Frances J. Pratt Letters on the U.S. Foreign Policy Association, 1960-1961

Cic, TtC\ Mt&y

rA+f,

1



vu, ^ CiAc^

New Year1s Day 1960
Happy New Ye^rJ. May 1960 bold health and contentment for all of us with as few alarums and. excitements as possible in a Presidential campaign year already laden with a series of Summit Meetings and head of state visitations to far away nlaces* I am sorry that I have not been able to write in over two weeks, but life has been filled to the overflow point* Somehow Christmas gifts managed to get wrapped and I trust mailed in time for delivery, most of the cards were mailed, but Aunt Annie arrived on December 23 to the arartment completely barren of anv Christmas decoration. She was a lamb about it and helped me on the 27th to rut up some nice Scotch pine left over from Clevers over generous cutting fir* their house. I usuallv leave them up until Epiphany, but this year they will stav ur until the 9th or 10th on account of the Waldorf luncheon on the 7th. That incidently has gone all too well and for three days I have had to "have people telephoning those who have sent checks for tickets to accent tables behind columns or let us send their checks back. This consumes a great deal of time ar^ we neverknow whether we can thus niece them and must save snace for those wh* rant to "consider the matter or consult their guests". By Monday we shall rrobably be out of even those tables and having to tell some of our best friends they can only be accomodated if we get last minute cancellations. It is a m-.d business. At last Don Dennis is back and undergoing train** n** to handle this segment of the event , at the next function# Incidentlv I managed to avoid a work force in-^ eluding mvslef on Christmas Eve, Then the office was closed.
Aunt Annie and I went in the early afternoon to Martha and Clevp^s . where Delli and Clevee are staying through his ore departure leave. (They may be assigned to a shin leaving January 27 for the Army Derot at Germansheim near Heidelberg for three years.) Delli1s trousseau is already nather snug for her and she was engaged in making a maternity dress. The house was delightfully decorated and we all had tea when Fran and her family came to deliver presents. The snow of Mond^""* night (a good seven inches through which I had to walk rart way to the office Tuesdav morning before oeing luokv enough to catch a taxi) had melted some and was beginning to freese in iev ruts, so she took our gifts back end we were snared the Planned evening deliver trip to their house. Everyone else went to the . mid-night Chr-'stmas service, but I nooned out with a sleeping nill and 1 went to bed. Delli* s Parents came for Christmas dinner at two and Martha and Clove took Aunt Annie and me to sunper at Franfs end to see the little bows with their presents. Saturdav morning we all drove through- the snowy landscape to Stony Brook with a slight detour to drive along tie ocean for 20 miles. ..interesting because it was windless and slightlv foggy. Cutting across Long Island was lovslv with the ground covered with snow against *^hich the green of mountain laurel and the barren trees made sham ccrfcrast. That household was well, happy and filled with gifts which the recipients
liked. Fred was very proud of a second hand Executives Chair he had smuggled into the house at a godHess hour for Jay, t$io this week will take over a gasoline station he is buying nd will use as homo base for his three trucks . The warm season has been fortunate ant enabled him to keen them busy pretty continuously. We had a frantic game of Monorlv in the afternoon and Aunt Annie and I took * l^te train back to New York staving late abed on Sunday. We have been impressed with the increased amount and lvishness of Christmas decoration. The LI Lighting Comrnnv must be rearing a fine dividend from the current used in tree and elaborate house illumination. December 22 1 went to the Council on Foreign Relations Christmas Reception...very distinge , and something of a compliment to be invited to. On the 29th to a small partv at the Waldorf Towers gi^en by the deruty chief of protocol (CIera Conger) and on to Aunt Mary*s where Aunt Annie awaited me for dinner.

5 (Wj, *

<-<--V

'

Jr.nupry 9, 1960

the NBC luncheon on Thursday was a success fro- -very point of view. I sent the'' chart to the dorf for over 1650 people, about 100 mere were tumeJ ewy and thh vast ^.jority who paid $7.50 were quality folk. The panel of nine news corresro^ents^S from such daces as Hong Kong, Moscow and way stations werecrisp end In three minutes

SerinthT the ninth man

9a0h deslt;rtth 4h igh4 topics gave a rundown of the Eisenhower

OtfoucrurwhGircehatheDheacdiscioovnesrepdr.oje(cHte-Lesvaiinde

the reason the President's eleven speeches in each country were so expropriate was

because they had been written by the US Ambassador to each country. } chet Huntley

served again as moderator and was skillful and generous in hie remarks about the FPA.

is 88! ecia.,.1 "leasing as the function served not onlv on the n+.ion=l kick-of'

for Great Decisions..l960, but laundhed this year's fundraising campaign, whi^ ril l

1li?n"e^n,

pmk

0n
flowers

on

t"hee)^heHad"tYa-blgre'asnSdvhea.d

Ithegoitce myorsemaallnlgferuvneefrionm

ubs,,innfg ppi*nv k jta,b,,le

pink oocoanut with chocolate sauce. As I wee saying "Thanks and good bye" to tte talent

in tne guest of honor room afterward, Sam Sharkey, NBC NEWS Director, he made * t>ass

uriil neri

S:

year and 1 bagged him 4 d4 that conversation Lit

nbed h,^.vn + W-e" 4 hap?d to be more rested. Despite his agreement, he was on the

nd I'd like 4^"g

T "* "m * Three Christmases have been fussy with fatigue

andI d -ike to enjoy one for a change, but I promised him an answer next week. Mean-

while I am more concerned as to a speaker for the.OTR for Janaury 27 and arent r-r+ -if

nil" Tni"gan ? fffj8 t0,g(rt Pierre Mendes-France.

o kn"s Tthlng of the

TV, J

priority work, which has been delayed on my desk, mad# a fine speech to

me Thursday afternoon and ordered me to take a week off to rest up from the hard work

T^d n^T6+n tha NfiC luncheon. Maybe, if he egress to let me polish off the back

off the weak '+-'UlgB+*

meetipg 1 muet Prepare for and follow up on, I'll take

Cr;i

J'

i:"' , "lght Yen ny i0 Borgia to spend a few ds.ye with Thelma and

the'ow! >"?b,Uty h" bn ral35d wlth them and I'll teleohone Tuesday night when

P. - haps 0 things in the office in cte arer and find out if they are up to bothering.

old frir,2rSe+VOi^ hrrdin 1960 ras ^ war*8* She and Douglas were talking of.

ti eo^k to wv o !ir !Iear Blra 8uert8 left Rnd telephoned mo. It was fun for me p e. to both o -them at 6i40 am. and then go back to sleep. In the afternoon I wont

to .era s party and bad a chance to tell Santha Rama Ru what a magnificent job she had'

done ir.^reviewing /era s book "New Patte-ns of Democracy in India" in the NY* TIMES of

always have a nice mingling of her friends and the childrdns, so I

I +u , r \ em glad to see agai.n as well as those I had not known. Somewhere

tr l e a v e for"6

"? ?ent * a bon TMy*g Party for Peggy end Saul Padover, about

1'"

a/9ar dr\Asla' where 1 8rent a long time with a woman natron of the arts-

heraei f .fd^-iV ^"fu

Modrn MssTM of Art two months ago , which she loves

another bv the = !f6P I 4 c7 *">. doTOU .anwhiU she got her husband to give her ar.ist for Christmas and promptly trnasferred it to the Whitney

Museum, which all but swooned with delight. Friday there was a quick office Party" for

^ nchad +v , . ' t r (FPA) bookstore, who after retiring from managing Brentana's

the' CosmoroMtnPrinwr

"d "" r~rtir

travel. Vera and I went on to

Ti vZ ^S ;r th silTer Adding Anniversary of Mildred and Houston Kenyon.

yw,, e ^oth? tby were married in and had an enlarged photograph to proove it.,

^uld not^ef

* honor were not so lucky-in fact the maid of honor told me she

could not even remember what she had worn. At one point the orcheetra played the wedding

coffee

b!J promenaded around the ballroom before the general dancing began. Tea,

! Ww rn-r iood third O f +h rWHnw

a horrld puncb "'re served. It is my guess that they were married 4 end6d and they thought 14 appropriate to return to that era. A guests were people I have known for a long time, so aside from a lot

with old friLda i!k

F-nn

Lr,l!+^

f

^

n f ** Undes Franc gamble, I largely had brief chats

John Mason Brown told me he -was so disappointed In not having been

he bad aJreedy mad- his rife -romise to take him next year/ ...

? d"Deo-mber liadison Avenue was a trass of isolated, culminating in

a v-tterv of t^thri b

"d^8 D^"^thay a" uaing p-a ll, such

middle It is

a 1 "18 eor,tlnuou' tA

a four foot trench right up the*

unday and .hey are going strong having renew--' tb din at eight a.m.

January 24, 1960
brilliant, bright blue, sunny morning and for the first time since I cpn't remember Then I have the feeling "life can be beautiful"...perhaps the fact that my temrerature is normal aftsr five days contributes. Satur day of last week the widely advertised Delta Royal Jet Service carried me to Atlanta. One accerts all the Douglas claims for their DC-83--"a true jet, no rrorellors, no pistons, no vibration, ..cruising soeed about 600 miles an hour at 28,000 to 30.000 feet " appreciates seat selection at the check-in point? the pleasing beige, brown orange decor, soft lights imple mented bv individual reading light at the side of the head cushion and a little spot over the let-down table, the excelent meal, the four hostesses end music by Muzak. All these luxury items were greatly impaired bv a two hour delay in takdaff southbound and almost four on the return flight.
It was lovely to see Thelma and Cal in their attractive home perched on a small hill with a delightful view of Kenasew Mountain, and to meet their friends over cocktails on Sunday afternoon. Unfortunately Thelma has not been verv well and had to spend all Monday morning in the firfct phase of a thorough physical check-up to be completed on Thursday. I anxiously await Dr. Jennings* findings and recommendations. In the after noon we went to the top of Kenesaw Mountain, where the view was fascinating-- Sunder*s torrents left the red clay soil darker and gleaming, the pine trees crisplv green over Hhich the scudding clouds added darker patterns of shadow. The hulk of a rapidly growing Atlanta about 20 miles away flunked by Stone Mountain was impressive. Kenasaw is the site of a civil war battlefield and the nearby country well mekked with olcoues describing the various phases of the engagement. They also shewed me the gigantic Lockheed plant where we had a good look at their C-130 jet as it trundled in front of the Administration Building. Considering the Dobbins Air Force field and a newer New air station tbere is much, much less zooming of planes than one has a right to expect. Atlanta and environs, as hub of the expanding South East, seem to be attracting a wide variety of new industry. Marietta is on the highway from Florida to Great Lakes and aeco^dingl"" has in the ten years Thelma and C^l have lived there sprouted a great many motels of a most modem and comfortable looking variety. It is unfair to make judgements on so brief a stay, but the administration of Georgia struck me as being odd. People seem to file state income tax returns without any payment or v/ith a worthless check, and the authorities go/ on TV end sav "this is naughty, but it is too expensive to bring a civil suit for Payment". For a very small consideration I*d be gl-d to tell fem how to correct the situetion!
By Tuesday morning my basic fatigue had caught up with me and I had several degrees of temperature and stayed in bed all day to my great humil iation. Cal drove me and Thelma to the Atlanta airport on Wednesday mro ning and they, kindly staved for four hours while Delta fiddled about with the Jet doling out delay an hour at a time. I can only pray that this experience did not have horrid reaction off them. By Thursday morning I decided I had "Q-flu" and ciuietly stayed in bad Vnd went Friday to Gerry for a shot of B-22 and returned to my treatments. It was a great disappointment to have to cancel having the two C.F.P. couples fo~ dinner at the Club on Fridav. It may mean that I do not see Delli and Clevee before they fly to Germanv next week. Maybe something can be worked out for Monday? when I see Gerry again at 9:30 and hope to be able to go on to the office. However, I may take a few days more--how the temperature behaves will be the answer. The Off the Record Committee in whose behalf I delayed my departure were a batch of witches, crossed up their prior decisions end left me with a most horrid mess. I dictated until eight o'clock the night before I left for Atlanta as a result I shall find it harid to smile uoon them graciously when I do go bask 1

, JVVJOA*^ . / V < R T - ^

January 31, 1960

On Wednesday Delli and CIeves were flown to Frankfurt an a National
Airlines DC 6-B chartered by the Army to take personnel to Germany, There seems to have been a rcinumum of red tape and standing about both at the
Fort Hamilton Base check-in point and at Idlewild airport take-off at 2 P.m. They made a fuel spot at Shannon and arrived at Frankfurt at 10:30--13|hours en route. The Shannon stop probably consumed an hour unless thev
were given a meal there, quite time enough to buy a few bottles of Irish whiskey at $1 a bottle. Happily thete permanent quarters were ready for them to move into and seem to be at the Karlsruh housing developement. While Heidelberg is prettier it is not considered as desiresble since it is a Little Pentagon and filled with top brass and therefor a point of call for all the VIP visitors and inspection parties. If my summer plans work "ut I hope to look in on them and make an eye witness report. It is
interesting that the Army has yielded to public carrier pressure and sent the risns load commercially instead of in a government piane. If I under stood correctly more than half of the passSnger list were kids under 18, the children of enlisted personnel travelling with their mothers. The
2roung Pratts h^d seats $1 and 2 -- well in front of the propellors and should have caught interesting glimpses of the Nova Scotia typography.

Monday morning I went to Gerry Wilmot again and got another shot of B-12 and we agreed I would be better off at home for another day. She
recommended a walk as I had gone there by cab. After four blocks I was gls^ enough to sink into a comfortable chair in the New Weston before taking the bus up Madison Avenue. I have tried to go late to the office
and refuse to be badgered but on g3a d enough to have two more days of rest over the weekend. Most of 3'esterdey I sorted foreign stamps and made up what I think is a charming little diseration on France ua ng
stamps as illustrative material for Bill. His class is studying Europe and he wrote me for materials for the scrap book the teacher wants each pupil to make. I had no notion of spending the day on this but somehow did. io give currency to the project I even found an Algerian stamp .

Before Christmas I promised tc go to the theatre with Eleanor Gibson

on Wednesday I would rather not have gone but she was only in town brief

ly for aconference of law student placement directors at NYU representing

the University of Virginia Law School. We had not been to the theatre

together 8?nee a night in Oxford ten years ago. So we had dinner at a

German restaurant and saw the French musical "La Plume de ma Tents". Robert

Dhery w^te the series of skits and stars throughout, supported by his wife ,

Colette Brosset, dancer and comedienne and superb cast of singers, dancers

and comedy actors. After a long Paris run, they were two years in London

and play here since November, 1958 to SRO houses. It is a fast paced, up

roariously funny evening combining broad and then subtle humor, good dancing,

slapstick and passable singing.

'

Happily Hal Lehrman enchanted the y/omen of the Off the Record luncheon

this week with his report on "From Tangier to Tehran", which was certainly

timely with the Algerian crisis in the front of ever"one*s mind. He was criti

cal of the French settlers and the lack of firmness of U.S.policy. I have

be*n assured that be

PC

to remove a feeling that the "A" series

bad had better speakers than the

a complaint hich I consider unjusti

fied but a

of troublo to

T^ese wemeh and their sixteen meetings

are a ^rial to grow t

to

mey

and

have

been

for years, thougjh

the

audience*?

continue

/^c, f k a - f t u , (^*kS sc**^yu.

, K^,

February 6, 1960

7

fin

Letter today from Delli end have lots of closet

saying space.

that their porw-ncri Perhaps they will not

quarters seem so

"sinpaKciaorulssruHhi enare

their possessions whifch travelled by sea arrive. As I have drawn my took for the UN

Cooperative Charter HI hope to 3e ave on June 11 and be back home on July 23.

Monday afternoon we did a routine check on the Wednesda}' OTR luncheon speakerNirmal Chaudhuri--Calcutta bom American citizen jcfirnalist only to find that he not only had not returned from Israel but had no hotel reservation,. The next check reveal ed he was not on the Monday flight and the next one was scheduled for arrival at 12:50 Y/ednesday. Naturally we cast around for a stand-by and were cheered on Tuesday to learn that the plane manifesto carried his name and t'e fact heretofor unknown by us that the Wednesday arrival was at 12:50 a.m. This is the sort of thing which takes it out cf me. Although the plane was late and he did not get to bed until four, he turned UP at 12:05 in the office, for his pre-speech briefing. He did a good job and the audience found him interesting--so allis forgiven. This whoopla almost robbed me of energy to rejoice over the settlement of the Algerian stpte of siege. While the barridades have been abandoned the basic issue is not settled, though it hav^ a better chance of settlement in a calmer atmosphere. It was interesting that it took deGaulle
only three minutes to relieve Jaccues Soustalle of his cabinet responsibilities, even though they were minor and not at all commensurate with his desire nor the wishes of his friends, Andre Philip had told me of the several posts proposed for him in de scending importance, each promptly vetoed bv de Gaulle.

Tuedday ^jfe^night Judith Listowel cooked dinner for me as she wanted some advice. Her preparation of rice is unusual--butter in a pan to which half an onion is added and a cup of rice. This sautesuntil the rice begins to brown, two cups of water put in and the whole boiled until water is gone, remove^ onion and rinse rice before ser ving. She exoecte to be here another month. Wednesday night the FPA Board of Direc
tors dinner after which Ambassodor Frederick Bolsnd of Ireland to the UN spoke. It was especially interesting as the US and the UK had that dav announced their support of his candidacy of the next UN General Assembly. The Russians have soemone in the field, who could hardly live up to the requirement of impartiality wL thout facing the rest of his life in Siberia. I hope Boland gets it s he would be good and with the support of the "uncommitted countries" (Mayla, Ceylon, Japan, Finland) beside Britian, Canada, Australia and New Zealand andthe US$, he should. We spoke of the marriage thenext day of his first assistant Eammon Kennedy to the daughter of William Black, pres-i-dent of Chock Full of Nut, who has just given five million dollars to Columbia Universitv end whose firm gave five weeks salarv as a year end bonus to all employees. Kennedy,
who is a nice man, has not only married an heiress but won a convert to Roman Catholi cism. By the time the Nasons dr->-~ed me off at home, I realized I'm not yet up to two nights in a row \

Thursdev I had luncheon in the UN Delegates Dining Room with TWO TOOD! from the NBC Briefing Session staff end had fun swapping ideas with them. I was amused to see Hassan, press office for the United Arab Republic whom I have noticed is al ways most genial toward guards, cashiers and other staff when I have been with him, shake hands cordially with his waitress as he sat down. Friday Vera and I had a sandwidh together in the Delegates Bar and caught UP on some of our mutual concerns. Funny I had not been to the UN since early December and then went two days in a row.

Judith knows the Hungarian Nobel Peace Prize winner in science, whose name sounds like Sonyardi and told me of a 1946 Budapest episode. Marshal Vori>~shilov in command of Hungary arrange^ a festive evening for leading scientists, musicians, writers, etc, Sonyardi and his boson friend Stephen Rath were included. As the evening wore on Vorishilov smiled and said"I should like to grant one wish to each of you". Rath asked that his only daughter be allowed to go to France for her education and to be accom
panied by har mother# Wish granted and proper exit permits delivered and transport facilitated. Sonyardi said "I diould like to go to LoiMon and see if Alexander F1 claim for onicillan is true. He was always a dreadful liar when we were in the sity together. " Vorishi-lov1 s own plane took him. (Rest of 3tory next chitchat"

>r?JWr;'

I

1

lW),A*,s/, TV- ,GuX,,
* ?
February 14, 1960 Stony Brook--

That was a nasty trick to leave the story of the Hungarian Nobel prize winner for a whole week on Heneral Vorishilov*s plane between Budapest" and London. I apologize. Actually the trip was quickly accomplished and Sanya rdi tumbled out of the plane into the open arms of his college classmat e Alexander Flemming saying "Alec, you habitual liar, did you really develope pennicillan and does it do all the things you claim?" To which Fleming replied "Come along to the laboratory and see for yourself." The Hungarian was convinced from all he saw, was given the steps of the process and as a parting gifta million units of penicillan to take back to seige torn Buda pest. When the General's plane came to a halt at the Hungarian airport, a considerable number of Russian officials were on hand to greet him. A mem ber of the secret police (Russian) stepped up and took the parcel of precious penicillan, when it was returned Sonyardi found he had lost half his haul. He got busy at once and began to manufacture the stuff for use in his home land and administered the rest of the British gift to those in great deed and cured all the women of Hungary diseased as a result of being raped by the Russian soldiers. There is another story , longer and more important about Rath and Sonya rdi concerning their coming to the USA, where they ' now carry on their scientific work. This had best wait for another time;

Friday morning I went to Gerry, then to the Laboratory for a blood test

to see if I am suffering from my old bete noir--anemia and then to Don Lee.

he is a hair specialist, who I hope will stop the excessive falling out

of my hair. He expects in a month or two to stop that and so improve my

scalp that new hair which has been coming in even finer than my normal will

be sturdy. He inspired me with enough confidence that I hope soon not to

oe haunted with a bald head in the forseeable future. As I came along here

the sun set, a great red ball and before arriving at Stony Brook saw a mag-

nicent full moon. Despite having packed my rain boots in case of snow and

laughing that this precaution would ensure a fine weekend, a nasty fine snow

began soon after dinner on Saturday, the wind rose and we began to fear a

blizzard. During the night it turned to slee$ and while the cold wind still

howls through the trees there are breaks in the clouds and occasional flashes

of sunshine. The ground is well covered making a pretty background for the green mountain laurel so abundant here and the deep brown of the oak

leaves still persistently clinging to the trees. The ground is so hilly

that everywhere one looks there is contrast of some sort, including the

green o pine trees against the snow, But the roads are precarious. In

V?W Pr J!y ha? bad luck on a hil1 in Huntington and the Cadllac

and

f a

a
delivery

+traurc2K

bapcp2ked

intaorehd iipl.ighIt*ha

vAeffeowrgdaoytstenafttheer

dheetawialsspoarfktedhe

third mishap, but the body shop charged over $600 to straighten out his

various accordian^ pleats. Yesterday afternoon I inspected the soon to be opened service station, the latest item to be added to the empire. The

three trucks contrary to expecta tion are working constantly and the current

goal is to turn in the s econd hand trucks for new ones and avoid occasimal los t work days from mechanical breakdowns.

a t the Cosmopolitan Cljib George Kennan spoke about Russiawitn the major thesis that Khrushchev inherited a very ba d interna] and cannot afford a war and the US is making a g?elt mistake ?ogS!deiS* policy on Russia capabilites rather than its intentions. He urged us to study the intentions . Wednesday George Ferguson, ediotr of the Montreal star
H^points outtthat.t the 0ff *he Record ladies on Canadian American relations by the eLloitatt! I Canadians scream at "the rape of Candian resourarf.

IMfrDljLf 7^

,

I 1

<

7'

*

it*^e "P tC ,
J

< February 21, ., LrcS^f, l\&x%te tCcA>i-dL { 1960

Vj\*ir T

a.

<&

t . . . . . s ; r ^ . ' s r TM , ; k . r

braui-n^,unroetpuonrmteidxedonmlytha lsnitotwl,ewbh etter V..* A, i.chh ndd aa hhaallf

of

rain Thursday night, ^ fflr me ,, ,,nly

but it seemed like much more as it fell mth tatoo vio ^ ^^ T thought my

began -nd I ted >reached home and ^ough^erja tightiy< Four hundre(J feet of hoarding

transcms would be lifted off * around the excavation for the Zicke

' fln

sixth Avenue took off and police were

_ ^

^ _ ipto the great hole. The radio

stationed there to keep

* Yorknot far from the famous snow belt rear

MK& slept'for four nights on the counter of a restaurant while their cars were

buried in 18 foot drifts.

Brit * ah Information Services here gave callers cigars on Friday afternoon to hohor the birth of Queen Eliabeth's second son and I am told that the UN bar had a great rus on champagne as the United Kingdom and Commonwealth delegations "wet the baby s head , I oSy had my own head wet again with Don Lee's lotions, which after even the first treatment had already greatly retarded my personal "fall-out . The blood tjet that I had 3,700,000 red blood corpuscles instead of 5,000,000 and a new batf of ls.rg
capsules are being faithfully consumed.

Fortunately the icy roads of last Sunday deterred many people from going out, or

mavbe it was the bitter, bigi wind. At any rate their were fewer than usali people on

the 7:28 train from Stony Brook. At Hicksville, 50 minutes later just as we were e*"K

underway, the conductor nulled the emergency cord to let e. voung negro women oil, fc/n-

dentlv the Diesel engine resented the change in olan for we sat as the train slorlv crrew

cold**. Fo^st a trainman announced there ^ould b* * fiv* to twenty minute d*._av, then

^

^vieed to take our train checks and de^rt followed bv a frenk admission that

the engine had broken down, Herpilv nr/ coaeh was at the rittng room and I could scuttle

in and get a eat on a bench, some had to remain on the platform whan even standing

room inside filled un. When we saw our train move off and Partially fill one follow,

w* surged out onlv to watch it continue toward New Yo*k, With me r*asrtiff^t1; . sUter and stsnders we settled down once more to wait for the announced relief train,

which turned out to be a regular train from the east, already well filled. But with

some squeezing we all got on, changed at Jamaica to an unheated electee train and - % arrived at Penn Station an hour and a half after those who had connections to make h*d.

hored. A large soup bowl of boiling hot lemonade helped to warm me up after 1 got heme,

Monday night I had promised to go over a proposed speech of Judith1s before she went off to make it in Cincinnati. We ended up at Maria's, with whom die had been to a cocktail nartv. Maria -nd Hank kindly left us te srtslve* while I had a drink to do our work. Over coffee we got into a great discussion of integration sparked by
Maria, who is convinced that romances start in school days and miscegenation is cs^inal sin. While I deplore interracial marriage, it was neissnry to point out the history of the blacks in this country. Evidently he feels we mad r. great r.istaJke in not shipping all blacks back to Africa a hundred years ago. I rather lii:ed the NY TIMES Quotation of the day from a negro minister of Greensboro, N.C. named shu.t-.eworth, .'."We don't want token freedom. We want full freedom. You educated us. you taudit us to look up, vhite man*. And re are looking upf." I'm not sure she got the ooint of that, not my insistence that this was a situation which had buixt^up over a long time and part of a world wide revolution against vhite domination, which coul . only be remedied by gradualism. We saw the completed port*it of a red laded young mat#n in a very fancy (and I'm sure difficult to paint) mauve 1pee an- billows o draped chiffon gown with her daughter and. two dogs, which I had seen in emoryc phase. Also a lovely young girl standing at the edge of the water in Her sailing togs--blue
pants and a pink shirt--this probably approaching the halfway mark of work.

Sign in a

display of Harry Golden* a "2d Plain" reads "You have read

the book, now tryrhedrink.M It is said that the autumn will feature "grape shades"

in men* s wear with Concord and Chianti especially favored,

fH t )lio('Cy . f) g .

^

L K',

/H*^ %fft '":< &y /kaxz**. y f . i..' y.^ * ' ':
February 27, 1960

. T Si|| * +'*ctation to wfelt and write on Leaf Year Da-/ but most impractical

?in'+t,,.

11 bed.

*1? , Obviously

IT'Jepm

+

aomunh after
not bursting

"V dinner, if I dally long before getting with energy, but the-e 'is a dimuni+inr nf

o,,ff rte\dT ZbllM} o,oT :d; T coerL pusT cflest^ as^sto3 oon!utn gartsowm InSgte oh" taotfv0sertruptth iire dedhb!laoboidt 0 cf0^ stoppingrethcoeurnaetekdingto'

ret-'ref9fror"YLmnv!rsSL^'fry"frnreolyonthinnakpi,ngsoabnowUtiti+'ismSieunm day3.0 Lslaeseto7night IIwheandt ttoo

.a r.

v* u" dTalP8 interest in cooker;- is stimulated by some de-

/ i'5T8 t0 her Hungarian refugee cook that she can do anything she outs her

personof tteaupperclasrircarawffbTi!Ufy

that a

th^ideology^to 11116 CoTMuni3ts 9eized P"er in InngTry

ehscap,,ingE,a#ft^.the Sh1T ""5/ofE ihB ipnsi?n"g*.*& She*and#o*the-rerveefungteheseroaf ndthhaterpheruioftdpdcnfrom

origins
origins

ff oo rr

+!rpr<76 themselves

classless society end than they actually had.

on For

theexametphleerMiangvdesntw, efsahreTaredndtoer

the motive JuditheisO,m6d-I0+ wier^3 rten in ptualitv he/ had 20. But whatever

cou--sn''nn I**1Mtkln6

<"<* *d really worked on two of our four courses

0n_ course was a superb cheese fondu topped with and unbroken egg nerved in indi

vidual caseroles. . vegetable, which went with steak and rieff wr"0aserole of

reai"rtngnthe'ofrboilinPPef9+rd

t0PPed K"h braad-umbe and grated cheese

from~HunL^v io

!/ . !C""h End sauteein6 f the onion and pepper. News

which ^diS tT a+9pft8"ln of the cfficial policy toyer* the former upper oless,

wi nter of the "ot.eon9|der I ^

fr the execution of the 150 " <*"

CicH W ckling

JS out

^c-erR,RumlslannSia

* theY recently shows ,, tightening

came of age. up end greater

m the other hand word oppression of aristocrats.

4?

30 TM'f' ba? "*** cf alr crasher, aniisegregation riot*

the Indonesians lt"?tS?r a?d*e|t*r to *** Pcthing of Khrushchev' s wooing of

frtrirri'ea one +hI nn

3an^ 0

S0m6 &nerican victories at the Winter

Se Will b r-pptyZ andT therpo1orop^ inioT n T > hoverr oft'A'rmstrong-Jones w1ilcl enrotatinbleyiuhospteiJ I ameni- Ui US "ith th8 unsevor- --rt.tioc of f a r,rP; "JTM*1
wit.. !)hi|h he was associated until Baron's death. I was amused to hear on the

radio .his morning that a lot of English women nlrysg a hor-r race hunch yester

day and won on a horse named "Engaged".

.-ester

+> Mnmhfayi-ndne of4th departrt heads left the FFA at noon for luncheon at intern .1 aidlmi in"iIsetrra!t-ion and how th9eybructaanll-bve fcroarnrkeclteends. disIcttiws.iilolnbeof infatielruersets of

,,,4P3+rbe! r tblS tur"a cut to be a. not unuseful letting off of steam or if '

it-- <5*rvi +1"~ I es4abllehf.d* Monday afternoon a man in State Department Secur-

,! v

' Tb0"e,

asb aboui the FPA luncheon for Adenauer on March 14, of

yhln8 ut h insisted it had just come on a teletype schedule f-cm

TM!,HlTed Iv 4a80"i;a31f:y' 30 3 "nesction check" of half a do son other people

wss not illuminatiiiet "hut n' d

EoP0pbone oa1-l to Conger in Washington

vleVd /', +

rl ^

0n Vn Keckmarin the German Consulate Goner-1 re-

' J "ee

would lunch/ that day with Dag ilammerskjol d, but v-e

. baJ3

Minister von Brentano in mid-Anril. I, eroun"the krcuit

again with the exoention of Conger to call off hopes for Adenauer and cu/W tke

raedom of persuing Brentano

Cleve yv- mo that he had out . hinder TM

tty ffl fill answer their needs, give Jfertka much

+ .!! t

,, 16388

r Present "cu.se to Fran end her family. Moving orobablv

to take place May-June. Now that is settled Martha will soon get away for her '

VLTM1? n *6V6 ^T3S liiil hoP8 that he will stay here during her ab!anll Ithhreiirr fIn4eLn5do" i-nll ?inrovlictectshimhefoer-ndtsintnoersaenedthcroouurgtehsyinwhiilsl coownnsuhmome eh. iiNtoimdoeu. bt

C-f-.cr'

lVl1rT $1

i*c March 5, 1960

This is "the third morning in succession Roy Howard's Asian houseman has been

shoveling snow when I got up. Cur luck just could not hold--two Thursday in succession

we had an inch and a half cf rain and were grateful it was not snow. But this week we

got it en gale wind beginning about 6s30 Thursd^ymorning with radio reporting that it

would end in the afternoon. Happy chance put a taxi my way rrsctically in front of the

door. During the morning I invited Jim to spend the night with me ts Stony Brook was

sure to be badly hit, but Travellers like many offices declared a three o'clock closing

and he wee sure that he could get home all right and would worn"- about Friday--his

hirthday--when it came* Curiously the snow stopped in town early Fridev morning, but

continued in Westchester and Long Island all day. The strong v;ind seens to have made

accurate measurement impossible here, but 15 inches is generally conceded with mere

than two feet in the suburbs. For the first time I remember the Cormissioner of Sani

tation ordered prorertv omers to get sidewalks cleared by 11 a.nu (later amended to

four hours after the nov stopped) or face a fine. It worked like a charm. Thursday

night they also broadcast appeals for chauffeurs to drive trucks and plows at $2.05

an hour (wish I knew why the five cents). At any rate I had eompnritively little

trouble getting to the

office by bus and unlocked the door at 9st3.

Thursday at six I was supposed to g^ to a ccektril party at the Lotos Club to meet some Turkish tcuring journalists and took the dressy belt, the ~arty purse
and gloves to implement the black faille dress along to the office. I even started
try to remember that Sekip Engineri was an official from Ankara, Vedat Refioglu wriies for "Habar" while Mithat Gulyasar is on "Vatandas " of Adana, etc through 16 others. Reports of the brutality of the wind and the blinding effect it vps having on people
made me doubt the wisdom of attempting to wallow through the drifts to get home after ward so I decided not to go. In fact I wanted to get home before dark and spent an hour and fifteen minutes on the trir, which takes from 20 to 30 minutes normally. My skunk greatcoat piled up a lot of snow waiting at 49th Street n<5. Madison despite periodic shakings. So as soon as I got on a moderately empty bus, want immediately
to the area of the rear exit to s^ake off what I could to keep it from meltingcnto those near me. Alas, the avalanch^ slid on the newspaper of a man reading and slither ed down onto his knees, so he had to rise to shake himself and the man beside whom I
then sat roared with laughter. It was good to get home utterly chilled and light the fireplace for a cozy evening. Aunjfc Annie telephoned that she had decided not to come
for the Friday-Saturday conference and risk tha storm's confusion and possibility of not having her hotel reservation honored because of the stranded travelers who had already filled rooms and were being accomodated in emsrgency shelters.

Last nirht I phoned Martha to see when she was leaving for Charleston and found she goes on the Havana Special tonight probsbl^ to return by rw xt Saturday. Delli and Clevee had bod weather when they drove their car from Bremerkaven to Karlsmruohreanadttrhaacrtdilvye slaowcathtieonCo,loBgnuet sCiantcheedthraeli. r Tohtheyer^preosmseosvsiinogntsoihoavtheenr opt uyrerttearrsriivneda .by sea freight this is no great difficulty. As the youngest couple on the post they are
being much petted and are as harpy as clams. Earlv this week Sal was involved in a four car accident at Bethpage with icy roads and a helf inch of snow. His knee was bruised and his neck still painful from one of the three inracts. The estimate for repair is $425 and because of the strange behavior of one of the men involved they have
put the case in a lawyer frind*s hands.

It seems ver"' strange to me that Mrs. Eisenhower goes off for beauty treat
ment' at "the Last Chance" before the President wn scheduled to reach Washington from
his difficult South American trip. Mgurb she knew in advance what we only hear dkie morning that he is staying longer in Puerto Rico to rest. The Agrdir o-tastrarhe seems to mount with horror, now Prince Moulay Hassan has countermanded his^order to s-.,op res cue end get on with demolition. One can only fear that oeaple who might have been^saved
during the recent demolition days will only be found dead ir the i w rescue operation. Verv confusing. Tomorrow I go by train to Washington for - national confe vnc, a ^ Hilton-Statler (guess it's the other way around--Statler-Hilton) to return late Tues a,? . I ~V-.11 not go to the Capitol to witness this silly filibuster on civil rights \

f] $P

T^cj

. ~$Lx*,W-

/>l>^

Kerch 13, 1960

k /r&u* d' not.anticiPate sparkling scintillation from this,

bulk of

the day has gone into an agonizing struggle with the fine print of the federal

tax form* This is clearly not the time for me to copy it. I need 4 chonce in

pace, Pernaps it was not too smart to stay up last night,after * fine relaxed

evening with Vera m front of her open fire, to, see the total ecHrse of the

TecJ^liLpsee^cotf Z thelW sua n P iseendliiS nhgte.ri0nfgtStmemon ortyh.e Hsanvoiwn/gnoneafgoorwhtehne mwoeonhoditaseteamMeld interesting to get one while I could. Thile there was perfect visibility from

effort 0n "* part' th0

*a to me r "

romtment, though I can see how such behavior on the part of a lovely full

moon terrified primitive peoples and lead to mass suicide.

7

L".st Sunday's trip to Washington

interesting as tfeS train oacriinriv <-.

passed through an area of diminishing erow fell. 1 looked especially in nlaces

where there mig.i% have been heavy drifting and failed to find anything speotaou-

lar. Washington had had eight inches but has little equipment. The opn train

shea platforms seemed, only to have been "cleared" by the scuffing feet of passe*-

fives Zyp9d

t0 paok H iom t0 n^residue mixed with earth, 'which

gives a much messier aapearanoe than sand. Itcs't of the streets looked as if no

l00ayy, +h

+ i"! a yy a shoT91, Houss proud citizens had cleared sidewalks but

=nd other i "+ bthared and 911 y *lke around the innumerable squares, circles

T -O ! 1

monuffients re iust where ne.ture had left them. Although

I did nft'fiir fut^it^ StayeyHilJrn' even before it joined the Hilton chain,

on -Wav for the + i I f7 afternoon arrival until I left after luncheon ni-fy .!StEt ?p?rtment and the train home. The American Association

or t e United Nations Ten.h Annual Conference for National Organizations provided

fr me *?

and *hil I h-.d"snaomtplaen"ticipated'much of interest

we, compelled to revise my view. Sadistioly I enjoy going to other people's "dps"

loroonstruc+ive ideas and the smug feeling which comes when things plainly go

TMI" P0"ld bs mpro7ed * Stupidly X went to do seme telephoning before

of us wore TM T

n8 f 36 fer whom extra tablea * to be set up. 3ome

cchniicckkeenn tthhee^inritgrhtt hbseffore wagsSgTla9ddenhoamubguhrSoferaonchanH ce.luncheon, but as 1 had taken

well thf^lr? TOS eqUipped^

*nd W, neither of which worked very



Kleensso. x was empty, toilet rarer container rmcticallv ec and the

contained four or five sheets of inferior paper, the tefal -n--?-

J)ls **,Sl a ?15 ro(llr' earrryi-ieit 45 <f,tax. I was glad of

ohar-e? t

as_ frsdneej-y nivht Hank was good enough to meet me at Judith's and

tthreanceop-pnoi tritnV.ehJ.netr,'

lri-oin.v- oee.lyiuinnto+i4---ilZTejn-iotih--bh~e.re,f. or^thde,eap,e%rio-1,deshweaswi.alnl

be in London a tizzy before

e- hn~edur

o^-nu

n ^ursday morning. Possessions farmed out for stpVagd in teye^al

'.:fevent places, packing her luggage and the U3u.al predeparture flu-r-. T

^ the

v?
summer.

V/edemeyer book to post to London and five plants to carry* through

As of May 1 Jim will be Assistant Manager rf Tr--tier's branch office at

Commack, a twenty minute drive from Stony Brook and will make ? saving of about

four ilours a day in his time at home. He deserves this h^eak and of course the

y is enchanted. We are all pretty fed up with the continued cold. J do hope

if ^efore tet ArmiQ arrives on Friday for a few days! Despite record

+ 4 r,"It C" /'

rps an especially good crowd for Prince Hubertus zu. Loayen-

S\e 11

the ladxea Ipr&d him. There was a.man in the audience rho had protected

a family castlo from being used as a U.S.Army command post at the time of hup ^ntrv

n Germany and is credited with the preservation of very great art treasure*"

The Prince knew of the action but was delighted to meet the hepp frcr Connecticut,

^iho seems to have an uncanny facility of doing ijcppo^taht things all over the world merely by being on hand at the crucial arrant and knotd r.g ^t to do.

,

_ .

**"

**v

9

fj {> Atd A, "p*c",

^4**,



I ' ' /H<a.-vy- , L.CJ^

'Nv">^'.>

March 26, 1960

^:,:
)

H

Be so good as to contemplate the dfrts and then let the temperature of

19 decrees register and believe me that nasty fine enow flakes have been falling

for an hour, \ mere statement of fact without editorial comment. Between the

weather and another vast internal administration reorganization arrangements for

my holiday just are not progressing. With the Passion Plr-y and the Olypics Europe

will have more tourists than ever.

A-j

Aunt Annie wias here all too briefly lest weekend. We thoroughly enjoyed, the Museum of Modern Art exhibition of Claude Monet -- Seasons end Moments. The pictures ar9 loaned from private collections and museums, one coming from Copenhagen, another from Krefeld, Germany and so on adding up to some fascinating units. Monet*s inter est in ratnting the same thing at different times of day and seasons of the year was dramatized over and over again by skillful hanging. The eight pictures of two haystocks on Monet*s estate at Givemy showed tiTem morning noon and night, in show and hot summer sun, but were not our favorites, four each of Waterloo Bridge, Charing Cross Bridge and Houses of Parliament were fascinating. In several you could smell the fog, while one of Perliamnet showed the buildings rise from a river mist to complete claritv at# the top of Bhe tower. Half a dozen of the facade of Rcusn Cathedral varied from one in bright blues arid greens to the sunset almost orange light, which made the stone look a deep cafe au lait. I especially liked Aniibes from across the harbor at three different seasons of the year. Credited with about 3,000 paintings in almost 70 years of work, this exhibition of 119 canvases needs more than one visit a3 it includes examples from 1865 to 1920. We did our bast to fire Aunt Mar/ whith our enthusiam for fhs exhibition, Then we called on her.

Hie Pakistanis celebration rf the national holiday commemorating the accep tance of their now set aside constitution is a "production. First the Ambassador in Washington invited me to his ua~ty, a day or tvo later, Prince Alv Khan's invitation for Wednesday ceme and subsequently the new Consul Genera"1 invited me for Thursday* As I work with both tvo Mission to the UN and the Consulate, both these were accept ed. ..so convenient as Pakistan House is practically behind me. I went alone to the Prince's party, again lavish in flowers, canapes and sandwiches, champagne as well as two well stocked bars and music. There was chance for a. real talk with Bob Clifford and Nuri Fren as well as greetings with a number of other useful folk. When Nuri went to Turkev assist at the Eisenhower visit he found that he had. been slated as Ambassador to Budapest, a fate he considered worse than death ?nd finagled an appointment as Deputy Permanent Representative to the UN, so he Cfu.ld stay in New York. Particularly amusing 9,3 his father-in-law is now his boss. After one of tbr sons of the former Pakistani Ambassador to Washington (currently Tokyo) h^d been practically told to leave us, Bob revealed that the Ambassador bad net pa 0 all the rent on the Clifford's Princeton house. While they were in Karachi, the house was let to the Ambassador for his number One wife and fgmij.y wi en he insisted on ban rig the new and beautiful Begum Number Two at the Washington Embassy. Rcb is SO angry at the last lack of response from Tokyo, that he is writing to the President of Pakis tan, whom he knows, Somehow Vera did not get a card for the Consulate party on Thursday, so T took her with me. The flowers of the da^- before were there but no champagne and not nearly so distinguished a gathering. I had a good ifclK with Lyman hoover of Asia Foundation about a charming young man from Tibet, yhos? rresence here I am noising about. He, Tenduf-La, is of a distinguished Tibetan family now resxaing in DjReeling, speaks English beautifully as well as ? lot of the languages of the
area.

Brooks Emeny is just back from Africa end spoke on Wednesday to the O^R ladies--

verv effectively, though he was worried because the red dust of Ifir-can roads was

still in his sinus and effect the resonance of hi3 voice. He came aw an we a

a fine skat before luncheon taking over an hour I had penned on to do some editing.

Friday I went to the Commodore for Freedom House Tenth Anniversary Thomas 1binlette*,

c!d. Jackson and Harrison Salisbury all told us r

*nd flabby and in danger

of +browing away our freedom from lack of attention

fjKB J

3

; j - < * c ivAp..,

, 'IXC, l*ww,

.''.-.u- 0 - ..

April 3, 1960

And how did you fare on April Fool's Day? Mine was un eventful r^ve

for a possible incident in this block. While in my bath, I heard fire sirens

and thought nothing of it until in a pause in the splashings the heavy pulsation

of a motor came through to me. Peering out the window I could see two extension

ladder trucks and a variety of other ecuioment standing in the street heading

west on an east bound thoroughfare. An emrty

hose ran into the basement

of the house next to the Roy Howard's and most of the firemen had disappeared.

It took enough time,to make me reach the office after nine,to supervise the

doings -- the Howards* Asian houseman appeared at their service door gestured

with his thumb and retreated, a young m^n came out of the front door of the

"fire house" startled at the erra/y in the street got a confirming gesture from

a fireman shrugged his shoulders and went off to work, finally with bells clang

ing and siren wailing the chiefs* cars for two departments had responded end

the others backed off into the not too heavy traffic of Madison Avenue- I hope

they took it gently as , beautiful ,pa.5r of new shoes itrod fcrloralv the

running board of one of the ladder trucks.

Three hours went that day in going to the Ccsmopolit-rf' Club for - Shakers

Committee meeting of the CTR, where this season with only one mere meeting to "

ws* -T"rHf?ed and seme groundwork, laid for next year. It was a happy event s

thev agreed ^hi.s bad bean the he?* 'yea:r yet; It always amused ne to remember the

enthusiasm for a speaker as they stream cut of a session and the much more criti

cal comments they make in retrospect* Thanks to my watching their expenditure?,

i$*?. r' "Id

tx o

with a comfortable next egg. Would that the FPA as a

?hole were as well off. There is an over-run on expenses and an undo^-run on

income with senior staff being instructed to see that every economy is effected

even to paper clips. I was to have gone to the Americrr Academy n* Social and

political Science conference in Philadelphia next Fpid'eb"! rhd Saturday to listen

to speakers and chat in corridors, but that has been 'cancel!a-"1 to save

to &3f

An unwise economy, I feel, but one which will enable me to go to Stony Brook for

P? ic fund^/ '.I'feyVdnd and to Freeport for Easter,

The neighborhood pigeons have always bored me. Today their silly complete turn clockwise followed by one in the opposite direction convince me of their uselessnese. Now, jackdaws are something else again. Ferrer1 ,'7. Lorcnz intro duced me to them in his ""King Solomon's Ring", where he teVs about the "tire flock" around his home in Bavaria. They have a rigid code of social order under a male leader, the wife (they are monogamous) taking the precedence of her mate. Their general behaviour and flight patterns sound v/onderful for bird watching enthusiasts.

Campaigning antics in the Wisconsin primaries seem to ms tc ra /r rse than any v/e have been treated to before. While it seems of dubious value to have brothers and sisters careening around the state saying "Vote for my brother", was it necessary for Humphrey to be so bitter about them ar.d their plane fe.rei* I should never vote for a man because his younger brother made the first ski jumr of hie life before a large crowd and then exhorted them to vote Kennedy. Francis Deak counts on the women of America to defeat Nixon to free themselves from pressing their husbands clothes. He maintains that we have too much sense to tP7e the First Lady set the pace for all wifes to undertake the pant pressing .
This week X became involved with a Chinese cleric with r church up on River side Drive, ^nd learned the difference between the two New Vcrk Chinatowns. Down town essentially the businessmen who are largely Cantonese. Uptown the Northern ers, diplomats and intellectuals. There is no social intercourse between the two. My Dr. Ching has another interestselling goods made in Hon? Kong by refu gees there for their support. Cecily he has sought the middle ground of 23rd Street for this & owroom.
Nov to copy the income tax returns and ready myself for the Eustace Seligmaiis cocktail party

1 ^ - / Jk ^ /,

,1)':'.; |v -i v. ( v-iA-f./ (Uiii*j

y' - -

Stony Brook, April 9, i960

The Seligman's party was accompanied by torrents of rain ard or the whole not very exciting. Their's is an English basement houfse with wraps left in the dining room at the back of the entrance floor The entire "parlor" floor is one huge room of rather gloomy decor"with be rtenders at either end. Fire maids opened the door, handled waters and passed sandwiches and both hot and cold canapes. My most amusing conversation was with the wife of Dr. Faulkner, who had been sent" for t. treat one of the two mothers-in-law of the King of Nepal. He had prorct.em a tiger shoot but warned tha t they must supply their own weapons

^trhUnSafh-Dr'aan5 MrS* Faulkner wer# duly purchased at Abercrombie" & i'->.tcn and shipped at once to Nepal. Mrs. F. knowing nothing of firearms bu. determind oc na ve scmef'tlng to show for the trip, arranged to have instruction at the firing range used by the J.P. Morgan guards. Thev us ed a sawed off shot gun^ for her lesson and off she went. The King

he- when the^ficer0^^1118^1^ br nbls own elephant and stood beside

or

nnott

killed

i a

if

came. She rge male*

rais ed her gun and shot and believe In her haste she rested the stock on

it the

upper part of her arm instead of on the shoulder--result a large bleep

W;..llShe

t hide t0T days 1 Her husband shot a small

the job th-" wn?nhve +* i;USe}TM of Natural History gets through with

asin town.

It

1is

curious8thra8 t

I

rug in the house
recently heard of

itnhetshaedcopulnitgrhyt

oafs

wPealt l

thflob h^ naving same extensive dental work done. In the midst of the job, her dentist was summoned to Delhi to take care of Nehru's t+h and for weeks Pat was left in an awkward sta te, but for some reason unable to shift to another man to finish the job.

It is cold and windy here with little more than crosus flower* swelling red bud trees and coloring willows to give hope of spring ' wi^nntehrr^gaTiesPwhenfirwe wreeattuhrenre.d f3r0omI Cpoimcmkaeedkutpossoemee Jbriamn'csheasftteorrMnavof1f by office. It will take him about SO minutes to drive there an-" evervnne
springPhondaris^ver%rrBiri^inh tMS wil1 bring thc household. Fred's

a=:is ai

Bu'^EI:ErsirsiFLPrrv--s,rTr

enter the harbbot!

S#a WS S turb"leilt and red.

could not

p^f

hp*) <c^>ic

/W"- yf * i April 18, 1960

Although the weather man could not make up his mind on which trick to
play on us--snow flurries a week ago end 82 degrees on Gocd Friday, then so much' colder on Easter that Martha put on the til burner about ten on Easter morning'. ...
T nevertheless had a wonderful Easter weekend. It began awkwardly when traffic was incredible and I missed both the 5:45 and the 5s47 to Freeport and arrived after CIeve instead of ahead of him, though at least Martha was cahght sn d warned on the telephone. Saturday we stopped at Fran's for a minute, bought some lovely deep hyacinths of rose color to leave at St. Ann's cemetery and had luncheon at Michael's in Sayville in what used to be the office and residence of Dr. Ross,
who took care of us for so many years. He serves an excellent smorgasbord, both cold and hot, with the understanding that if you leave anything on your plate you P8.y double. We heard the next day that too many people had learned not to overserve themselves en*5 he was going to give up. Then Cleve drove back and forth between the
Merrick Road and the Bay on most of the streets of Sayville and Bayoort so I could see how the towns had grown in the at least ten years since I had been there. Most interesting to see the very nice new homes of a lot of people I had known as trades men and such. All too many of the homes of old friends had been destroyed and the property subdivided into building plots with some really nice smaller houses as
well as some not so attractive. Our old house seemed in good repair, though a two car garage bee been attached to the north side and the wonderful big bam left to shift for itself. They must have tried to keep animals or something in the lmd behind tie barn as all thr fruit trees, the hawthorn and lilacs I loved had dis appeared. We called on Watkins and learned that he will be 82 on May 1st and has V e spjne wonderful sense of humor. When I told him the note in the door "Back by
five o'clcok" had made me fear we &ould miss him, he replied the note was not for us but "one needs a few moments of ixivacy". In reply to another comment he said "Well, it is Leap Year. I must be careful".

Martha's pink Perfection camellia produced a beautiful bloom which I wore to the seven o'clock service and continued to draw admiration today. Cleve hurried
through breakfast and then went back to help with the nine srd eleven o'clock services, vdiile Martha and I were more liesurely and then hid Easter eggs and gifte for the little bovs, iho nprived about 10:30. Fran and Sal went to mass together
and I fixed roller skates for Jerry and Bobby. Th^re were no dull moments in the day, for as soon as Cleve returned, the Russells came to join us at dinner.

Last Monday there was a speech by and reception for President Lleras of Col ombia, where I had quite a chat with his military aide and learned that they use the German army insignia designations for officer rank--at least I'll know a German or Colobian LieutenaAt Colonel again. It was good to see Clem Conger of State
Department Protocol and my pals in the Secret Service. The-'' rode such good herd on the President and his party that they arrive two minutes before five, when I was still in my office and looked out when the motorcycle escort roared up to the front door. I'm afraid Carnegie Endowment goofed. They asked people for five and
many trickled in for the speech after LLeras had begun'. From there I went to the Derek Russell's apartment at 50 Sutton Place South for cocktails for three visiting
British gents. The group was largely drawn from television and aside from the English I had amusing conversations with McDonald of the NEW YOR&ER and Diet Jenn ings of NBC, who is anxious to do a "program in deoth" on Fiji and present some tapes of the "magnificent voices of Fijian women". Oddly enough I think I put hjjm in the way of getting it. Also sold British Columbia to Nick Russell, my hest's neohew who started teaching in Nova Scotia in January and was discouraged by the way shoulder high snow stayed about. Alt^ougji I found two parties in one afternoon rather tiring I'm going to another at 5:30 tomorrow and then on to Aunt Mary's for dinner. WHEN shall I ever get at letters, fisteeially those about my European holiday? Palm Sunday Bill was in bed and I played with him 5nstead of writing in
the afternoon. Service at the Caroline Church did not take all corning, but some
how the day drifted away pleasantly and without tangible result

AU

#4 T< ^-^K>

Aoril 30, I960

Another

i A weekend

,,A and

nrct

rhi+ch*+ ~

so

now I do things

this on Saturday do not get done,

evening to "be sure I had ejected to

of something again. As an examp *

,

of earincrB as i have lest one of

\mr two

J, arthree months and misplaced cry favorite Danish silver

ones. Accomolishments: left fu^oat^o^torag^ Heavf

souvenif^f^el^^hi^^hould^have ^een,j^8bitCof^food f or%he0weeke^Ci^But0to8

^Honel might'throw found no cavities and I had my passport Pictures taken igdJ.it xr

"r *
jn

But U this adds uP to

only a tiny dent on the "things to be done".

With inadequate notice ^stace^i^; ^"disked mfto s^Hutlhf^

vitations

Mgh a jercentage

phone campaign to round up s o m e additional vara

^ ^

~eally iffl^r^r 0fTe lir^esuons put to him after his statementjer^by

people I had invited at the last minute,

?t ih, 1.9 annuil

that his department keeps abreast of ,he nor....,

rises tbev ere still short.

increase in population, hut as f e s t a n d a r d o f li^n^rxees^t^^.Te^ ^

OInnde ieillhuasstrbaeteinonraoisf inthge-hcoanuese ceonf suthmirstton aone' m i l l x o n , lleeaavviinngg thhee ssecond for export.

The people now drink more tee. and coffee and use the exportable .u, P

^ Kw&.

t&sgxz&ssx SWMMS: TwhheilGe obveirrnthmecnot nitsrogl laddoefsornotthekePep90UpPlew' ith Vth/ehlpenZgtttheenneeddlJiiftae^ssppaan

resulting

fnom on9

Sy^45Hhef craf+fo erf lA ew"hoftob' utter'a^wLSof buthad lost

fIitnafrligshtrtaewns, mnoet. hoonwlyevteor, mtehaoui tthite Twum rkish1 jtuddeennttsvhhaavvee nnooww^oru^t ^ on d^ emoncsigtraarteiotntes

and riots against the dictatorial methods o. Mender . t +

b Te several Middle

box he gave me or send it back?) Which coun ry wi

g

Eastern and Asian candidates, while most of Latin America

if Tith discontent.

Meanwhile preeidentiel candidates all seem *****^delight'onfenemief

a football of the campaign, which will confuse

national security seems absolute

Adding this to the charges end counter charges bout national s.ou!^ ^ ^ f#p

madness. I am completely confused by -.iserViC'.'.e- s r

b li

+h + Khrushchev or

Mm in the closing days of the Summit. Surely

aeoona-stringer. While

deGaulle will hang around to negotiate ... th am c;. ..edueating" Nixon, the President

I nersonally believe we have spent .oo muc . y

oemplexitiee of negotia

f ZTe tes not given him real opportunity to g ^ ^ x p e r i e n c e lr the cempl

^ ^^ go

tion at the

Mb r h d o

fould accept him as the American

wThad HEFTLU^ other topics before X heat UP eny more.

Something has altered our weather-a

cfmuofafit''runs'. %''

air. Even me.have

mv mentel clock appeared in the

objetts to t* amp apartment clrerd^ vet

fff.Ilkklloorree

has it they do not come nas^i^ ^^ the

this hi*. The plane trees and gmkos in 64th Stcb,rry treeg the 0 N

tulips on Park Avenue a r e beginning tr ' ',,howing as the S aves came out too soon

park have been out most of the jee -- and veil the pink and white flowers.

" > I should

"pu+t

away

winter

clothes

this

week,

on, fhtL, ht*:i tvc, <^.rav &t-;

/]u

tu.,1::;: jysvss!

May 7, i960
i21 p"*t - -*

I Darticuljirlv "Kire^ +ha 0-i a-4,,j . ita^ to hold their

rigaae *iong ohe procession rou.te TM ^T^'/T fr" ^V9S to en

v? v* saTof: rt^tp:^r^rtft2s1r:icB

%*>

Cement Workers Onion to ere,to more TOrk for the royal dressers!' Iat8TM*tl0Bel ladie

Herterifoerte^nly^^e^erSrttefwr " t t U r n d

i n ** l e t t e r box' K^-

ten-thirty on Friday to my box about llfta vh % " lt.0PeS to doeuB>nt8- From after

f* weekends or no longer issue

T ,, 9sday orn-nff * * wonder if they work

in this speedy job they stili take tinT+o ,n+m+ifF"jlnrton "d Embaseys abroad. Yes, even

photograph witaresulting'distortions?

'

impr"3 f th 8Sal ansok

weeks5Z?lJvln%%lnt1 J L# the iptos Club a couple of

for his erstwhile boss Nuri Fren who mh6 y*>t8f f T?rki8h formation Office

Representative of Turkey to the OH -In il

f **>?***' as deputy Permanent

of only four women. Although Turkey hue amfnJ** +*!! .

under

% was one

were there, so there are

, , Jsclano^flted

woven, none of the official wives

Keltenborn .as cast in the role of

?'aiP^b! f ^ 39Xea- **$ V'

that since Eren had been so successful in hi! i + -^d it mast amusingly pointing out

becoming over confident ol h," abilities id' J"* -ositiM, there was danger of hie

in order. He pointed ou+ Z ?. * and therefor a few words of good advice were

than coping with the many

that

'm9vioenB WBS uoh simpler

French and that Eren could n t e .!

WUld be ** to perfect his

at the UN was repetitious, dull and int~.de*""-" ** 9x?use* Since 805? of the oratory

the delegates at the UN Free TMLw ponded for impressing the homeland rather than

on but disconnected and that Keltenborn wcuiPba'"^0'' D9pks vath tht officiel earphones

which would hold attention! tad -Hi T

t0 ?rVide Ust of Frsnoh books

a silver dollar minted the yea^ E^n was b rn v-^ious parts of the design--the fjtrur* nf tiv +

f ^ loVe for th9 serve, he commented on the

being the aspirations cf all mankind the "r p a W08rin

French Republican bonnnet

their universality 0f mLrtL thZ^i t

? trus* a"d F ^ribus Unum" and

represent the heavenly bodief,' which shira ^alPu + h<>r9 P Ur oriFlnal ^lonisa

neat little device, which could be adebted^e1 ""I""8 f the ^obe> 9t9* A very

Kaltenborn, a man I do not know

i B

man^ sentimental occasions !

known" pulled a penny from his Dooke+

9 + ,ecison Avenue together and the "un

done almost the same thing for 99 cents less1" * ! t0 Kaltenborn that h "ight haw

part."^Certainly^we^want Pictures of easily come by as comparable riatur**, r to take them ourselves, I object to the +4*J put us in a bad light, vi-^ ^,e ^ f +,

^ 3

ia^< --one-s

' -iati-ms and since they are not as

0 afdestablishments probably have

seeais a deliberate attempt to

serves as an excellent added argument for the^ritish labourPert!

oria9,<1" "

our planee be removed from Rru ^ *, , J7

17 1811 Labour Jarfc ^nsi-tenco thnt

indeuendertly start an atomic"^r

mentioned "trigger Harry" pilot

m, Fr*-!sr!,,f!!"miffhehhBd1;

nowforTr?d t

* MM Washin t

dW*d

h" o

iH oon-erv*+-iv .r?ld9"t chpEln?: between Kennedy and Kixcn

whom he consider, , j|J : "L2 ,#T

tryl"6 to *et btk 9

than Keanady,

Kennedy nor Humphrey will get the nomVu t on99nr'!-+d'vs* Fia current guess is that ndthsr

starte. Tfarren, as le^er of 200 u s

^ !b9:8'lv98 out "ith

nrly'

Stockholm is fighting State Dec^t * whfrh ?rSr

$ 't,9""r '""ternet-* --nel conference in

East Germany into membership, yet'v/sst

th" adffiissl" of

; i* '



,;. ': .

Kay 15, 1960

Since the weather holds cokl, though uncertain as to sun and rain, I

riTrlJtLT Tl JJuunLe "1l1l dererturs. Not knowing yaretUwndhetothwenr LasarPryawiW illempereet pmaeraatotrythetoFmreynch

l" ******** M b;ir1L tfri

5m PariS t0 Irun or throughout the Continent or if I

and therefore proto fly straight to

It lfi lL I nJTk1"

bv ,"|,tecte<i for ""king these arrangements.

attractionn,, eLsrpleectia1ll?y aavse.!unhoevreedisabousteSrvuircoepefrboymtrMaaindridthtaot Ktheirslshruahs. somOne

. T. an.

hT bo stay overnight at Frankfort if T flew ee

the Madrid flight arrives there too late to be sure of catching a train back

that night. Lately there has been so much cloudy weather that

the tulips so liberally splashed around town in the Park Avenue traffic is-

-v T'8 Statue mi 'th9 natn

and behind the

Of wh?+r s Llbrar>' have held beautifully. There are some fine rlentings

.1Pj8aB? ma* 'est+ erd"aA y * afteJr"n*sorooupn the west "ionfdacalr^rieeldyradngeeedp roseseedws hfirifoem

tre*a_ (elm?) along Fifth Avenue through 64th at my window level. It also

brought a s. over just as I was finishing my household shooting. Earlier I

bought two^pair of shoos and two hot weather dresses. The'nex^ task will

to eliminate sere of the tired objects to make room in the closet'.

Fpa Jt?

flrt timlln V9r 40 ytnn an

source has charged the

Pres^mest h-1^ ! !n Coulrt- .Georgia, Grand Jurv handed d~n a

J"? a+a'ib, which nob an indictment. However since it is a matter of

official record we feel that it must be answered so that it can be thrown

" would 'alte aa?as t0 explain intelligently the details they hove

r.rfac+iev9'U^aimany ! th<" a" *a*en out of Pbext and others are so j, J v! + ridiculous and I regret to say show an abysmal ignorance, that I

TOITRBM av tha matter by mentioning that the Atlanta CONSTUTICN and the

T+

as w,d aa the paper in Macon haveppinted editorials "on our side".

ir.

' 00TMUJBii:-6 operation to prepare material to refute these

If charges, but the chairman of our Board, Eustace Seligman, has

"""e hour, la preparation of a statement and secured the vol

et the 1 ol f , 8 ! "gUl d laWyer 0f Atlanta "Med Troutman to help Jh + <?Tini f attack- Privately I call this "1>affaire Turnir-
Jioi. .***%? tha name of the chairman of the Grand Jury subcommittees,'

CCoouunnttv/ sscchhoooollusa rGeorgia ha*s ahas*ysteamUoFf PAcoSnteinruiaal lG, rbaned.rreJudrvfrowmithuseeeinh FpoupltPoi n drawn for two months. The one on which Mr. Turnirseed sat TM.sd through

i f nSr m#f fUSu !r# th9y W#re disoharEed the end of April. Now a

believe ihev

ZZZZ-lTM ** th Grand Jury for Kay and June. I

to other affairs d

1k "F th9 "*ttar or burn their attention

Jn

y

a 1 J *ar lt 13 our intention to get them back on our track

floorr tthhee tthhrreeeeBFFPPAA -sttaff members wehofioarkeenbaafreodm >the+h,,recftolrrdn.te XRfeegeiol nsaol Osofrfriyce.

this

r,di0 "?!S r#ported that Gaulle tr.lked.with Khrushchev

he-- * and hence did not go to the airport to meet Eisenhower. I s this

be did"ne! + .1 deliberate attempt to influence the American pub?'c?' IF

far W-^ g-

r 6 alrPrt fr ***# r Macmillan, why * ould he go

^ LreSmdenW ?ere h9S bean 80 "le tine to read .yen f

+h" view that he v rancis Powers--U-S developements, though I lean mere to

-X , n

double-agent for some time and acted on oveers

^ mMoscow ,o "deliver" the plane deep in Russia at this time. Since a holiday

getting O^Derwi009 f a3+uh8 b8S+ dya fr an attaok' he had "f brouble in bad^v LvLa9 u-e" f!r the 1587 1 fUght- Eisenhov-r has certainly been nfinSSanV?* uttarancee. It 1. humiliating that he leans on non-existppeeaaocee bbeeeenn iinndriunlgfLedd8*in cawsraarnlu6exetrsapiolengaagle,awchtiicvhitsyince time began has in war end

,CAT,MT,Sub*,D+c,

k

5S* >- f**A

--

c;t:.

May 22, I960

Vi

Stony Brook and Molly"

this will la 3t. ,"nf*rrs{,r where it is rather more breezy than

tablished on the bac*

ih roo]c ~a rden. This is the perfect

wIeekreenadlifzeodr

wdohgiwlooed,azaleas*nJa*nd[ tthaat

sort^of

thing.
Qn fQp

I&tgrheaastebreenspan

oool and cloudy so l^that ^ lantana and petunias and while puttin

theminmpulltdSout some ivy and e^0cupationTsemea a^good'idea.

^ndelions

It number iltntaiSain^ieaa which were ^seeded

wS *

ssra?joSS i" '* TM" - 1 grows in the driveway and the weeds in

tr tM r a ^ grass from the gravel

Thursday ight I had.1~M fr

1of3fthf.orMythfelFirgehntc'hs estima ted ttae o0f^a^ rrrrixvvalaii^n ^ Pa ^ ris ^ is juafstterl_ate

enough on Sunday to ma - n_.,,4ne a sleeper compartment. I'll do

'aU^trlvefoA tL^tinent^y train "for a change and may even

use the ship from Holla nd to England.

*.*<*;** ,, r* turning up in the offioe which would

A great many things ^

&g there are bound to be a ooll-

be nice to accomplish bf0- ;

,,8refuiiv hoarded for me to cope

ection of items faring my abseThefiascoof the summit adds to

with. So life is husy

^ OVertired that the world situation

general low morale. Vera isresai0n that she is threatening to hole

huTaphsiisnleIhftetrhihenorkwniwnialp3laUrp*tam*esnst,pff*oers'pPnbeaecrianhlo.liiyida. asyy sniensntaeasdcoomfPpgloeitnedg

to Europe, her teach-

Lg at the U of Roches ter f ^"o^J has not written a word,

which she took the a dvanc- a year ag

black cloud. Never

Natura ully thishangsover . it f c David, it seems to me

having put much faith

we alway3 were. in

tha t we are now only_somewhat ^rs

certainly going to be nasty

fighting for his

through the ineptness Of the official

and we have los t fa ce in Asia

read the details of the

handling latest

of the U-2 incident. * shooting down of an American

Ypiane

ov,er

East Germany, but f lnoidents, July

anticipate that it is only will be messy even beyond

the the

hpo^oapolPafa 0t 1*v*ucr^

conventions,

A sparrow family is busyimmedia tely baa"d,,my0mToa]s: trees

young keep distracting my "^ention. uff of wind, but I am getting

drip into the machine on

^"ha t I'm also getting a

o a lovely lot of sun and air. Can 1
little sunburn my fa ce The b ^

j haard this week comeg ^ olasg shouia think of

from the feeling of a ocnool tea .

mercy-killings to them

and discuss ethical questions, -.t r -gyb1eot 0ne giri went to the

this one--"Youth in India"

j>^C,

dl

11
May 29, 1960

At four a.m. on May 2^Laura Margaret Pratt was born in the US. Military Hospital
in Heidelberg* She was a fr.v days late and weighed seven pounds five ounces*--quite a production for one as small as Delli. Three days in hospital is the Amy standard practice, so mother end child will go home to Paul Revere Tillage at Karlsruh before you receive this. After 25 years of nothing but boys, it is nice to have a girl /for; a change. Martha has not the slightest idea why those particular names were selected-

Tuesday upon return from two cocktail parties X found a Western Union slip and had them read me a wire from "Douglas Dewar saying tov had died suddenly of a heart attack in the Penticton Hospital. The tragic loss of a dear friend of 40 years stand ing was shattering and Douglas was on the telephone to me before I could adjust myself He has been gravely' ill himself most cf the 4nter ~nd surely only his Scottish stoic ism made his voice as firm and clear it vaa-, feey -w#fe - t- -'ng en Wednesday to Vancouver for the Thursday or Friday service nd wptjl& soon return to the country. On Wednesday I sent s. long telegram-offering to go there for five weeks from June 11 to mid-July. This afternoon I111 telephone to see if he thinks I'd be ?, help or c
hindrance. Meanwhile I live in saddened suspension.

Thursday the FPA had a luncheon for Sir Moiman Angell one cf the founders of FF& He is 88 and filled with energy and still writing busily. In answer to % question ho
admitted that as a bey he vad run away from the University og Geneva filled with the idea that one should live by the toil of its hands and sweat of the brow. He emigra ted to this country yrd after six years a9 r. miner, a farmer and homesteader he. turned to journalism. He feels his mission in writing is to relate the facts of r* liizi
-which most renders know --with responsibility to bridge the gap between knowledge and understanding. I had enjoyed a cceMail p$fey for him on Tuesday where there was opportunity to see many people it wrs pieosent to be with end then rushed up to
the Wildenstein Grl3.tr/, where Maria de Kammerer has an exhibit of 40 portraits and a dozen paintings. The quantity and quality of those who came to the private showing was high, several papers have said kind things already. I hope it will bo a most rewarding experience for her professionally. It has been a terrific te,3k to pull all this together, portraits to be borrowed from the owners, etc.

Hater. I have just talked with Douglas end Mary on the telephone, feey are doing well --returning to Penticton on Wednesday as Douglas has business in town tomorrow and Tuesday* Pat has lad friends wit': her at Penticton as. she could not face the funeral. Douglas has qualms about my giving up Europe* but I could not enjov the trip for thinking of them. He admits he walks with a cane and as the result of a clot now is in danger of bleeding to death from any cut--he says he has the same thing as Eisenhower and Churchill. I expect I'll fly out on the 11th stay a night in Seattle perhaps push on to Vancouver, I must take an early plane from Vancouver to Penticton, either Sunday morning or Monday. Now I must turn to letters fo people in Europe I had planned to stay with and tell some of $$ 'tev's friends here that I learned the attck struck her just bofrre luncheon on Monday. She resisted goine- to the hospital but the doctor's immediate sedation was not enough and she went as required. Douglas and Dr. Paine, who unexpectedly was spending the weekend with fthem,left her more comfortable about nine o'clock but
wftre not long home when the word came that ebe had died. I shall never forget hoY/
good she was to us whan Mother died and only hope I cam. be of some help to them now.

Empty paper--a rarity indeed from mej

M ftBB,

flU&a. Hd.sS'/+- f trv<*V&{ # j\\\- C> - # .,
June 5, 1960

Of course I would not admit to smugness* but by. Wednesday night I was well satisfied with the progress made in undoing the European trip and setting uo one for British Columbia. Then the middle of Friday afternoon the ON Coo';-enative called to report they had worked through their go-called waiting list without success and unless I did not want to pay ^or n emrty seat J hod better get on the ball end dig up a sub stitute. Of course it is a terrific buy for my one who can make arrangements 3 puickly, AMD who is also a member of the Cooperative for at least six months. I have new done evcwthing I can until tomorrow* so you had better know my travel plans:

Saturday June 11 - leave N.Y. International Airport Northwest flight #73 at 10;20 r.ml. (making two stops)

Sunday, June 12 Arrive Seattle at 5t43 a.m.

leave

"

United f ight 991 at $$ 7:15 a.m.

arrive Vancouver at 9:06 p.m. (it is only an hour's flight

but Seattle is on time ^f the sun and Vancouver on daylight)

I*11 go to 2745 Point Grey Road, There Haines, the caretaker

will let me catch ur> on sleep and have a bath$>

Monday, June 13 - leave Vancouver Canadian Pacific flight $ 4 at 8:30 am due in Penticton at 9:45 a<m. (last year it took about

six and a half hours to drive over the mountains)

Return

Friday, July 15 - leave Penticton* Canadian Pacific fligh| t 3 at 6 p,m,

arrive Vancouver 6:55 p.m.

Leave Vancouver, United flight #754 at 9:00 p.m.

arrive Seattle , 8:48 p.m. (ha-ha, here's where I get that hour)

Leave Seattle , Northwest flight #\0 at 11 p.m. (nonstop)

Saturday

arrive New York at 10:40 a.m.

I'm glad to have the Sunday in Vancouver as I can get the news frbm Doifelos Adair about his father, and from Poppy MacKenzie on her mother, Lary Harriscn. Alec I should arrive in Penticton fresh instead of jaded from the night flight and a busy day of packing and dosing the apartment. On the return it is useful to have Saturday to lay in supplies and Sunday to unpack end get set for the office the following day. Meanwhile my address is:
P.O. Box 237 FSNTICTON, B.C., Canada (c/o Dewar i3 optional) Train mail takes about six days and cost 4^ Ai"* mail should get through in three and costs 7g

Mean-bile the office booms along, we have a posh, stag luncheon t< morrow which I have been running by remote control with the guest of honorSecretary of Foreign Affairs of the Philippines, Felixberto Serrano. IN preoaring the stuff about hiih to be used in the introduction I learned that he and his wife have 12 children. Tuesday I have an CTR speakers committee meeting for which I am a long way from prepared with material on all th wonderful speakers they might have fiext winter. Fred should be bacv t"morrow from a week of his last year's holiday tomorrow* which will be some easement.

Friday night Eddie McGaw had dinner with me on his way to West Po5nt for his 40th reunion. He. reports that Lillian has had a fine time on her ijU^opean trip but resists his attempt to have her delay her return. Last night Vera had me for a farewell diniB r at Canairi d'Or, where I must admit tne food was better than at the Club on Friday. It is so hot and humid this afternoon that I am going to have to shed my dress i Please be understnading if I do not write much from B.C. ^here it will et least be cool.

m

Banbury,

July 2, I960

This promised report on the family is no doubt long overdue from your point of view. Now I hope to take advantage of th Fourth of July weekend to get this to you. Douglas had a bad set back on the. 16th and it did not seem fair to write during that period, which we hope was one of those Things" and notpart of his permanent condition.

4\ ty\ PH#
tf'/
/
miSh&<"
:Bi "v"W

Although he had planned to meet me at the airport on the 13th he had a minor upset and did not feel up to it. However he dressed, and with the ; aid of his cane^and Alex (the butler-chauffeur) was down for meals and working in the library with a secretary from Penticton for three days. Cn the Ipth, he signed a new Will and later had word from Douglas Adair that the caretaker at Westbury had suffered a minor coronary and been taken to the Sbaugrmessy Military Hoq? ital. Once more he over extended himself sending messages of various people and making arrangements for covering the mail, care oflawn, etc. As a result the old dysentary asserted itself and clotting factor in his blood went into imbalance* The doctor came out twiceA the medicine to stop the abdomina pain and the dysentary , HtLife effective was hard on him in the side effect of making him dizzy was very disagreeable and I fear frightening to him, Gradual~y he improved and we were encouraged whoR we had three very hot days. Douglas suffered from this a great deal, His sleeping fcorch is like an oven in the afternoon and we got him onto the open deck off my bedroom, where he was more comfortable and did not take the energy required for the stairs. Yesterday was cooler and after a good night he talked in his normal voice instead of a flpt
monotone, isi&fced- conversation and made little jokes. Mary and I were disap pointed,aftver thinking he would go down stairs in his dressing gown, he remains in bed all day. On his last visit, day befqre yesterday, the doctor was quite satisfied . We live not from day to day, but adapt routines from hour to hour. He likes someone with him and is apt to doze off, or go into a deep sleep when the paper or a book is being read to him. For a time his mail was read to him,
but now he is back to reading it himself, not however up to dictating answers. He would like to tell you about things himself, but was glad to have me offer to
do it myself. The male nurse turned out to be a drunkard and was fired when they went to Vancouver for the funeral. Alex, has taken over bathing and dressing tasks; Mary administers the vast number of medicines he takes. I spell her in sitting with him, so she can have her morning walk and afternoon rest, and am permitted to fetch Scotch for him at the specified hours and light cigarettes.
Pat avers that God has taken her mother to. heaven, where she is preparing a place for herself and her father. She holds to her routine of vieeding during most of the morning, resting after luncheon, presiding at the tea table. She misses the social life of frequent card parties and looks forward riappily o "going out quietly" later this" month. She last a good deal of weight with a strp throat in the winter and walks with more grace and ease. She has^accepte the ultimate sale of this place which is on the market, admitting its isolation and heavy responsibility is no longer desireable. The waitress, a local woman, is excellent with' her. Obviously Fat is no help with her father and I sometimes think bothers him with her "Are you better, Daddy dear?" every time she pops m.

S 5&i

Young Doug is trying to get his father and Mary to the Coast for the hot weather. The journey could only bemade by ambulance a d his father resists, so now he recommends, an air conditioning unit. He by the way will marry his bosses daughter, an American girl who came to Vancouver about the time the Dewars returned. This is the situation as I see it for your information. They still expect the Slnoh faSly frcm Toronto about July 19, roughly a week here and a couver. Douglas daily becomes more dependent on Mary, who is. wonderful with him.

July 8, lyo Banbury--Skaha Lake

It wns stupid of me not to believe it, but I have now had a letter from my assistant Fred enclosing the official mimeographed staff notices telling of the dismemberment of the Speakers Bureau* Once again I was tempted to resign. Instead I wired him and asked for news of when Mason would be in the office and already have his answering telegram. As you can imagine there is a big mess to clear up, I must get Mason's approval of my recommendations for handling the internal reorganization and the external public relations, Mo need to bore you with these ramifications, H owever, I am determind to arrange things so that I am not imposed on and should have a more normal work load. Of course, there will still be the pressure points of the big luncheons.

Meanwhile there is good reason why I diould take the extra week's leave I would have had in Europe, This will be a help here even if I cannot take the full week because of Mason's holiday. Today I'll get on the airline to shift me from Friday, July 15 to "Wednesday night July 20, and ask for an appointment with Mason for Friday or late Thursday afternoon. Travelling midweek there should be no difficulty in getting the flights I want.,,,I hope, I hope.

We probably made news in the weather report yesterday. It is supposed

to have been 99 o/o in Penticton and as this was the sedond day of humid heat

without a breath of air stirring until late afternoon pretty trying Happily

Douglas has had an air conditioner installed in the library where he can be

comfortable. It is splendid to have the necessity of his being helped down

stairs as he should have some exercise. When the house was built a blower

was installed in the cellar and through its use we have had a good circulation

of air through the house, The fabulous part is that there was a change during

the late evening --a good breeze of dry air from the north and while I do not

know how much the thermometer dropped, it was necessary for me to use a very

heavy Hudson Bay wool blanket when I went to sleep,

I'll probably wear

a sweater in an hour \h en we have our lunch in the shade of the pine trees

across the

lawn. The contrasts of weather in this place have always

fascinated me, as well as of people and scenery. The comfortable, sophisticated

living of this household and one or two other families and the Indians who are

our nearest neighbors to the aorth. The aridnees of the wee hills and the

starkness of the rocks and pine trees of the mountains throw the lushness

of the green lawns and orchards whereever man has taken the trouble to pump

the lake water,

Maturally I am anxious to get this change of plan off with the daily house cleaner and the orchard men when they go to town in the truck this afternoon. It is a disappointment not to go to Bill's confirmation on the 17th, But the combination of helping here through a few avikward days and begining this new arrangement in the office by calling the shots myself seem to outweigh.

D S5, Pitt b( /^

^ V J ^ -'7

/V)fTj k *Vv^( AfC. J \.ix/s;t y <. ^v_ I.. (

17 East 64-th Street---July 24, 1960
Sad as I am not to be with either of the Long Mend families this weekend, the two week old strike on the LIRR precludes trips, at least I am fully unpacked and squared away with the July 1 bank statement and entered in the checkbook items paid for by check froTM ^*0. The prospects of a stroke settlement are poor, but once peace is made I shall be eager to see both families- I hsv* washed my hair and thrown away all the hair pins, which had. acquired a heavy layer of rust# On Tuesday afternoon the orchard foreman informed Douglas that he was having the pickers begin at four the next morning as it h$d been 130 in the apricotcrchard that afternoon- I never saw the thermometer higher than 95 myself, but c~n imagine that in the sun and mong the trees planted on both sides of rather narrow gulches where there could not possibly be any breeze it would be impossible to work after midday* The heat ha3 been greater and earlier this year than last and no rain in July at all, the last was about June 25 and was only 2/l00ths of an inch. This drought does not bother the Dewar 3n acres of orchards as they are prepared to rump tee water from the lake through the trees and to keep the lawns and flower beds well sprinkled. The air conditioner in the library has turned out to be a great boon to Douglas and Y/edne3dav he seemed better than he had been in some weeks*
After Mary left on the Friday afternoon plane, 7 took over medications and gen eral supervision. As it wa3 hot Sunday, we waited until midnight for his sleeping ^orch to cool off from the afternoon sun --kept out by canvas shades, but nevertheless hot as an oven. I rolled them up at 8 and turned on a fan to assist in 'cringing in the cccl evenin?' a~.r, but he was tired and anxious to get to sleep as soon as we got upstairs. I gave the medicines and left Alex to take him to the bathroom and lost no time in getting into my own bed. I had barely yfcratched out when .Alex called me and
threw on lay dressing gown and found Douglas slumoed over the brsin vfaile sitting on the clothes hamper to wash his hands* I waksndd the waitress, closed Patfs door,' and. watered .Alex piek Douglas up and carry him to his bed, removed his 3weep second hand wrist watch for pulse and respiration counts and telephoned the doctor/ He came about one, went over my medication chart, heard our combined recital of the day e.s he and 1 drank coffee (Alex had already given me a brandy), then made a very thorou^i examination of Douglas and only got a small grunt when he exerted very real pressure* Immediate report--no functional accident, possible aecuumule/ti n of opium from one of his anti diarrhoea conscriptions (I had been using a fresh bottle for two doses Sunday and there was the impied hint that the phamasist had put in too much f) , and anticipa tion that Douglas would remain in this completely relaxed near coma until morning. A little after two .t. sent the staff to bed and. tiptoes into the sleeping porch to return the watch, only to have Douglas say 7. was mean to him in turning off the airconditioner. He was both confused and aware, wanted a sip of water, a wet towel on his forenead, oo have his hand held* In the course of an hour of these ministrations he was annoyed that the doctor had not taken his blood sample and finally knew of his ^wn memory that he had collapsed in the upstairs bathroom but found it hadd to accentthat Alex had carried him to his own bed. About 3s30 he dropped off to sleep, so I laji down cn-Ary1s bed with a quilt for cover and slept from something after four until he spoke ho me a little before 5:30. I rang for Alex to give him the urinal and went back to my own bed for three hours.
jVhen the doctor came back about noon, he tried to get Douglas to go to the Horpitpl for a few dews of tests. He did not refuse, but later told me he would not enter th3 nl&ce Amy died as a patient. By Tuesday "di en tho doctor had not produced a nurse, I ster+e'1 a to .ephone campaign and had Mrs* Hilton, a graduate nurse with wonderful recommendations, both as a special duty nurse and a hospital for old. men and chronics matron, out at eight that night for him to view. He had said he would not have an elderly person and my heart sank when I saw her snow white hair and she admitted to being 69 to me* However after a few minutes chat Douglas asked me what hours I thought best, so she turned iu"> at :30 the next morning to begin the 10 to 6 shift.

July 24, 1960 -page 2

The first thing she did for him was to give a proper bed bath --poor Alex had be^n

doing what he could but fearful that with his work toughened hands he would be too

r^ugh and naturally did not know about roiing the patient. I was able to show her

the complete geography of the house, the supplies and medications, brief her on the

routine, introduce staff to her and tell them how grateful Mr. Dwar was for all their

helps and explain at what points Mrs. Hilton woud i relieve them end most important

should be able to let them get their customary two hours off after luncheon. Her

additional assets are a husband, who will transport her (I could not have considered

a person on Whom Alex would have to spend 45-60 minutes in driving back and forth),

her complete and well expressed willingness to work eight hour shift or longer or

b9 in residence and to be on duty on whatever jreriod is best for Douglas, also the

fact that Pat likes her. She has been on cases with Dr. Foerester and has gre^t

admiration ftft for him. 1/hen I went in to have tea with Douglas before leaving for

the plane he,unsolicitated,said "Mrs. Hilton is all right". So I left with a lighter

heart.

Mary was due the next day v/ith the cousins from Toronto to stay almost a

week and return to Vancouver with them for ten days. She v/ill then go back to Douglas

probrbly to remain until late September when he plans to go to Vancouver. As soon as

cool weather comes, Douglas should really improve and they may be able to let the

nurse go. Meanwhile, she is invaluable and should give a lift to the staff, who

were getting pretty fagged from the hot days.

The Province is having a great many fires, some near Kami oops, threatening: fine stands of timber. From the plane I saw the smfeke ftp of two medium sized fire, How I can confess I lived in terror that one would break out on the Indian Reservation range land across the highway and only a mile from the house, but adjoining the Dewar property, Unless there iras early warning and Alex could have driven Douglas out, we could only have evacuated him by water. The great velocity and variabilis of the winds in those mountains scare me ""-9n fires are around. Yet my plane to Vancouver passed over a great deal of 3now on mountains. The 11'.hiP "Black Maria" met two criminals handcuffed together, who unbeknownst to me were on th9 plane, Gertrude Belyea was there to talk with jpftfjfcy me for ib'f couple of hours I hadt o wait for the Seattle plane# which was very nice of her. The NW sky was a deep, deep red at 10p.m. when I took off, the city itself,and both North and West Vancouver, climbing up the mountains across the Gulf of Georgia, were lovely patterns of light After we gained altitude the Fra*rv River and all the salt water arounc1 took on a beautiful opaleseacs of deep pearl. We flew over Fugst Sound but close in to Seattle tfiere the residential section was demurely yellO'V and white lights in conirvrb to i \9 Christmas tree like colors of the business section emphasised by the changing traffic lights* Dealing as I had to largely on the telephone with the Canadian Pacific Airlines man in chaning my tickets from the 15th to the 20th, I allowed my self to be shifted to the United Jet Seattle to New York* This turned out to have a stop in Chicago and perhaps because I was overtired, it took a very long time to get to sleep after we left Seattle--result just about one hours sleep* The flight from Chicago was only an hour 50 minutes but they served breakfast and more sleep impossible* Instead of going straight to the office for catching up and ]e arolng the gaeral situation, I came straight here and after telephoning apologies to Fred went sound asleep, had dinner of more bacon and eggs and went hack for another eight after talking to Martha and Clave and Molly* (Poor wee Jerry has measles, but both Freeport families are happy in their new homes*)

Friday I had my talk with Nason and we agreed just to announce that the Speakers Bureau is no more and after six successful years with an increasing ahacripticn list to discontinue its publication* 1*11 get a new title and am urged not to involve myself in too heavy a work load in the rearrangements* I still think the "econoey utterly wrong and hope I can yet make something out of the "directive" which will interest me beyond the next nasty six months i en I shall be busy telling hundreds of people that the FPA no longer wants me to help program planners across the country*

August 4, 1960
At least the "nee life" works to the extent that I am able to take to -he +tyTMpewTrditteerr aItt eeiigghhtt eo'eoliooeck aaf. ter h.rarwirintng Kfinhiosmheedataythdisinhnoeur,r.instSeOaTd. oRfocthkeefeallller PiLllv^tSoefin yesterday, pounded the table and settled the IJHR atrikeyester-
SfdlrtSn the fourth week. Last Friday I trawelled about 40 minSuteees oonn the Eighth Awenue subwailyncteodthanedexlapgrgeesds sotnopthbeeyboanekdrEoaadsat Nsoewm*uch*thanadt I was
ISUhdstftrtedbaektotoimnore^than onee, but we arriwed at their new home

S^.s^sshm

r^rs.*

other non-operating enployees the day after the strike was called.

.mm.-, fi

.t that ooint dinky Iloore telephoned to giws me a blow by blow

dtteasctrtieprti.onNosfg'hooiawtiohneshhadadjubosgtungobtteefnorae fIatboufltouasndcoInt^raasltrweaithdya heard -ost <f nie recital, but he was too exeited to be stopped. I an enchanted for him.

Now I an back from a morning shopping expedition, most abortiwe. One place at

51st Street,^ere I saw something 1 needed in the window fron the bus lastnigh^and

door "after

sign "OPEN SATONDAfS* AugSat 20th" t None

turned of the

out today to haws a dress shops carping

fine huge

print addita. nal announcements of

s *ar

nSi^aee,"b-furtfnooptes^alesopnroiseddar,keoeotttotonnanddredssaetroonwheoaurse eo^tt^whuichTweil'leoocoloflerr tiSan * my

srsSitrKTSTi 'AXTM old but still good nylon and Jus1t as

J* ffSS'S* night with

fhile Kartha and (Here still hate the "good china and glass" to

wery well settled in the new!little

teU^Tthe grandpa Jackson

HrESa
tfoin r aalnttriceispeastesdupipnerwSieuwndoafy,thaellshgaoyt ^ and^bl^ oc^ ;i g^j>w . tehQySwooutldtepidk^m^e uepTth^eriekan.d r^lMlet^VtheSPor? hereon to Bridgeport ferry and the NY, New Karen
and Hartford railroad I

As eolleguce drift

^to^'l'tn't^ast.'but8^"bten

sTha^rx1^ i

srysart

-* Sf&&X- rda^traced by is Ration ^fer^e. BeparW .

sx 2?--S^aSS-SrSs r. after this austerity fiscal year. Belier# me it is a

* ^ ^ir^k was the

^^^^i?utio^"ly!TMS Prin^lf the ^moet eonsideration is being shown me ^thfrequent urgingB by Fuller & & not to owerload myself.

Y,

J

^

Sdj'c

^ ivMA^i , /i^ u *..-. V, <-' ,,. ( /t( <^c

If carbons are faint it is the fault of the now ribbon* It is so balck that I Ray bo inclined sot to hit as hard as I should* There were two swims at Oak Beach two weeks age* dsere I found Maria and Hank deeply tan and the proud possessors of eight feet more of lovely white sand* This is their share of the prejesi to protest the Jones Beaeh barrier from washing away in storms and the result of serious erosion a eouple of years ago*
Friday a week ago Aunt Annie arrived and we went at onee to f# Stony Brook for the weekend* where it was foggy wish showers most of the time* We/ played Samba Saturday night in front of a good log fire and late Sunday afternoon managed to swim before our out door dinner* It was so relaxing that if Jay had not driven like the windj^jf we would have missed our train* Their eool damp summer did little for the roek garden and I was disappointed in the failure of the supposed* ly superior petunias I had dug is to provide midsummer color* Bill had skillfully put in a hedge at the tip of the bank to provide a background of green* The un fortunate weather 3&sted until Aunt Annie le ft on Wednesday morning* She made some progress on gathering material for a paper on the Sues Canal including a trip to the United Arab Republic Delegation to the UN office* She was sot more than an hour on her way when the man to idiom 1 had given her a note was on the phone to me to see Aai I could do about a friend of his arrivig in early September from Cairo* (If the office does not explode 1*11 go to Albany Thursday night* Saptember 1 for our long Labor Day weekend* but return Sunday evening or early Monday morning*)
I have been greatly sheered by a letter from the nurse about the slow but steady improvement Douglas has made* Having feared he could not make much pro* grass while the heat lasted* this is indeed good news* By this time Mary is bask there* I expect to stay until the Dewars return to Vancouver about the middle of September* When Mrs* Hilton wrote the last of the apricots were being picked and the early peaches as well* This can only mean a good 'sot crop*
This week a Cuban professor* whom I knew casually 25 years ago* dropped in to see me* He had been expelled from the U* of Havana together with crer 400 other members of the faculty and through a real cloak and dagger operation fled from his homeland with his wife on July 20* When the Brazilian Ambassador told him he was in danger he went into hiding and advanced his departure from August 5* The Ambassador picked them up from their hideout and drove them in his official car to the airport* His excuse for leaving was to speak at the Canadian Institue of Public Affairs at Couchithing* He has since been declared am enemy of the people and hie property seized include the car he legally sold with all proper bill of sale* etc* Fidsl Castro was his pupil in 1945 and never did better than C minus in history* Of course* Castro did not have pneumonia* The original diagnosis of his trouble was hemorrhoids--too earthy aq4 ailment for the Great Man* Yet Cuba's leading surgeon was called in and diagnosed pollops of the rectum with possibility of malignancy and recommended a biopsy* where upon he fled the country having had disagreeable relations with the dictator over an operation on Fidel*s son and an older female relative* Castro was schedule to address a huge mass meeting* but when only about ten percent of the anticipated crowd showed up the illy educated Minister of Education was given a script to explain to the dear followers the Premier's in disposition through pneumonia to be with them* The poor illiterate minister could not cope with pneumonia and used instead the Spanish word for "inner tube"* the crowd rocked with mirth and needless to say the press omitted mention of the dip*
After two delightful days the heavens opened about midnight Thursday and in less than 24 hours dropped three and a half inches on New York* I had an early appointment with the dentist Friday and because of the gale winds arrived at the office greatly resembling the Htch of Ender* but the proud possessor of a fine new supply of writing paper* Now we are warned that Hurricanedeo may descend to day and or tomorrow* There has been feeble sun all morsing*

j\iX ^ J

Augi at 21, 1960 17 East 64th Street, New York 21, N.Y.

Splendid as were ray intentions to write you a better report on the Dewars than was possible on July 2, there was neither any good news na* time to do so. The heat set in early and hard and Douglas suffered cruelly even after an airconditioning unit was installed in the library. .Jthough I had shocking news from the office about reorganisation and a major c-ange in my own work, I delayed my departure ihen Mary had to go to the Joast to ready her house f<r the arrival of the French cousins. This left me in cnarge cf things, most particularly the administration of the 14 doaes of t;i.3 and tfiich Douglas took daily. Th doctor tried to get him to go to the i enticton hospital for tests, Douglas refused on the grounds that .Mat the /anccuvsr General could not discover in over five weeks, Penticton could not uc in a few days but really I believe the reason was he could not face being a pa tie-in the'institution where Amy died. .After a pretty bad experience with him af.er ha want up to bed about midnight on Sunday night I persuaded him to let a* try to get another male attendant or a graduate nurse or even a practical ior him. The doctor had ostensibly been trying without success but my telephone ap. sal to everyone Pat or T coulc1 fchinl oi turned up toe very thin^,.

Mrs. Hilton, graduate of Kamloops Royal Iospital, with years o institutional experience with chronics and the aged, now doing private duty from Penticton and living with her retired husband, tfic could drive her -o ana fro passed the initial interview in spite of Ter snow white hair. ^ou^a3 accepted my recommendation that she take the 10 a.m. to 6 p.m. shift and she began on July 20, nhich let me take t&e six o'clock plane with an easy nu.nd. Immediately she gave him a proper bed birth, the first complete freshening up since I do not know men as Alex, with his strong toutfi rands ms afraid hurting him and Douglas, I was told, did not cooperate. JThen I had tea with him in the Library before going to."the plane, he said without prcaopting Mrs. Hilton will do nicely." Knowing him as you do, I think you will agree that m a good remark with which to send me off. The next day Mary returned vnth the French cousins, who lived in the Bandbox. 3ho wrdto me hesoarcely did aoto than welcome them and say goodbye. She had to go back to Vancouver with thera after almost a week there, Their visit gave Pat great joy an- I suspec, she laid the foundation for har to go to visit them in Toronto in the autumn. I hope it can be arranged as ahe gets on her father's nerves and s .e is stil.. terrified of him.

This week I had a letter from lira. Hilton with the most excellent

news that Douglas had not had diarrohea for over ten days and had also gotten better control of his bladder--not only good for him physically but important

t o his morale and pride. Furthermore she has persuaded # him

i*t

walks in that huge living room each afternoon, rest a bit in the ,tertrl

.

and walk a bit more before retreating to the airconditioned library. Incident-

ly the air conditioner wa3 D.A.'s idea and indeed proved a life saver for h-s

father. ... Pat Ins begun to go out to her beloved Haiel Knox for card games

... By this time Vary is back with her daugrter, Helen Hargaret ana her two

children, which means Douglas has Mary for oompnionship and to do the stafi pa,

roll with all the social security deduction complications, etc. and tRO has ner

cousin and the children. ...Haines is out of the hospital and with his nephew

in Alberni, no mention of when ho can go back to iestbury. - expeat Wiry will

stay at Banbury until Douglas returns to Vancouver, which he .old rae would

mid-*Sept ember.

(
5

%*aSR&;

'
Good nousthis week from the fine nurse I dug up for Douglas* Ho has mad slow but steady improvement deapite the boat* T had not dared to hope for any progress Titfiile it raoainod so hot* He had not had any recurrence of the diarroh<aa for over ten days and that is important not only physically but for hia pride and morale* Further she has persuadad him to take little walks in the 2C x 40 foot living room en.oh afternoon with a "brief rest in the forth Porch before retreating to the air conditioned library* This exercise had been ordered by the dootor since late June but he claimed be did not have the strength. Neither llary# Alex nor I could persuade him to comply*
Mary had written that while the visit of the coucine from Tortnto gave Pat much pleasure and discharged a long standing pewar dobt of hospitalityj DougLao did little more than greet them on arrival and bid them "God speed" upon departure* I suspect that laid the ground for a return visit on her part to Toronto in the autuLin--a good thing after the return to Vancouver if she can travel with some friend* Sho has fewer occupations in town and unless he is leading a much more mobile and independent life would relieve him of the constant irritation* which she poor dear unconsciously causes him with her questions and too fre~ quant queries about his health* She begun going about with e ga^e of cards at her beloved K&xel Knoxfs and this ought to make her happier oven though it presents some problem of transportation*
By this time the old friend George Paine may be with them and Mary Harrison is back with hor daughter and two children in the Bandbox. Good# because it provide# companionship for Douglas and diversion for Pat* Hary will be able to take over the payment of the staff with its messy deductions and the bills* I think Helen Margaret end her children were only to stay about a week# her real visit being to Vancouver and to ta.:o back to San Francisco the objects she inherited from Helen -- a help to Mary is preparing her house for sale* My understanding mas that Mary would remain at Banbury until Douglas returned to Vancouver# which he told me would be before the end of September* She is such a comfort to him*
Since my return I have bean coping with a nev and difficult situation in the office and spending weekends on Long Island with family and friids. It has been levoly to swim in salt water again* It ic good# too# to be able to aB&ro thi3 bettor nows about Douglas*

-'-T T, AI J & I Y ,

August 28, 1960

An attempt was mad earlier in the day to do a chitchat on Martha*s portable at Freeport after X had been warned that it was out of whack* The latter MRM had to be returnsd to position aftsr each use by hand* X tided to compose without using that letter not only slow going but rather cramping of my free wheeling style* After three or four beautiful sunny and cool days the weekend was sunny and hoi* Suspecting that the trains would be jammed and the passengers would be irritable from too much sun and wind, I took the 6jll and decided to start fresh here* They have made great progress on the over grown borders and the place begins to show what h ey hope to do with it* I cut a hedge* which had been clipped earlier in the season* but considered it an achievement as it WEB a "first" for me* We talked a good bit about things they might try to do in London and Germany five or six weeks hence, ffcich was fun* Yesterday afternoon X SIB nt an hour with Fran having as much conversation as three little boys running in and out permitted* This morning we went to the nine o'clock service--both Communion and a sermon The young blond ourate officiating* Transfiguration gets higher and higher every time I go, but still
no inseenae*

Thursday I go to Albany for the long Labor Day weekend with Aunt Annie
and X hope we can go Friday to DElliamstown, Mass* to the Clark Museum to see
the Renoirs and other lovely things they have* The FPA works on Columbus Day -- a legal holiday in this state and takes in exchange Friday before Labor Day, very good from my point of view* 1*11 return to New Yoxk either late Sunday or fairly early Monday morning# The New York Central does not offer the choices of trains once available, but I prefer not to corns down on the Labor Day overfilled trains* In all probability there will be no chitohai next wesk end* The office muddles along with requests from people who now know I'm not providing speakers any more but as I expected begging for "just the once" a great favor of help in time of need* This will continue for a very long
time even with repeaters, but X think it is very bad public relations for the Association not to do it and furthermore X can't bear not to store what X know * We seem pretty certain now not to do an after Election dinner for Eisenhower-
sort of a swan song of peace for him*

Friday night we saw Echo scooting across the eastern sky very close

to overhead* Glad to have seen it, but it looked only like a star in motion*

The Powers sentence was lighter than I had anticipated and some of the double

talk statements of his father on return to this country were odd* Neither those

remarks, which certainly had been "arranged" nor the snatches of th pilot's

testimony, which I read, have changed my initial suspicion that he could well

have been a double-agent* The Presidential campaign still revolts me and X

plug for "Vote a straight Massachusetts ticket"--Kennedy and Lodge* The Kip-

linger News Letter already reports that wild and horrible rumors are being

out each candidate, but sanctimoniously does not repeat them* Today I read

and article from the London Oblb ?er, which confirmed my worst fears about the

dangerous and extra-legal agme that Lumumba is playing* From my point of view

the Belgians failed utterly to train the Congolese to govern themselves, alio wed

their nationals to take huge sums from the province for years and then when the

five million dollar deficit reared it ugly head "graciously granted a quick

independence and threw in the deficit as a bonus"# There are two horrid, cynical

comments

which I should not stop* But I must unpack and it is already time

fcr bed* X brought in half a dozen late to matuie portulaoa plants to try in

doors* One of my now year old petunias still has quantities of bloom and the

plants vfoich I inadvertent ly rooted from it bloom handsomely for the people I

gave them to* May the portulacas see us through October anyway#

/? B ft//]

A,t CQo^j ' s"V ""

Wptsmber

, M f T/
MMM 10 1960

That was pretty stupid to write August and have to correct it, especially when Aunt Annie and I saw Christmas card displays in Jensen's window when die was here a month ago! X guesssd wrong last week when I feared the strike on the Pennsylvania RR would put horrid strain on New York Central's through train to the west* which I took Thursday a week ago for the Labor Lay weekend with Aunt Annie in Albany. After I bought a roomette to be sure of a seat I found practically no one in the coaches at approximately half the price! My solace was the Conductor's statement that people had stood in the train the night before# The humid heat of the week broke Thursday night and Friday when Aunt Annie drove me over the Tfetconic Trail to Williamstown we had sparkling clarity to bring out the range after range of mountains and were actually cold at the "top of the trail" when we stopped for the view# Williamstown is such a beautiful town* the Inn serves a delicious luncheon and the Clark Institute as great a joy as ever. There was a- special one-man show of Toulouse-Lautrec, which we dutifully examined without being greatly moved--somehow the tradegy of his life always impinges on my mind when I see his work. It was a perfect day topped byj Doctors Gurry and Jackson coming for desert and cards in the evening. Saturday morning we went to the renovated Albany Institute of History and Art where they have fascinating models and displays of the old Dutch Albany and a summer show of Experiments in Dimension from Williams College and a collection of the Albany Print Club, of which Aunt Annie is a memsbr. Hazel Curry had us fcr dinner in he r charming heme where the dining room walls are filled with an unusual collection of bells --an interesting hobby for a person deaf since the age of six. Sunday we had dinner at the "Captain's Table", a comparitively new retaurant,specializing is lobster but also serving "land food", with a magnificent view toward the mountains to the east and a flock of sheep in the im mediate foreground.

To avoid the holiday crcwd I 3e ft on the 10* 34 train and was home by quarter of three after luncheon at the Biltmore to stay me against probable traffic delays caused by the Labor Day parade* which want up Fifth Avenue to 63rd Street and east for dispersal* The bands made a raucous accompaniment to going through my mail, balancing the check book and paying the bills. About six I went over to leave some of the asters and zinnias from St. AgneQfi School with Aunt Mary, who had just returned from Mohonk,and was inveigled into staying for dinner. The windows had to be kept closed beaause of parad9 noise. Walking through 63rd from Park to Madison I dallied on the way home to see a few of the 174,000 marchers. They were gay and informal, grinning when they caught the eye of a watcher, footsore yet many carried children who had evidently insisted in joining the march. Most units carried slogans calling for better education, more job security, adequate pensions and medical care. A few bragged that their union provided the best pensions and fccked it up with buses filled with their retired.

Wednesday I blossomed with a cold, origin unknown but a dashed nuisance. Thursday and Friday I went late to the office andtried to 3e ave early and am getting along finely. Last nigii I watched an excellent NBC-TV presentation on the Congo, which did little to cheer me. The Overseas Press Club Builtein carried an excerpt from Newsweek dramatizing one phase of the problem* " Swaggering Congelese troops and police combed Lecpoldvill hotels and restaurants in search of "Belgian spies". Newsweek correspondent Russell Howe, cuaght at dinner with his identity card, folded his menu to identity-card size--so that his name appeared as 'Escargots de Eourgogne.' When the Congolese guard grumbled that it was unsigned, he wrote 'Julius Ceasar* and the guard went off satisfied."

Campaign stories circulate happily--What is the difference between the people of France and the U.S.A. ? The French know when they do not have a government. ... When Stevenson substituted for Nixon at the American Bar Ass'n he began "It reminds me of the vicar out in a remote corner of England. One Friday he wired his Bishop* *My wife just passed away. Please dispatch a substitute for the weekend.* *

to

'fu,

--/(

, P ' ^ *-< <L , At17"/

September 17, 1960

RR,ui+tfhc toinee*le*r-Bie^nn1e^tt^++ was o^nra!tih>ea Mdo0a2ueryetaannida Iduaemyneoswteridnavyolvanedd iIndaela"yseiddegeofinfegctto"* Freeport ^or the weekend to have dinner with her last night, BUT Donna must have

uLfclsV

J?*! ^ radloed me ^ would not do*k until Saturday morning*

a to get to tne Battery to procure/ a customs pass for the pier, I telegraphed

X nLoww TM aniftt^thVath8c1a?llhannd: r begin to " feafritatesdnafu. hItarr* emaianstotolubnechseewnithwhmene Itodgaeyt . to Long Island! Maria and Hank were warned to leave Oak Beach at midnight Sunday and spent three hours packing up their poseeeeione and driving to town in torrent^ of rain. As there had been heavy rain here most of Sunday, I feared the saturated soil o-d not hold tree roots when the hurricane hit on Monday. In fact over 2,000 tress did go down in the city and East Hampton lost all their lively old elms" iSost five inches of rain Monday (never did find out how much on Sunday)* Contrary to exoec-
? rinf 8 y* of.th storm did pass over New York, About one o'clock the wind ws

iinng* i&h L em TtoTthhee street.

After

mier con3trucftion
seeing ons miss a eab by

i*n*ohes

Ianhdadf'tihreetswAvitecnhubeo, abrdurl

,"!*r?e'rlrr !

.LfI*9t0

rer<"rtea M construction workers were merely

possessions without making any attempt to warn vehicles or the few'

filled'-th'rJoff'tt ^9opl9.in,th8 suburbs were without electricity and some oellare offiT e TM1! psroiscion was given those living out of town to leave the

of day at Sat*

the rain had stPPed <>> an unsettling kind

, , lovely

u ,

Bday

holiday in

ni^'t 1 had dim,er with Vera and Bill Bean and Portugal and Spain. They were blessed with an

ehxeacredptsioonmaeltlhyi^nfgootlf

their car-

shile motoring from one interesting beauty spot to another and enjoyed the Iberian Penin-

*\L tf be

giT!d fl6ht' but Biil *"* tallar Ca ~red him 2d f^nd hLT

fsrnienndds! iinn -the soirifa of Fradnioectarnyea"rdNisicier*etione was miserable all the time they were with

. ,, _

^han-emeiy-of-thc-people, Portell, hae been given a job at the U. of Florida

L !s"i-

aB up an InamutB f Caribbean Studies. X am delisted for

...... a.d relieved that he is returning to New York to speak to my Cff-the-Resord luncheon

on Ootober 5~a gentleman and a scholar. When he came to report all this he said he

believed that Castro would not last until Christmas. Curiously ofougj; I met a 2n just

,

*rcl

Conge the next day who had spent three hours with Lumumba. H e was

80(1 Ti60r' adEitt9d *'aB impossible to S hL int

m!r!lv

that he would not last. Then I questioned him on this point, he

r

, ^e "'19an P8Pl9 have ways to handle such situations." Within 48 hours of

Griffith s statement Col. Mobutu had taken over, ordered the Russians out and this morning

biook.

ZPM, P8rBistBnt TODr that Lumuba had been killed trying to run a# road One can only hope Lumpmba is permanently out of any position of leadership.

The office ie agog with the potentates due in New York and putting me thr oush

J" ""rcise of trying to get the "right? heads of state for some sort of funotion. rt

,!au!' f the shortness of time any of them will be here. At the

"U i

. J?,8 .

fun but know I'm on top of what can turn into a voloano

+n

T2r !w m!* M,anwllile I carry on making recommendations to people who

0 knowledge

Speakers Bureau is abolished. Yesterday's blow in that sector

+hf

??C9pb?d four ecgagemeirts, announced he had Just taken a job at

fI f e e la

"oral

Td mu ftrJyl2+t !+o! hh e il" p

t

h

o

e

8
e p

t
r

hr
ogr

" a

of
m c

h

th
a

*i r!

am*e

n

As
ge

t

^s

i
o

a
m

e

o

n

e

e" pl sr ee -. a bAolliiet la od ny

vbeucshini ee su sl "a r

una ie is prao,ioaj.ly at a standstill and will be worse next week shai the General

Assembly opens Tuesday and the curious will try to look at the international figures, the

be!ideSft^ow their illvlll against the dictators and the police will he

and sleepT2trVd.sk.

r* " "*7 b8 #lmpl9r t0 t8k 8 blank9t to 1319 m9

Hr&i, r-#c,

September 25, 1960

^h i>m

SS^^SSS^SsS^^

uawsss ??%&& s

ss&.

*MWS. ?ifS 2r,rW.na 1.1.. W M. to ... nnjttut Ml..

mS5l^iSj5wSr^^H2"jK

0we^re^tu^ rne^d 5fr^ om^serrSricM e S^ und?ayteMM oruninlg3tl*w jaik^ eShS ad,S <tidne^ IudeingaVloW vely S lavea n-

adn ard m tue lfirpemwipthlandatirnkgerthveeirqu; na g,, The iinn!front-of-the-hou3e planting^ie&cofimnidnggatalorntgto

beautifully and the dismal damp

last - ewjs y Btc$e d f of a short oall, all

the new or traneplante

JXaS^ we Sve hrd a lot of analyses of the wetest

in good form* noTT^single

Z the beginning -

the cooleflt in about 15 years*--

oveZo <$!"Yrtill oall it an unpleasant s^r, of which I am

glad to see the end*

rjtrr

-

>"" *',-- ^^tS/SSZTLZ^iS SS""

ed southward, traffic is subject to upset ai3 'See etcort^nd^*fcrtw. Th.

to sessions and calling on ono anotuer

P -

^ worst get into fights

demonstrators pro and anti make a great cL a

lie9 Tuesday afternoon 46th St.

With one another and hare to *9 99P^t9d ^I/Sv Xr"oaprir nations" sang &

was closed off and the emigre nl anianj pp h

^le 47th Street was similarly

made speeches over a public address system tor

J mixsd it up. The police set

s ays zsxzzss:

J^S-EK.

.erred good buffers in the pens between the violent ones. On ^*^4 befol,

mounted men rode their horse onto tie si

off in handouffe and through it

tahlelythaeltedriefdferthenetrochuatenttsoo4f 8tthheSptl.acard carrying marc,hers bbeelllloowweedd uUpP aannda mmaaade honest

work hard. Frederick Boland's handling of the General Assembly is lirlng Wto my

anticipation. We hare cut into the TOs closed

^ ^ Eisenhower's speech

ground floor auditorium from time ^ time to looked Ueten. ^^^

#

was etateBmanlikSjerenifhedidsay a

^ K,, on ^ other hand made a poor

good speech even if tending toward whe USS j -*pn+iv expressed vote of confidence

speech and I beliere was rtupidin ipioringteerac^ > P

charter to re-

tc Hemaarekjeld as well as

. Pefeolally 1 think he did

place the Secretary General with a Committee ox TMf9*

wat9r -through his

himself more harm than good--though he may hare sc., "

join yera for

three referrence, to how good that Russia "*2 mount Nei weekend I

lunch at the Westbury to discuss my office prohlMis, wniw mo

u ti

hope to go to Stony Brook if the pot does not bill over with a Big

g.

^ '

JW Tii^ j it. / /It

t C~cl

<

* fiVM-v^ /W 7 October 2, 1960 ,

It is nice to be with the family at Stony Brook, where despite

Aire predictions for rain it cleared late Friday and the moon was love

ly when I a rrived two trains after I had hoped--man called from Chicago

wanting more than the very comprehensive material Mailed him a week ago,

I ended up sending him among other things a long quotation from a letter

written us by his own predecessor. Yesterday was superb--chill, dry

and with a cloudless bright blue sky. Dogwood leaves are red, sassa-

yellow as a re a few of the black oaks. It is at least a week too early

for dramatic

color* Everyone is well and very involved in th eLr

individual round of activities. Jay with his trucks, Fred with foota

ball and Bill with ma rionettes. He and a friend have takenover hie

so called guest house and built an auditorium with two stages and the

most elabora te backstage lighting, costume and prop storage space. He

and Frankie ma de $60 with a whole series of performances at the Church

fair a few weeks ago. Now they are booked to do a showing for the pi

patients at a hospital in Port Jefferson, Frankie is away this week

end, so Bill has just done some demonstrations for me as it

takes

two to do a pla y/ Special performances have been requested by nei

ghbors and teachers--so they ha ve also constructed a portable stage.

Today I have grubbed up petunia seedings totake back for what I trust

will be la te Februa ry blooming in the house and office.

Thes best thing that happened this week was the depa rture of Castro--a least there is one less controversial character about re quiring vast police protection. The extension of the lease (rent $84 a day) for the Russian ship "Baltica" is not such happy news, Vfc must use more tha n that amount of ga soline in giving the old boy police protection as he moves from point to point I I saw Macmillan* s masterly speech at the UN in pa rt and was lucky enough to catch the illbred and for the UN unprecedented interruption by Khrushchev. He certainly did himself a lot more damage by that display. A French boy who dies displays and posters in the office in speaking of the Prime Minister's speech said "Such elegancet" The way the general de bate goes on and on, one wonders when they will ever come down to business and condsider the ninety odd itmes on the agenda supposed to be acted upon at this 15th General Assembly, They usually^finish so people can get home for Christma s but I suspeetthey will carry on most of the winter* With Nigeria obta ining nationhood yesterday they will be knocking at the door for admission, too.
Dinner Wednesday night with Maria and Hank--shell steaks coofe ed on the charcoal grill on the terrace, but eaten in the dining room, ohe fcas already finished two of the commissions resulting from the exhibition and two more practically completed a re still in the studio, Tha t very day a woman had been in to ma ke arrangements about the painting of herself and her husband in hunting clothes against a bade ground of woods on their Carolina estate--photographs in color of tire latter to be provided, Plank is enjoying his World's Fair job and calls me with the oddest questions--"Which countries are in the Near East end which in the Middle East", Ma rtha and CIeve leave Wednesday night by Pan American jet for Germany, via London, where they dally for 48"hours. They have been to Idlewild to observe the prooeedure of flight takeoff and da Hied to watch the arrival of the Lufthansa flight they will return on and were able to watch the customs inspection, A very good idea, I think, as neither have even flown the ocean*

#"ss

7V-C/ Tv+iyn,

mr/,

October 9, 1960

We feel losely at the office with the bulk of the building1a police pro tection withdrawn with the heavy departure during the week of the Heads of State from New York* There have been a great many individual and collective statements of thanks and approval for iheir handling of a difficult situation# Senator Mike Mansfield of Montana has proposed that President Eisenhower's special fund pick up ai^4 overtime bill of three million dollars to avoid giving time off and leaving the citizenry further lacking the normal patrols* At least, there was no attempt on the life of any visitor# Enough of the imporatant remain for howling sirens to disturb the peace at all hours of the day and night all over tew n# Wednesday I was challenged as I turned into 64th Street on my way home from work but permitted to proceed when I gave my address* "Mr* K" was attending Nehru's party up the street at the Indian's delegation headquarters and it was fun to see how the police handled the departures* Meanidiile motorcycle outriders jarle d on the sidewalk across fkem ms and the waitress at 22 held court at the kitchen door so effectively -that some men had to make quite a sprint to get their places in line when their charges left*

# .Time out for a long talk with Vera Dean about the office and "the world and over to Aunt Mary for dinner# She had been to church and although she complained of failing memory seemed about the same# Poor dear, she is so much alone, it is crim inal of me not to see her more often# Earleir in the week I went into that building to a political party given by Mrs# Edward Murrow# No, Ed did not appear, but I have always liked her. Chatted with a man who writes books on the art of selling , and has meanwhile sent me one of them# There he was handing out business cards and pre sented me with one reading on the reverse side "V/hat are you going to do for xerciss when you stop jumping at conclusions?"

The office is in a great tail spin because the Atlanta American Legion Post las issued a book attacking Hie F.P.A* as a subversive organization# This presumably is part of their ammunition to get the resolution of condemnation through the Legion Convoi tion in Miami next week as they have already done at the Georgia and Washington stats conventions# The more conservative and isolationists elements^in the Legion have never liked us and never will, but there is real money behind this attack and we should like to know whose it is# I have not seen the book, but understand it is un scrupulous and vicious and very well done from their point of view if you believe in lifting things out of context# Meanwhile the first Off The Record luncheon series cam off on Wednesday with 265 wonen there --fire laws permit 2C0 in the room, but we squeezed in a lot more and some had to listen on the public address system# Ihsy loved my Cuban Portell, who told ihem that Castro would be out by Christmas. We had a committee meeting afterward end tried to take steps to avoid auaii a large crowd but at the same tine agreed to buy more plates and cups, so I won't have to go to the kit chen to dry while one of the waitresses washed and the rest of them tended the two buffet tables# It is hoped that after the other series opens on the 25Hi,. we can keep within reasonable audience limits or I'll have to dream up less attractive speaks re and topics, which are not so timely#

Nehru seems to have a whirl in New York, visited botn the Metropolitan and ibw Guggenheim Museumf, went to the World Series game yesterday and the P^y about the presidatial candidates "The Best Man", participated in UN debates and went to lots . of $ ecial pr ivate Conferences and delegation parties# He asked Vera to call and gave her 40 minutes during which he talked of all manner of things including his great interest in Mongolia and how Indians travelled "there 2,000years ago and returned with most fascinating reports about the place# He looked and acted better than she la d seen him ever, relaxed, gay and perhaps even a bit flirtatious--in view of all 'Ue o~d gossip one might have expected him still to be mourning Lady Mountbatten4s death# # i e "Great TV Debates" disappoint me, while the second was betted than the farst, thsy are not debates and too scattered in subject matter to be useful* If there is not some external factor between now & Nov# 8, I think Kennedy has a sLighi edge in a close count#



'

October 10, 1960 E t't J, g t I N 7 R 0 1 3 L O N D O N

n Vf* 0V9r KngliBh airaa11 twp. I WB able to give wieirs a se. addressed stamped envelope and so tonight had word from themi

- ^

Picked UP Frn <5al and the &ide and 1B ft Freeport at

li1^

^0r weTlt wel1 *t Howard Johnson's so we were at the airport -it (G iifn,#rrnonu<ss 4ti-im m<iSnvsi~ for 8o>. 30 fl- i.g,ht, .)\ .S.i.x.ty pounds of rluggag#

3 on

and 1 plv*d u? th' st assignments. We wore in the

8 ' ,. :'fv

jCcmomy seats right over the wing. That made it a very

flight and much quieter than in the tail. We left or. time and the

pilot salt we should be in London in six hours and 19 minutes. faybo ire

-o oAver London, but we did not get down due to #og. After circling

* tH ?llot Mld London wae foggy and if it did not open soon we

-B.E

C3 '1C^ . Ie finally lrnded in London at 8,40. (Lucky as Prestwiok

Mt L tl ? a"d t,le g?od dy *in would surely have left by the time they

lotirrflv ) *-v fM0r\T e*Perience 'rom London to Glasgow was ail overnight sleen/er tZTZ'l $ finally landed in London at 8,40, cleared oust cms quickly and

. ' " lC about ten. The room was not ready, so we had breakfaat

thev avnidihinp?

th! Si* toward tbe back*

< 1 had suggested that

W buse-s

w~hmic1h

rumble

in

Vy 31

the

dose proximity

hotel aocount of to each other along

tthheat hseatrveyedt.o)uble

decker

Z I is troinc .prT A ***

i0 gC Ut and 866 W>B 1 we *n line UP Everything

seen: fl.ift ;for t.hf edd_awye .!"hould hve n fine time.

,' both slept pretty well *nd

1 SS, V \

H H

*********

+

'^U6t Fe'id this t0 Fran 311(1 foun<* that everything goes well with

;I;+.r!ali^,Mn

* ?tatQ

Krsnt to study Russian for throe

!f8

He will get 16 academic credits and be able to teach

"lu"f "JJ1

by

to summer schools His school is thrilled to be

a ; V Ver ! C0Ur8e He *> to class, about 20 minute.; away on Tuesdays

and Thursdays from 7i30 to 9i45, Golly, the thought of such a language in

alphabwetandA

s1cTrTip1t

to

C0K3onants arld
bo learned!

f9w vowile,

to say

nothing of

the new

. -a

Tn *88

d5d not kno* they leave Frankfort on Saturday, October 22nd

Pan tosTcanVel

mS

^

* Idl9"ild at 3(40 * 3a'~

... wasy ^" ~ n. dated iXiVXtoW t

* **" C1"8'3 le"ar

had Saturday and susnaet 4+ wt iPoatmuksd 9,45 p.m., even so 1 should have

-f U v w ,

\< / i , , V v ^ / fo+T,
October 16, 1960

Although Indian summer invariably occurs with the World Series, we have had much more of it this year# 85 o/o reported at Newark airport yesterday along with snow in Denver# With the welcome departure oij Krushchev by plane on Thursday night the city is much quieter# I do not think I have heard a single police siren and know there was not even one policeman between the 47th Street bus stop and the office door on Friday morning instead of the usual approximately 50# Perhaps over the weekend they will gather up the hundreds of grey barricades, the half dozen in 64th Street have disappeared# The last demonstration on 47th Street was on Columbus Day by anti-Castro-t itee# It all gives hops that we can settle down* By merest chance I got a ticket for the General Aasemby public gallery on Thursday and spent an hour there just before the one ofeleok luncheon break# President of the Assembly Boland, always a florid man, shocked me by his boiled lobster complexion* He has always enjoyed his food and drink and one can only hope he will get through this year-long job without having a stroke* I enjoyed a rehash on the "right to reply" provision of the fireworks of the day before between Senator Lorenzo Sumulong of the Philippines and Khrushchev* When the former said "When 1 agree with him he calls me1 not a bad man* "(at which K# bent over his desk in laughter and poked the member of the Spainiah delegation seated just in front of him nodding his head vigorously) " but when I disagree he calls me a stooge* or a *jerk* or something in the language of the gutter with which the translators have great diffi culty*" le went on asking the insulting words of K* be expugned from the record# Next K* spoke for a mere 12 minutes, after a merry "In my country we have a saying *each vegetable has its season** Maybe in time the distinguished delegate from the Philippines will mature and have his season#" Then he got down to reason he had the floor to urge that item 80 dealing with US aggression of Russian soil ( U-2) be dealt with in Assembly and not in Committee* In this he pointed out that happily there had never been a war between the US*A* and Russia, although while they were busy throwing out the cruelly grasping landlords we had sent troops into Russia# Wadsworth followed for 11 minutes to urge the item should be assigned to Coirmdttee and not open Assembly debate and made the stupid mistake of saying that K# was In error, that we had never had soldiers in Russia# Even I remember reading in Borne book that we had an Expeditionary Foroe in Asiatic Russia under General William Graves after the Russian revolution# My feeling was that this Foroe was rather a mess because of the fluid state of the revolution and our chief object was to keep the Japanese from getting a foothold on the mainland# I was doublj humiliated by the Wadsworth goof, when I leared from a friend that K# had gone into a correction on the eame point on Sunday nigfct on his greatly criticised TV interview on "Open End"* As far as I know K* did not correct Wadsworth during his third sppech of the day during the afternoon session* But suspect it will be used againBt us where it will do the most harm as Wadsworth "ignorance" or "deliberate lie"

Rred*s right arm was broken in the StonySrook-Friends game at Locust Valley on Monday afternoon# It was set in the Hospital on Tuesday midday, where he spent that ni$ii and got back to classes for Wednesday afternoon* He is sad to be out of football for the rest of the season# Poor Molly will havs to drive him back and forth to school as obviously he cannot use his motor cycle# After the office Thursday I stopped to leave a pot of Moses-in-the-Cradle with Aunt Mary and had to accept a beautiful double purple African violet in exchange. The Moses came from the office, but the violet will remain here#

Friday I had lunch with a man from the Chinese Embassy, whom I feye known for years#I fesred he would want to commit me to doing a big meeting for Chiang KSai Shek as and if his rumored trip to the U,S# comes off# Not at all, he presented me with a fine propositi to hire him to conduct a special project with the representatives of the newly created Afro-Asian countries# I declined, told him of a foundation I thought might be interested and another job for which I thought him suited# It makes one wonder if he/ sees an early recognition of Red China and a dimunition of U#S financial support of Nationalist China with resulting curtailment of Embassy personnel in Washington* All very interesting speculation* Eisenhower*s best birthday telegram "Congratulations on now being In the low 70*sM from one of his golfing companions*

, v }M rJ >-

'V

October 19, 1960

W 4 '

'

/:

Ralph Bunche was in the Congo as the UN's representative at the Independence Day celebration, July 1, 1960. Over the years, as a colonial power, the Belgians had made no preparation for independence by training any African to be more than a truck driver. Unfortunately the population felt that life was going to be beau tiful and complete in every respect immediately they were granted their independence. However, in the Congo no normal standards apply. The country is filled with in trigue and external pressures. After independence there was enormous unemployment and a mutinous army. Neither those in the central government nor in the provincial governments had any knowledge of how to even organize an office. Only two members of the Cabinet had been to a university. The Cabinet included a Minister of the Middle Classes. The Belgians had firmly established a society of total separation of whites and blacks, and at six o'clock every black retired to his own quarter. In the entire Conge there are only 16 university graduates.

Presumedly to solidify his position with the army, Lumumba immediately promoted everybody in the army one grade, leaving no one under the rank o Lance Corporal, He also Increased the pay although there was no cash to cover the ex penditure, The national army, numbering 25,609, had been trained by the Belgians to brutality and all kinds of oppression. With the Belgian officers' departure, the junior noncommissioned officers were rapidly promoted and are incapable of maintaining discipline (In view of their training it is extraordinary that they have not killed more people). However, the people fear them and this fear coupled with turmoil and confusion rapidly spread to the various provinces, carrying terror generally throughout the entire Congo, excep' in Katanga where the Belgians stayed and conditions have remained more stable.

The first UK ferces began to arrive on July 16, thanks to the USAF. They came into Leopoldville and in most cases In two hours were off again to trouble spots with little or no briefing. Great credit and thanks due the USAF for the airlift and the troops of many nations comprising tho UN force. There are now 19,000 troops deployed all over the country. Their aim is to keep people on the job, maintain central services without force, explain the UN to people who had not even heard of the nation of Congo. At all costs they mist avoid any semblance of "takeover" nor must they become a takeover government. The Belgians had en couraged tribalism and tribal conflict therefore remains. Tribes are influencing provincial governmentyand the tendency is to snuff out the other tribe. There are now three and sometimes four 'competing governments" operating in an atmosphere of childish impatiente and fear.

The establishment of law and order is s difficult task. The population, deserted by the colonial power which had developed a highly materialistic Western soelety, is foorful, Lacks in oonfidencs, and is of extraordinsry volatility. Politicians and population alike flare up, create sceues or riots, quickly forget what they wore angry about, and turn to wanting something else. The UN techni cians have learned that it is fairly easy to deflect the aim of this sort of demonstration. Ludicrous situations exist 19 hours out of every 2*1, and can only be explained by the practices of the colonial power which lacked any sense of humour or human understanding. The situation is further compounded by a growing virulent black racism; for example, Bunehe was accused of being a Swede.

v . 1 . ; - t

)-

. -

The Ruaaianamade a bad blunder when they tried to subvert the people of the

Congo. Total anarchy cannot be subverted and Russian attempts to influence were

foiled. They actually were glad to leave after two months, and left in considerabl'

disaraay. Kasavubu and Lumumba are holed up. The Cabinet have probably never net but occasionally issue edicts. Uobutu is not the strong nan. It is probable that Lumumba put the Belgians up to dividing the Congo. Having made no preparation for training, they panicked and gave independence in five sonthe. Kasavubu is sore responsible than anyone else for independence. He pulled off a coup d'etat and went to bed for 24 hours, which Gallo Plaza called "unprofsssional methods" At the time of independence there were 40b doctors in the Congo. All but 18 or 20 left at the time of the takeover, and 10 of those departed inside a month. Screams from an operating theatre el a hospital were heard. It was discovered that two orderlies who had appointed themselves director and deputy director ol the hospi tal were satisfying a long-desired opportunity to perform an operation. They were found waving scalpels over the victim and arguing about where to make the first Incision.

Eighty So elghty-xive percent, of the whites remained in Katanga province because 200 Belgian army officers stayed in the gendariaerie as a result of being offered very big incentives.

What of the future? The UN must not take over despite the fact that Congolese

politicians are tiring. An untidy rapprochement can be effective. Disorder will

continue endlessly. Lumumba is not a stablo man but he is strong in the country

and has the largest and best reputation externally. Government expenditures have

diminished and productivity has not entirely ceased. It is possible that Ghana

and Guinea have supported the Russian attack on the UN because Nkrumah is an old

buddy of Lumumba's and there is doubtless a plan for a federation between Ghana,

Guinea and the Congo. jta-av

.. *

...

"f >, t ' fJ C;

L V,

> T^C



'

'

'

,f '/'\fu+'/y' fcVJ

October 2R, 196

Wednesday was Africa Dv Lunched at th Overseas Press Club with Santford Griffith* a^o will speak mid-December at the OTR and we had to sort cut what of his month# observation of tension areas*-- Algeria* Freeh Guinea & Ivory Co-st* Congo, Southern Rhodesia and the Union of South Africa* An sudienc cannot be exoeet8d to take in so manv different basic problems In a* widely scattered a *eogrt>hical range* I dnvnrour greets us hen we sierrad out into 39th Street* a taxi unprocurable e~ we finallv hopred a bus* At five o'clock I heard m men just back from ten weeks in the Congo with the UN -- n Welchman with a delightful, sense of humour* He woo dee^ iv shocked at the colonialism of the Belgians and their granting independence with five months notice to a population trained for nothing more technical than bus driving* Hie native armv created bv the Belgians was trained in brutality and oppression and when the Belgian officers left, everywhere except *atanga where large incentives were given t*8w to remain* the junior non-commissioned officers were incapable of maintiaing dis cipline. The great winder is that more po%le have not been killed* The oeoole ara hiphlv volatile* as are the politicians* disillusioned as thcv had thoutfrfc the coming of independence on Julv 1 would usher in a psivn of bliss with "everything fine, instead tribal intrivua* external oreesure* enormous unawol ovment and the mutinous array lead to lack o^ confidence* f*ar end finally terror which uickly spread back into all the provinces. The growing virulent black realfE contributed to the departure in considerable disarrs/v of the Russians* who had tried to subvert the people and found that total anarohv cannot be subverted. I had wondered if the comparatively light pigmentaticm af Ralph Bunch* whom the UN had sent as its representative to the independence celebration ad was caught there by the terror, w^uld make the Congolese mistrust him. The*' did to the extent of calling him a Swede. Lumumba advanced every
iSi42.S"^rTe?52s,rie^^2?gtigte?ogeSf ft8ae eueae it is Colonel) Motubu is not the strong man. In fact all of the politlcAers a"e tiring. During ihe last days this UN administrator wee there Mobutu with four of hie eight children moved into his hotl room ard at regular intervals had to be fed bullion aod trsn^uill sera* complaining that he was ohlv getting five koure el eep night--at that point the UN administrator had averaged two hours for ten days.

Yasterdav I had a wonderful time -- cannibalising two chairs to make one. The next weekend I'm home the seat* arms and bock must be paintsd or stained to match the base and legs of a wahognv chair* the unreliable back 0** which had been out off verrs ago to leave a fine telephone seat. Martha ard Clave got In bv non-stop jet from . Frankfurt at six last nieht end spent the night at Fran's because their house was cold and the electricity had been cut off. At the last moment they switched from the flight due at 8j40 p.m. Thev had a wonderful time* found their granddaughter a beautiful rink and white, sweet tempered bab^y* her parents well* happv and busv* I hop to hear some of the details on the telephone tonight.

Fred's broken arm is coming along and has excised him from the school rule of -- wearing a jacket. To provide him with variety of slinks I had already sent him a gob's black eilk neckerchief and a red fine meshed length of Maine fish net. Yesterday in searching through a glory hole for something else I hit Day dirt--rale orange needing only to be hemmed for a sling* chint* for a sofa cushion cover and some daintily flow ered material* *fcieh made a fine cover for my wed** shaped back rest used every night while I read in bed* T sling and baok rest slip cover wore made last night sfcile TV provided the usual Saturday night rvaterv melodramas.

Nehru's ranting s+ateaont that the USA ard USSR a*** the two counties In the world most alike has interested me very much. On can agree that both are large areas* with big populations, hic^lv industrialized* etc. I recommend this notion as a good area of contemplation. In thinking about us I am reminded of aome stra.nee end I trust not symtpmatle of our olylIIcation-- green stamps given to people attending ohurch service fow example. Speaking of trading sta.r%.~e. smell smaHb steel company effer.3 stamps with Purchases at the standard rrle . One of their customers Is ''savings stamps" to acquire a desired, piece of machinery hitherto within their budget.

. T*4 c,

October 29, I960

Fro* aa office memorandum I bare just written on Molly* s machine you should hare an easier time reading this StonyBrook written hit chat than those of he past# The automatic space after the letter "a" seems to hare disappeared. Hurrah.

There wgs a light rain a s we came from the station last night

but as we sat in front of the open fire the wind and rain increased in

intensity and we had what might well he called a rough night/ Most o f

today has been lovely and while the color has passed its prime, mafies

are either flaming red or bright gold, oaks range from a vivid red/

to dingy brown and some still green. On the whole the dogwood of

which the woods about here are as full as of mountain laurel is still

Beautiful spaoftso*fJch0oTl*or. Molhlyavheasnostohmaedufnruossutalancdlecahrrlyesmaonnthyeemlulmsoware

rm --charming.

Fred

aurleA
has graduated

intSouma, ltihgeyhtgerrowoasitn

aeynldinndoraldoxawlser

great a wew?iagfhjt..a Bill and I ha"tvhee sdheocuilddeedritmusicslemsorfercohmeecrafrurlyintgo troeofer t willow trees as SWEEPING instead of weeping.

On Wednesday we opened the second series of the Off the Record

luncheons with Louis Fiseher talking about Russian foreign Policy. He

attracted a few more than the other opening meeting, but we managed

with less stress and strain on the staff. If we keep on growing, we

may have to offer three series next season--twenty four speakers to iHmd

tihnsetagercoluopfs,sialxrteeaednyf

yet maintain the "equal jealous of the speakers

but the

separate" treatment of "other" series h| ave

NATO in all its majes ty has gotten around 18 months afterward to send

us an award for the job that lead to my shingles. It is yet to be de

livered, so I cannot give any details.

Lately so many people have told me that they were voting for Kennedy without enthusiasm, but feel tha t he would do a better lob than Nixon. This household of course is for the latter. I understand that when David Dubinsky was about to intcrduoed Kennedy at a garment district ra lly on Thursday, first touched Kennedy*s am and whispered something in the candidates ear -- it is said his comment was "Lovely material" Yesterday I renewed my battle with the Mew York State Tax Bureau--they had disallowed one of my deductions and assesed an extra $43.43. I paid it under protest and have now filed a further complaint on their stupid form. I shall be surprised if they make a refund.
James Reston took a column in the NY TIMES on Friday to tell about the Aneriean people and the bafflement of the experts* His approach is somewha t different than mine would have been. But I oa n see how they are baffled, beeause the people ba ffled and uncer tain themselves. Our capaoity for self deception grows with the adver* oontinued program of deliberate fooling the population. I hear that discontent is growing across the oountry with the attempts to sell shoddy goods and the urging to "throw it away and get a new one". Per craftmanship contributes to the poor goods and I continually see and bear in the office the tendancy to refuse to try to repair anything that has been damaged by wear--or carelessness. It all goes against my grain. I cm almost afraid to read Vance Packard*s book on Waste, being quite certain that it will tell of even greater horrors than those I know about. Well, that is off my chest %

2.7<e,

wj|a,

A beautiful autumn day on which Yale trounced Princeton in a very 8xciting gaffe during which the radio commentators caffe very close to drawing the analogy of ffoat could

mult hare bfan ^loua game to attend as 62,000 did with tha Yale e.de ^ng hand-
"Iti!777X^^*7% SiMWSrt'Sf"itfSACS -t iSto the o f t r a l P a r k" a n d h i t t h e a r t i l c i a l w a f t ? n g l o T Z Z S o
SUH^SZ M S .Sd'for 10, and^pereent^ were

Z L"fb^eaBgotodieifonthrago and sea li. being fed, always an amusing show.

Last weekend I went to Martha and OTeve

to'sunrise Highway to see Kennedy

afternoon drizzle we took tran and -w _-^ -^0udid not dQlay long enough and after about

pass. Although we counted on his being la_ j

weeks ag0 at least to me, initiated

half an hour gave up. Tonmy vrho

how he went there and got books and liked to

a conversation do so. In the

as we passed the xi^J^ * evening I saw the pictures

, taken

i in

LLoonnodoonn

^d *u

Germany and heard all about htseaing, it is so nice

old enough to be his father about their "ari^l and o.^ ^

He haB ,,ked for an

T^rfSGe*rwor^n.iniS he ^cording

more UkS to consult

at the 11/ clock

On Sunday the rector and cura-e Bade ^

,,hars very interesting as I had revei

Si^i wf attend on first Sundays, *n+5;9^ ^""tuj eiplainations. In the artei-noon

leaves, I have aireau>

would be amusing.

?^jgsz ; ** -trStSir ~w a ir.sail one with variegated _ea

-

u +h. dentist told me Tuesday he would like TM

Kriday, 1 went to the office

'

jilmot for early

sits

ssirs*-['

/l\d evee at 719 C declared Kennedy the ^iotor. ave y

lKncheon. I so much

5

a

[r.y!LT.
a drink a

-

%&3F -

a

* ----

"

T

Vy^^aHSgf3nr

Fanrv thought this should oe formal

J ar+hrinax helped the toe,

%^PcUve pfr^n'asTefn us^S and 1 expect can ^Y^ol^kertooker Club

Iwore my garden shoee - t o r l y t o the ^ l a S t i e d to the bar, where I was

for dinner. Because it was ladies night Buth an

the Feeler-Bennetts took me

ToSh* 7 + 0 s e e t w o w e l l p o l i s h e d b r a s s s p i t o o n s . A " 6 TM TM t

of the century attempt

UHshinkable Molly B~a ^ucoue musioal * in the demanding role of Molly

to break into Denver society, ^.^^f^ iines,
Robert Morris has written some deliciouel.

|

~Uv /wr, c*W<,,\

November 19, 1960

Yesterday brought my first Christmas geeting of the year--true it was a
letter frpm Martha and John deVftlde reporting that his tour of duty with the World Bank in Karachi had been completed and they were starting home slowly and would like to find news of me when they reach Virginia in late January. Neverthe less it spurred me to check in the cards I received almost a year ago and pledge myself to start writing the "faraway" cards tomorrow. A quiet weetend wqs planned as yesterday afternoon one dentist extracted the two loose center lower teeth and another popped in the replacements. There was no violent rash about the job, but
as I had to have some lower jaw work done, it seemed a good idea to get it all cleared up at once and not risk one of those loose teeth acting up ushen I was up to ears in work --or perhaps even worse when on holiday I There will be a couple of more trips "over town" for adjustment, but thsn I should be in the clear. So I have written Aunt Annie I'll arrive in Albany on Wednesday evening and leave on Sunday morning.

The "Queen Elizabeth" was late in docking Wednesday giving the crew about 12 hours to clean up after the inbound passengers before the departees started to come aboard--though on them, but nice for the Wheeler-Bennetts, who suddenly found themselves with several more hours in New York. Ruth lunched with me at the Cos
Oluband begged me to do something about her hostess Lady Dean, whose husband is the new Permanent Representative of the United Kingdom to the UN and is somewim t at loose ends in the process of settling into New York and missing her two sons left
at school in England. Wednesday Vera Dean as a distinguished alumna of Radcliffe made the dedication speech for a new Graduate Hall and revealed that after coming as a rufuge from the Bolsheviks she decided that she must have the university educa tion denied her in Petrograd. She had been working in Boston and felt she must go to college accessible by subway--hence Radcliffe. Now the College has undertaken a
new Institute for Independei Study (soon to be announced) and invited Vera to be a member of its small executive council# I am delighted fT her as my preview of the Institute sounds very exciting and a possible spearhead for ether colleges to follow in encouraging women to take graduate work and enable them to have useful careers
even though interupted by raising a family.

The Eisenhower Economy announcement discontinuing off-shore buying and the

return of armed forces dependents to the US fills me with disgust and horror.

Disgust that he waits until after Election to make it and mindful of the slow

motion of carrying out such an involved *dict must know that nothing can be

achieved while h* is et^ll President* It seems to daddle the incoming adminis

tration with carrving out his notion# Horror becuase the commandants of the over

soao rost; knew only what they read in the Toners and could not hel" the shattered

morale of their man end the families AND viien we are in a triokv relationship with

our NATO allies we thea,tn to cease t*ie osrefullv built uo off shore purchases

hitherto made from the**. Reactions from

to Ankara will damage us in all

th# intermediate stcfo These supplies and materials imported from the USA will

cost the American tax paver more. Martha, had just told me that Delii bought eggs

from Holland, milk from Denmark, lemons from Portugal to mention a few, Phooev on

Eisenhowr5 who car+ainlv has not helped Dillon's mission with Adenauer t

With Kasavubu. fighting for recognition in the UN General Assemblv this story mav be appropriate if you hve not vet heard i+. I have been meaning to te1"' it for ;/eeks-- pon arrival in the Congo the captain of a spa ce ship from Mars' asked the first Congolese he found to be taken to the leader and was asked "Do you mean Kasa vubu or Lumumba?" Whereupon the Martian repliedHI said 'Take me to your leader' , we can dance later ." Hie departure of the "George Washington" nucelar powered submarine is especially interesting to me as I have been reading "Surface at the Pole" the report of the under ice expedition of the U5S Skate, byj Commander James Calvert, also because this sounds very much like the floating battery that George
Fielding Eliot recommended to me at a cocktail party a couple of years ago and which I took a dim view of. And now the British have an anti radar instrument X

Ay ,,

' " r

' e~*yr*

'/[A <z- pjj-

,; a

December 3, 1960

Thanksgiving with Aunt Annie was wondsrful ev8n if it meant no letters done last weekend nor any Christmas cards addressed* However, Aunt Annie devoted herself to me from Wednesday night until I left on Sunday morning and we had a fine time seeing her friends, entertaining and being entertained and driving in the country. The idyllic Indian summer cast an almost springlike atmosphere, the Mohawk Eiver was without a ripple and threw back lovely reflections* Not remembering ever having been to Ballston Spa, I i^enoha^jith the late General Grant highly decorated architectual style, which must delight the local painters and confound the householders when "painting the house" is m order* Hard winters play hob with the sidewalks of Albany and I always watch my step with special cars, but witnout any provocation fell on State Street Thursday afternoon and still have five scars on my right instep and leg to prove it* The most indicative cf fch season was a call from a second cousin, who had driven down from Syracuse with tor mother and daughter for dinner with her husband's brother, to Aunt Annie. They had not seen one another for fifteen years 30 we drove out to call, I looked in vain for family resemblance betwwen Aunt Annie and her mother's cousin. Admiring the hostesses African violets, I am now the possessor of two wee new plants she had just propagated. On the back to Albany we passed a great field of flowering pansies, bands of yellow and purpl9 waiting - or the winter cover to protect them for the spring market* I bought two new dresses one nylon and one cotton in lovely shades of blue and green, both "more appro priate Jor spring than the wintry winds which struck us two days or &b later!

Anne Wolfe invited me to the first of the Chamber Music concerts for the Kraeuter uusical J* 0 untaxion --a group of people interested to keeping that type of music alive, an intimate gathering end a pleasant program of Beethoven, Boccherini, Bartok and Dvorak wy violin, cello and piano* This afternoon I heard part of Verdi's "Nabucoo" from the Metropolitan--*to me a new opera andintrigued me enough to want to attend a performance*

The office has been made merry with switches on the part of NBC of the moderator of

our Waldorf January 10 luncheon* About four on Thursday Art called me to ask if the press

run had been made on our announcements carrying Chet Huntley as moderator. He is roing

prima donna on us and not wanting to do it. The general printed announcements were

being printed as were the reservation cards and 2,000 individually typed letters to

corporations usggesting tables--all carrying his name. Since pidnters stop at four, there

was nothing to do especially as Art said it was not settled and must not leak out. At

eigrrt that night he called me at home with the news that Huntley would toave for Smin on

J?ni?ry

aS 1 had suSgsted in the afternoon he had gotten Brinkley instead. I

Pj V how to cope with the situation and drafted an informational memo to the staff#

whicn was mimeographed and circulated Friday morning. At noon Art called to see how I

had made out and was glad to hear that everything was underoontrol* He called again at

4 our and said that Brinkley would leave this weekend for Hong Kong, which would delay Huntiey s departure by a week and we would have him after all* Remind me never to work

at K&tioaal Broadcasting Company! I'm still uneasy about packing the Waldorf ballroom

now tnat we have raised the cover charge to $10. There should be an inkling in another

ten da}s. Thursday l engaged a temporary clerk to handle the reservations, mail the

tickets and prepare the seating list. If die works out it could be that we could use her

or e next big Event and save a lot of time and energy in breaking in new help all the

aV t tlhLe

OJ?fA1!u*he

RD ecord

lfa1d!^ie3s68lumn8caheonsD0wS6piatree

best 9fforts t0
now about 70 over

t^ he

Fdoiwren

Dtheepaartttmeenndtanccae-

another room. mI ecaenrstaainlolyt hoafvepeaopbleulwl iblyl hthaevetatoil*listen on the public address system in

Yesterday a Turk I have known for many years came in to tell me that he had left his

government job here the day before. Having a married daughter here and another in college

f I? i-0v,n w0 g0

specially as passports to leave Turkey are now only being given

"Otiose wno are certified by Turkish doctors to have a disease which cannot be treated in

a Turkish hospital# It rather looks as if the intellectuals who had greeted the Army

ouster of the Menderes government are rapidly becoming disillusion with what they now

o t^ave killed L- e illegitimfao?te13c,hofildtheomf sMelevnedsariens--tha esiortrpyrowseicdueltyioncaorrfietdheindoocuortrparellsesg*'ed

.'& A .. f' . iVi : L.* .'i
't M%

v m

:;"r'i .. x

<&&*-#'' :4;--

5

... ,

* ,' % y-V;

;- \ fy 'S***.*- v-.*

i

p.-- f

j.

' * .V'5"-

y
h

-.

'


v

A
*

VV
' A'.:

,
;

;

NORTH ATLANTIC TREATY ORGANIZATION

'

-i

' --V"f''

; ..

' ". is.;,'

;. "

In recognition of the exceptional efforts and contribution to the success of the Tenth Anniversary of the North Atlantic Treaty Organization
m?y.

m

*V -'v

t'y. 'r-

y

**v?

1II -
.'-" > fc~

pg
-

on the part of The Foreign Policy Assn
The Secretary General of the North Atlantic Treaty Organization and the Chairman of the North Atlantic Council grants this

C E R T I F I C A T E of A P P R E C I A T I O N

on behalf of the North Atlantic Council
yyyW't''i? :'

(signed)

P. H. Spaak

iSK:

IB >v.
'M:Z II!:

yf H 5..-, ?.. ! ,"5%:v
v' , ? 4 - ' : v . . . . i'4 Vi x

. *'

53.j,-- .% ..

vV '-.V

-"V ' v< .;Vj- --V- ,.

^ 5#.



A . si && 1 "

. -r

.

^/.r.J** v:av

rWrV# A:

V;t(.

. "

i . ; |

vr . -;

'f .,.4. - $v
Vm-
I

FJP/ws
i mi


(Presented on December 7, 1960) ; ^
-
; :.r.t ' >114% .,1

:: *

*rr^-4f;' ..

? ' * - . . i* -

V

|^.!':;

C--

4M

f '

December 11, 1960

By Thursday winter had arrived with a bang and I was glad that my good old fur coat had been delivered to the office that day to keep me warm on the way home, Especially so as lednesday was a doozey -- when icy secreatry brought in the mail with the second cocktail invitation -- no the third -- he remarked "My, everything seems to happen to you on December 7th"* At least I had the wit to decline one cocktail ptrty. Tbjf ihf test of my recollection
the day went something like this*.

About 10:30 the fine speaker I had for that day's Ladies luncheon

telephoned that the UN Security Council was acting up again and he would be late, but would be there and we were expecting about 40 more women than we had plates and cups for -- a situation which puts considerable pressure on the flow of traffic to the buffet tables and means that a good many have to listen on the

public address system* Actually he was not as late as anticipated and had seme food before he enchanted the throng with his experiences in the Congo (on October 23 I gave a pretty good run down of what he says) As soon as he was ushered out

of the building with profound thanks, I received a man from Luxembourg--to my

rectllection the first 1 had ever met* He has been here telling a lot of audiences I had stirred up about the European Common Market and wanted to know more about the Association, see the plant and thank me for our help* By the time he had been seen off I went down to the first floor to greet foimer Under Secretary cf State Robert Murphy and lead him to our Board of Director!* meeting, where he delivered a Certifi

cate of Appreciation from the North Atlantic Treaty Organization for our "exception

al efforts and contribution to the success of the Tenth Anniversary of NATO", (This

is the operation which brought on my shingles in May of 1959.) Murphy,

the way,

is a charmer*

There was just time to dictate my letter of thanks to the luncheon speaker and do a few chores on the January 10 NBC luncheon before five o'clock and going to Joel O'Brien's "office warming". Chance to talk with him, his wife whom I had never met, Ted Higgins from Pittsburgh and several others. Back to the office to change for the more formal reception of the Ambassador from Cuprus to the UN and the USA. I am vsry fond of both Rossides and his wife and could not have skipped their first party. It was not as useful as I had hoped as the Security Council was still acting badly under the chairmanship of Russia1 s Zorin and hordes of peopj.t were hanging on Kammarskjold1s words. That session broke at 7:35, just as I decided I oould not take it longer and the taxi situation was so impossible I came wearily home by bus. At this party one of the Greek delegation told me that the Russians were saying that the West only needed a few days for the fur. and games of their holidays and that the General Assembly & ould reconvene on January 3rd. This would keep the delegates of all the poorer countries here during the Christmas recess and the prospect was making them angry. The real joy of the Cyprus party was the Arch Bishop of the Greek Orthodox Church from London with his apostolic face framed in 3now white hair and beard set off with the black of his impressive robes topped byt the flat topped cylindrical hat and magnificent gold necklace. He so outshone Archbishop Jacobus of New York, that the latter soon moved away from the visitor from London, whom he had brought.

For the first tims this season I hai had to use the fireplace and at one o'clock still need a tweed coat as I type. At least we are not having snow as Washington, nor rain which is spoiling President Eisenhower's golf at Augusta today. I wish that now the Kennedy baby is ohristened, papa would get along with his cabinet ofrmatian* It begins to look as if I would not get either Stevenson in the UN post nor Fulbrigftt as Secretary of State. Gould it be that Kennedy is having to say "7/ill you be in the cabinet if the Electoral College does not vote for Nixon?" and that the potential members are holding off? It would finish us with all those to whom we pose as the Great Democracy if the "independents" in the Electoral College switched the result 1|

Hap|>y New Year, even if this is the leggl rather than the real dayl I am asahmed not to have done a chitchat sinoe December 11, but between Christmas cards and prepare ations, Our Storm, and the build up for the January 10 Waldorf luncheon time ha3 been at a high premium- Sorry. It is a beautiful crisp sunny afternoon here, though Navy Missouri are battling it out in the firange Eowl in 75 degrees temperature- Poor things even with ice packs under their helmets and the odd whiff of oxygen it musit be tough. This morning I drew a few checks back dated for contributions I di ould have made weeks ago- When this is done I hope to finish my thank you letters for my very nice Christ mas gifts.

Our autumnal blizzard began about one thirty on the afternoon of December 11 vath

those nasty tiny flakes which mean business especially when the temperature is low and

the wind hihg* Monday I started for 1he iff ice at 8s15 and the plows made walking down

Madison Avenue possible especially as there was little traffic- After walking about six

blocks I managed to get on a bus to crawl eigit blocks to my trnasfer point. Assured

that the cross town buses were running several of us waited almost an hour in the winds

whipping over the top of St. Patricks Cathedral for what purported to be the fir at buss

through --our driver had been stuck for three hours in the great drifts caused by the up

draft at the RCA building at Rockefeller Plaza along with a taxi and a newspaper delivery

truck. The leader of the Nigerian delegation to the UN and an aide came out to join us,

but when the aide declared their car was garagedin BroolJlyn, the rotund and handsomely /

swathed in soft TJlue wool toga-like garment announced "I shall wait in my room" and re

treated. We paused briefly between Third and Second Avenues while rubber coated firemen

dug a Cadillac limousine out of the plowed path in front of a small subsidiary fire station.

Total travel time a little over two hours for two miles. As a pitifully small number of

tie staff made it

at all, we doubled in brass* Needless to say I did not go to East

19th Street to the family dinner party to which I had been invited to welcome Maisie and

Jim Cash back from two years in Pakistans be at,(Just as well as both taxi and bus drivers

both told me not a wheel turned after ten o*clock-) They came to me for dinner at the Cos

Club the neat night, when they had planned to be in Philadelphia on their way to Virginia-,

Before that snow melted we had two more falls each of about two inches. There was still

enough left for children to coast on sleds in Central Park when Aung Annie and I went ofrer

day before yesterday to see the ice skaters and the baby hippo. For three weeks traffic

had to creep and everything took from twice to four times longer than it should*

Aunt Annie came on the 22nd and the taxi driver gave us a hard time because we pro tested having other passengers and as he could not find any at the station we set out by ourselves, but at Fifth Avenue and 54th Street he picked up an attractive young couple laden with hugh parcels bound for 84th Street and the East River- They were so cold we were glad enough to start them on their way home. Saturday we went to Freeport and had a wonderful time with Martha and Cleve, Fran and Sal and the three small boys--much visit ing between houses. They managed to get in everything for us, the midnight service, the suburban home decorations and the trip to Jones Beach to see the sea and the result of the recent high tid8s which at one place had left flotsam within six feet of the highway. We were to have gone to Stong Brook on Monday morning, but Molly had a nasty virus which un known to me had made her mise^rabke for a week. (I have talked with her again today and find that she is dressed for the first time and up for part of the day.) Jim and Bill came to town on New Year's Eve to do the Museum of Natural Kisttry and the Planotorium, coming here for dinner before they went to inspect the Rockefeller Plaza Christmas tree on the way home. Bill enjoyed it all but announced that he much prefers living in Stony Brook and seemed disappointed that we did not all rush out to the fire when we heard the equipment screeching down Madison Avenue- Aunt Annie was to have left today, but when it poured yesterday she was afraid of up state snow and the possibility of tied up trainsSo after having mid day dinner with Aunt Mary we fairly soon went to Grand Central where I saw her/ settled with her possessions in a car, which should have stopped & ose to the stairway in Albany. Friday we went to the CBS-Columbia University luncheon at the Waldorf, as I wanted to spy on what the competition to our NBC luncheon did and was glad to have her get an impression of what our big January do is like- It was a good show but the house was so heavily papered that it coat someone a fortune- We were cash customers and seated in the second balaony, while heaps of people I know were for free and on the main floorl

||

January 8, 1961

Oh me' Where to begin in a telegraphicsiyle with so much left out from last week's feeble attempt to get myself up to date? The pressure of the NBC luncheon mounts with the usual silly demands for "excellent seats" on the partof those re serving less than a week in advance; other late comers request seating with friends^ whose reservations came in weeks ago and were put on good tables; people switch their guests and so on* After I had sent the program listing the speakers, N.B.C. asks that we add an extra speaker, I promise to accept him and get &he name into the list when I OKed the proof in a matter of a couple of hours. The next day word comes that the situation in Laos had so worsened that he was being shipped back there immediately. Happily the two lines of type could be removed by the printer before the press started to roll* Yesterday Don Dennis, a clerk and I worked all day discovering several people of such popularity that two different hosts expected them to sit at their tables, and I regret to say several clerical goofs where the table number had not been put on the card of the people , but were able to find them all on other records except one poor Mr* Wheeler, before Don took the alphabetized box of cards to the poor devil who is pre paring the stencils today. We have issued over 1,700 tickets and are sure there will be mere requests on Monday and Tuesday in the mail with checks. We have staved off over 100 people who kindly telephoned before mailing. And I was worried that the increase
to $10 would keep people awayl
When Judith Listowel announced that she would arrive on December 18, I arranged with a TV shop to collect her instrument, which I have used since she left last spring. Despite the blizzard they sent for it on the Wednesday morning and as traffic was still hideouB I rode with the truck to a block from the office on his way to the next call* Friday at 7, just before leaving the office I found out what the overhaul and replace ments cost asked it be delivered to her hotel the YB rt day and mailed the check* At home there was a letter saying her departure had been delayed, so Saturday the set came back here. Last Tuesday morning she called to say she had arrived, so Wednesday I worked at home until my young friend came to fetch the TV, again I rode most of the way to the office in the truck. Needless to say this causes much merriment amongst the staff and in both instances saved me considerable time. Poor Judith has a dreadful cold and has brought her 21 year old neice with her. So far I regret to say I have not seen ihem, but her cold is better. She thinks she will stay until March 2nd, working on a book.

Last night there was a note from a man in Bayport I had never heard of telling that Watkins had died after two days in the hospital on Thanksgiving Eve. I am so glad I saw

him last spring and although his sight and hearing were failing his wit and sound philos

ophy remained as vital as ever.

The troubles in the- Wgrld are so great and widely

scattered that a priority rate must be given them for worrying. Ii looks from recent

(half hour ago) b^oadoait as if de Gaulle would get the vote on Algeria that he wanted

which at least keep him in office and save France from what I feared would be a civil war*

What fresh mischief Eisenhower is able to perpetrate in his remaining two weeks continues

to haunt me. The breaking of diplomatic relations with Castro1s Cuba seems a ereat blunder to me. For long time it has been evident that Castro was UP to no good but how can we keen t^ack of what goes on there without even diplomatic sets of eyes and

ears. It is useless to depend on the reports of radio and newspaper correspondents, when

thev re continual!v being pooped into jail without charges being made against tr.em in

many instances. Poor Kennedy was inheriting enough troubles ^thout having mor*A created

Between these concerns and working to the fatigue point at the office, I cannot even

make m chef:

balance and have just drawn the chec* for

a t,

without^

reconciling the December bank statement-- only consolation is that they credit me with more than I thouhgt they had. The cloQds look oinniously like more snow, but I'll get

busy pressing a couple of blouses, which cant wait until the char decides to come (last

week she turned up on Tuesday when I had not left the ironing out!) and worry about tne

snow when it begins to fall. I had taken some comfort in the move ox the weather bureau

from the Battery to Radio City with temperatures being taken in Central Park, but cannot

gee they are a bit better

t /i I

T" i *$ c

lf^ u^ 'k^

' k

January 15, 1961

Income tax last payment deyj well o+m v . r

statement and being involved in a speaker ertf* ^8

'* balance the bank

yesterday. Even with the aid of the adrl'nT^ S/r1.

GeorSia 1 want to the

book $37 to balance vhareas when

f !, 394419 fr

XT

ence 7/as $180, Anyway I drew my checks ard 'muild +h
.slier to give me a 10# rebate on the State f cheeking to see how accurate I waa i,, I By the time I had dictated

X Xooked as ** the differ-

n0K.wait first for Gov, Rocke-

besin the laborious business

1960 4ax fer

firaf rrturn,

denoe pushed aside for a couple of weeks,"laftoo Mrsd*^1 *** 4hs
,1 hate to climb the stairs without a parce1"J ,,-V + *& household shopping .
reserve of meat and vegetables agaist tl l lljt ,,sc,m930rt and had in mind to lay in a

into the steady flow of produce for this hungry'"city!)f ^ Btrik which U

those^os^lt^^s0:

r

* - a -9a* success, but

were slow and ruds and illy disciplined bv their9mwrs?IanS f

hotel service-waiters

pal at KBC telephoned for the third time to" add f!lors; At 1*^3 that morning my

we might not be able to squeeze him in at +he head "m

4 tilS

"km I feared

tuhrievveenn?t with the^ heabdSlignaen h "Rlsevs, taKteamile'sntsnbvy, ,saJyin?g, th.a"t8 V nomT e 't* oTOrP9C apaeUr hreecohraddsdbsen

graphed transcript of the well edited version ,fJ+f231""* 1 oan send you a mimecnetwork and the Armed Services Radio network It t lanfeou a3 broadcast on the KB0

whicn you might enjoy. I,, speaking abo^ ooehstenca

BUt 41,81-9 *9r9 a ** quips

hoscow was shown a lion and a lamb Ltte demonstrated the possibility of coexistent

LTM 1?

Sld War " a tour"t in

?-th the soo guide explaining that

Tva arBSli3h8d 31,(1

Suide explained "Oh it iH 881 ?Kthu39d end asis d how

lamb everyday," Another panel member epeakinv of'th n very 31mPle- '-"hey put in a new

coffee plantation to go to Leopoldville on

S S*ld ^ the Alters left a

the street in the parade. Disappointed thev b,!r" ** 4 396 dependence go doTM

a glimpse of their ideal. nnaUv th! J? ?

S 8rUnd for 39V9ral da>" hoping to 1I+rf

ssas sar ? ss. about the crop rounded up his workers and htn "nerof ^h Plantation getting worried
pendenoe". Satisfied with sLX" tanviM ^ ** 8 hi4 reacUnS "Good fo? te ^de-

ed and asked fcthek tt94b allnollno3d a president

of

pleased Castro said "Good,

<3u^ravra

self alone ?o.th his Argentinion oUnri^+, i " an economist," Guevara looked startled -onmiunist' Inoidently the hotel

^ ^ie ^ank" but later finding? Mm "CI?e' 1 did not know that you are
Bconomist 7 I thou^t you said

I got to my table, the one swift witrr% * i 5 serve lf 750 lun<ti eons but by the time

ging John Nason to begin the speaking, s^I fsllitl erved^he deser^ ed I had been beg.

On the way back to the office I haA h \ " ^uecJ for coffee and a couple of retit fr,

With the working staff.

06 f. ^ 8 h8mbur2er to

me through the post mortem meeling"

Record luncheon^adies^bort'Afr^AsiM Ambit/0^3-'51'''9"5' telling th 20 olus Off the

sis of OS foreign policy of the

S?8? in tte Sixtie3- His concluding antlv.

did not know his strong Republican allegiance

-S damninS

those who

would hi VP ad0r fhn Po9ter Bailee and linear fell would have recognised Red China ages ago. Thi,, L '

him 8 3tauneh Bemoerat. <*RM' * he stated that he

" a ' J4 - i c4e9i9 nstf,9a4dinofi

ft w.

30
o s

edrrei eads eedsp,r

v

eb/nivtn

Jfhj^. ut S

sayingTawwoolrdd

they

unamlmaoutse lv lvy o+b^y

the

to see if they would do a s+orv on M-f! 3"T*, . from LP1 tu^p t !f,

contrary to my specific instruction and11% b

"wcmsr.'s interest" series --"this

xs the last thing W want for the oire^ burstillll, l9aVe' v%! kiad <* fublioly

decline oefore they make a formal prepesh SeUi

?.*** EPcnp and U is easier to

-nursday and Friday, so tomorrow iUl'hwV

\

d~3ob^9d t sick on

her that I, not she, make policy decisions,

ari ,dth Iisr ?-'jd remind

'
_

| -IffiB,

T4C/ JU&



'

i *'

: V . ?'-!VV

m

V

W--M-

l IJ
,'

>... ' ; %
M v

W }%M

:< '

:. '

'

.

:>*' : :"A.- ' :

.< .. . . ?; f> -i-. ' V*

'

>. THE



- |f '

.

7

M ' /:v f .V/''"5?

&''' J..L. "v;iJi,PS- t "if ?< rf>!. >. ''/& *.* / ' u\ K 'k J5* '

M A R R A S MA?K A F O U R T H S O N

1 :

.

^Mc':

" '

^

''-. . P i

' - "--V

4:A

At 12;&C a.m. January 17 in Iterey Hospital,

. ;

< -

.'

'

'ly.

Rockville Canterr

'



Fran and Sol a fourth son was born. Weight 7pounds and

yet unknown ounces. Mother and babe fine and as of 12 hours

i

.

- .

^\ oV;

after delivery everything was going well.

,'V ;



,

Cleve told me that Fran was looking exceptionally well both

-- :y' *

: 1 * . III

" : J m' " :.V . . J ' ~" I

' ; -,iV' ";P v-. jV yi*M .m V'^A

I
1

on imday and last nig'ht. Monday afternoon she went to the Doctor ^
and he siad delivery night be very soon. In the late afternoon she

has suspicions that he was very right, 37 seven she had some labor pains

t" . s V.

~iri* '

,c"': - %*' - *'

-A .. *.'&'' *\:r% **

and taking her already packed bag she went back to the Doctor's office

He let her go home but by nine she was enroute to the hoepital.

,

.
t

7

- * v .: , >* v v -f.

,
r

'*..

t .

*

r. '-4^. V*." ?

p.'

*'

;

fjfc s V;** '

Martha has mov ed into the Mi*ller Avenu. e to be wi th? *v.the other boys

.
A-<.' v v.-



I

. i

4 - r *

. ;'s'-'jj

H|i:-|Wy? I r

but Cleve at least slept in his own house and probably will continue

to

do

so

sparing
k

the, m

the

added ..' *

confus' ion

of

his

early

of f

t o

the

train v;"

routine. He did not know whether they had a boy's name in mind, so for

r,4i H

V. .y^'M *'

the present we can only think of } Little Number Four" . With the way they rush new babes homo nowadays 1 suppose he will be taking up residence

in his new bedroom on the weekend. It has been papered in pale yellow > .. \< . , V . , P'

--hence this paper.

' . ''.1*

"4.



3.

My secretary is out ill tedav~>sa I em ehla hupyisdlv tn iee hie

PfSK

flh , {rtr\ ;)/S/Vv/

(' '

''

/

~-7't
January i, 1961

Hot ff the wire! Fren got home from the hospjfc al yesterday wiih John Edward, who has not only regained his birth weight but added some ounces to bring him up to eight pounds. He is good and has long narrow feet and hands with tapering fingers. Alas, on Friday Jerry popped out with chickenpox, a mild case without temperature, which somewhat out of season is epidemic on Long Island. Consultations assured them that it would be all right to teke the new babe home, Fran takes this all very calmly and admits there is a happy by-pr*duct --the curtailment of all her friends with small children coming in to call* In two weeks Bobby and Tommy either will or will not foliaw the elder brother and if they do may well have heavier cases and have to be kept in bed, Jerry is being very good and looking at the new baby only from an open doorway Tommy
at two and a half may not be so understanding, though already he thinks the baby rather stupid to confine himself to eating, sleeping and crying when it is time to eat again, Friday at the hospital was a real lark, most of the kitchen staff could not get in for the snow, so the sisters did the cooking and meeds were served on paper plates. Between her own radio and another patient's TV, Fran got the full inaurgufcal proceedings. She declares she is fine and certainly sounded so on the telephone.

It is now noon and the sun begins to add Y/annth to the living room, since nine I have had the open fire and burned one or two of the gas burners. Happily there has been no wind since late Frida3>" night as the temperature went to near zero--my indoor thermom eter has now gotten to 65 o/o. Cur near-blizzard began about two Thursday afternoon and continued until almost noon on Friday, I realized that I had learned a lot in December and started later than usual instead of earlier on Friday morning and quite quickly found a taxi, the fact that it had no chains or snov/ ^tires and the driver was a Puerto I&ean did not contribute to the trip, but we made it and despite the late departure I arrived a good half hour earlier than in the last big snow. Even remembered to wear two pair of gloves but when I came to put on my galoshes to go to Maria1s for dinner discovered that I had been wearing one suede shoe andone leather all day! The last snow cost the City six million dollars to clear, maybe this one won't be quite as costly. Friday there was a radio appeal for shovellers at $1,80 an hour.

Yesterday I spent a couple of hours in the office working tn a free lance "moonlight Job and got the first portion into the mail for Colorado--I'm not very hgppy about it as it is distinctly off beat and out of my "line of specialization" , but if I make good it could lead to others, which I hope will be easier# Afterward I stopped at Judith Listov/el1s for a late luncheon and good talk with her, (Mistrusting the settlement of the strike I got some supplies "or both of U3 "Just in case" and was horrified to discover that Canadian baoon is 65 for four ounces, but that with eggs could provide a nourish-* main meal, ) She has recovered from her heavy cold and I got caught up on her pretty well, Fer new grandson was born in late September and poor Deirdre Grantly had a rough time although Sir Robert Peeljher obstrotian,did not get to the hospital in time (fee ij>588 ) and she had to have a nurse at home for five weeks, Hie eldest son and his nanny stayed with Judith during that period Something had happened to his old nanny and the new one--a gold medalist from the Hebrides took to going out every night vjith or without permission returning at two and three in the morning and then having such a vile temper that she hit little Richard when he politely asked that she open his breakfast egg for him# Happily she walked out with the uniforms Lady Grantley had had made ot her before Judith learned of her treatment of the child and had to fire her# The next one was a dream but fell and injured her back, I'm not sure what poor Deirdre has new as nannying seems to be a lost vocation in England nowadays and demand exceeds supply.

Last Wednesday Vera made an excellent speech at the OTP. with a packed and wrapt house, Thursday she went to Bethlehem for an evening meeting. The plane was held 20 minutes on the field and then the passengers told to return to the building as the radio was not functioning and no other plane available for transfer# In the -blinking sncw she and a young lawyer drove to the Bethlehem-Allentown airport, where she was picked up and although she had no time to change her dress was in the auditorium and being intro
duced at eight o'cIook. The next morning she had to walk to the railroad stattion for her breakfast, ought the dela}red 6j13 train, arrived at the restaurant where she was lunching (vi^h me a- a.40-- six and a half hours for a 90 mile Journey \

Stomy Brook January 28,1961

m.-.-.i-v if I should not get here this

It looked very muoh on, 1^. - J about half past three--those

weekend when it started sno| vi 8 bitter wind. Fabulous rumors of 17

nasy little flakes on a ^ong

aer0 win4s irifted into the

inches offiae

mixture of snow and X had to o

tao^nadni8Xin!d!i?aTreoepptbliooonlchoxnodridinngotthheaivreatnnhievehreasratryto

osftaiyndaewpaeyn.deHnacpep.ilSyintchee

sitnowwa^soipnpemdy^efor^ffiive ^ ln^ the ^ m0rning,

drop m
snw

mere four inches on the previov

inches. The weather bureau calls

fall this

in six weeks m^ing|fc^ the first winter in 85 years,

maa4aeeh^a^ r4erthboyustan hi eseo xf treambeancdoolndedwhoiaorhs

hwahmipcehrsharveemboeveanl,leIftunodn rttyjWqt+tr.e:eitnsc.since Decemberth1e2a,e,,v,eihniclmeasnywchaiscehs

the plows have pushedsnow nr^er,

golid ice, which must be

has partia lly 1Meanwhile they frequently keep a street

wcihotphpeadsainwag7le

tr^afr6fic

ca
lane so

a

truck ^makingsaacadreglivbeebr|yno4rlte.ven

Aantyawxaiy

discha rging a passenger will hold p

arriTed at the house about

Iqulaerfttertbheefoorfefisceeveanliotntlatrai,n

not. 'mo

e _ tban

fifteen minutes late. It for months. The roads

good to see the family as a
rx "

- ^ 4 bbe snow ig blissfully clean, i..rLS:

JSuf

iSi.1

U

*

*

u ma MI. p.y i",

siiSJ*"""

lings in his best white

^ trie^ t0 gTeet people before they

coat stood in the entrance ^r^0^r^*c,,d wraps. Me, I bypassed

had divested themselves of uheir ^

carefully avoided the ceramoa-

hiiaml adnedsicghneclkaeidd moyn tfhure marble floor in ooior^p^^^ and wepnatklusptasatlasirs

to the proper reoeivmg line. Less

variety of "Indian oddments"

they served t e a a n d f^it juices an^ settla4 for"one of my own cigarettes

I anwdasa mcuuophot foo pitnieraepdplteo3ueix.peeer, Wednesd,ay

wbae4KLLyouitsemFpios.chHeer ssupgegaekstaetd

another OTR iuncheoa. which

Krushchev recommendation and let 1h*

SttrS&JssivisM i SMfSSSf-SiUu1.s1l!& iXTrTM s:slosiwjs sr

affectively meet the Russian challenge,

As things standa nowi1n,t,h"he* onftffiicaee iitt wwoouulid sewn tthheeheeing4ht0foJfuxnediy

floerstmIe tboe ttharkeeamtyenesdumwmietrhhojlcipadrarytaigma'ifnfittho 'atbhseenTMxa4laiafistbaat ftihsecal

WSKUtSS $SHA5 S E?U85S<m yBeoaarr,d

RoufmDoirrserotuonsraFemfpearruta

rtyha01t7

mbebeetriengw*illIDmaygTM

better tQ

info^ rmed

thm
f

S S ....p.v.. ! ? S " S t " 4
ccoyncjlaeo,tBlirlelJiJs 5laTMy1ing"sTapiixe',"i' 7 i. Jpospirnogmifsoerd ttlo>.pEroeiplaore-Tfnoirnlotuorr" >1
before Timer drink! I hope we shall have another bright moon and p# star lit night as good for sleep as was last night I

.

,. ' v'- : .... t v

2>, ,o;tAv. ..)>

S

r:ffl rm/.;..*' fi ' T ,. .'. ..

?.-f:v '^>s. ,.,." ? . *:" , ,,*> . T4 - .'/ .:.v

.'&
'

.fi '".-A '<, .

;| .*v ':'S:r r.\*. f* '.A,-."> ;f %.I-T'.,^ .}3-s"-.%y%iJ<'L**dKr:L;i.&.>S*(.h;i;.~'.


:

-?a%. ,,'. . .t.r..-it

:.

' i ; : .

A ' ' fA

. A'

- -

' .-. - . .' <<&

-

.

...'.

r ;

='

'*

' - '

- '
fi

- .. - .* . 4 -A- " . " .'

.

-.4 ;

-

V j

'

I I

' ' .

-* -I

..

j

SnSaX1

Tellov. lor the sun' ahlna we are' n.e-t havin' g to give a very las,t run

:



. '.

down on the loailje Yeu, Bobby and Taney have both burst out with suiiioient

I

?r'V* 1 1 -

- I

MPH\/ opP%fo/Px"t4M> htKeoP amMM phlriaI oevt viMeiod--hVeiWaOid'iila*BwtuPoiBilsilttiay!y.l.l<i}MnnTMoI bWw mepwmdi]y.p'WsBIaiJpf W opB.hrW 'Bnev'B.nanpvyrrpipcnapn og> pn--ftaApiABn.d.|ua.leyaim slbetAwiloioarbeo

Bo'bby, but neither a miracle of good

PmB; yVB.V j

I

behavior and Fran is trying very hard to keep him from getting the cheieken pax.

f

r. f>.v Martha

continues

to

battle

a

cold,

but

amdiagee

to

spe#ni?5d?.-fMtf/-h.e- f'.

day

at

. 't-xry. Miller Avenue

I

weekdays. CIeve developed a nasty boil on the back of his neck, which was lanced

& 1

i"*;

Tuesday (or Wednesday) nigi t and got a close of pennicillin. It is draining nicely.

I I

. ;

t A

.

-N" ' ' :

" .'"f

' s



Y'esterda7yA I s tarted

aneeiting

and

dripping madly
"

in

the nose
.

and
.-.

thought

I would not come in today, but decided to anyway as it was only about 15 % instead

J* v. .'.* >*

1

of aero this soraing. anew is forecast to begin at noon, but at 1:26 hup not

ir <

started. However, 1 have just learned that the British Kmbaesy in Washington

has told everyone to go home, or if they went there for luncheon to stay there,

j;

'm

;

2K '

f')5-J"

already there was four inches--quite enough to tie up the District of Columbia.

IkM/*1" j** *; -4

'

.

.

Fred is very happy to have gotten his letter of request for an Annapolis

.

' : - -

' '1.

'

;V ;

I

appointment into the mail. The next step is to appeal to the Senator for the

>

'j .

...

f J- f*"

Ti..

' : V-.

~.;.j ' r >

.it ! * - ?

<i; *, .. .* /a . :

; .r i ..

.<'

Air Force Academy, too. But we understand that this is much, much more popular.

Must chew ay sandw ich.^rSSnkfoc w and got along with the second roun*d o'f tryBng to get

Prime Minister Mcaillnn for an oarly April luncheon or dinner:;

2"^r;3.'-2

illi }<*% u

.'.i'.2i %V?< ';2:< ' ^>--pv , ?^-



?



-

. ; ' *: A%,''&$]^ ' :

'

> - .', -

'i

M

v .

w ;';v-rv ' *.

f,.l-^i'

V. -;,,>5

/5V ..S '

5t :''i.'"f.\; ..r'v. . V"rs". v

*y.

*

2'*V -* v: . * . .

B5,, J4?,

-< vy, February 5, 1561

This weekend we got the 17%4 inches we expected a week ago, but because it was
wanner this storm does not count as a blizzrd. Beginning to sneeze and drip from the nose on Thursday, I should not; have gone to the office Friday but felt I had to take steps in an attempt to get Iteamillan for the week of April 2, to talk with a fascinating Swi3S who got into Red China for two months and to follow up on an invitation to a French official* It was not bad getting home, ough very slow, and I stopped at a local open-all-night store to lay in a lot of fruit juices to begin the forcing liquid program*
Saturday morning I had two and a half degrees of fever and stayed in bed reading the winter selections volume of Readers Digest condensations- The swirling sncw became monotonous every time I raised my eyes, but I was warm and cozey and happily successful in bringing down my temperature- Judith Listowel almost sounded as if I were chicken when I phoned her I would not go out for dinner- For the second Saturday in succession I had to decline Maria1s invitation, too* Despite all our snow skiing conditions are not good and they are in town again- The sun is out brightly this morning but few
wheels turn as Mayor Wagner declared a state of emergency at noon yesterday and declared or rather ordered all private cars off the street. At 8*10 yesterday morning the first pi07/ went through 64th Street and although ihfy have been back several times there is only a wide one lanetiack, Madison has an adequate three lanes open. -he oa-1.-^a-icn Department has been pleading on the radio for privately owned bulldozers to help push the snow into piles to be carried off. (Before this snow began I heard that there were still seven million oubic yards of ice and snow about the city despite the expenditure
of something like 16 million dollars for snow removal before this last drop. J

Poor Vera has had three hideous experiencesin getting to platforms. Bethlehem was followed this week on Tueday with Dearborn, Michigan, when her jet flight overflew the Detroit stop and dumped her in Chicago, and United disclaimed all responsibility and/or interest in getting her back to Detroit. She managed to get a piston flight on another line in time to make her speech, answer questions and catch a plane back to noches^er for the term opening on Wednesday, but without any Tuesday night dihai r. lfi/hen she re ported all this to me Wednesday night, I begged her to get a roll of malted milk tables as a survival item for her purse on the Thursday trip to Eau Claire, Ydseenoin, inriday night she called from Chicago, There she was holed up in a motel, to say the Eau Claire audience had to await her arrival and she was T/hisksd onto the platform ^without even oime to remove her boots. 7/ith New York airports closed she had decided against sitting up on p train and was awaiting flight developements. Yesterday afternoon she telephoned from Rochester that she had gotten that far and would not come, on to N ew York, wi ich was
very sensible as 1 had earlier urged and which the uncertain reopening ox our a--rpoits
indicated. TheCTR Wedre sday speaker, Klaud Mehis rt, arrived Tuesday by KLM, "h ich: had lost his luggage. It contained all his lecture notes and a month1s wardrobe, which he
has started to replace..-prematurely I feel,
Martha reports 25 inches of snow on their back lawn, and an eight foot drift between their house and the one to the ea3t. The remains of the December snow is still along the back fence on top of many of her spring bulbs* Road ploughing has seen well done, though Cleve walked to church to usher at the eleven o'clock service and will dig cut the car this afternoon. As expected Bobby, who always does things thoroughly nas a oad case of chicken pox, while Tommy's is light. About ten days more before we know for sure about the baby. Poor Martha cannot shake the 1b ad cold ittiich has plagued her for weeks. They are so pleased they insulated the house, as fhe outside temperature one morning "tiers was 6 below zero, probably th9 day it was 2 below here when ^ wenb vo work* *. My three month flirtation with Paul Henri Spaak finally led to his accepting for luncheon Feb,16- Recent rumors from NATO so disturbed me that I telephoned Paris on Monday and found he would decide that night whether to resign.^ Hours after the radio announced his return to Belgian politics a cablegram brought his regrets, lurtunately there had been an inefficieit delay in Rowson1 s office and the invitations nad not been gotten out,..*I can*t help y ndering if Galvao really thought i^e siezure of the oanat Maria would amount to more than days and days of anti-Salazar publicity -I -find it good to hear Kennedy's vigor, awareness ani candour in State of the Uion and press Conference. - . Cn Tuesday I picked up my UN card after years of not having one.

I j

f^C'V-*\ D ' ^ ) ; 155

1' February 12, 1961

Happy Abraham llncoln's Blerthday and goody for me getting a day off tomorrow, At ne point it looked as if they were going to try to avoid the Monday holiday because of
a whole series of committee, annual and board meetings piled up for Tuesday and Wednesday* I hope that by staying quietly at htme for the bulk of the three days I may get enough" extra rest to completely lick tr.is cold, whifh has lead me to arrive at the office nearer eL even than nine most of this week. A little earlier on Uednesday, not at the office but in tne iiiccnomic and Social Council room of the UP for a strange briefing byt Charles Hogan, inspired no douct by stupid behavior on the paft of some |f the Men Governmental Organiza tions but delivered in an entirely negative manner not calculated to wir^ friends#,-My
*1,411 -lCn governmental Organization is again rife with rumors and apprehension--what depart ments v/ilx feel the economy axe at the end of this fiscal year? For a man, whose original >.tela is philosophy and oy religious conviction is a Friend, Nason seems not to show any of the traits attributed to either group. '.Thile it suits my long term financial plan to' work another year at FfA, there are moments when I wonder how much I would really mind if //e ^made the break on June 20th of this year. I have no illusions about the ease with which I might get another .job at comparable salary. Few if any outfits would employ a person of my ag8, do until committees and the board make basic decisions , all personal plans for moving into a place ishere I would not have stairs must be put on ice again.

The new baby has not yet broken out in chicken pox and although it is a nasty raw day he is being baptised this afternoon with standing for the godparents, Delli and Cleve.
The rest of the children have colds and there is not to be any sccialaMlity after this routine one of many being baptised ceremony. Tomorrow I'll go to Gerry Wllmot for some good advice as to how to comport myself during the art two months while she is in the Far East again. Just as well I gave up spending my travel holidays with her before she reach ed the round-the-world every year stage, though she is an excellent traveller and a good companion beside being a first class osteopath*.

^

ip .* it not thought of the British to bring out the Portsmouth spy case with all its

j.ovel y speculative aspects just when the Santa Maria story tapered off? The t^per is so

fi ed with problems or great seriousness that spies and adventure on the high seas hare

added a to me most weiiome antidote. This lest Lumumba mystery is too fraught with danger

to s--r. If ae seems searchable he has been killed and the blame can be put on ncnCon-

gc^ese shoulders the ?at *iii be in the fire. I still cherish the remarks Senford Briffith

ad*ggeerTMouusVmaa2n, nut Africans have their own ways to ta?kef Ccoanrgeoolfesseu,ch"rHeeonilse.a"brilliant and

Off and on this morning the tiniest snow flakes I have ever seen have drifted in the

*liT^ IT 11 i*

bv ihe

of gravity My cart of Madison Avenue has been

AI - 8

W 9 enew, It bsd been rushed int* piles It i# 12 feet high and

carted EF,. THIS MORNI 'G the vacuum ce aner, which bit* into the riles, breaks uo clumps

ef TOmbined BNOW and ice end suits thm all through a funnel into dtam trucks went along

mv aids <v 64-th Street. Later a noisv little die,el dr'rer #r,nge plow turned ur aeroas

r.he street to rush the curbsid* piles out into the street, where * sprinkler truck eaimed

1 " * lUee

,? PUthe^ it down to Madison Avenue, Some of this snow was neatly

sptead over the Madison traffic lanes wera traffic is busy grinding it to mush d out

ef existence. The rest I guess was carted off, but the funwy art is that just acro.o

the street they left about t-ntv feet of enow five feet high, and as r anv wide. Sun do-s

rapah this roin*, so^

Any way, tW now talk hbout snm and stuff again by

late tomorrow. At least we miased the last drop in Washington, which was originally sfe ted

u ^ + 5 951

f1

a tHal thi* winter

been and with the Groundhog seeing hie

shadow ten davs ago mv feare of w^t-er^r* -' t-u*-te-E*.etew ^re oonf-'med.

Interesting obituaries on Dorothy Thomnson. whom I knew , and Angela Thirkel,

S

!??:.? rc*?t d"v Curiouslv enough I had *l*cted "Suahilln" bv Graham McXnnes, Mrs. Thirkel*s son by a rrevious marriage, to read a tw* d.vn before her death. It is rn interesting novel about the nainter daughter of *n American woman a-d Indian lsndo her.

Wen written ^th r* - feeling for th- Indian reorle before

though I suinect

that tb- ,robU,9 of oixe* TOrri.g, maT ba ffl.re nouta n0_ thp,,^^

zvz,

A i v ^ f T >^0rr'vs^ f February 20, 1961

Last Tuesday nigvt when I reached home after a dianer at Eustace Sell

beuae

a grim message greeted ma in the auter entrance MN hai fo- 2 w 3 davs. The boile

hae breken dtwn". Poor tMng it ha^ rrobablv g3v*n its all in an attempt to ke-~ us

moder^talv warm during the nr *are e~*ll. Or rverhar* *t had heard of the elan to eon-

vert to oil and was offended. Bv ThurddavK

ne*sa~v to boil nans of vdter on the

ga ftcra achiav A --arm bath and I t*lerhonef( Cleve that I would be gla^ 2 'to

ijher Friday nfrht far the weekend. It ..r ?, r.6 d t- see* t-< n II "d to bo w ~n the

morning and not to have to go to be* with the electric red at earlv hours, Just * **U

that I wor* vr boots there ae the snow of t o weeks ere which had been over

two feet

deer on the back 1*^ wae rtill a.

foot dear on the front lan when I left this morni*r

and that after several avove -beva freettng dva and hfvv ra-in on Sautrdav night. With

the idea that a few hour of airing would l*ft our morale *** hd a. regular Charleston

three o* clock dinner on Saturday and got to the flower shrr.7 at Roosevelt Racewav in

Weetbury when everyone else was streaming out and had a levelv time looking at green

things and bltoning btiihs ^rd il-nts. M^^h arid X exercised the moat terrific restraint

and did n^t buy tuberous begonias in the most luscious skdes,

geraniums nor verv

temotin* trail4 basket's of blue lant-na. ' <fcd fall for ehr*jm *3 ante and an unusual

suculent called *urr bereMM r*th grey yam leaves edged with * rosv rink. What is

more min* got eafelv to to*"n and ne^d ncv cr.lv to be transplanted into larger nets, Mv

wae> had alrendv ban cheerad with one pure! a ratunia bl ocTM hare on Valentines day and

three wh^ie ones on an office riant the next da,v. It is rather fun wintering the self

ao^n seedlings *r October and waiting until Febru&rv to *ee what th*

will be I

I h-d been rathe** dreading; the Seligmen dinner as it saained potentially to be a de vice, which might ^ut me in an untenable pooit* on in the office. Mv fsers wer*s not allayed -when Eustace asked me tc sit on Ms right, Nson to take the foot of the table and hav^ th* only other woman kesit him. His onenirg .remark vtp* that he ha** ha^ trouble Mth his wight a^r and har* vpw bollr with it and I looked forward to a difficult dinner chatter * While the soup was being served ho asked mv orinion on one point and to my jov I discover ed he agreed with me. After he had taker, thrAr srocnfuls ha then asked if hAsthought of beginning our business while we ate would be acceptable. I concurred, and off he went w5th why the sixteen vera together, outlined verv well some background nod ~ut ue wv bogey man and before T h*d taken a mouthful of my meat asked my reaction. By this time I could not have cared less if my food got cold because between us we killed at once a mad idea before it was elaborated upon and in the end had a potentially useful schema hammered out with everyone enthusiastic about at md the "nigger-in-the-woodoile" so overwhelmed that b* never poena* his m^uth except to eat. I got home R^d into bed soon after nine-* * r+", As mv block had been cte arad of env since Sunday I was surprised that mv taxi taking me to the S*1 igmnn'e h*d to pass the house at 126 Fa,at 74th Street to find a Path through t e hip high si ow at the curb for me to gain the si devalk--guess
I lime on one of the more favored blosks S

Wednesday had a, verv good *Jnglish woman turned Austr 1 * tell the OTR ladies

about her trip into Red China. Curiously enough Australia has not recognized the Com

munist government, but trades with it extensively getting rid of a lot of wool there.

Myra Roper is a first class speaker and held the audience enthralled. That evening afyer

the FPA Board of Directors meeting there was a dinner followed by a statement of Robert

Bowie on Nigeria so I had my dose of learning for the day and got home to my chillv home

late enough to warrant going to bed right away. Lest I forget, it

73 o/o here

when I got in for dinner tonight#

On Lincoln*s birthday I went to Gerry Wilmot and found I had lost three pounds in less than a month for no goM reason and then to the dentist, where I return again on Washington's Birthday. What a bore# The rest of the day I hope to really get somewhere on my income tax returns and get some letters written. Yesterday Martha asked some people
in for a drink and they were so glad to have some fun after so much ''winter" that they sta.V8d and staved--no letters, Saturday night cats *r*a with fog rising fro*1 +be snow
and blotting out everything but the very near objects, but it wee even more pronounced middav yesterdev when the same situation obtained near the Bav yet clear with bright sun a half mile awav. Cleve and I saw lots of things we had never noticed before *.

!>$, AMk !! 'j^

/Vit
February 2.6, 1961

Oh mv, here we ftre ~ith the **cond month of 1961 practically over and I seem inca^ble of keeping up with the march of event* and the P-s*ge of time. At least our pattern of snow everv Thursday has changed to torrents of rain every Saturday. Dandy for us as the snow accumulation has been weshed naay end the residue of muck in the gutters too. Yesterday I went to Judith Listowel's for lunch and to sktoh e 1-eture he ad.ll give throe times in as rnarv w-ekr. ctu*llv it is e t^a- e we eoncoet-d two years ego and has never b**n -sk*d for. Harnilv it still stands up and we thought of plenty of current items to put into "Earfchbound SatellitesH. In the morning I gave way to a crowing compulsion to write an -rticle ab-ut Veral adventure* in -caching her Platforms. Faced with the temptation to angle it toward snoofing the gap between airline* adv-rtisinc (MJet there in no time at ell") and p--fnrmanee-^>lav^ +->- ofit my jtfj# wait of four hours in Atlanta t overflying a scheduled -ton: Vera *ut down at Chicago inst*-d of Detroit,etc. I found th-t no magazine carrying ac- after race -f air line . de would every carry it. Now I'll
rewrite from the aTMr*och of difficulty of reaching the platform end getting home again with a mor* tender treatment of the Slogans versus "-rformance . Probably a useful exercise but unless I get a manuscript ouicklv th* potential market and interest will have evanorated by warm weather.

Thursday was such a gloomv dev of foe that I stopped in to deliver a book for Aunt Marv and a sweet geranium plant. A crowded bus gave the latter such a buffctinc tnat 1 wre giving off its most charming scent generously at time of presentation. She goes out judicleu-lv -nd for her 89 ve-r* is filled with interest and oninion on a -id. v-reitv of matters, It is alwevs hard t lesve, yet I always feel guiltv about the gaps between mv looHnee-in-en her. Wednesday (Washington's Birthdev I had an ssrlv anointment wi+h the dentist end pl-nned to do rcme ehonping only to find that none of x..e mid-town stores were ODen excent Lerner'S, where e slin in the window lured -6 in. I never di get the slip but came home instead with a cotton knit such t have trving to buv for six months and will be a most useful vear round office dress and another mch I V w*ar to the Harvard Club for dinner tomorrow. Two gav blouses to liven up my suits were also snatched. I am still a little overwhelmed at whet I got for $17 plus tax I

Being a highly mobile People that wildcat Plane strike plyed hob with all sorts of people and plans. The husband of one of "artha's friends who came last Sunday had

t ln ^^umbla s-c- fn Monday. Reservations on two plane flights were cancelled and he ended up on a tram --coach a* there were no Pullman seats left. Fortunately

Vera, wa* booked for a Sunday morning flight on a non-struck line which had already

mad* the concession to flight *rginaers the others were fighting for. Because of the

fog she made the flight ahead of her booking, though her luggage went on the original plane and did not reach ner until after she had spoken in her travelling dress. "The

nex morning she was offered $50 for her seat on the early L ight from Cleveland to

Rochester, which she had to decline because of a class at the University. Another of

S ? % lu

t0lnd ?bUt * Canin* Ccuntry C1b which takes care of the

+h*ir!?!

t *1*1 rn!

.Sme d0gS Are delivr*d with a supply of silk sheets

^\ sleeping baskets. At Chnstma.s all sorts of gifts including holly wreaths

are delivered -- not as takens of appreciation to the management but for the dear little

^

?6KS

outlets for telephones to be plugged in. It is not unusual

for owners to call from Pans or Cannes to coo into the animal's ear and be regarded

with whines and occasional yelp. One hears that the British love animals more than

people, but it cannot be that the patrons of the Canine Country Club are all owned by

the English I

J

Should there be a gap of two weeks, please do not suspect that I have been over taken by illness or some other dire fate. Two weeks from today I shall certainly go to Washington and may leave Friday for Charlottesville. Next weekend I hope Aunt Annie will be with me after the Secondary School meeting here on Friday and Saturday.

7V

c

Karoh 5, 1961

3#;/^ 7

'

Double birthday yesterday -- Jay attained his majority and Jim--well, no need to

go into ihst. They all sounded fine when I telephoned about dinner time, though

Molly had had a recurrence of virus type cold. Fred has had his acknowledgement of

his application .or the Na'val Academy and told to stand by for examinations* I dined

Friday in St. Agnes "brass": Aunt Annie head of the lower school, Margaret Braewell

vice principal and Mrs* Vandemore the new headmistriss--much more lively and fun making

than her predecessor* It was a delightful evening, though I was sorry Aunt Annie ""

wanted to go back as soon as their Secondary School Conference was over instead of

ccming here for a few days. However she will come back on the 20th and we shall go to Freeport for the Palm Sunday weekend*

Thursday afternoon as I began to pull myself together to be un the UN Conference

Room 2^at five o clock x or a closed circuit TV panel discussing the problems to be

heard in the reconvened General assembly beginning on the 7th, Hank called in great

distress* He and Maria each thought the other had called me about their 6 to 8 cock-

TtT0:il

af;eTM" fTcr a great assortment of African and Asian Ambassadors, "

a?d Mission to the UN characters. Requiring a change of dress, I could only

promise to goi there before seven. It was a funny party introducing a member of the

median delegation as a Pakistani Hank got me off to a mad start* It took quite a bit

of cross purpose conversation before it came out that he was born in Lahore, but at

par virion his family migrated to New Delhi* When we finally got straightened out

x could not resist telling him about the day I interviewed Ghandi and saw the Taj

Mahai -r ce same 24 .hours* ... T liked the other people I talked with much better,

though he so reminded me of a character in an Indian novel I have recently read that

really was entertained* The Ambassador of Dahomey is a wonderful person, the balck-

f ,,

- ace accented by a ger.eroueX sprinkling of white in hie kinky hair.

hfv nf bowl of soup.

"

0

1 had aaten to ""y anapes to have more than a

uieH session was moderated by Richard Hotelett (CBS) and moved at

a der fusui Tn f

introtdouchtiisorarhumanns. Paul Hoffman was the best, ,Uber t

J

bUt ?aB89d the hat in PoifltinS

since the Soviet bloc

pay ltS shars of m^reency

Forces in Korea a d the Congo

the red ink was appearing more and more on UN books* If these noncavments ,rr nnt nr+

set by nations detensind to keep the "big glass houie on tho1ast K L business

be o-e"of stf eEr>y

by flnanciel strangulation. As Mrs. Roosevelt is going to

Stevenson s help rs, she was introduced as "Den Mother". Stevenson was 12

^reakhashaSl f01feb ?*' ^ TM secretariat characters were interesting but

Z Harris partyf

7 kad +' Walk fiTS blocks to *et a taxi home to dress for

h fTMdat' fudith had Lady Dean (wife of the Britieh Ambassador to the UN and the

its) S piS anif staan^ d f wifoe f ofPPe^ter r S Korrnm,itiiGe0mUann0aigle)rfo0fr i TVUMChhea0nn nel

Ko)ur.a It as (Pthe English

rasnsfemisErFnrma imx rma rmr m

next s?ep9in mfinc^W

** looking for a statement necessary to the

to the dentist and TMnt over to^get tickets for "Ba'ir + JBsberdaV"^ * ^d to go

out on the night I wanted to take Vera, but I did find" fF + ? th hUSS sold

where one can be tatooed in New York Al so Lf

, T by returr!3-nS F Eighth Ave.

be carefully planned-third trip to get stuff ielt before Srie^sf^3 Eom8thinS *?.

' '..u Pk

uv /n*7

March 11, 1961
The dzplict of the misdng tax data arrived todat and enabled me to work away at Ue return in the course of which I have probably made a very stupid mistake as it came out with their owing me almost half of the non-withheld portion of my 1961 taxi* 1*11 have to check the worksheet very carefully before I copy it --but the job is progressing. Do you suppose it woulrd be possible to claim a deduction for the value of one's time spent in preparing tax forms?
I had a lovely surprise on Thursday evening when Aunt Annie telephoned thqt she would be going to another school conference on Firday in Connecticut and it was possible for me to lunch with her on Friday* She has gotten into a steady weekly trip down the Hudson, she will come down next Saturday for the beginning cf her extra long spring holiday and stay with me until the Friday before Balm Sunday and return to Albany after we have spent the weekend with Martha and CI eve. Today Judith Listowel lunched with me at the Cosmopolitan Club, and tele me some interesting bits and pieces she had picked up in a recent trip to Washington----she is convinced that BangJensen, the Danish member of the UN Secretariat in charge of questioning refugees fr#m he Hungarian uprising had been murdered and not commit suicide as is generally be lieved. She sensed an atmosphere in Washington of youth, even in the staff of an older Senator she called en, an informality and zest to get along with the job to be does* Another friend recently back from seven months in Asia called on Chester Bowles, Under Secretary of State, who reached for a pad as he said "What ideas have you? There is so much that we must be doing." I was amused at Dean Rusk*s statement this week: "It has been suggested that foreign ministers perhaps ought to organize atiade union to try to establish more tolerable working conditions, but that is some-thing for us to think about and talk about. " Isn't that a precious notion Last night I had a delicious dinner and a fine talk at Vera's, I wonder if we might have more content ment if we joined the office union? She thought well of the first inkling of an$p$$$ incipient idea of mine for a new facet to my "moonlighting" iperation, In fact after my proposal is polished and put into project form, she has offered to intorduce me to the key pe rson.
Monday I \vent to the French Embassy to a reception for Jacques Chabon Delmas, the President of the French Assembly, a dynamic youngish man who certainly has honor from his post but one wonders how much power under De Gaulle's authoritarian methods. It was useful for me to go and chat with half a dozen interesting people. Two of the little helpers for the mechanics of the Off the Record Wednesday luncheon were out and we had to limp along with substitutes fortunately it was one of the smaller atten dances, so things went smoothly. The weather has been indifferent to disagreeable this week--rain, drizzle, sleet and snow, during which I became so fed up that I drew mycheck for the charter flight leaving on June 11 returning me to New York on July 2t* For the most part I hope to reconstitute the itinerary planned for last summer. Nov./ to see how these plans will suit my friends and to sort out the rotation.
Tomorrow mid day I'm off to Washington for two days, returning late Tuesday because there is another OTR on Wednesday. No doubt I'll return exhausted in two places--from sitting through endless sessions and from listening to numerous speakers. In less than a month I'll be doing the same thing in Philadelphia. If I don't know what goes on in the world and how people are thinking it will not be for lack of trying. But I am osrry to be out of town just now--Thursday I dropped in on Aunt Mary with a couple of books. She had had a tummy upset and was depressed and spent-- so much so that she had begged the doctor to take her to the hospital for en explora tory operation. She has been in for tests and find nothing the matter but she th/o* if they looked more might be learned. He assured her surgery would not help and J she sounded much brighter on the telephone. Her world shrinks so that I ought * mere for her than I somehow achieve. Poor dear, with her Victorian wyas, she horrified if she could see the untidy mess on ray writing table tonightI

AlWL


Air
iM/*a. rch 19, 1961

One day to go before spring makes what we trust will be a triumphal sntr&nqel Ten days ago I wont back with joy to my fur coat and last Thursday night would have been miserable had I not worn it to 1&s Cosmopolitan Club. I had gone to hear a Dartmouth professor on the influence of Prussian literature on hast-Jest relations, who was dull as ditch water -- the sort who begins by saying that he must define his terms. I wa3 disappointed and 3orry that I had made the effort of climbing into a decent dress and around to the club in. the bitter cold wind* The trip to tfaMngton was a great disappointmgi t in its failure to produce signs of spring --only greening grass and in sheltered places one fully flowered forsythia, one full Japanese mag nolia and one so fully budded as to giv9 promise of early flowering. Yesterday afternoon Aunt Annie and I went up to the Cloisters at Fort Tryon Park, the view up the Kud3on was muzzy from the moisture in the air, but there was pleasant sunshine
and crocii abloom in the Cloister of St. Michel de Cuxa --small fl owers but hearten ing. I had never seen yellow ones before with deep brown on the outer 3ide of the petals before. Alas the herbs in the Gothic Garden within the 3t. Bonnefont Cloister were still too well covered with fir branches to tell much about which herbs are con** sidered Gothic. It was a pleasant expedition and gave me a chance to see how Negores and Puerto Fdcans had spread to the west in previously white areas. Much too cold a drizzle today to go out for further exploration and or education.

The speeches in Washington were interesting and Bill has been busy since my return copying out my notes except when I toil: compassion on him. and gave him. some dictation or other chore to break the monotony. The new colored Deputy Assistant
Secretary of State for Public Affairs made a touching introduction to Mrs. Roosevelt,
whom he plainly adores and told the old story about the presumed d&3ay in the invasion of Normandy when some impatient people inquired if it was caused by an attempt to find the ubiquitous First Lady to. be sure that she v/as not caught in the cross-fire. He
speaks with great ease and effect, but it seemed to me not always with the right
word, as using grasp instead of grope in; connection with grappling Y/ith a problem, I had a fine conversation on the telephone with Mrs. McCoy, who urged me to stay with her when next I am in Y/ashington as she is back in their lovely house part of the
original Dumbarton Oaks property. Coming back on Tuesday the steam hose broke a
couple of cars ahead of mine in such a manner as to sever the coupling and the engine forged ahead some distance while the rest of the train gently rolled to a stop. 7/e were exactly an hour late in reaching Mew York* which gave me a fine epportunity to take the next planning step in my new brainstorm for "moonlighting". I think I need
only to lay out the proposal and write one section and as a sample before submitting it to Irita YanDoren, the editor of the Lively Arts* Don*t misunderstand me ITm not thinking in terms of a weekly piece, more likely one a month if I can sell her the idea that I can fill what I S9e as a gap in their roundup,

Wednesday we had my Cuban exile back for the other OTR series and he made a quite
different speech than in October, but still forsee3 sn early and bloody overthrow of
Castro by the disaffected Cubans. It was a. curious coincidence that the next day*"8 reported that the entire Cuban Embassy staff in Holland- had resigned and sought polit ical asylum, Thurday I went to a luncheon at the 'iifaldorf to hear the new Deputy
Assistant Secretary of State for Inter American Affiars Roberto (?) Morales Carrion
speak. He waa born in Cuba, but at an early age went to Puerto Rico and wa3 at the
U, of P,R. a year ago when Vera was there, fcorales ha* good English, is undoubtedly an orator but seemed to hold himself down to perfectly "safe". At one point I thought he was getting ready to really say something against Castro, but it was too general to count. Next Friday Aunt Annie snd I will go to Martha and Clave until Sunday after noon vhsu she must 3tart back to Albany for things she want3 to go there and to get her car out of winter storage* T do hope she v.ill havo a few days of decent weather hero,' Judith Listowel got off Friday night for London by way of visits in Portugal
and Spain* On the laiat flurried day I was drafting lecture topic3 for her use next season. It is likely to be that way--tilings done with a great whoosh at the last possible moment, Il&ybe they will help to earn her a few dollars next season.

nc.^ ?%

I'

1

/' ' 1

I'

9

. < h y 7 ; < w < TM Mareh 26, 19a

A beautiful bright blue sky day as it always is the day Aunt Annie leaves. She did not fare TOO badly though Thursday was horrid with rain, sleet and snow in great blobs ineiaad of flak33. She graciously pointed out that proper travel planes always include a few days "at liesure" and Thursday was hedrs. Martha has been bothered for over a week with nasty swollen glands, so we did not go there'on Friday for the weekend. nen we called on the telephone today though we found that she was much improved. Not going to Lond Island on Friday did enable us to see Aunt Mary, go to the Museum 01 the Git/ 01 New York---wh1ch I had never set foot in--go to an amusing French movie before Aunt Annie took me out for a fine dinner. The movie "Love and the Frenchwoman" was very good, sta tistical comment used as connectives for the life cycle, most appealing children in the prepuberty sequence, rather wonderful teenagers in re adolescent, all well acted and some of it uproariously funny* One night we had dime r at the Cos Club and then went to see three British official films and a monthly news reel* Rather a different level but each most interesting. "Between the Tides" was a colored exposes of the natural life of Britain's costal areas--barnacles eating, razor clam digging into the sand as the tide ran out, colorful sea anenomes waving graceful red and purple tentacles in search of food, a dozen kinds of sea gulls or their near kin nesting on the rocky coast, wild flowers, sea weeds and so on, No wonder it has been awarded three international competition prizes, I could have watched it for much longer than its 2b minutes. The recent state opening of Parliament in the House of Lords with the Queen's speech from the throne was a blaze of color with their lodrships in their red velvet rob*s, the symbolism of the various steps in the pageant made it not only eyeiilling but historically very interesting. In ten years I fear Prince milij> will Lave
to have a topee to cover his growing bald spot1.
This weekend has developed a great office crisis and considerable emotional upheaval. There will be immediate changes in the Association's officers and further staff cuts come the end of the fiscal year, June 30. I picked up a scrap of news during the week, which prepared me for scne of this, out Sunday was a day of direful foreboding* After I had seen Aunt Annie off I started to Fy^ my federal income tax and in my bemused condition coppied almost all of the 1959 first page, to which I had referred to enter my social security number only, before
I discovered my stupidity,
Continured March 27* . . . A few more facts were ascertained today and while there will be changes and more departures, the picture is not quite as inhumane as appeared yesterday* At least a few of the more senior staff will get bother severance pay and small pensions, which had earlier been denied. My own fate will not be at issue for a couple of months probably and my guess is that I'll be kept on for another year or twof if 1 can stick the hocus-pocus and the ruthless behavior of top management.
Last Monday I had a delightful luncheon at the British Embassy with Sir Patrick and Lady Dean (they are great friends of the TBheeler Bennetts), the Ambassadors to the UN of Libya and Indonesia and their wives, (the latter a vivacious little v/oman in a magnificent purple sari-like garment), Dr. & Mrs. Peyton Rous and to balance me, Sir Samuel Hoare. It was rather fun socially and interesting from the appointments with everything marked ER II, Thursday night I looked for the three Ambassadors and their ladies at the reception of the Pakistan Ambassador and Begum Hasan in honor of their day of independence without success. I understood that since Zorin had accepted the entire Security Council had turned out. Stevenson signed the guest book right after I did and I met hi3 sec mid in command on the stairs as I went in fairly late, I ran into my old friend the Cypriot Ambassador and several other people it was useful to greet, so I suppose it was worth going around there in sleet and slush in my fup coat. Today I wore my beige spring coat and petunias bloomed again in the office.

/)K{f,

t

|lSt

April Fools Day--1961 Stong Brook

It is pretty silly but I am not yet sure whether am April fool joke was played on Bill and me or not. We shall have to wait for Fred to come home again to he sure. The revised forecast yesterday morning before I left New York wad --rain, sleet and snow# It held off until bed time and since then there has been intermittent rain with a na sty cold wind# Thank heaven the other two have gone elsewhere. As I went through Central Park on my way to the station there was forsythia and early MwildM azalea in sheltered spots bloom ing handsomely. Here only crooti and yellowing willow trees. Althou gh imperceptible the oak buds must be swelling as most tfi last years leaves which ha ve clung thoughout the winter have la rgely dropped unless they were s tripped off by the strong winds and wiight of the winter*s winds* The family all well and Bill have grown tremendousl y
Ee is now the tallest, though youngest, and his voice is in the first stages of cha nging, though he is six no three months short of beiig thirteen. Last night Jay and I ha d a session on the stock market, his interest ha ving been quickendd by ownership of some shares I gave him for his 21st birthday*

Although I think Easter is is silly time to give a big cocktail party, the Eustace Seligmans a re doing it a gain tomorrow, so I must laave at three o* clock to get back to town in time to go. It annoys me, but the atmosphere of the office is such tha t I feel I must go. I do not like to a sk which of my colleagues ha ve been invited, but know it is good strategy to be s een by such members of the Board of Directors a s will turn up. New budgets have been draw* up and it is common knowledge tha t some heads will roll a gain in June. I know of one and have been involved with a lot of agonizing hand holding very secretly as the person concerned has been forbidden to tell anyone of the advance warning given. While this pledge obtains it makes job hunting ra ther difficult 1 While one cannot be sure until general announcements are ma de, I am not unduly disturbed that I am to be given my s everanoe pay. We can only trust that the axe will fall about the middle of April. Needless to say the general morale is at a desperately low point.

Wednesday we ha d a by invita tion only stag luncheon at India House in honor of William Burden, until recently our Ambassador to Belgium. The fact tha t the King and Pa rliament made representations to the U.S. government tha t he be continued in the post, he has been replaced by Douglas MacArthur, Jr. I went down to see the room and i^eet the maitre d'hotel (new) so as to cope better with him on the phone for future events. The gears of the cab froze on the way down and we had to take to our feet for the last bit of the way. India House is an old club with many shipping and import-export magnates as members, a cha rming old rabbit warren with many ship models, old brass cannon and Asian gods and godesses for decoration. When the time came for them to move from the cocktails in the Marine Room, I slipped in and checked with Nason that we should go in and then asked headwaiter to see to it. He gave a couple of taps on an old ship's bell and lead the way to the private dining room. The staff member, who had been checking in the guests and I went to a reserved table in the ladies& dining room where we practically fought off extra serving of this or tha t and broke their hearts because we declined to take a liquer with our coffee. That night I had my Australian Myra Roper for dinner a t the Cos Club with Josephine Schain to hear the distinguished recent Swedish Ambassadress to India Alva Myrdal speak. We found her quite dull, but Myra wanted to hear her as she lea ves Wednesday#

**2,*^740,

Thursday' the staff gathered to hear the news .of the PQj&rd 6f Direcicr1 a "solution to cur severe financial crisis". On Mjfcy. 12th 15 people are terriinr.t -1' 12 are transferred to equivalent jobs vhtie 3even more have changed or reorganized vvorlc. Immediately after that everyone on the second floor ad.ll be roved "'tber t: the wound floor or the fifth, Wednesday after five o'clock I had. a private session vith Nason in whir. T - told me that I res to move to the ground floor -here -r-r^ -rill
be.squeezed into open working ar^a. In my 34 yeare -.nth the FPA I he.ve always had a proper office end. fear I am too .s*t in my. nork habits Au orange novo r.'nd. so shell have to fight. On. Friday bason flew off to the West Feast- so " aha?I have to (JaaX with vice presidents or leave the future for about a month of uncertainty and bitter ness. Vera Dean is am^ryst the departing group as the BVLLMTIN is being riven u.p and is in r state, of 'hock bordering on collapse. My heart bleeds for her md all I can do is remind her of the useful tfcxngs she has' dene and her varied talents will still be in demand# that her life is not over, etc. Probably we made a miat&ne ir not iic> ping to analyze the handwriting on the wall several years ago when the FFA gave up be ing * membershin organization* and rea'-ned t| hen. shorter term if^blen for me arose yesterday when there appeared that we might get the Secretary of State for a big l"~ebeon on June 13th-- two days after I had planned to flv to Furore. Do I take a more ex tensive flight leaving July 1 ? Mavbe with the *-nern1 hocus-pocus in the office I should do that anvwav, though it is goIn- to be mighty hot in Stain in !t July and
early August.

In the general confusion I had thought this was the weekend for Philadelphia in
stead of next, bo unless I cancel that trip there vdll be no chance of writing over
the 15th-16th. Last Sundv the train was late from Stcnv Brook, and although I avoid ed Fifth Avenue traffic in to^n crawled, ao bv the time T reached the Saligroan1 s cock tail oartv the drawing room was jamma'3 with humanity. After shouting at a dozen people I left exhausted* though mv oresencs registered on enough oeorle I was genuinely glad tn see as wall as thoie I wante4 to be eeenby to tvA o it worth the effort, I supposeIt was interesting at the Easter service to have the rector sav this was the 937th Easter at which services had been held in that sw9et church. Organized as Christ Church in 1723, the building was erected in 1729 and has been used continuously since. In 1730 the nma was changed to Caroline Church in honor of vri1heimine Enrollne, George
II*s Queen, who gave the Church altar: oloths and a communion service consisting of choliee, mien and alms basin. This old silver 4s only used on special occasions,
mavbe en* d" the v"uior will let ma at least have a look at it.

YJiil* mnkinf? mv coffee recent"'" I hfard a clatter in ire living rcom and discov

ered a brash voung riceon had fle-rt- in the sti11 open right hand window ancl w*s having

a fe-st on the potted Petri?.*'* 4n the center window- Having devoured h*lf the leaves

and fl-wer buds he had knocked over a. oroteaK nd the sweet geranium in moving to a

better iAcat1

- rest. Closing th# door to the galley and approaching gently

with * dishcloth +o drop over the intruder, I frightened him. Stupid flew just in

front of m0* to the closed left window with such violonce as to be r-'rtr'ally stunned,

and remained quiet while I opened that window and encouraged departure. The assau^+ed

petunia is pretending shock and ttl

bloom. In

o: ' c there are two deep

purol sa and a huge riant covered with smaller flowers -yy^ite with merest variety of

purple markings. Bv Monday still another office plant will be in bloom, the buds look

as if it "^ight be one of the largo v te fr 1 r r- varietv,

Thursday I stooped to leave a couple of bo^ks with Aunt Mary and found her well

and the library and parlor filled with lovelv Easter plants, She wae eood enough to

lend me the latest El4zsfoth Goudge boolt "The Bean's Watch". It makes ni ea snt bad

time reading these -'daysi

Time out to go around to the Club for luncheon with Vera.

She took me totally by surprise in askin- if I wanted to think about sharing her aPart-

mentat 70 East 96th Street- She rosv have to stay more i%n three nights a week in

Rochester after next winter and find that * baso in New York so important as she now

feels. H moment the thought of her elevator has cons *Dcrable allure. .. Dinner tonight with Maria and Hank, no t that i-.- e- ing rl|** is over.

-

"laay

*

^ V- /$r ' ^:t*/c*r,hr*., Ari1 T", 1961

Surorisl Time to bat this out this morning after #11 which ia good as during the next month there wr5.ll be little time for my "-personal life". The income tax
returns and the estimate for thia year -were filed, at least in the letter box, on
Wednesdav# Former Ambassador McDonald did not want to hear "Martha" at the Metropolitanon Thursday and sold me his seats# Since this is a gay opera only this year
restored to the renetoire I was glad to be able to persuade Vera to go with me (she
is so crushed that as to resist going about). It was fun and Victoria de los Angeles and GiorgiOo Tozzi won tumuluous applase fro" # Decked house--though I have heard better voices#

To my own amazement I made the eight o'clock train the next morning for Philadel

phia, reaching the hotl before the ten o'-cipek session bcpn. You are not to be

bored with tVtt details of the "learned pacers" delivered in the mo*ning afternoon

and evening sessions# After chatting with a man from Ceylon I went to my room at

nuarter of "lye to cbenge into mv bl c1, brocade bsfl

with a silvery white pattern

to find a slip to call# yes* vu

it, HIS OFFICE. My secretary had bucked a

State Department c31 to me on to Dick Rowaon, offering us the President of Tunisia

at dinner or Thursday, w-r- 11. He is coming on state visit to confer with Kennedy

and it is not onlv short notice but will be filled with the stuffiness of State pro

tocol and Islamic idiocyncracy such as I went through a couple of y9ars ago over

the King of Morocco# However it suits me fine as I shall not have to change my date

of JuR8 11 departure for

ar^-ahed so likely. a.^eek-'agc. I gav< Dick a

list of points to verify with State and said I would return to New York on Saturday

to begin drafts of the event's budget and the working timetable the off5e must

maintain# Then I slid into the dress and went down to & "recaption" at which thejre

was no receiving line and everyone was stricVly on his own. It wa3 easy to spot the

former U.S. Ambassador to the Philippines now president of the F,P*A# of H#rrisbrg#

I t h a r d e n s t h a t I h a v e b e e n v e r y u s e f u l t o h i m e n d h i s propr?n n h n i w ^ dufixjr-. t e e

nat two years and they love me dearly. Mr# Swops's Niesi wife is most attractive

and a ball of fire. She darted here and there and collected other people she felt

I should talk to, Result about a dozen of us all had dinner together before the

evening session. I dashed off a memo to the office about things I had learned be

fore getting into bed and when the telephone operator called me at seven I snuggled

down and slert for at least nothap hour. Nevertheless I was at the door at 9j4Q

ready to go to the stattion# only to find that Philadelphia's largest fleet# 1,500

cabs , was on strike. Doorman made helpful suggestions that I might walk several

blocks and take o Bubwa-"1. No cabs arrived at the Benjamin Franklin and after a

12 minute wait we craved a Cruising *,b, who for reasons I did not stop to determine

could not take rae actual1 ~ into the normal unloading driveway# By a hair's breadth I

made the ten o'clock, which turned out to b tsetd* of tub r design cars* Very odd

the bulk of the passengers are onlv a f*w fAt above the rotdbed# though three steps

higher over the wheels in a compartment separate* fn>m the lower level by glass parti

tions a dozen smokers sit in comfortable chairs backing the windows as in a loungs

car* Again I had luck and found a sect among the "upper crust" . From Trenton on

there were many standees#

Arriving at the office a little after twslv* I set to cleaning up a backlog of oddments and then attacked the manyproblems, ^ihich will have to solved in cor "'unction with otVrV p*OT>! * toajc-roc*# Since Jerrv Wilrtot is back from Asia I have an appointment
Monday morning to get my smallpox vaoination at nin4, end drer^ed about on several desks red ticketted memos of things other people can be about before ny arrival,. * .. April 17--sorry, at thai point Larry's aunt Isabel telephoned that it was too miserable a downpour for hr to go to church and whin could I join her at the New Weston, (Her arrival had been geared to weekend convenient to me, when I thought I was in r--f dilphia the week earlier, fo " -*d to ru*1 dovhi there as soon as I had given Vera
her hour long telephonic handho1d5ng--unfortunately things had happened in the office
on Friday which undid whatever good the opera h*d done her,') We talked and ta|fced >.-
vv^ f "*? carry back across the Atlantic a ring I had taken to Mrs. Harris in 1950. It nov/ look- as if I could keen my June 11 flight & see Larry in Paris instep

-thov'- * thunderstorm kept me longer last night at Verm'e 'than I had plana to s+y in after dinner chat, the sun is bright day. So mucv rsin this month that we ere lucky our feet have not begun to web. The unfoldinw story o' the Cub.n rebe, inTaria" and our c*iBpli*acv has added to the we-k's gloom, flhil* we ao no. know the lull u c y vet, it seems clear that Kennedy was told of clans hatched <n the Centra Lency end rut into motion long ahead. This explains his reappointment of Al-n Dulles,
v ' + +* his Aocearance as e. nioo, dirrt little men has a weakness for dev'jmg involved devietali etrategeras instead of usins the simple, direct method. The rredident's conferences with Eisenhower and Nixon this week confirm, the degres of our commxtmsnt a long Ume arc! Time will rev-?l at what ocint we gave our backing to the rebel group -4th the poorest undewoflnd resistance oorenifation. Of coarse the rs.snts *.0 got lerd from Castro favor his continuation inrower, while the industrial workers w ve veined little end in manv eaee even lost their jobs through the irS tr Is onvtse hin, but being 1-resit urban esn easily be controlled bv Oastwc s force e. mni*a-v mig'-t. Poor Steveneon h>e taken e flaving at the hands of the Rusa ens in tne mi and it is onlr i small corf rt we on t-ke if the Pentagon sen rrove to the world that the teaks were Soviet T-34b not Shermans. I think I rewwber that supplied the Russians with Shsrtians in 1944 and th-r eomrleined -bout them and it will be hard te prove that the wilv Ru* iene had deliberately -mt seme of them to Cuba in the no "
nutting us in s bad light.
The French settlers seising of Algiers ore-tesen-ther netv situation fci" us-d. -- stick- 5'ith deGnulle as our NA^O ellvt Kv 'ranediete eoneem is what this will do to Eeurgulba, We fancies ''"self as the perse m-km betwe-n France and the Algerian dieident. Thr ugh hard work end some good coordination w have eottno nut *,C. letters +o correct;ens -n< ara Sell along in mailing 5.CM announcements to individuals inviting them te nay *2i a cover f . ui dinner ,t the Roosevelt Hotel. t .est wo are 1-te is - rcv-noi g. th- dinner and are at the Roosevelt, a hotel we have never used before be.evse all the others ar. booked. Earlv in the shopping operation on- banouet m.nager ahee-llv announced we would not get anything that week. I trv to cheer myself that the aigeri-n explosion will nuke B'juyuiba more anxious then over to see Kennedy. hen my only anxietv ><11 be that 80n neople will want to have dinner with Mm V

The smallnx innoculation has bothered m a good deal, slight temperature and a general mlalee aggravated bv Nason's latest little machination to "nut me in my p-ace. Unfortunately my "bitterly disappointed" protest embarrassed him, but so far has net o*Wfd th- -diet excluding me from attending a Stat Department conference to vhich I have been invited on the grounds that we can onlv afford four representatives -ti d ae has selected three other men and one women, none of hcm have the close and continuing relationship with the department that I do. At this point I am in no mood ,o pay my
own wav to it,

. . . . Meanwhile I have tlked to Vera about the world and herself, and tc Hank

about the planned departure of Maria and himself on the Friday plane to Paris,

morning's radio flashes seem to make that trip illy timed- ) Result I am going

for dinner and further discussion, and renlly should stop now and address envelopes fwr

this. Friday I received the first issue of "Th* Cernhill" to which the Whoeler-Fennetts

gave me a Christmas subscription, It is a very old. literary mag,sine published J.n

London and now a quarterly. I think it must have Ver y-eklv when Anthony Trellbpe

hod msnv of his books serialized in it some 90 years ago. The first arcici.9 is -

Art of Autofeiogr*nhyHin which Richard Church develores the inter-sting thesis --the greater copulation grows, the lonlier the individual and the wore regimented, ^He ex

plains the growinr number of autobiographies as manifestations oi ere iniivisual to a

least be remembered in history. He is an excellent writer and has stirred me to wisn

read his book "Over th Bhidge". Yeeterda" at creek of dwn for a Saturday - err;

r w.,,wvff.onav,t and t)re aded Andre not to "crew cut" my front hyr end hone the resulo will

be as easy to manage and at the same

none b*coming--heaven brows I do not have

time, Honestly little inclination to primr.

f\8t( /XeVUjT*C,ZlyK,k<tVyt ,Uv/,

V s".'"'
. ~ril , 19 1

W*1U where were we? I'm still befuddled by the ell the things to be penned for end attended to in eonneeiion with the May 11 dinner for Bourguiba# Arrangements are one thing and the $20 a plate customers are quite* another* For the moment we are better off, though far from out of the woods, and the former but pitifully low n the paid reservations. The Algerian revoJ# left us wondering on Monday and Tuesday whether we would even have the President of the neighboring eountry, but that hurdle is slcared. Personally I do sot share the dream of seme that we shall make several thousand dollars, Nason has relented, and after telling me I would not go to the State Department eonferenee in Washington on May 15th has said I tan provided my budget permits. I pointed out I had net been given a travel budget, but had underspent on my postage and telephone allotment. He eapitulated and I travel en these savings.

Thursday I had to find several hours to write up some background material te us used in a eulegy ef Vera in eonneetien with her departure. A dreary task but ens whioh bee&use ef her many aetivities and distortions, nine books, eifkt honorary degrees, set* provided plenty ef course materail ranging ever 30 years. It did take time I did net have te give. She is still dazed and hurt and I an running cut ef angles en whieh te try te restore her confidence in herself.,

* should have abundant "May flowers" in view ef all the April * ewers, unless

Mature gets sticky and insists that the terreste we have had are not the required

AP^l showers". A couple ef days I have gotten drenched either geiag te or fresi

the effiee. Nevertheless Cardinal Spoltaas1* magnolia trees behind St. Petri*'e

finally bletnei, the ire nearest his house mere amply than the other, Friday

a week ago they mowed the lawn at the Dilited Nations for the first time. MONMT

wltih
daffodils in the beds!

in fast there were mere ef them in the lawn than

Isabel had luncheon with me at the Kent d*Gr en Thursday before her dinner time

departure far Bradford, declaring she had had a fine time in New Terk despite the

disagreeable weather. Days when it was pleasant enough te take the boat trip

around Manhattan she had other engagements and just smiled when I suggested this

!?

to bring her back soon again. After almost two week Aunt Mary has

let her trained nurse go . Although better, she finds her strength alow to re

turn, perhaps notpeeuliar in view of her 90 years.

Dinner with Maria and Hank last 3unday wasdisturbed by their natural anxiety about Joseph, the Siamese eat. The vet thinks he has menningytie and was giving

lots of medicine for that. I wonder if he would have ailed for two weeks with that.

*] * * t a l fcil0rt S h e b a , t h e o t h e r b e a u t i f u l S i a m e s e , t o o k a n a p o n M a r i a * s

palette

wejwere at dinner. It took the three of us fifteen minutes to get

L-f* Pt

thn daubs of other colors from paws and other

jrofnrr^? 4 .

g*in*t a nig"htT*pa"ra1t#r0ootproraabildtdoahy?attrla.g*Trh*lyM*a*sr*e* an4

t0 tlj t0 'toi' on Friday night, though thy had forgott*a ..> detail of getting nail poi Taseination*. Larry *a* *ch*duld to pr*d

Fr*h ^d*r from Uuann on Monday. It n left that they

4?

l Sif

n*e**ary not go at the last soment. They *sp*etad

back on the 8th and I shall bo anxious to have their news.

Prodident*/ Kennedy*s speech to the newspaper people fascinated me. I met agree that a great improvement could be made if the news were more selective and less sensational and have myself yammered about that for a long time. However
. t emendation of self censorship on the part of the press will be hard to arry out, especially if some rugged Indivualists d not heed his plea. The opening speculation about how different the world might he had Horace Greeley paid Karl Mars more than $5 a story, keeping him from writing "Das Kapital" was delicious.

May T, 1961 On Thursday, May 4, Del11 gave birtk to a nine pound ten ounce son at the Army Hospital at Heidelberg* Being her father*s birthday this huge infant for so tiny a mother will be called David Fusee!! in honor 6f the grandfather* fc dislikes hie name, but been fond of Darid* About ene o*clock in the afternoon Delli was picked up by ambulance and GLevee, tho was duty officer at Cemerehii notified* David was born about sever, and the initial report sac "nether and baby both icing well"# Some tin ago Fran agreed to be godmother# Hhen she heard the news, fcer comment was "With four sons of my own, I can*t even get a goddaughter I Practically the first news item I heard this morning was that President Bourguiba has bronchitis and has cancelled his trip to Faoxville to inspect WA and on to Dallas, *iere the Council on World Affairs was giving a dinner for him Tuesday# Naturally my query is will he be well enough to some to New Tork late Wednesday for the heavy day scheduled beginning with a ticker tap parade up Broadway, the official Mayor*s luncheon at the Waldorf, tea at the Council on Foreign Relations and our dinner? Our reservations creep wp with agonising slow ness and I begin to wonder how many potted palms to order to fill in the empty spaeee of the Roosevelt Ballroom# Late Friday I found my elf tell the Depart ment of State ifcat G* Ifennen Williams, Assistant Secretary of State for African Affairs ihat to say in hie introduction of Bourguiba# Earlier in the day I laid been at the hotel settling details--had to take fruit cup instead of pate maison as the latter had pork in itf warned them to go easy on the brandy in the Key West s| oup deciding on the ckablis for the toasts to be drink after the rock Cornish hen was served and warning that orangs Juice must be offered instead f wine at certain tfcblee with a high percentage of Mohammedans# Th dessert was fun--It will appear on the menu as Bombs Tunisia and be Vanilla icecream with fresh strawberries since the Tunisian flag is red and white* Saturday morning when I started to do son work on the head table precedence and place earde, it developed that the most imporatn papers wtre still on my desk, so off I went t the office# Let ue hope that the bronchitis news does not deter anyone who might still be planning to send in reservations# The heavy schedule of other vents (charity balls, annual conferences, etc#) present a serious enough handle sap without Jewish people boycotting him because Israel has not recognised Tunisia, and the French staying away in droves on account of his having abolished the Alliance Fr&ncaisc in Thais# Even the other Arab States are lukewarm because of friction with Nasser--or maybe because he came out and recommended the giving up of dayligii farting during the Ramadan period traditional in the world of Islam# Larry wrote fro Paris that his Journey on the 24th from Lausanne was slowed by five police road blocks, while courteous the questioning became more severe as he neared the capital# Ths city itself had again been alerted to a possible paratroop drop that night and was ve#y tense, though outwardly calm# The people vers almost unanimously behind De Gaulle and mightily relieved when the putsch collapsed so quickly#

Wednesday I had a very useful morning and luncheon at the UN bv eouttesv of

he US Consr&tte for the UN which is specially concerned with proper natioarmide

observance of October 24 as U N Day. Harlan Cleveland came up from Washington to

speak and a couple of new members of the US Mission to the UN also participated#

I was impressed by Klutsnik (sp?) and disappointed in Jonathan Bingham# At the

luncheon Adiai Stevenson responded to an introduction briefly--the UN Job is chaUenmlne

an very hard work making him semetines yearn for the simple brutalities of bipaz*

t^ean party politics# I noticed during the meal that he seemed tired and remote

and semewhat ^evier in a not altogether healthy m&nmpr* Hw radiator sissies,

d E#t of.}**:

aow At 18 nurky and intermittently drizzling* I wonder

if poor Vera will be able to fly to Rochester this evening and about Maria and Hank

^ tjri- todv. At l.t X t.f

u2.1T

the torsade belt# #. Biree cheers for Alan Shepard and the people behind him at

LapsCanaveral* Next Sunday I'll be with Maleie A Jim Gash at Croset, Monday in Wfcshlngtexu

Q&B - /iC f

t

M&jy, C\je ^V*-/

*^'a^L"'^u,

May 20, 1961

The Bourguiba dirater finally presented a respectable eraad and probably from the ay a of a noainvolved person to have moved along wall, I saw plenty of faults* The dais was backed with a great red velvet canopy and backdrop dose enough to iha color of the Tunisian flag for people to think we had especially arranged it He Is an animated person with a wonderful mobile and expressive face,^appeared to thoro ughly enjoy saying the words Allah put into his mouth at the moment, instead of the agreed upon speech with advance text for the press* GUCenacn Williams exasperated me to the point of desperation* Bus at the hotel at six and in the receiving line at seven thirty, he arrived at 8t03 without a raaer or collar for his dross shirt* The hotel sent three sen out to try to find a size 17 cellar about 8s30 without success* Finally he was put into a soft shirt with the drees one on top, soft collar manipulated with nfciie tie and sent down to the Madison Room where Fred MUncs and I awaited him as the head table had gone in to dinner at 8slG I greeted him, apologised for starting without him as we walked across the room where the reception had been held, at the foot of the dais steps turned him over to Fred to deliver to Mason* We went to a second row table #*er several members of the official party were supposed to have been and to my delighted surprise were able to have a fruit eup, the rock Cornish hen and dessert* The tiger claw necklace looked well in the square neck of my aqua chiffon* At the staff post mortem n Friday morning I claimed it was the most difficult event I had ever done, Mason disagreed with me, because he knew practically nothing of the frantic aspects, frustrations and disappointments* He did instruct that I be given a very nice kit bag to carry toilet articles with a note of thanks for engineering another Top drawer event*

The three o*&cck train got me to Charlottesville about half past nine* Maisie and Jim insisted on talking to midnight, but I had a fine sleep before helping hang the new dining room draperies*Karachi made from the design she had "rubbed" frcn the doorway of an ancient temple* By the time we finished the flowers the Cattaralls arrived from Richmond and we changed for dinner* Very good talk again in the evening and much activity after breakfast as three dosen people were expected for buffet lun cheon after church* Lee Masters, the rector of Emanuel Church of Greenwood (Given by the "Gibson Girls" in memory of their Langfcorne parents) managed to get in Mothers Day, the public christening of Charles (age two who howled lustily) and Anne (aged four months iho took it like a lamb) Meade* Maisie was touched that he used two of the hymns she had requested the Sunday before the Cash departure for Pakistan one having been written by her grandfather Bishop Doanc* The luoheon was delicious and gave me chance to chat with the Gibsons, the Dumas Maiones, and other Albemarle County friends as well as formar-assistant-to-President-Eisenhower Morgan (maternal grandfather of the newly christened) The Cattaralls dropped m at the station on their way hops to spars Maisie the trip to town*

The State Department trotted out a lot of Big Guns for the Off the Record briefing on Monday-Chester Bowles, John Mcdoy, Charles Bohlen, Henry LaBouisss, etc* and staged a fine reception in the eighth floow Diplomat!e Suite from which there was a m&gnifieent view across the Potomac from the Lee Mansion to the Masonic Memorial Tower in Alexand ria and as far sast over the city as the Gapitol* Very posh sandwiches and hot canapes, little cakes, tea,coffee and lemonade of which I could partake only a cup of coffee and one finger sandwich being too busy having a happy reunion with George MeGhee (Asst* Secy of State for Polity Planning), thanking Governor Williams for his introduction of Bourguiba, telling McCloy, Labouisee and Dick Gardiner how much we m&ss them on the FPA Board and chatting with dozens of others* Back to the hotel to change for buffet supper at the Spring Valley home of Sophie and Temple Wanamfcker for people from New Hampshire to Los Angeles who run FPAs or World Affairs Councils* Sophie is the granddaughter of Rachmaninoff and was largely brought up by him and is a fascinating creature* She told me that 200 simple folk like sleeping oar porters, stag hands, piano tuners had unexpectedly turned up at Rachmaninoff* funeral quit {$$$$$ sin cere in t-i lr devotion to his humanity rather than his genius* Tuesday morning we had a roundtable discussion and heard horrid details of discrimination against the dialsingto*d2o about it* Wish 2th*er* e w*erat*ime" to tell more biut 1 must dbersofSfaniJuFarno,epiosrtt*rTyr-orA

J Su&e.

May 27, IS61 Steny Brook

Brace yourself for the extra spaces that seem unavoidable to ma in this machine of Molly's, plaasa. After the forecast of a fine weekend New York got torrents about 2:30 yesterday afternoon -- the sort of sudden rain we expected to last half an hour. But no, v&ile not torrents at 5:30 there was still a persistent heavy rain. Burdened with an azalea for the rook ga rdem beside the usual weekend gear, my attempts to get a taxi were fruitless and I resorted to the Second Ave. bus which moved moderately well to 34th Street. When the erosstown bus came I was glad enough to pay a second fare, ha ving lost my transfer, so long as I got shelter. But woe, the traffic barely moved for five minutes at a time and it took almost an hour to go the mile to Sixth Avenue, where I got out and walked to the station. Having planned to have dinner in town before the Administrative staff meeting was schedul ed until five and dull a s it was managed to go overtime, just as I had gloomily anticipated, I ended up following my pattern but arriving here at 9:45 instead of 8:43 as arra nged. It rained all night and 3:30 seems to be set to continue through tomorrow. This is the weekend for me to buy and plant the annuals for the rock ga rden--too cold to wear a bathing suit, I begin to wonder if I hsall be able to plant.
Last Saturday afternoon and Sundpy I had a fine time with Martha and Cleve. Azaleas were in prime bloom, pink dogwood very heavy, lilacs poor, tulips magnificent. We went to Hempstead to get some Perkins & Jackson everblooming roses as my belated birthday present to Cleve* Ke has rose fever, but wants them even if they will make him sneeze % After the Whitsun communion service we dropped in on Fran^ where Cleve took a whole series of pictures of me with varying numbers of the three youngest boyfys, only to find he ha d not readjusted the shutter. Baby Johnny's eyes are eery large and very blue$ a contrast to his three brother's dark brown.
Tuesday night Gerry Wilmot and I had dinner at Shanghai East and managed our chop sticks satisfactorily, though I am badly out of practice but she jus t back from her second trip to Asia did well despite a to me unorthodox handling. She took me to Asia Society to hear B.K. Nehru where I knew a lot of people and had a good talk with Bob Clifford, who saw us home. It is a lovely building with a charming Japanese ga rden, but s eems to spend $400,000 a year for eomparitively little result. Wednes day was the Off the Record Luncheon Speakers Committee meeting where I got the green light for asking a good many people for next sea son. After the Board of Directors meeting, some of the staff joined Boa rd members and spouses for cocktails on the 11th floor terrace over looking the UN ga rden and the East River before dinner. Later our former Board member, now deputy to Stevenson at the UN, Francis T.P. Plimpton spoke. He was no worse than I had suggested he would be, but siad nothing mos t of us did not already know. The Board did approve Yera's being made Editorial Consultant, which is nice for her. However, since then she has had two other offers, oe of which is with Govern ment. She is putting in a weekend of ha rd thinking as she is delighted with the invitations, but I fear that she will not find long term satis faction in bureaucracy and the need to follow the official line, when it happens to be dome thing she does not agree with, ...Tuesday I had lun ch with Peggy Padover, who ha s been asked to show the women of Malaya how to organize something like the League of Women Voters, a task which presents many problems in a new nation composed of three different races and freshly emancipated women. She thought well of two ideas I gave her ... Some progress on my holiday arrangements this week, but oh so much to be done before I can depart in peace two weeks from tomorrow*

J. M\N RRUGIUG. JNM - JULY ITM

Juae U Depart ldleviid Airport 7:30 p.m., BOAC Charter Flight.

June 13 Arrive London 11:30 a.m.

Depart London 3:30 p.a. on MA Flight #015.

1

Arrive Edinburgh 7:00 p.m.

c/o Miss A. X. Petri#

I

SA York Boad North Berwick, Last Lothian, Scotland

June 10 June 20

Depart1 Edinburgh, 10:30 a.m. on TfiA Flight #312.

v-4

.v'::

Arrive London, 12:00 noon.

s: ' : %U M ;n

i

By motor iron London Airport.

Vr-3

e/o Lady #h*eler~eaett

; -;f"

Oarsington Manor

;

^



$ " v.V "*t



,
; v,&

, I *v

iuWtM&& B'y

hear Oxford, Bnglaad trai' -niV to

*| 11 *i f K .;$*> :I>i!7v,t,'-\ ,'f

;>'<s

,/

*1 vm*

"v * p *-1*I*

c/o Lady Liatowel

1# Cheater Bow

London, g.V. 1, inland

M.&

June 30

Depart Loddon airport, 10:55 a.m., Lufthansa Flight #121. Arrive Frankfort 12:43 p.m. Bp train to Karlsruhe.

c/o Betel liaxkdolsiioi 2 Minheld-?rasdfe*atrasse Karlsruhe, Germany (not recommended by nail)

/ ; :v,;

Depart Frankfort airport, 3:45 p.a., Lufthansa Flight #150.

1

Arrive Paris 5:20 p.a.

c/o Union Interallied

I I

33 Faubourg St. BaacrA

Paris, France

Reservation: Fro# July 4-13 at Hotel Oxfor t t~ Cambridge 11 rar <T Alger. Paris, France

Juiy i_3-i6 By motor to The Netherlands.

c/o Mrs. F. J. kahlaeyer Hilversur , the Netherlands
Bttssummergrintweg 40 (Probably return to Oxford #4 Cambridge Hotel for nights of July 17 A 13 - but would certainly cheek at Interallied for nail.)

isiUA

Depart Paris, 2:00 p.m., BAA Flight #359, Arrive London, 3:00 p.m. Depart London, 11:80 p.m., BOAC Charter.

July 20
.

Arrive Xdlewild Airport, 3: f, v;-

**; ^Vv -.; .


S '



( Mi Tf 1)^, T^Cf

( $*+&&, {- ~ c"

Juno 10, 1961

. ;i

; p' ,-t ^2 A - V- ". - :* " *;

/. > 7-<~ - V *.# i~VX-Z'J&, '. ' -V :' aY ' .V<w - ' .VJ' . V

He ehsif purpose of this fa to unclose toe itinerary. dartha and Clava

has. been good enough to say thoy will lunch with ae tomorrow at the Olub and

on toe way hose dror oe off at Idlewild before my hek-in time of 6 f.. At

MS*

the moment I an depressed by 90 o/o hucadity and toe foreast of more of sane

tomorrow--all ay earofully pressed slothes will be sodden

of wrinkles

LLo^nncnon5airpokrt

wJh7ile

XTEgo**t5o^ 7jc*ot7lo*n7d

nost
irom

aoointoo*ay

t<o*Frid a"y,ilal s"Sthiterienisthae

ooa8tfuction **

Edinburgh airport (called Turnhouae)

and to. probability of our putting down at a little old wartime fi.ld called

LastFcrtuns. Addis has warned as not to fear that ws are Baking a farced

lefcdlpg in a sheep pasture if I am taken to Last Fortuno. toaaliai of all of

toshdV.*5jeTLHto , f **!!*eaxnpdsc*oi7ve"o1neuobranboo.ovSoror"r"yi,Bxbtgfootrinthtoistololcaa, lbfultight had bettor explain. BOAC transatlantic allows firet olaes 66 pounds, so the

eniT'e hi rninoout

13 to

V topesat during the trip), toe

Ollorble umbrella my aserstary save mo yesterday, a book i mo taking Judith.

T * lUer:

" tC Uk* ***** *r9 n trouble .ad go into toe big

J unsti,l IT st?a"r!t!0b^*cklaLfroooradoLuonrdaoninotooaNtow YoUrkB*brollo come out end go over the am

*

a. _L^*T35tUrd*!I L4id * lot of

crmnds until it started to rain. During

77 i ^7lL77;i f77?;*d ,md fin*Uy Mk9d Li#"91 u^ u h "ui

Tto a tLttlJt J 17 "7 B"d if 9 would h "hb office with me.

Off!1 717 1! 7 7

Bnd afirt9d' 30 1 "* slated for a two window

7: ", 7 Q 7

b<i 9V9r' * flQUPl of square feet larger then my

b S'\' v.'v'
gf

STT S ttoo bbee aerrsLotteedd'ffeowr ttoh*e n<"an5uteJ)i;t3hmeomrumhaonfdrv orinItrwiooautlde hararraenhgusmopsaedts, tooef nebwaspt aIrtoiotiuolnds

do was to p.0k up my littl. obj.t d'.rt.odd peer, and i

m .M f

Rr/,,

'XT ! b' pu#*4* Ur ""Cretary eUl be there a week after I go

SftS

777i J1TbRT*

7 f8 eeup,9 3iao*

wW a JrObTaed*tbolsthat9b99ui^ldin*gin"<1rt9u5a3l

nI oAvot

to the four

block half a do sen people--close neighbors in the present epaoa invaded ay office

*^r* 77 9 bottl* of Dubonnet to toast my getting off to TVr.. lT^ tn-. tory sweet of them and I began to wonder if 1 had boon

ZHTaJT!!!!. Ba7ui kno,rfj,!? iU w 4,15 1 imritod to th. Sditorial

il; ibxLnd jtreet.

s!h?ad/go! ne tofoernJdw le"rs'9sMftr"oo"u-"bW clei ' 'f~o,arrtu: F,s1ra-end"drNswuaans:cc.v*e>rn*ye*wkainpdar.tmnenvt m on a*

' '

'" . M-.V ' '". I
I
I

dust *"7'd*Y

181,1-19 9ad MaBk h*d M fcr dinner in the studio, ifc are she had portrait, of two children and he bed Just returned

7** ln

""f twT* Fne to Oak Beach for the susnsr and I was

fortunate to sec town before leasing as It wan impossible for re to amply with

tH U7'<T. 2 Ut th"~*

I able to give , drink to to.llf,

BBjsnnnr^stttt'es^it w.-7uldd*h7n*rad#rb4c ^ A9kAn"rd" for mtht^tu,rrne eurp*tt 0frf?iresni^dF,tooRf two.ithouuhteenlaswra-

I I

5 *ewti"r'.*Ctoroleedhtd 7ll" 1'm 777 "**

but the Security Council

h. off7L7fi "?v''9 Ud.^* 1 "" ln luok- Ineidsntly the

fLm c7ri7w to*

0a1 7

London in>crt for ma next week uDon by rstum

I

,, 7 rndSrfUl lB

r'9 ei5 Into and ooroan Lender, and?!

of

\ ,!w 7* *" yU 8111

trm

iiinrarj- there 1. plenty

>-;y:

HiiTM7^ 7 2iw77 7 "9rr 9,!9r*

tbe few days in North Berwick and

.basin..g7,!?s-o msanws.il.brItob*o'pshttheinsubnedesarndwaagse lwoenlgl ewnidthlaysoyu.mornings, as I feil like n

.*5
iJt.

i'i y'Vj , ^V.

Hrt!

CST7(>BBJ /V OWyCAtZj (

London

June 21, 1961

. C o u r t e s y of Judith Listowel's typewriter . Gwen Crowe and I had a fine flight on the BOAC charter, with heaps of stewards and stewardesses ply ing us with food and drink--the former being preceeded by a very formal printed menu. As the steward was serving the after dinner coffee I asked what time they would give breakfast and found that it would be in about four hours. A fine tail wind got us in earl# and I not only transferred myself to the one o'clcok plane, bought some pounds and stamps but had a sandwich. Addie had warned me about the primitive character of the East
Fortune airpport, which from the air would appear as if we were making a forced landing in a farmer's pasture, but the tarmac was fine and I was only seven miles from North Berwick instead of about 25 had we put down at the currently under construction Turnhouse filed. Her apartment is charming, much too large for her, but with beautiful views of the Firth of Forth, 13 miles wide at that point, and crowded with rocks and craggy islands. The pilot puts out from NiBerwick and at tea time we made a point of checking on the shipping. Eastern Scotland is les3 -a^y t^an western and so we were not interferred with in our expeditions--Tuesday of N.Berwick, Wednesday to Edinburgh, where I found too many of the fine old clubs and residences on Princes Street had pushed rather low class shops across their fronts, and Thursday to the Gullane Golf Club for lun cheon with Edith Woodcock. We had brave ideas of going to a church fair & on to the garden party of a home for wayward girls of which Addie's cousin is director, but happily lost ourselves in the ruins and beuatiful gardens of Dirleton Castle. It was built in the 13, 15 & 16th Centuries and ren dered uninhabitable b Oliver Cromwell's cannon. On Friday Ruth was good enough to send Harry in the Rolls to fetch me at the London airport, which made the journey very pleasant for me. Further she nlained a curry o_ e&gs which only ^ad to be nnt +0"-ether at the last moment with do danger ol spoil ing--just as well as my flight was a good twenty minutes late and the regu lar Friday traffic was augmented by people going to the last day ^ot Ascot racing. I had the green bedroom at the east end with the view oi the garden ablaze with roses, lupine, delphinium, the end of the peonies, beginning Oi lavendar and endless other charming things.

Before luncheon on Saturday Suzie and Frazier Meade arrived for the weekend. Right after coffee on the terrace we went to the church fete at Thame, where John skillfull* evaded judging the children, art competition. He and I bought things like mad for the Garsmgton fete tables, delivered them back to the Manor and picking up Ruth went to Ditohley to see the house, which has been bought by David Wills (tobacco money) ^turn.ed <over
Haa*sS-".SS-t=t7a58sSssi'w 8-.aSt&u.tLsS,rScSrUa*u- tn n foundation of which John is chairman of the board and dedicated to t e
she and Tracy Philipps moved to the East Hagbourne u-range.

us for Quests

lunch on I hardly

their way to had any time

the Shakespear Theatre to pick sweet peas and

at. cut

oil

dead *r0ofses,

two

of the tasks the old gardner lets me do. It was a lovely visit

Oct. m*?,'^

1J6unCe h2e7s,te1r*6R1ow, London sw 1

^ \dith is out tonight and I at ho*., ao U gp>
use the typewriter-Hungarian, w i t h ^ s o n e ^ o f ^ ^ ^ However , ^

p l a c e s , where J . e 3 c p Z t t f , t Saturday a l e t t e r came from Larry on my

mbroesat kifmapstorttraynta sTHKXiNnGg

if

T I

wwoouulldd

find

it

pleasanter, if he ^ 3unday>

can get trie July 9th,

snteocpepssinargyabt uRshineiemsss

t op p v"ie*w/ tthtehoe a td n erda r ali ^a n d

visit

a champagne
mil as he

cwaavs e

and also at brusells. Also would I MP * y WR8 dated -.Vednesday X

ldeias

pv

ai nt cgh

et

hd e

a2w8 tihr e

f

or
and

left

for

The

LLii tt tt llee

Srange"

t
l

o
if

sp
e

etne

d n

a

nt hc

y e

wofeekt he

end with Tracy's cousin ^va .dlen, cottage. On trie chance that Larry is able

the appointments Qf Thur8day, it

wwohuicldh wbeoubldesjt utsot i fuyse

the

Xn^teLrallilieeee aadddress

for

mail t

^ a n d

also Hilver-
Qf the 8tooa

sum. It

p8he ilsVgets his8mail at the Interalliee, we woul

i t e -ethe hotel might not.
Eva is delightful, a widow about my age and we hit it off well. Saturday afternoon we went to another churoh fete at the home of irxena of Ruth and John. It was sunny and hot, not nearly as pleasant as the Thame fete. It was interesting to see how the grounds have developed developed in the four years since I was last there. She was very upset that her roses had passed their prime, but the garden was attrac tive with lots of white flowers against hedges. Sunday afternoon we went for tea at one of the half doazen homes of Sir Allen Lane, her cousin and the managing director of Penguin books. This farm house some where near Reading was occupied for the weekend by his younger brother Richard and wife Betty, here for a few months from Australia and their very large farm. Their latest addition on which they hope to make a lot of money, which they do not need, is Chinese gooseberry. This Berkshire farmhouse is* about as old as Garsington Tfenor and to ae farily unattractive, it has been added to and changed aoout tnat it might as well have been built yesterday and to make matters worse is painted pink ! Betty and Riohard were snch fun that we 3tayed on tor cold supper and got home by moonlight through the winding lanes &va thought nicer to drive on.

I got back in time to have my hair done for a cocktail Party

Judith gave yesterday--a fascinating collection of people and all sue

interesting conversationalist that I was amazed at the lateness of the

hour when they left. Today Frazier ^leade gave rae the grand tour of

the Embassy, on which the architect did a bad plan for the amount 01

wjrk to be done there. Friday I had luncaeon at their very nice home,

tea with the hlonkhouse sisters and a drink with Beirdre &

ley (Judith's daughter and son in law.) Judith and I loved The t

Soldier Smith" last week and look forward to the oound of .usic t ie

night before I fly to Frankfurt. I'm busy enough considering that

I loll in bed over the paper at least an hour after my breakfast r y

Rut the

h is mat

i

in ne

e

t

ow of

n

& "R

we oss

"

l

u t

n h

c e

h s

to to

ge ry

t

he of

r

a La

t w

the renc

e

Tur of

f

C Ar

lub abi

b
a,

e^ me

ew;eUa tfheerr



continues ideal.

~t C^oo-e.-- (CW-7J

July 3, 1961,Paul Revere Village Karlsruhe, Germany

ideal weather prgress to very fine for those in the laundry business.

sl!Ssvkk

^SSJfiSssfjVHa&TC.i1a-Ssrss siffj?a l.t.r .nd

.J.

t.!.pfco,,l,,g fro. 4,,,,ol.

SSi-SSE*-S SiTM?; ?p'i' ' 2--llke botu*

opener sat on top of the freezing unit.

... .

ffi-t-t-ip and their quarters attractive with a combina-

s i f t j r s j ssfts?-

trees. On Saturdaywe

elli Badeb-Baden, twisting and turning, climbing

^overWf000 metres; from time to time the beautiful Black Porst gave way farming areas. Hay was being brought in and in almostevery instance it was handled by teams of eight with at least three women in the group, poor o ve

was disappointed that the heat haze cut down the view to the kest

^

flat Rhine Valley, but I found it all very lovely. We stopped at a new chapei

at Beuhlerhoehe, completed since he was there in October. Adenauer had given

the statue of the Modonna, very plump of face, which had been on tne a^ar

until a modern mosaic of the crucifiction was unveiled as reredos. The window-

are very high, no doubt to keep the attention of the congregation on the sermon

and away from the lovely view. We had lunch on the terrace of a small inn

high in the mountains and on the way home went to Durlach to see the

-from

another height overlooking Karlsruhe and the Rhine valley.

kptJ*"1'

park has a not too attractive memorial to the German deao of World War I. her,

we went through the Schloss area of Karlsruhe, badly bombed in WWII, and being

restored in the period of the original. The city has been a court center and

official offices approached from colonaded walks face the Schloss grounds in

a semicircle. It was here we first began smelling the linden treee blossoms.

Sunday at 1:15 David

Russell was baptised at the little GI chapel

and cried properly. He wore a charming gown, which has beenused by many in Delli's family, and at one point was made hotter by the priest s addition of

garment embroidered in red even to his full mame down in the corenr provided

by the St. Elizabeth Guild. Throughout the ceremony Laurie stood on a pew

seat uttering one syllable to a little playmate three pews behind, who responded

in key. Afterwards a group of neighbors came here for coffee and cake. I was

not only delighted to be present for the christening, but to come to know some

of the friends. Pictures were taken at the church and in the middle of tue

afternoon Cleve looked for his camera without success even car that it might have been left there. Two minutes later

after Rose Parsons

who

nadd

served as Fran's proxy, shifted in her chair and there was the camera 1 In the

evening we went to OberBayer for dinner and to listen to the orchestra. I

noticed that aside from the family groups, girls came in pairs or trios and

sit fc tables for eight, ditto men. At nine o'clock the tables were moved

to the left of the band and the fun began. Cleve and Delli had never seen this

dance pick-up there, but I found it almost as much fun as the music.

It is still hard for me to understand why Cleve1s depot is^in the French zone and the Russians have a military mission in Baden-Baden giving tnem a ro
route of access through "our" gone. But such is the case.

/fcfvw* .

-- Alc>ul/"_

Pa,<*a*j _ UujCj*. 7

t-&p U^~ J--/dy Ijl (fgf

k*F Tu^ ' vi < ZltU / /"c ^(^V< b^JsyAJ~~ L.') t <x yt"<.- j\<M fV ' : -vr>,c /.. .,

t\.7^('{. ' ..j

<^i, &

'}: Tv^C'^y 0,,

',</ ^

'Ajc* /.,,(t(<-,<.

cChpGZt^ei ^ ^ ^ ' vAc' 4^*

" '? / //../ ^

SA

/ /.iL l^fcA t ; t-\'- ' [rv!- / f ~ ~ J

1 '.r!''^7-c

/DycM 7--

O-'-yVfyt ''< "'>' //r>t-WvA/.fX .,/./7 6 ,. ^ ./.. r((<1 ""'* O *f



i --1 I 4 vs % *

''
'

r

\"a'") '(j p -C

c<

"B?*w***ik/*' sfej^' /Ai,4

I l^c yj

.

}

Citt.cu.4X M-^^C ^ Cct'iSCX' K-* ! feUf,' l~C, 5 fT" AAi- JJ y'

4,., A~
hQ*. -- '-/UC04

YlfK'

AC-.,, Jt t*

rl " Civi

i AT - A

7-, 7. g (|

?h v*;

44^

v l& a#Cii,,/' ,,,

// /!'',. A

ffHv <'A<!7 lo<

ta.-ii~ "jit-1 tj!u fcyJo

t W. ; J:- /' it-- S. < >K. . ij.'. .,(}' .- Ci.-sjpn'x-l(

f
:

L"'''K' J ,:'' ,''' ''/ ''

/

-

':;f
< A..t

^4/C,

;:j
^ c

'- , (i. 30

j ,;, ;

;Ar fcJ'.LjCO'tcl.)

-t

Cf,L,:,i,r:'.r.,)',...r'a

Ltt^'

'

i < / v * u * t z y j . . V - - ' / / r v - -

r

.AfI,.

<-....'/> A/,

'

v./ ..

jv,,

,71, ,,; _4'!

4te-

u

L ' :t *: {;-- ^

^** v,

'

k.,' "

fiM / " A

V/

/ & 7:- y | v/7

T teW4;.

;

^x^j,x[x ,xt r w < r i , . ' i rr~ /-> Vf ^//- ll"l'':Cs - K-{ >"p~~ J v .

: 7

A T / ' ^ x

. / ' : r M ( a ; -, 4,,:,,, / ^, ^ ; f

^14^^ y *'"'//
ct l/c

^W ~ a ' V ' V t l - V y 4 ./^ /; /'

A:

4'^
.

Y$ . H$ f"/ '-,/ "'.'

-
"

/^H*'';'|*a-a -' t/.|_'

,,


4C^iiu

A
-

riwX !

'

4f ! -,- r

.--" [# trf-.iI.,f -Mt+vi"a.

Ar~~^ " it ')

-'* r
i --

I

^ A 2 ; : ;; r v ' -

A t o ! ii / -

,? ?

f<fc?5":!-

%0P**.
AA4 I t ^ , , Y , J f e 4

r ^X ri I r7" f ":;"r'/" :

'-- :; l &| . ,.,,

A 4i4l

^tu iMt--k



/

r~
'in

X '

r ' n"-M' :"o '

(* u.tr.* 'tifrtPr ?i

A -

a ' ; . " 7

fea

?;** cmmX f
ctf' e 'vG VCT /,, 4f /

/ /~" 4 >i ' ' / , 4 4 ^ ' ' - ' < S .IS ^ S - S

v

' f' " ' !'/ :- ^ t/W w A....|gjfi

i -

A

J fc! A /4 ^ ,A- A- - , .ya r . /

7.7.ry/, ,

\i 'r (lAc -7" TfL 4o U:Tti /'>; Y /'?>' ^)A.c.$ < U (rt Cr < MO -/A . cLiltf.'. 'C .

, _ ^ _ i;_ t

'f6/

7i~<-A^c$&PAPfBB"PJ B-^Bh|-BO|nBs>M&PPPtBsBi.BIB5oB< *BrBPylP^WBPi PBB*B.-~.IVB"PpW_ ,P,(Pr~B/^,P,9IPPPPaB. Bj..,. JBjBBpBBBppWIipBi ^,

^

oiLrvjz, & > bo

a } ~ 0 k y &U$. &J-*S> , ^

<=l^~ p^SS^csT* U s t ^ t t i

^ Q- T/LMlcCL o^jrt CeaC ^ ^ r ^ M Lu^jit Cuu v <e

S-G-a-vxe ^ / f c ^ 2 ^ i^T<L*re&sxb

'

pG/foLAsi $"fc T^G^uzi Li'^Ue~J t^c jpajt~?!' h_u^ /

"7r

^<4<yaj/Z dLt%bpT~'.ztAzuisS < w f - cU-uv-t^ *-

<z~ kazcn

/ / F c < H H t 4 ^ s C c < s ^ - au^Au -V<LHat_

jTff J 4 f

V 7 ) ' / /Hi' I ^

n 7

^

cjrtft^

^ ^UaZo.JT' Ih

7 * Tt e ;it/lfLT k'4'.4 1 "

^

^ c , & ^ y> /,t e y ^

*

weeterftt> ^ h ^ 4 L u . ^ l a

DT^h-a

* ^r 7%

yz'ttt:^r-^- - - ' '"^ if/77
^vhjAg ^ /, />r-u.-

/ ^ ';

' W//c

^ ^ ^ - lZa it

A-^A.^/

^ >^-5ferekX '

'

f b,^j) - / ,

7 ^

- I .,

A^ - v Cc,

y) *~<rv^iL0^

^ wCt -ACc' -y*y-<H,

vttkW.u f' I

wA J;6

w

1^ S& ^ f vyiy-y^ttzr f/fccrrLfU i )/r " "*T fI " *fca" r*^^ ^

twd' WL,
4e ^ A.JJwt t^. -rf- ^ ^

^ '/2 ^'<*<4$

/ VJ'rC

LtAAy

T ] \ & s i y > ~g^o .

(

^

17 East 64th Street --July 23# 1961

faally"**and ny a1aera"tatrr*y iJnfto aWOfffri*en^st*s,r Tahpe eBrOfAeGctl*ytriwkndevrfufll+4h-onliday anjd sat, th* to wort given so 1b Pari. we had to bo fe^.d to rrL^k rt\

SS'off^rC^ r^%aenJ 1 th* W' "> **

Ut.^

J^^Td \ "*? in,Bo,ton for

"ddefup to a S

3K.SMrT-sr?Sf2 -^uasMks as
naiued horo I turned to a bath (hi# humidity and tsmep.raiur. in high nU + . sd

up the dreosee. Suopecting the Setauket family would be swdmmrt? t + *d te hang

then until after I had southing to%at Xt"

Lnrtf ^lng ,

Molly tried to roach me and got a continual busy ,, S! Ld th!^^

B?raln6

L T called the office and learned from Billat ]2 rt.f r

v ^ fcefore

eo h

agrtcAthtreceonhcaeyrnin.g Htheocua#lleIdaBrriivlledandthefonunindst+eha.+d vo,f. vqu!artwe! rlyt ^xouw r'and*JW#^"ed**CClle^yee iJnf*1

pitS ^^.i^^^rdiro".^ *^ ^ s-Kjffj' 1 1 door, arranged that if I did not show up on the twin l^vinfru. v'^

?n th*

to nest him hare with the spare I r i I kir rtrtffcf^

Yrk at 3,09 Biu



Itetan*. autobiography had kept th. ree.iv.Xf Mg* c'plft^^^

gcirvoesnsinagntihcee hoocetabn rueiajuksfeasitt. wV*s bsertftfleddvdlLi#Jtw + h!f w+ sV,sft*Pw'strwtSickk"aSnd! *w*ere soonllatfUte*r wore back with more oof fee. hot eavouw . ,,..J\ sleep and in about four hours they

hour later the preluneh drinks came around nd

*e * eould **t them. Four

Z ** the passengers knd alreadTlhavHlf^Tlff,!^?,,* T !'!a1,

take Bood aTM of

isdchleeddualwedaytowiltehavoeneItofmtihneutM es eatfw terooculr^ef

!?-i!T

del^ in ^don, which I

i+S^f* directors,

W-B on another charter

hour ahead of us, yst when we ir-rtLf+i?I

they were sent to Pre.twit# about an

lounge. Ve did not see them at Idlewild ^here rt IA's i?.the distinctly unattractive

arrangements hav. been vaeUy LpTo^ ' York

?* PUblS h*altt S^U*

Mweaerkthaanadn1d .Cslotviell*like a.st*eL bDaattflh.rt.TM n Bn today's forecaT st wha0s \1!00re!/eevI6rraelm*ainedftiwith

laintdtlleateboryisnfothreaevcceonkinogutktloaUsyt nightas a^fesleftad^Ji uvraFrt+io? ncamof hJ*e"*r*1July 14th birt^hudary

staying for another sort rt#tfele^

1 ?hfrt Setauket. I WB well rewarded fof

a ,, "" Cadillac, since it was stolm and deliblra^VcBf,"ny U Wine *1& for Jay's

fri#tening that th~.li,,^f^0 rtea ^f Sl "fn/ire

J^al loss. It ie raSer

.,, i.

th. French border. Too latfto hW for^ ?etIPi* f 'ref' third * th W

a sandwich and carafe of wine and found thre

+r8*jaUraI W8

^or *

**or

give the proprietor peao.X c S !f *" r ?r,handl >** "een removed to

buying rolls, cheese and fruit for picric w# fnnn* the bar, happy not only to give us "here" sandwich??

f !fl? ** r**ohM ^ Pit of

I

a delightful woman behind

sliced tomato and herbritha ?urbl,Sf!" S? ? th* f^y larder ^h for hie small glass of red wine he ihntt b.f a* each of the habitues came in

t l ordering . A step further along for pastry gave us f Jur*d" all of the others before

aftertfaubeuge, and anoieit fortified rt^ u^Lv,

***st and " oroesed the borter

now show, af Sid ga^ in the m.^^;



match-box" construction Aops, hotels and bulir.^i . ?

by nodern "concrete

ni#t in the Falaee Hotel, where we had an ??cln !n? ?i'1?<u d:1,18S* V* "Et th*

comfortable. It had the regular Belgian divid?d ?h t^

S*r* my rom ** E03t

entry ws a tub and washbaeST*il? rt ? SSJ5."bathroom''--on the ,i#t of my Aort

bidet. Laurence had appointments with FurstrTM

smaller room was the toilet and

me in Bruxellee it rwlSid hnewaviili?y.. wye. left ^ at ^fiivetanrdegtohtetoneHxtilvdearyauamndfoars duisnunaelr-- forat 9,

#P3 ft+T, foa*t,~frc.,

,,

v- ' tos

^jL

7

T<JV

-

j

Tha tide Is at flood and toe boys are all swimming, Jay is haylaa his firat lesson with the aqua luag and fins and not at all sure Fred

is not planning to let bin drown with a Tiew to inheriting the Ford~rlek-

up truck. I left the otffiee at four on Friday and was here at 6*19a

stunt I do not get away with rery often. Up to aid July they had a fin e summer, trees and shrubs ha re done partieula rly well and hare made a

good second growth. One variety of aaks are tipped with bronzey wee leaves

other trees have a foot or two of pale green shoots, which look almost

indecent against the darker grnen. The family is well and all very

engaged in their own activities. Yesterday it poured, so haying retly relearned to play Dominoes at Hilversum I started a game yesterday

morning , which with various combinations of Fred a nd Eill and their friends seemed to have continued most of the day. After lunch Molly

Jim and I went to Holbrook in the middle of the island to a sweater fastorr ana bought nice ones for new babies--poor dears-- cn the assumption it will

not stay as hot as it is now forever. Of course, I was politely invited to swim , but decided that the two o'clock sun was no place for me when

a^HLCree\p0r0l.1^0^8<,,aiehty to*PW*S a fter too short a round of r-

SHMSI +v, S01".,

is efouni8i" whatever tha t means...last night he

vfa ,

+hf 5

^+

y
rear.

CSr skillfully avoided Excuse me, time out to

two spy

parked on two

oars but badly denyoung Dheasants

looking for delectable tidbits under the laurel 25 feet Sim me!

A++-3h+v.ffi^e.?aS BOt 0Be baily this week, though I still have not

2r;?s&v'uaR.sf

STi hi1susjiS,' "fording to the chart I had left) and the apartment! Now toe
Civil Defens e Commission has warned us of hurricanes rates ana -finna. in August, September and October with to. added adSoniti!n to

water^mesnwhii a* C0Biibiom lay in supply of tinned goods and drinking7

ha- Cltorea the an+?Pfr 6

? rt UP windows. This fascinates Bill, fto

w,t0'r"

'>

ot ifvss

of hours work in his Amsterdam office Marv tnnk t .

a couple

ihcineoBusrobmeerruyseafnudl sskoomueuicottfk-er tiems he wiatn,,te?d.u It ^was 11 fa 1 Tcnofua?lad ? har re

Franz in time for l^ch ft

SfJ* aot beB for the need to meet

about 20 miles a^^o! dinne? It ?o!t

W# Wre taok in ^sterdan

Friday I had steak and was !rsfntld with ?!'

frgetting it was

tThheeaytrhaedoisleravecdan4al,6t9o6,s5e3e0wTbhe8foWreestme. AqftAernw wnard wejwt..o.t to,'tthh^ecfrCrair8r70e

the dancers were excelleat, "ut for the

soke of

or even ennuciate clearly. There were souv<*n?t r*n explaiation in Dutch of the Stills If +

ca8t ^uid aot sing detailed

got all the unsavory aspefts of Sf gLg^ar betofen

a?iiW*a

Hicans all too well, Sunday evening we went

and Puerto

restaurant for dinner Das^iL If* n$ IL n ? another very attractive

route. Monday we sta rtei hffv S I Queen's country residences en

7,1111?.&\i iwe.owueire. only reallv atonjr.ia.STM ,.L!.rr**r,! TMn,Hhtn:erfSu!ll1.raiIfn,,trhe round t- rip

tJtV French side of to. iSSHeS?!.

^ COBtrols 8114 tha* was on tie

was down and a keen eyed official look*. changed easy conversation Sth Larr! f!f

tne rei anA white barrier rry carefully as he ex-

were plainly looking for Fih* +T

but not asked for.

eht

us e*' W# were EOt what they Passports & oar papers were ready

JU

f ' hi l Tv^O r<r

hh<^, M-fT, c^VV(

August 6, 196L

At clgit o*clock this tv ing ths radio revealed the temperature was 85 o/o but as

there is only 50 % humidity and a pleasant breese here 1*11 ^write at least a little* I

had bought to got back to town yesterday in time to pay bills and write letters as well

as wash my hair things changed on Friday afternoon* I was going to Freeport for a COUDI

of nights* Maria called and asked me to spend Sunday and that ni^it with than at Oak

Beach* I happily accepted,as they tried me twice in June and agaia a week ago, even it

would out seme hour, from *y planned stay with Martha and CI eve AMD I neither had a bathing

suit with me, nor time to go home and get it* Traffic was so slow that I got to Perm

Station that I had to stand most of the way to Freeport, but it was cooler there and we

lad a pleasant though humid evening* Saturday was sunny, hot and heavy but CIeve wanted

to get some miles on their nice new blue Falcon and took us to the North Shore* We steonsd

at Melville to see an 1812 Presbyterian Church at Sweet Hallow, where a very friendly

woEian she was doing the lowers ms delighted to show us prereeotation photographs showing

ru

pot-bellied stoves with their V shaped flues and urged us to climb into

the belfpr* They had done a beautiful job of restoring, which bro8ght up the congregation

from 40 to 400 and are now building elsewhere to fill their needs. They plan to move the

old church to a new site and use it for a chapel--weddings and christenings. A large lun

cheon made us glad to walk about the baling Museum at Cold Spring Harbor--a very inter-

eating private museum commsnorating the whaling history of tie town* Their fleet was not

as large or famous as those at New Bedford and Nantucket but as it Involved the whole town

was very dear to them* CIeve and I were particularly impressed with the 600 knots and rope designs mad by a Capt. Patten, USN, who seemSd not to have any connection with the torn *

The ship s company of one whaling expedition showed the t&lest mac to be 5 feet 10 and 3/4

incieg ana most 58 i'1 or 5 2", another showed that two out of three men signed on the crew

with crosses to be witnessed by son of the few who could writs. A bird like little woman

wi ,h keen blue eyes explained the name of a prime mover of the industry to me. Welter

Restored Jonfawae so named because anfi elder brother named Whiter had died in infancy* a little later we stopped at St. Johnfe Cfourch (1862) bedide the lake above the Harbor and

?!luTVn fT*7 0f Walter Hestored. This church, too, was admirable simplicity and also had velvet hanging behind the alter instead of a reredos.

in

it

., Han^

me a^out

a **

the "first Sunday" and Glove was covering all

^*.Srvi0S Transfiguration. How Maria and he and I talked! This year they are in a

different house, again at the water* s edge but nicer from every aspect. Frankfurters were

charcoal cooked and those which came to a sandy fate were quiokly picked up by a lovely

* ? ? T?full

li^hted t0 snatch this treat eight feet from us. The light across the

inlet while we sat on the front porch surrounded by most successful window boxes of petunias,

ageratum and geraniums, wasbeautiful* A lovely place for daiquiris and to grill the steak,

but we were glad to go inside to eat and view if all through the windows* Hank, although

or .as holiday, drove me to town this morning claiming that he had errands to do.

. .JInTtP?rl#TIJLlolJ-?d in bed ***** =y breakfast and tried to do an errand on the way over

li6 r ! * m e 9 t , f o r l u B c h *

he

throu^ his appointments

early he was able to read his mail and the papere and tell me the news fey "to e time I arrived.

men I got there first, there was usually mail for me and I read the news for myself. We

not only had our favorite corner in the drawing room, but "our" writing desks in the writing

iootj. Mine afforded a new of the courtyard and that meant observing the members arriving *

The bulk of them^are l*nch and many of them very old, so old their dress was unique in many

cases, and undoubtedly either very wealthy or ancien regime or both* The ceremony of arrivals

and departures was so enthralling that the writing output was negHble. Almost every day we

wars able to eat in the garden and as Larry was described as"one of the*young* old members"

if member to another, he is something of a pet and we invariably had either* a

fc15^+tr r^a par*iJu**rlT' desircable table. It was very cosy and most pleasant. When he had to go for appointments I entertained myself and we met again for dinner, to be

d7 ff

a

^

sidewalk cafe close to my hotel. The night before we

ftlilll

aplodtd and burned both palms. A man at the next- table had just

PPrreobaabllvy ithheTUwaii+t*etr, tlyhe lba*r 4ten5deeramandtaoll the cUPliaenndtsIinssugigdeesttehdouLgahrtryhegeotr tIhewetreeambaadg,*

(t-hejr already must have known we were American----or at least that I a \ w,,*.



the nasty deep burns so he could drive without discomfort the nexl a?fernoox$

1

7V^/
August 13, 196X
Has first wsektnd in town sines my return too hot yssttrd&y to do the errands downtown so the larder was replenished with fresh peaches, cantaloup, tomatoes and a tin of corned beef, whieh slices so nicely for a non-eooking evening meal# As always in midsummer this part of town is blissfully deserted on weekends# Even the people who usually bring the children to the 64th Street Zoo go elsewhere. Poor neglected anii-.e,ls. I managed to sort out a good many letters and stuff not attended to before I wnet away and hope today to finish a basic tidying up against Aunt Annie*s hoped for early visit. Those kind Canadians have sent us some cooler dry weather and it was ne cessary to close the window beside my while I ate breakfast. The Wsather Bureau*s frenzy to report "records" has now been complicated by a new factor. In both 1944 and 1955 there ware 29 days with over 90 degree days. So far we have had 18, then someone re members iift-fc the official temperature used to be taken at the Battery, cooled by sea breezes, and now the Central Park readings are "officialSo back they went to the old records from the park and found 1944 showed 33 over 90 degree dayil Few people take much comfort in knowing that it was hotter 17 years ago and continue to go about in a dazed state and the oddest costumes of near nudity, though an occasional "status seeker" carries a mink stole.

The office tempo ia relaxed with many people on holiday and I am peacefully plugging

along trying to get speakers for the Off The Record luncheons and sorting out reoordr "

no longer needed. Bill Campbell was on from San Franeieco in connection with an Africa

being held there in mid-September, It was good to see him and kind of Hank Harris to Kibe

him useful pointers on the cere and feeding of African diplomats, Ted Higglns was here

,roo Pittsburgh making basie arrangements for a series of TV documentary films an disarra-

ament. To my great joy he has developed into a fixe Vf operator, both as producer and

news commentator, and strong mindedly refusing large sums to do commercials. He was en

chanted with the Beekman Tower view when ws want there for a drink one afternoon, Honda?

a er a

a' ths ',N ^legatee Lounge fenn Haile was happy when I took him to see

J>e espaliered fruit trees, the roses and the moulting peaoooks in the garden, I was not

so happy a, the distances we had to walk in the broiling can as the staff had already

commented on the "becoming color" picked up Sunday at Oak Beach, and me stupidly hatlese .

, ,lQ !?fis jarry took me to a fine performance of the Uarquie de Cuevae Ballet pre senting sleeping Beauty" at the Champs Elysees Theater. Rosella Hightower (sister of

, *2 ^"'. ' fB 'h* 'riaoess and Rudolf Noureev the Prince, His recent defection from the Kirov Bf lei i.fter he had appeared too interest in bourgeois life during the

Kirov Paris season and was told at the airport he wee to return to Uosoow instead of

f!

v

*h ompany made him a political as well as artistio attractidn.

He toioss in the beat classical manner, though I had the fseling he was holding himself

dT'LTZ\: 0"*hin

ompany which took him in. In London I saw Michael Bryant

--a young man to watch-- as T.E. Lawrsnoe in Terence Rattigan's "Ross", a fascinating

interpretation of ai controversial historical figure. Judith went with me to "The Sound

Music and was shocked at the tempo with which the nuns were made to trot about and

wave tneir supposedly invisible hands. X found this Rodgere 4 Hammerstein, Lindeay 4

Crouw musical a sheer delight with fascinating children doing the Trapp F^y. ^erhape

1 also

5 singers when they were touring the OS predisposed me,

Ws also saw miliarn Douglas Home's sotry of his wartime insubordination in Franco under

. U*la

ad So3-iir Smith". He could not ewallow ths uneonditional surrender terms

imposed on the Germane by CSiurchill and Roosevelt lifted as he says from out Civil War

^"charmel^nor-t0! n'1 fe+-

aoks and deided h would not oarry out an order against

PWinr l fj i +^ v tb"*,, !!?*? commander was given a chance to evacuate noncombattante.

CO h J

?! H Command would not. agree, Home-Smith declined to obey,

mI

V alternative but to court martial and eend him off to prison after

but

uniform. Home's elder brother is the Foreign Secretary,

doL"!?+ Lh

y+i

8 son"in_law) Told n at a cocktail she gave that the play

tthhe.vy a.rrei !q?u!i?t+eIbr!o8rSedY'wS itfh^rtfhFerma9uatihl o^ro'sugehxhiitbiatinnggerhs isexpGerusaorndas lobffeilcieerfss.like himself as

C<~&-yJi

'

f' 7'^T1' Auguat 20, 1961

,t11-^,f,!t this pla0*' Ystrday I *a dctcrmlnd to cheek off and

Z* it T TO, en

the

end

nf'-'hf**1' + rl"aards * loh ^T4'1' i8 Christmas Book

81:111 811 in a has completely

dlaisragpep, easqruedar. e

Hgliae ssseabrocwhl

tldlw t

afmeglotyhole including among other treasures a lot of clippings

J out to send fr* nds and now too old to bother with. Perhaps the blind spot

"!**'! $ MA

tthL at ronBe^hasVto

^ *xpodition durine Which I mailed make out four forms to send one pair of

three parcels silastic hose

and dieto Holland,

j did secure) a -.imetao-e and my ticket to Albany against the Labor Day weekend with

+TTM?S**+h!! Sl8 e8 ^ flbl8 bsfore I discovered the wallet was too thin

a box^ etationery'instead.

"e * ^ ^r obsotiT" * bha #* So I bought

n.a.

hf k8pt ,v,ryon on adS this week, just as X am sure the

!oL f d^iMontirt",u HNOo HdouM btSTLynUdo"n"J,o1?hntshon',swfrliogfhtn#troveGs ew rmoaunlyi wd5as wadedllingcotnocetihveisd, "bsuumt mietr

aanndr^piiMeceees'ooff tthhUe nOTTBP*liunchv,e"o"*ns, NiJs*a1g1a8inTruasinin,gwhheorisFPAsuhppoolisdeadytotodwo otrhkeacslearsicteawl abrditesss on the charter flights of G.I.a and dependants bstwsen New York and Frankfurt and was

has a'new ft ll!"TM !r,^ay\,

tb W"T she worked for 3a et year folded and ahe

paseL^rs

Tf" Bora like a T-ailraad than aviation-told me the

r J5?

88 3 euBBer' thoug>) with fewer dependents on the east-

bound. Incidently I diecovered this week that she made a couple of stupid errors in

TM T? * printer and now with too little time for comfort three separate itme must be done over. Thus far I have not been able to be sure that we have to pay for

mind"? Z optel T,u7j*| ***

* l0t f

but *

<*

-fsHrfTxrsr2rivsxr-r*x"ss' ih - h *5 v?,+&sfr?

5 1 th* Dware'

ai iaa 1 :tsvz^
ar* supposed -to live longer than their

+hia !vr??di?g.f

VhiU's "Th8

of ihe Presidest-1960" was interrupted

World War l ind "In5'^JU it!af^fTHselslf", *1r*came ontWthaPlaart'tSerf b*y *meRreu"chalnltc8e aonxdpefroiu.nndoeistinto

+ +h!

nooount of Erneet L. Wrentmore, she enlisted in the A.E.F. at Altoona, Pa,

lEfL2f i2 mrVnd P m0ntha on Sept. 28, 1917. Somehow, under th?



! .go-t to Frane8' fought on the Anould and St. Die sectors. During

J t idled e n r r T o f ) " ' # n 3 1 , e h * a s B r u n n s r f o r h i s company c a p t a i n a n d h a d h i s g a s mask

-ily

^countered gas and shrapnel but he got a citation for carrying the

F ? ? h' r



P

U53

Army

ht orspPit'a,ls1 "in"

flanfc o
Franco,

n O
he

otob
wae

#srhi1p7p'ed1 9

h1 o3m e

Atof theirsf foaumr imlyo ,n twh hs o i ant

of

hhiLs

e.ilietment

when

Uhe

T signe^d"*th-net

RfreodCSr0ohss00eiarthde of

he
"safe

arr*ivayl

windFwraenroee"onwlyithawharise

own name. He had enough of the infantry, so in World War II he was a retread In North

jirioa and the Mediterranean Theatres in the Air Fore

yes, this time under his own

Yisjn*-

t London with Judith was vary pleasant as I was completely independent. Jeliberately Leiaberg of Parliament and other former speakers were avoided and I was free

to spend an entire morning amongst the crumbs of my breakfast tray in bed, * en that was

u J**' ^ f f my 0ld fri0nd Harriet Workhouse had just died in a nursing home, but Monks and Rosy 1st me call on them. The Fraxier Ueades had me for luncheon to

see their tiro children and th# apartment to isfcich he walks home from the Embassy. Upon

.is insistent invitation he gave me a personally guided tour of the controversial new

^

T v s^ruJk m8 as ^ing poorly designed for the comfort of the workers. Aside

from the Ambassodor s wing where they even have a small dining room for TIP entertaining

and complain mightily orf T no\iisne a0pn^d npaoroeraas irorcirculationpr. otected by head high partitions"

. ',S' 't*j#i'V s.'-i', .'r >y, . 'A . *Wr!f}a

rf'.

ap;

:,..

.

^m'3y.--,



U li-iAifi'v-g.nCy. fj..&,4- #sIgfe|gh|g*jhfe :,d:r -v-. ; im, - :* 14*884 ~' m<r''; .

'-"^- ^& y^Pgi^al

i

t i,

r ' m r.*it>fvc'*-'w."\:.&!- 'UC*

Bulletin

August 24, 1961

Dal called m just before five o'clock this aftHeranlfoon to say that he

had an accident on Monday# In helping to lift a trua3 onto a truck he injured

his left knee# "ueeday he- had ra in in the loft calf * $d vrr' to the doctor*

Miurs viy ti e d ctor iold hin/he had phlebitis and put an ela ic bandage on him,

:V f / !;.'/' .,/.// tr'lhfj;i5

>/c /

y " <{

'

when Oal explaine' his situation the doctor said he could bo In-PbiJUad at home

Y-.-Tf
K^>v
'fx jjur-lfji'W^'&'M",?I5i.-..v&->
4:P^ri nl&'l iSL .*> ^ A?*I*s Tyifcia

instead of going-to the hoppit al# D&l's voice sounded f: -

;,. u id he thought

ni^ma'^S'-up to writing:on/hir# He .is permitted to got to

for



.' 'i'i 'i "" '

.: ' :< 1"

' ;c": .'t :' :/ .

bowel moverr.orita and on Saturday will be driven br" ; ueigh'bor to the Doctor's

yM& , 1

g v 8y&' f'^

t

*1 // ^ v^j * *|| , h jjf t, 1 f/, gnf j4 ^ v

*

office fo: a blond test to detamine the onount Of dicuzueral he e ids to thin

?Ht' h' o .c'Vo7a'vgulati o'an f.:a'. c!-'to- r and<'/.b.' reak up /tihf e >c: lio t# '" (ibis i/'s tt h' 1e drug, Dou r-.las t-w\ a'sr" if vV

taking last Sumrcer*)

?

ilhm I ca'iied 7!eve in t :. evening he said he was in bod four or five days

.: .. |P';H
I mm m .imBitTf

a few years ago with phlebitis* -We hope that Oal* clot will be iisipated as
promptly# 1 urged Cai xo V---s guide-\ "by Hue doc cor'3 advice atid go to tho hospital .s/Ji.o'j:'u<lid thfij ex^crtent.w-:.ith hor.e treatment no, t wor k ; out# . ;. Ho:u'ri .tile notes

of ch- er fro'o one ^.d all arB in orlei* X

,*$y

. ; -i J* ;; JP%
S2S

W' ' Mi, 'd

Mr*

s .; iv; ,
- ,'*- '*"
7v

A.,-*'

',i,&pS,.-;j"

0 33

ily 11^0

' ^Y/

r

t

Thursday

August 27J, 1961

Gal phonedfttfii$H.jf afternoon that he had had an accident Monday afternoon injur ing hie Isft knee and on Thursday the doctor told him he ted phlebitis in the left

c&lf# he is immobilized and on dicumeral# Until his reaction to this anti-coagulating

drug is determinid there will be frequent blood tests to establish the proper dosage*

By Thursday he felt that the knee was improved* Poor dear, it will be hard to be patieit in this so||g wsatber#

After leaving the office early on Monday because he was not feeling well, my sec retary was quite late on Tuesday but allowed Wednesday afternoon that he was better than vhen he came in that morning* Thursday he never showed up nor did he telephone from hie temporary lodging# Whan he did not appear Friday, I became concerned and found we did not even have his address# This voice teacher allowed on the phone he had not seen Bill since Wednesday and could not seem to find the address but thought it to b 19 West /6th Street# 1 dispatched another young man there, who reported an unmade ted and two people who had seen Bill on Thursday afternoon# Word was 2a-ft that he should telephone, but up to midday Sunday I know nothing further# Do we report to Missing Persons Bureau on Monday ? Or put it down to the weather? Gangs fued, bricks are dropped frcm rooftops on passing policemen and now a lower echelon member of an African delegation to the UN hit and was hit back by a policeman, who asJd for the African e papers after the car and a taxi had collided# A newspaper correspondent writing about hie reoent life in Indonesian and the unremitting heat said "There were times when mere survival was the only thing that mattered#" Perhaps some of us have reached that state here#

Hank picked me up at the office at 4s 15 on Friday and althougi I had anticipated fog we had a lovely swim at Oak Beach before dinner. The breeze was so strong that we had our dinner on the screened north porch, eteaks grilled on a "fine little charcoal fire, after cocktails on the front deck looking across at the last daylight on the dunes across the inlet# Over coffee I noticed the glow of the full moon and donning sweaters we went back to the south to see it# By the time Hank, who was exhausted, started a movement to bed I realized that there was an eclipse# We wished him happy dream##Jf tied scarfes over our heads added raincoats for warmth as Maria and I settled do>i to a fascinated moon watching. We got in a lot of conversation while the earth*s shadow ate away almost the tatire moon and then slowly receded# After assuring ourselves -chat the moon would bo restored, we went to bed too. Throughout the entire period the stars were brilliant, limits on boats going in and out of Great South Bay entertained us as well those of planes presumably taking off from Idlewdld# MUMifUM Saturday we i ad & liesurely relaxed breakfast on the south porch, a swim, frankfurters grilled on ^he"ierfca (tbay on the sand} but I on the north porch) followed by another swim. Cocktails were still in progress and the charcoal ready for the chicken when in full sunshine it started to sprinkle. Hank said "North porch, here we ccme" and it was well that we shifted our dining place for it was a real shower, yet he drove m in bri$it moonlight over the Cap Tree Bridge to the Babylon station for the 9i06 train# They were o start oar.uy tr,is morning for a day with friends in Westchester, which oannot possibly
as coal or pleasant as Oak Beach# Maria has outdone herself with tubs and boxes of geraniums, petunias, lantana and of course a special one of morning glories and declares another year she will not have flowers on three sides of the south porch and along the east \appraoch to garage and stairs to the noth porch) side of the house at ground level and^ also under the south poroh# The watering and cutting back of dead flowers takes too much time--but the result is magnificent--I have sildom seen more profuse color#
This morning I washed the inevitable salt out of my hair and shall call on Aunt Mary at 4i30 this afternoon# She came home from Mohonk on Tuesday and sounded well when balked zo ner on the telephone and said she planned to go to church today# How ever when I called just before her lunch to see which time would be best for her this afternoon I found she had not gone out after all# Ifihen one is in one*s 90th year one should not hurry out to anything in temperatures between 30 and 90 degrees# Ifll cer tainly walk on the shady side of the street when I go over there in two hoursl

cv'^jvv September 4, 1961 Aunt Annie and I came down from Albany ye sterday on a train, whith left at 6*20 instead of the scheduled 5*45, and was delightfully cool after our steam bath in the archaic railroad station* It happened that between the up journey Thursday and the southbound trip Sunday, I managed to see almost the entire route by daylight complete with heat hass and the river an oily calm, Friday Aunt Annie drove me through the lovely Schoharie Vallpy to Oneonta to lunch with Alberta Rogers, getting us back in time to dine at the Captains Table with Eelen Chambers and another friend cf theirs* Satur day was too hot and gave promise <f thunder storms so we did not go over the Taconic Trail to Williamstown and just as well for the rain and wind with thunder and lightening arrived as advertised* "The Doctor Ladies" (Hazel and Kitty)came to dinner and played the latest
version of Canasta called Hollywood in the eveiing* Sunday we had a wonderful mid-day
dinner at Hazel*s with homemade meringues (despite the humidity) with ice cream and choco late sauce* Dark cLouds came up over the Washington Park across the street and we ex cused ourselves to scuttle the 100 yards up State Street to beat the rain, which did not
dampen Albany as long as we remained I
Hie great office excitement came lat Wednesday afternoon when I found my office could be painted the re xt day in peacock blue if the plants and what the painter called "knickknacks" were moved* Bill moved my dictaphone into Nason's office, wheri I based in style on Thursday* The paint looked more like robin's eye blue to me after it was on the walls and I hope it will dry & little darker over the weekend! Tomorrow will see the resettling of plants and little treasures I keep on the black bookcase, also the return of the late vacationers and the general Increased humming of activity in all departments* Bill's health has gradually improved over the week, vhich began moodily and without any apology for not having telephoned in the days he did not appear* The Sinners1 Almanac haB given ae some hope that by the 20th of this month it should be cooler and the weather forecast today reported that "Betsy" seemed to be moving into the Atlantic instead of to ward the mainland* I hope she is a husky hurricane and breaks up the hot front reputedly coming here from Africa and making us miserable* The Labor Day parade an ds at Fifth Avenue and 63rd Street. Since eleven o1clock we have heard the bands going through 63rd to dis perse further East* No doubt the first aid stations have kept busy with heat prostrations* The sun is pretty hot but I have a very pleasnat breeze coming in by my work table* I must not sit here indefinitely as the place is not as tidy as it should be for Aunt Annie* I had counted on several hours Wednesday evening to tuck things away, but what was to have been a half hour condolence call on Ruth Cox consumed all my time and energy* I even had to pack in the morning*
A young Indian woman in the office, known as Kiss Chandra who was formerly Madam Pan dit* s executive secretary, got herself and her Danish husband Nils Rasmussen a good spread in the New York Times this week* They bought an island in Glen Wild Lake, N* J* By rowing ashore and other transportation commute to work --presumably an hours trip* He burns their paper trash in an old furnace, puts perishable stuff on a compost heap, ihere "it percolates quietly" and carries bottles and cans in a paper bag to a New York litter can*
The weekend I was in London I went to the "Little Grange'1, where Eva Allen (Tracy's widowed cousin) has life tenancy* It was dreadfully hot so we only stayed a short time at the church fete held on the grounds of the Wedderbum's manor deciding it was more peaceful to have our tea at the cottage* I liked Eva enormously Hiough I wish she had not asked me whether I minded being put in his suite* It was fascinating to see how the grounds had taken shape and the way huge tree stumps along the west boundary had adapted themselves to plantings around the base and in scooped out places in their hearts --a treatment he and I had discussed* Sunday she took me over back roads to tea at the farm Home (one of seven residences of Sir Allen Lane of Penguin books) occupied for the weekend by his brother Richard back from Australia for the sunmer. I hated what Sir Allen had done to the Eliza bethan house but he and his wife were such fun ih at we stayed on for supper and drove back in brilliant moonlight* Part of the way lead along the Thames, where quantities of psopel punted or lofcled in scorching sun* I predicted many would regret this soon, little dreaming that the girl who was to have done my hair on Monday afternoon would be among those so badly burned as not to be able to go to work*

<1(

-&o VC-,

/W^,

, Tc,^ My-r,

September 103 1961

ttoo mr,eeCa^ft5errthh^aSlff^p^a+s% t fno'uaTr ewith the result Iofn3lytge*ot aFwriadyafyorNaFaroenecwota-nf tedtto talk after calling CI,TM to report I had lost all chance ofTtaS aS proSbly could

Street v +

f TMUrBe> ihere wer ccen at th UN nor even at 49th '

+n to

mt+ot 6th

l Sitlt St.

aonfd5fer^Te!hddirdeA1aveU nufet"andHgert

hpd
driver a cab

eleaZifdt from

half 811
my beet

hour 86rlier
way would be

go*wwithatethdem

the Queensborough Bidfe. "sounds

Ti\Trkeiand J" P#nn ,tation in

ontheplatform^f

t " M The iwart night a f t e r dinner a t t h e Salisbury Club Martha thought Aunt

Annie might be interested in seeing the ligfate along the ocean barrier befch ~d

the bay shore as well as Idlewild. So ws went back to Frseport on Meldcrtrcck

back to tiie

man inland

to

the

but tUrned
airport. The chains

t0
of

LliognhetBweaecrhe

arendalltyheloRvoeclkya!w^eeyrsne

fardiKmlblu^f<'en rcu7 Bulb, and others strings of white in the iar or

tj

variety of shades used inside hangars and in neon lights made

Xddwild far more spectacular than by daylight. The fountains were illminatsd

changing colors, planes of various slaes cooing down and taking off and the

vbdcular traffic pattern all showed to fine advantage. As Aunt

"au "ver been there at all it was quite impressive. After Fran and her bove

'* nTMe From lunohinE at CIeve's Aunt Annie and I took the 5i21 to Fenn Station

52 sr.s.s-"""" is Jurt ae well ttat^h.'dV

T hoB# "fter tablishing her on the Uverine. ' 'it

.J+v . !u

she did not euccumb to my blandishments and stay a few davs

ttthaFaki-c&-onv rs + ngU,0 md lo*?d abcut sagely> grinned and showed his t$f new

fo^Sl^ton

T *

* 6n anyne j0ined him* M*rtha leaves tomorrow

nv,L*i !

I

YB or 80 11131 Page* C1*

delayed his holiday

slightim,&*' e "^ey g 0 t o Gray for Christmas returning on the 27th for

slightly late celebrations here, Clevee's German tour of duty hao been extended

ll

^V' X!62 He writeB "" have lived on the edge of th knile

Si-T-JiJ?Sus-sr.,ssrrs.fcir-Ajsrsivs."-s.nusrsasr.?ras\isi;r'

seem as thou^i we migjit go right on with the nasty proceed IU t^ not vfk

tZfiiclht ha.sTlo,nT g s* ince mads m60e aB0R"EdDrip"*, h bai"S * a Kate of contin^l ^ oaap.ne^ ss

on Friday!

Llan5,":3''^:3

"*" be cooler

As both yesterday and todav have beTM ,

s a cold front cominghere tonight"

ment was right, but we have been fooled"o oftentha"'I shfllb finUt *ater announe when I feel it. Last Tuesday was Prim*TM no ^ at I shall believe this blessing

disappointed me as Mayor, but the alternatives^ slPhorribJ?ht'1^

greaUy

petition to get him on the ballot Tho />'

^

i^ible that I even signed a

even one sound truck bellowing nasty accusatfoS ^ counter barges have been horrid -

Republican Councillmane Despite what is sai- agaitlst poor old Stanley Isaacs for

withua.her and her ex--trio of s:ttia-ff-ff today and1 dined with her and her sohnackR, -mI luniacho+ed

weeks"in a'real^holida

months ^n tha

ay

nd eDChanted with BaQealore where she spent ovei two bounces it is an ideal spot to retire except for two

Mh '

,!

Stay there was broken by a weekend at the palace of the

Maharaja of she did not

Mysore where one of realish at all.

the

"treats" was

tn

hhq

r.

t >_ elephant and experiencr

AB%/

T^cj fotfiy, fo*y,U^, JIL-^

^ C*'"L{\

September ljZ>, 1961

At last the weather changed Friday night and yesterday was a brilliant blue sky day withdry air, which one did not have to apologise to ne*s lungs for breath ing. !!!lhile not cold a 20 degrees drop in temperature has certainly helped* For a long time I have maintained that atmospheric pressure and weather changes react on human well being and behaviour* Now science admits it, asserting that electrically charged ions in the atmosphere cause humans to behave well or irresponsibly in accordance with the positive or negative electric composition. On department store is BO conviced of the validity of this that they are having properly charged atmosphere in the shop to deter shoplifters and help clerks to resist tampering with inventories! Yesterday I bought two large hats, ishich will be inclined to blow off in hi|i winds, but should serve me happily otherwise, fflne, a green-blue fur felt, to go with the tweed suit I bought in Edinburgh* The other, a brimmed black velvet, will probably be worn this afternoon when I go to a meeting at the Waldorf to have a look at the US delegation to the General Assembly* This to be followed by a cocktail party for the elect also at the Waldorf and thsn I go to Pakistan House to say "Goodbye14 to the Consul General* These Paks are smart and frequently get double use of floral decorations* Sure enough tomorrow I go back to the other half of their double house to greet Sir Zafrullah Khan, who has come back as their Permanent Ambassador to the UN* We all dread Tuesday and the opening of the new General Assemby, fearing that the sound and fury of the debates will be greta and disagreeable* Also that it will unleash again numbers of street demon strations with noisy chanting outside out office windows, $$ picketting of Embassy buildings and the endless wailing of motorcycle escorts* sirens as the heads of government or foreign ministers here for the opening debates whip around town

Friday at five minutes before five the State Department telephoned to see if we would do a dinner for the President of Sudan on October 12, 13 or 14* I could only moan that the dates were impossible and the time too short* (With the 12th-- Columbus Day a bank holiday though not for us--a Thursday too many people will take a long weekend to view the autumn foliage*) X promised to check it and give a firm answer Monday mcrning* Meanwhile I have looked into Lt Gen. Abboud and found nothing to make me enthusiastic --he came to power a coulpe of years ago by a mild** tary coup and once or twice since then has had to put down similar efforts to oust him* He has taken help f rom Britain, Russia, Yugoslavia, Egypt, Red China, the US and the World Bank* Yet this is a State Visit to the President with full flourish of red carpet and YIP treatment*
Hank adced me if I'd like to go to a cocktailpprty last Thursday at Robert ICoses1 for the Russian mission to the UN--part of the World's Fair Bofiening up to get a Russian pavillion in 1964-5. I begged off but suggested that he invite Vera instead* She telephoned me that evening to say tie Ambassador had arrived at four minutes after six and stayed over two hours and everyone had had a fin time* Some of the Russians were particularly touched that so m&ny important New Yorkers had come to meet them at this juncture of strained relations* One eleva tor serves the Moses apartment and that of William Lawrence, Science Editor of the N*Y* Times and both residences were used for this jarty* Moses had the bar and the Lawrences had the buffet table, Mrs. Lawrence is Russian born and arranged fine Zakuskies a la Russe--hot pastry filled with this and that. She and Vera chatted in Russian with these guests whose English was labored and generally made themselves useful, Tonight Vera flye to Rochester to resume her double life and happily is finding that no longer being a member of the FPA staff has many ad vantages and so far none of the draw$j>backs she had dreaded Of course, she missee the services of her secretary here and other office helps but does have her Rochester secretary and has subscribed to an answering service for her home telephone. We had a long evening of conversation Monday when she told of her desirs to go back to India in February for the election and her difficulties in a native Japanese inn, where I suspect she horrified the staff and used soap in the "stew" bath instead of in the preliminary "pour* area* behind locked door*

A TrtCj

K&y

.~7^j>

C ^ "Aay,

'i

September 30, 1961

So much has happened since I last wrote with Berlin^ still simmering, Hammarskjold*s death,the opening of the UN General Assembly, Esther flicking us with the fr^ll of her skirt,
Kennedy speaking at the UN and last weekend at Stony Brook. //here i. egin? #/h - srj.^t Happily we decided to tell the State Department we could not do anything about the President of Sudan and out cf respect for the Secretary General both Sir Zafrullah Khan and the Foreign
Secretary of Britain and Lady Home cancelled their parties by telephone. One cannot help wonder what the host does at the actual time the guests were to have arrived...tell the staff not to answer the bell or repeat the cancellation message to any casuals who turn up without having the courtesy to accept or decline. I was glad enough to have had the time given back to me, especially as it was dreadfully hot and humid both afternoons. Esther gets no credit
for our weather change--ifcen not lolling in deck chairs on the shady lawn last weekend we dripped. Storm damage there was sligjhti a few small branches, lets of twigs with a dozen or less leaves easily picked up and burned, lectncty off for 1<> hours nob long enough to melt the ice cubes but inconvenient as the water pump is powered by electric current. LI Lighting
280,000 customers in Nassau and Suffolk counties to restore service to and had 3,500 men on
the task, bringing 420 in from as far away as Michigan to speed things along.

Brilliant sun and cool temperature today made for fun and celebration. I took Vera to lunch on the Cosmopolitan Club terrace before she took me to the Kirov Ballet at the Metro politan (especially interesting as Larry had takne me to see the man who defected in Paris from this group.)* It was "Gala I" a melange of excerpts from four ballets of which only "The Nutcracker" was familiar to me* "Bayaderka" --first performed in 1877 in St. Peters burg and loyally mentioned in the program as Leningrad!--is what I call classical ballet. The "Gayane" excerpts were lively mixtures of adaptations from folk music, Grieg and demon strated the great variety of racial types of Russia as did also the Cossack Scene from "Tar?* Bulba" throughout traditional ballet stood out brilliantly. Next week they move to Madison Square Garden for ten additional performances, It would be fun to see how they adapt to such a setting.
The last two weeks in the office have been largely devoted to Operation Switch. The girl who has caused me a good many anxieties for two years and made the mistakes in printing this summer resigned# Rigjhtly or wrongly I fina&tod that portion of her job for which I was responsible over to Bill. He is happy as he gets athe higher grade he has bucked for and some additional salary, I may have to do a few more things for myself to compensate for the time h will spend on the Off The Record luncheons, but at least I shall determine priorities and have total authority where latterly it has only been complete responsibility* The annual subscriptions have been rolling in from the women in avalanch volume.

Yesterday I went over to the UN to sign the book for Dag Hammerskjold and found that

individual signings were possible for each of the secretariat members who died in that tragic

and mysterious crash. This little ceremony took plao at the entrance of the Meditation

Room for which the Secretary General had himself written the black marble plaque "This is a

room devoted to peace and those who/f are giving their lives for peace. It is a room of quiet

where only thoughts should speak". The great question is There was the plane for four hours 7

One suspects that a great and horrid secret lies behind the crash, a secret which should be

revealed while people are still numb. My candidate for the interim job is Frederick Boland

of Ireland, who was eh cted by the General Assemby last September as its President and worked

skillfully for a year with

the 99 delegations and with the Secretariat. Whoever gets the

post will have a horrid time but can save the UN for the future. With Seirra Leone1 s recent

admission carrying membership to the 100 mark and the undoubted bid of Syria for its own old

seat back "the club" continues to grow in size. So far we have only had two days of demon

strations in 47th Street under my windows. The day Kennedy spoke brought out a lot of chant

ing anti-Castro Cubans and made several hours rather distracting. A feeble and quiet after

noon of those opposed to nuclear bomb testing was mild by comparison. Too soon to cheer, but

X like to consider it an omen for greater hope for less commotion in the street. Fireworks

in UN Committee meetings and plenary sessions are bound to be frequent as thy cop with the

96 agenda items, so many of them packed with dynamite.

****/>

. J^e , ft

*T)

October 8, 1961

P<?o C



Without the benefit of

much publicityMonday and Tuesday were windy, humid with

drizzle alternating with heavy rain. Not quite as bad as the periphery of Esther but

certainly not pleasant weather. Maria and Hank had cocktails on Tuesday for the Presi

dent of France-Amerique M. Bouihlet, -yho Larry has lined up in Paris as the Key to a

committee sponsoring a French pavillion at the Worlds Fair. A good many fewer people

turned up ihan were expected--just as well as it had been planned to use the terrace

which beyond the awning was useless. I had an amua ng time and hope that the French

will carry on to the alter. Bouihlet* s vl sit being the on-the-spot examination of the

bride* s future home and in-laws. At least five out seven days were pretty, though

Wednesday, World Series Opening Day was morelike football weather and also Thursday

morning. Gradually we go into the 80* a and people talk about Indian Summer. But is

warm weather in the early autumn really that, or does the term come from the legend that

after a period of freezing washier the Indians were fooled into planting their seedcom

Is fore Christmas?

Alas, Cal is immobilized again and on dicumeral. The phlebitis flared up again in his left thigh* Staying in bed has brougit down the severe swelling and accompanying pain* Poor Thelma/ is also worried about her eldest sister, who has just had another slight stroke, though she herself got a good report on her own recent check up. In this clinical paragraph I might brag thai I had my first cf a series of two flu shots on Wednesday and liked to think I had reaction oil Thursday# Totally unrelated, on Saturday morning I de cided not to smoke that day and so I did not until I took one after dinner. So far the score is "that one cigarette in 35 hours instead of at least a package and a quarter.

Beginning at five on Thursday during the next 48 hours I have listened to 40 differ*

ent people and perhaps gottsn a few ideas and appraised one or two whom I did not know

and might be able to/ use. But oh daer, I do not mind tsn a second speaker takes the

fi*st apa#t but find it confusing \h m tie same person expresses as his belief/, two quite

contrary recommendations! The Thussday experience was uncomplicated as it was 1he point

of origin of a closed circuit TV program--a large conference Room in the UN. With the

cameras and stuff in the center of the horseshoe where delegates usually sit, we were in

thB press seats. The ethnic contrasts in the UN membership was highlighted in this semi
circular desk, each placs labeled for some nations delegate (adviser1s/chairs immediately

behind) so Cambodia and Cameroun sit side by side -- a nice variation of pigmentation from

chair to chair and I Si ould think more dramatic then in the General Assembly when the five

delegates Ait side by/ side and often vary in shades of complexion as well as dress# I

shall have to go to a Committee meeting and see if my imagining has overdrawn the picture#

The CBS commentatorsp Richard Hotellet, moderated the hour long presentation which began with

Andrew Cordier (the Under Secretary, who often deputized for Hammerskjold, and who for years

has sat in General Assembly plenary sessions on the left of that year's President) eulogized

the Secy. Gen., Joseph Lash (N,Y. POST) explained the difficulties of succession with no

legal formula and forecast it would be temporarily U Thant of Burma ("hose friends have

been telling him not to take the job.) Ambassador Arthur Dean condensed into ten minutes

his story of negotiating with the Russians on banning the nuclear tests /he had enlarged on

at the FPA Board of Directors dinner --to which senior staff may go-- a week ago Wednesday.

Dean is or at least impresses me as a delicious mixture of hard headed Yankee shrewdness

with a sly sense of humor and an almost negligent easy going perhaps self indulgence. (He

is certainly overweight, but not so much as his wife who looks almost square.) Norman

Cousins told a folksy sb ory of a friend who was using his jeep to take the Secy Gen to an

impromptu dinner and had a minor traffic tangle with a taxi. However the heat had frayed

tempers and a donnybrook was only avoided by "DagM making ooneili&tcry and soothing remarks

Four blo/cks further the jeep stalled, by the time the would be dinner host confessed he was

out of gas, the same old taxi driver stopped, not to bawl out the jeep for holding up a

traffic lane but to offer his services in whatever the trouble. Upon hearing the

difficulty he said H QIC, 1*11 just go ana bring you back some gas and maybe your frined

would go with me." The rest of the speakers were at Freedom House 20th Birthday--luncheon

Friday at Commodore There a thin and vhite looking Ed Murrow gave an award to Kaftor Willy

Brandt

*at and red faced. Some people during the next day's session expressed concern

at his "exhortation" that the Ulbricht Wall must cpme downS..whatever did they expect him

to say? So many liberals are so intense about indivL dual fixations as to be totally naive#

P I'jQ, lAv.,

^ Ti

'

A*v/ C.ivu Co~*^b-

'

r

October 15, 1961

This week has been a hocus-pocus of quite a different sort --negotiation, plotting and planning, "which began for me late Tuesday afternoon when Nason told me oral overtures on the ja rt of two FPA board members presumably working at different levels in an attempt to get Prime Minister Nehru for a luncheon in New York early in Novmeber had come to the action point and I was to take ever* I did so without enthusiasm being in no way confident that he is the great leader he used vo be* After talking to the Indian Embassy and the State Depart ment I concocted a fine telegraphic invitation for luncheon November 10 to be acted upon in a Embassy-State conference Wednesday* From that point on the plot thickened as the Indians continued to "piddle around" as my friend in Protocol put it* It seems thay have been indecisive for weeks and occasioned so much de lay "that the schedule will be a mess* Thursday we were told we might have Fri day dinner and after sane frantic Columbus Day telephoning when so many people were having a holiday I discovered that the "Mass Media" luncheon at the Waldorf would take the cream of our potential audience had to tell both the Embassy and the State Department we could not promise to fill the Waldorf Eallroom, but would do a 300 to 600 dinner in a smaller locale, The Embassy answer was that they would respond to this counter proposal to their counter offer to our origi nal invitation by eleven Friday morning* Not having heaidfrom them by 3i30 I telephoned again and said that not having heard we assumed with great regret that they were not interested and it was now too late to do it with the qualitv of function we had in mind* To this Mr* Ganju said "I have not been able to 'clear this with the Stat Department, but *the old man* will be gh d not to have to make a third important speech that dfcy* When I reported this to Clem Conger he said "That is a black lie*'1 No one seems quite clear what the "other" speech is as Nehru had first wanted to speak at the UN, then did not want to* The staff has ooen divided on the desireability, but the Board were at best unenthusiastic, Me, I su glad to be out from under having had horrid trouble with a big dinner for Nehru 12 years ago \

* x. In

timas 1 have besn very busy *ith the Preliminaries of the opening

of the Off-the-Record luncheon series on the 18th having had a Speakers Committee

meeting last Wednesday and had to writ the agenda and three or four reports for

their Governing Committee meeting right after David Popper talks to ihem about

"U*S* Objectives in Arms Control" at the opening luncheon. We open the season

with more meabe rs than we had last April and quite by chance I discovered on Fri

day unafc --ire Commissioner Gilroy had been around in the summer and cut the capa

city ox the room where the speech is given from 204 to 180, Next week I must look

at space said to be available in the new Engineering Building*

4

^eing T&shington on Wednesday, Maria asked me to have dinner with her

at ,,re Yale Club* Her classes have opened and go very well, though they take a

lot out of her* Curiously I ran into Hank just outside the office on Friday as

x started to the British Embassy for the "make-up" reception for the on they had

to cancel during the period of mourning. He kind y drove me up to 66th Street and

we had a chance to catch up conversationally, at least a little. The party was

pleasant and being early I had some useful conversations and got away before the

peak of the crush* This morning Lady Dean called me to ask if I would dine there

tomorrow-black tie dinner for 18--the wife of the Tunisian Ambassador had just

_given out". Of course,I accepted. I must ready my clothes today as I should go

1B eYe^n6 "to a Peace Corps reception, forerunner of a day long conference to

morrow, though I shall have to skip the afternoon discussion groups. It is just

as well that I went to the office and worked for five hours yesterday clearing uo

the chaos on my desk resulting fran the abortive Nehru affair* It was cold and

windy, not to say rainy, enough for Vera and me to enjoy a fire in her living room

ax er a cozy dinner a deux. She showedme some lovely dresses made for her in

the world markstG

un^ual sari material 8X1(1 a180 a raw silk they are develItalian, but I suspect rill compete strongly in

f)

AtJ-- T 5sfc

'aAf7

^

'

'

^

' October 22 lsfii o+

kKiinndtM neLss;, M AoTll?y5'_s sty topny ew Brritk

game. Thfn^K Irf vSybon^s^r* beat Poly ^ep at a home

field^tthhough

f?rDodmStph'entchaa

gr8at deal
raoter of

othfe tgL^ee'trhoett^in8 ^.11B7 02S14Froffd

is a
th

2rt JPw

nly kicks the ^th down play but h]i + more time on thai

after kicking because his team ma tes faiiis

?

get in tackling

A sunless afternoon with a strong oils

? plac* themselves oronerlv

into the car at half time. We vf^ed tof83t

Wind whioh dr<>TM MollJ aS ml

of the field because of some sheltering , sicond half from the Poly siae

siience Molly, who cheered happily with the'pni At n< point 1 had to

r8w,reatlon hal1 to warm ourselves wither,F00t8rs 1 After we wt

^bffee# when they had had their shower- +C u

open fire and hot

congratulations, we chatted with a cla^s

?fn* along for Punch and

on the team and on the way homw "tonnes"? TM 0 Jim 3 whose sun is also

in a wall display case-?LS bo^fcfl end??^81 Hal1 to 888 "l* Pictures

ball activities in a year book. Thl =. to

and mention of their &>0 t

with a pleasant library occupying one end

-r.tt0

Mne m

V8ry ^tractive buiMiL ^

T=J"oSnJJopif!5JI.5"hL,'*!!toSy yit*S5J;y"!?rt?lr" t6"'*

"r

Ambassador and was rewarded in mv effort to

1 dr8W the Austrian

a childhood friend of Rud^f Bing o/llt Metrn^i f/

by finding hi

stay by as long as the opera rutins in no part of the new one. He hs^ w?r ?!

Bing wiU
building, but will haws

having had enough of the hazards of a non subsidized ^rect the Berlin Opera
knowing whether he can meet the nert^ayrol^81"2^ peration ^ never

reaction. My gamble^n^^ve^oDcer^a? hot; without the same degree of

Record Seri^!luncheon pall o?fnice?v ed him to be despite the heaw

fr the 0ff ^8 just as good as I expec t-

ment keeping him from getting enough sleen for*i C0nn8?t8d with disaima-

meeting of the Governing Committee went well with $ne

' The following

reciting the reports I had crM.r.sT! +! ? tb four of them prettily

have "a bear by the Tail" and m.,0+

them to make. They agreed that wa

siad than done? it w?U

at ^P?^ore efril^

oonsidera tion when Bill and I bel tn t if squinn and try for "spec ial

dilatory friends they wil! be put6oS a w a i t t o f t o ?f ^elr dearest, but

series this Wednesday .

waiting list. Dave will open ths B

about to goTDar-eI!srifa^ fTattSrSta^iSi^eM*?0^ Saying ah0 ls

ly enough she will be staying with raj, ^7

becoming a nation. Curious

there with her English baron hushand LdtotT'

4mrioan,woman who wit

yiica Parliament. Interesting you mav snv h +6vSejf lcted to the Tangai-

coincidence is tha t for two we?ks tL??' v hardly urious. The odd

meeting Thursday afternoon to plot a sneaking Jn f t0 g0 to a TMittee

Chesham.

An exercise in patienceas nffriil k !" for the 391118 Lady

how to go about it. How to say enough to to

t DOt the

idea

being asked to take over the Job9 pii k. P them from chaos, without

liked flying to Alabama in a militaid aiTM?

tomorrow to bear how Vera

would speak Friday I counterS wSfwoS he T\01 Eze11 asked

if S

o ad not accommodate to commercial schedules,

88 hr existln dates

folfr fMjL h*y/ T^e,
/ /

jje.)-D4C,

<^V. October 29th, 1961

To continue nhere I left off last week, Vera had a fine time at Maxwell Air

Base, but found being flown by a special Air Force plane somewhat arduous- Two

colonels were on hand to greet her at LaGuardia, were sympathetic Jiat she had

had no dinner, happy when 3he said a sandwich would be xine and .hen forgot .0

get her one as they became involved in weather reports and their flight clearance.

En route the flight sergeant gave her a cup of coffee and a hitch hiking soldier

offered her one of his cup cakes, Arrival at the base was a* planned at midnight

(though two a.m. by her watch and tummy) and she was glad to find tomato juice in

the refrigerator of her apartment and a fine array of liquor bottles.

a can ^

of tomato juice and a Scotch nightcap had to do her until the 7s30 breakfast witr

Col, Hopkins, her host on the post, At 8 the courtesy call on the post^ commander

provided another cup of coffee. The lecture at 8130 was oroken midway oy a coffee

breakand still another before the question period. Immediately a-ter luncheon at

the officers club she mplanad with two majors as escort. They were uPPBd 'c0

fuel Dayton, but the weather changed it to Louisville, where they dallied xcr

over two hours by reported fog in New York and Syracuse, It was three in the ^

morning before she checked in at Syracuse -oh, yes, dinner-a hamburger at Louis

ville--and she had to be up for an 8s30 breakfast with the chairman of the luncheon

at which she was the speaker. The airforse war college is a "prestige" itsa^paying

$100 and the Syracuse speech was teachers of Asian studies and of academic impor

tance 'without any remuneration, Who says lecturing is an easy way to earn ?

Wednesday Dave Popper came back to open the "B" series of the GTR^again with brilliance and distinction. The excitements were largely in the catering department-- The freight elevator carrying the plates, cups, glasses, coffee urns etc broke down and trapped the waitresses, after they finally got set up in the second floor buffet area an electrical connection for one of the coffee urn gave out, the head waitress tipped half a pot of hot coffee on herself miraculously bending so her clothes were wet and her legs not burned! Fortunately the guests were unaware of any of vfcese
incidents, which added up to a firm demand that the waitresses be paid more.

Maisie Cash arrived on Thursday afternoon and met me at Asia House for a re ception for the Afghan Delegation to the UN. We had a cup of tea talked to various people, enjoyed an excellent colloection of rugs displayed in tne art gallery eluding one small one with 300 knots per square inch producing a velvet like result Since the Afghans still had not appeared we hopped into a cab and went to the last few minutes of a lecture on Afghanistan and in time to see Bethmaans amateurish but very interesting pictures of the Kyber Pass and Kabul and other less well known areas. Since this was at 345 East 46th I showed Maisie how we did the 01R S, the office and the view of the UN at night. We went down to the new US Mission .o UN Building, where the nice black guard let us in to look at their inner courtyard and lobby--both interesting architecturally as is the building itself in its honey comb type tf facing. Too late to get dinner at the club we settled for Schraffts and a fine talk, Friday night we had dinner at the Club, paniced at tx-e dGermans report on taxi situation and went by bus to the Belasco for "Write me a Murder" . Written by Frederick Knott, author of "Dial M for Murder", superbly acted by Denholm Elliott, James Donald, Kim Hunter, Torin Thatcher with Ethel Griffiee at the age of 83 as the superb old family physician of Lord Rodinghem and "pie feudal village which is part of the family estate. Although the old lord dies in the first act, and the 30n of the village grocer become tycoon is killed in a motor accident in the second, the actual murder occurs in the last act. We loved every minute.
Saturday morning I went through the Chinese Art Treasures formerly in the national museums of Peking and Nanking at the Metropolitan. Some date from 11.k Century BC and include interesting scrolls of calligraphy, horizontal scrolls as well as the perpendicular. It would seem that the earlier artists did xantiscapeo though in 722 Chao Yen did Eigfct Gentlemen on a Spring Outing, it was much later pribably 17th century before many "still lifes" were painted. There wera comparatively

October 29, 1961 page 2
few bronzes, several cases of lovely porcelain of which I most admired some 18th century "enamel porcelain" wee wine cups with exquistbirds in flight and lovely color, several toothpick holders (rather like modern spectacle cases in shape) and tinder boxes. The partial case of jade disappointed me though a three inch scholar's seal of Ghung-hua stone of grey with a blob of liver red brought out cleverly in the carving was intriguing. A dozen heavy porcelain men1s thumb rings were fine in color and design, but must have been very awkward to wear. 15th Century porcelain vases and flasks all with blue decoration reminded me of Dutch things and because of similarity of decorative design raised the question of who copied whom ?
The crowd was almost as interesting as the exhibition--many Asians accompanied by their children, lots of students some making notes, others merely taking up space but able to tell teacher they had gone, couples talking French or German, not a few eager young parents carrying babes in arms or encumbered by todlers, many eophisicates tfiile others were idly curious. Manoeuvring for a spot for a better view of a segment of a 40 foot horizontal scroilof images of Buddha executed with lots of gold and much color and superb minatures of faces--or some other object of especial interest to me--gave ample opportunity to observe my fellow viewers and eaves drop on conversation.
Maisie appeared on the tick of two at the front door and we went for lunch in the fountain of the muses restaurant. While visiting her aunt in New Lebanon she had been to the Sterling and Francine Clark Museum in Williamstown, sol made her take a quick look at the Stephen Clark room --a wall of Cezanne (sp.V) half a dozen Renoir s including a portrait of the little Bedard girl of whom he was so fond and four or five Degas. Although she had seen the Chinese treasures in Washington, thought a quick look would bo interesting, but when she saw the crowd even larger by three o'clock declined. Unfortunately the Christmas cards and other things she had hoped to buy -fo ere were not as attractive to her weary state as they had appeared in the catalog and we went back to the Cos Club for a refreshing cup of tea before setting forth for her train to Charlottesville. It has been a joy to have her here and get caught up on all the children and the wedding which I missed in July.
The end of daylight saving has lengthed today for me but I apologize for dripping into a second page

l^cAXy^ TVC^ I

A*;St'*-. tTa^/

ActywCa^^W,,

i

November 5, 1961

Yesterday*s N.Y, TIMES distinctly disappointed me in its treatment of the election of U Thant of Burma as Acting Secretary General of the UN, Instead of characterizing it with M relief and good humor felt after 103-0 vote ends long controversy" , I would point out that it was a moving occasiSn involving several "firsts", Throu^i the kindness of Lionel Landry (FPA staffer *ho took the little office slated for me and while country director for U.S. Information Service married a Burmese girl) I sat in the "diplomatic guest" section in the row behind Mrs, U Thant and five other Burmese ladies all gowned in lovely gauze and silk pastels, Surely this is the first time 103 nations all voted unanimously for the same thinfr, he is the first Asian to become Secretary General (even Acting only until April lt# 1963) and undoubtedly the first Buddhist to be elected to a post of world wide political significance* To me it was interesting that Ambassador Malalaeekera, a distinguished Buddhist scholar before becoming a diplomat of Ceylon (with whom I last talked at the FatrickDean^s dinner party) made the gracious and highly liter-* ate presentation speech, I had never witnessed a vote by written ballot before and was impressed with the rapidity with which the 103 delegates trotted up to place their voteB in the wooden ballot box and the counting -- the Times said it took nine minutes, I was so busy identifying the vote casters that it seemed even less than that. We saw U Thant waiting in the wings with Jehan do Noue (Chief of Protocol) ifliile his assistant de Meulameester lined up 21 chairmen and vice chairmen of committees and Councils between the podium and speaker*s lectern t# be the first to shake the hand of the new SG, It was during this friendly and in formal moment that Stevenson shoke Zorin*s hand (could this be another first?.., they usually dodge each other.) After President of the GA,31im of Tunisia, admin istered the oath of office, he lead U Thant to the six weeks emply chaia^ on the podium for the acceptance speech,,gracious thanks and a plea for their continued friendly support in discharging the grave duties he has undertaken, (I know that his personal friends have been begging him for weeks not to accept and have the Russians crucify him in their determination to create a troika#) Stevenson was the first speaker from the floor and although he read a long and good telegram of congratulation from Kennedy was himself quite poor and I thought ill advised to try to imply that he personally engineered the election, Zorin followed but I had to get back to the office expressing en route my gratitude to Lionel for making it possible for me to "assist" in this historic occasion from such a superb vantage point.

After pulling a few things together on my desk I skipped the Pakistan party to greet the new Consul General and went at once to Vera*s for dinner, She had been in the press section and I lot her tell me about the afternoon for a bit be fore revealing I had seen her there, We had a lively conversation about the auto biography she plans to write in the course of the next couple of years. Because there was a box of excelsior in the office I went there Saturday after a bitter session reconciling my check book with the bank statement, bitter because I had twice added a deposit amounting to $5001 With the British excelsior I packed the Christmas souvenirs for the German family and some of the double tulip bulbs, at long last arrive^ from Holland, which are birthday anc/or Christmas presents. By the time I had gotten these five parcels to the post office, I had had it and came home defeated by what seemed more than the 72 o/o reported temperature,

Tuesday I belatedly had Judith*s neice for luncheon to meet some of the girls in the office of her own age, Wednesday Kouis Halasz fascinated the QTR ladies with his realistic reminder that the UN is very different than the creature brought into being in 1945 in San Francisco and should it become "a debating society" can enable crises to be talked to death instead of being fought to death, Friday luncheons are now spent with our Community Leader Program of briefings on the UN, where I hostess a table and invariably pick up a lot of choree for people from all over the country Some week j. nop to have time to hear the morning and afternoon sessions where they are really informed! Sunday Aunt Mary confessed that die has been having unexplained headaches, which I fear are a source of worry to her,as they are also to me.

7'4C, M+iQcy

(

/

PU\jfD^C . pc
November 12, 1961

Stupidly I began to drip at the nose on Wednesday after the OTR luncheon and another committee meeting with the African-American Committee. Immediate
measures had so little effect "that I withdrew from dinner at Vera1 s on Friday to be followed by an Asia Society meeting with Indian graduate students. Last night I felt I 3hould telephone the Jack Duncans and say I would not be at their black tie dinner Monday for Sir Hugh Foot, but have decided to risk it as a lot
of extra rest yesterday has helped some. The only thing I did was to go down town in an fruitless effort to get slippers to wear with the silver and azure lame dress. Despite a couple of days of high wind and temperature in the low 30fs, there are beautiful deep coral roses blooming --and lots of buds-- in front of the Public Library. On the way home I took a quick look over the parapet at the new children's 100 given by Mr. and Mrs. Herbert Lehman in commemoration of their 50th wedding anniversary. Hordes of youngsters pretending they were Jonah walked into the open jaws of a huge spouting whale, climbed into a eastle tower to pop
their heads out of windows, admired a gingerbread house and looked at pigs, sheep goats and other animals. The strong winds have blown off the golden ginko leaves, which had made 59th street a row of flaming torches, as well as aving most of the park's trees naked silhouets.

We did not work on Election Day and fortunately I registered my vote without having to wait. Later Ruth Cox told me on the telephone she had only voted on the
many amendments and questions as the candidates were only a lot of rotten apples in
a Dad barrel. I was glad that Stanley Isaacs was reelected and only pray that Warner will be a little more vigorous than he has been in the past. The milk strike has been settled after about two weeks drought. Fran and a great many other mothers of young children are so indignant that they have cancelled home delivery and are de pending on store supplies.

Even if I do not meet Sir Hugh and Lady Foot tomorrow, I at least know more about them having read her book "Emergency Exit" telling of life under the terror proceeding the final independenceof Cyprus. He had been there earlier and went back as Governor General for the last horrid 18 months, when the Greeks and Turks of the island were killing one another and both taking pot shots ast the British. Government house, wiere they lived, was an armed citadel and aside from her personal inaid all the staff were so ldiers even the cook. When local carpenters or painters had to be brought in for repairs each went about his work accompanied by a soldier. How the family maintained any sense of balance,not to say humor,is a mystery to me. Ever since the Nobel Literature prize went to Ivo Andric I have been reading"The Bridge on -a Drina"--an epic covering centuries with too many overlong sentences, except in times of "trouble", which seemed to occur every second generation the Shristian Serbs, the Moslem Turks and the minority Jews all seemed to get along pretty well and usually stuck together when Turkish troops came through or Austrians tried to u&ke over. The idea of the bridge came to a ten year old boy being taken
by the ^urks in 1516 as blood tribute. Trained in Istanbul he rose in the Turkish service until finally he was a general and statesman of the Ottaman Empire known as Mehmed Pasha Sokolli* At his order end expense the tridge was built, but the o-thespot bosses seem to have pocketed meat of the finds and used forced labor from the -i-'tiro neighborhood with great brutality. The bridge was however a lovely and en during thing .

Kennedy's statement at the Tomb of the Unknown Soldiers yesterday impressed m greatly. Isn't it nice 1hat Truman and Eisenhower have made up--such a childishness as they have fostered all these years I I'm glad the British crown has a Fifth-in-Line in^Princess Margaret's son this week, This week's NEW YORKER has an interesting article on London fog. My worst fog experience was returning from Glen Eagles with the Dewars and the Greys. IShen visibility became nil Cappy took the wheel of the Isowu& and had the cnauffeur on the running board calling "Left, sir" as we crossed tahieinRtenefurrejwetmoovrisewiIn Stygian darkness of a July evening which should have given us

November 46, 19^1 '

< y dint of taking the 10j35 train from Albany this moroiab x was home and unpacked o* clock and now I have eaten the sandwiches Aunt Annie thoughtfully pressed upon
me in case the train was delayed and gone through the greAA stack of mail -- heavy both in appeals for contributions(including an opportunity to buy x^eense from an Abbey in England) and half a dozen "real" letters. I'm still bemused by u*y lovely visit mth Aunt Annie, and the quiet peacefulness of the country yesterday wnea she took Miss MacKLnley and me to Cambridge, about 50 miles northeast of Albany. We went and returned by different
rentes with lovely views of distant* AfcLrondaks and nearer mountains, along the Hudson and for contrast followed a number of tiny brooks, some of wnxon gained size as we went along. The hills were largely covered with deciduous tr # stripped of leaves giving the effect of the ridges tipped with fur--the white birches made a reddish edge of branches ,
other tree various shades of grayf then for accent a great swata o- green pine or fir trees. All this under a brilliant blue cloudless sky, Occasionally in towns Norway maples clung to their golden yellow loaves and willows, too, wore yellow- Much of this country is devoted to dairy farming and the black and white cattle munched on the still efazin^Xy green grass of the hilly pastures, Vo had lunch at the Cambridge Hotel --the Home of fie a la ITode. Xr the mid SGTs a Professor Charles hat son Thompson took his meals &here and always had ice cream on his pie. One day a Mrs, Berry noticed this special dish and chidingly eiad "Pie a Is Mode". On his next trip to New York Thompson order his favorite dessert at Deibmonico's and when the winter said he had never heard of it, the professor asked for the manager. He expressed his amazement that the famous Delmonice's could not supply a dish he was in the habit of having at the uambridge Hotel. The manager not only had Thompson* order filled, but saw to it xnax Pie a la Mode appeared every day on fielmonieo's menu.

Thanksgiving Dinner at Hazel Curry's was mouthwatering and the conversation lively

degjixe xne presence oi a our m.D.s--a surgeon, two psycniatnst and a TB specialist nontech

nical, Friday evening Aunt Annie nad two irxenus aor dessert and a Jaaicifought a "a

f-wliywood -- no:..- sx.i

c.

old Or..si-- . oa :a: two other fne^us ca-e to can- >r*

In between times Aunt Annie "beat me regularly at anagrams. Now I am now 1 ?. pr .coner-"-

th* r.i?r had to help me up the first flight of stairs as he had put fresh white paint on

the wainscotting and balustrade ana was no more eager than x to have it cm* off on my fur

coax, Wnen x telephoned Gunther on the 15th to deliver the coat to the office, the clerk

moaned that they were swamped ana the first del v: ry ca i " cou prom m was tne hoth,

but it could be gotten from tne vault in 24 hours if I cared to call for it, Well, that

was a nuisance but I said I'd pick it up on Thursday, only when I was ready to leave the

office it wasppuring and there were interminable waits for bth busses and then the fur

storage desk was all but unstaffed. All of this put me behind and I was less than prompt

in changing and getting aroudd to the Patrick Dean's for a quiet dinner with Patricia (Sir

Patrick was making a speech) and RHth Wheeler-Bennett. Poor Ruth had picked up a bug and

joined us while we had a drink but retired again to her bed. After dinner Patricia and I

joined her for our coffee, while she sipped hot water and we finally persuaded her to lave

a hot water bottle on her tummy. One or the other fixed her up and she went on to Virginia

the next afternoon, where John will join her in a month. Paddling around in the wet did not

help me and Friday I had to telephone the Germans I wouH not go to their cocktail party

and Cleve that I would not go to Freeport until Saturday. It was good to hear more of their

plans for Europe, where between December 2 and 27 they will be in Paris, Rome, Florence,

Venice (Milan for long enough to visit the Cathedral and see "The Last Supper"), Zurich,

Pontestrina (near St. Moritz) and Karlsruhe iod Christmas with Delli, Clevee and the babes,

I left them early but not until we had been to church where I learned that on Decemrber 4 Cleve would undoubtedly be elected Senior Y/arden (no arrangement made for absentee ballots), I had to get back to use tickets Aunt Mary had given me for a benefit at the Metropolitan for the American Field Service at which the Bayanihan troupe danced a beauti ful program showing the influences on Filippino culture of the Malays, Chinese, Moslem and Spanish. They began with ancient pagan dances from the mountain regions and worked through the rest. There is a marvelous quality of working together, in fact their name is Tagalong for just that. No one is featured or has top billing, but with grace and gaity they perform magnificently. The costumes are beautiful in color and range from utmpst simplicity to elaborately embroidered and besequined satins. A most satisfying evening.

Abb

December 2, 1961

Don't believe a word I say! It is Sunday the third, not December 2. It is a mixed up sort of weekend as I had hoped to aee Aunt Mary yesterday and when she tele phoned about four that the doctor had not yet come and she was having a bad day, I did not have the wit to wash my hair, which I had planned to do today. How I am committed to her for this afternoon, if h e is up to receiving. Poor dear, she is having more
dull days than good ones.

US/hen I returned to my dssk Friday from the rat race of the Community Leaders Luncheon
where I hostess a table (this week I drew a couple from Kentucky, a realtor from southern California, the charming yrs. Hastings--whose husband Army Quarter Master General until retirement and now head of Tom Dooley*s MEDICO among others) there was a message to call the Cyprus Delegation. A greatly embarrassed secretary reported that my invitation for
Ambassador & Mrs* Rossides's cocktail party that afternoon had been misdirected and could I attend anyway--6s30 to 8:30 in the UN Delegated Dining Room. Having known them since he was a member of the Greek Delegation agitating madly for the independence of Cyprus, I accepted and went early in my workaday suit as I was too tired to go home, change and go down town. By mere chance I went up in the elevator with Sir Patrick Dean, who also looked tired and rumpled and confessed he was making an appearance as he had to rush off and make a speech, and learned they had heard of Ruth Wheeled-Bennett* s safe arrival in Charlottesville. Then I spied Sir Hugh and Lady Foot and had nice chats with each of them, even settling the topic for his January speech to my OTR ladies. She was wearing a lovely medieval green velvet suit with a silver lion of Cyprus on the shoulder. It seems that the succession of conquerors having left three different lion emblems to idie island. She has them all, but genteelly never wears the Plantagenant when with Cypriote.
Overly delicate possibly, since Sir Hugh was the Governor General n&o went theirt for the express purpose of directing the tortuous negotiations between the Greeks and the Turks
resulted in nationhood for an island, which I do not think sufficiently viable to be independent. Caught up with ct her amusing people I stayed longer than I had planned and overlapped with those who had dressed for dinner in floor length beautifully gold
embroidered skirts, etc.

It was a relief to find the bus strike threatened for Friday had been postponed, but

the prospect for the future is worse. This would have been a strike against the privately

owned lines and I could still have gotten to the office on an alternate route of city

lines. Now they propose to tie the negotiations into the demands <f the city transport

whose contract expires at midnight December 30. Should these fail and we have a strike

it would be of all buses and all subways. What a mess. I trust Aunt Annie and I do not

get stranded at Penn Station when we return from Freeport on New Years afternoon I For

going to the office, I jokingly told Sir Patrick*s press officer that I would propose

going to his residence at eight in the morning and riding downiown with him, though it

now dawns on me that he (Sir Patrick) does not go tb the UN then, but to the Dels gation

office at Park and 40th Street, so that is really no help to me* It is interesting

that the heads of delegations get to work so early to read the telegrams from their -re

spective foreign offices, etc before the meeting with their dele gations at $:30 (nine-

thirty) to plot their positions on the day*s agenda topics in the Committees and Assembly.

It will be fun to see if Haydon is right in believing that on December 20 this General

Assembly will shut up shop and not return in the new year for a "resumed session" but only

reappear for a "special session" should 1h ere be a crisis. He bases this on the fact that

the British, the Russians, the French, the U.S.A. and many of the small nations do not

want to have the recess and regathering of last winter. He admits that some of the Latin

American delegates want the resumed session because of the $500 a day payment each receives

for his services --claiming the poorer the country the greater the per diemi

- *

t

i

liiving received my first Christmas card, which travelled only from Princeton, N.J.,

n Friday I am conscious that the rest of today must be devoted to the completion of the

ffar

*\jja which carry long notes and the addressing of as many more as possible,

with

and an outside temperature of 50 degrees I am not exactly in the

done.

GtAse^i^t /H

Decmmber 10, 1961

A combination of snow, sleet and rain in the night has left a am.ar

of slush on the streets and patches of white on ledges and cornices. More

01 Siusxi

+ nAaV a,,A tomorrow. It has been a routine week with

2240 9wTM omenIatC t tthhe! WWeeddnneessddaayy l^uncheon but a cMapiacchiitgyanc,roRwhdodfeoIrsltahnedCaonmdmPuneintyn-

eylvaniaatmytahle^
ia rather better time

The Pakistanis had a reception Tuesday, where I had

s

^

his deputy. ^0. i-F

few months the Menderes scandal and coup d'etat

resulted irPorders to return to Istanbul. Upon my return from British Columbia _ , . +>,_.+ up. hod unabashedly wept in farewells and fearea he would be

for haying ably carri^ out the work aesigned him by the seyeral preceding goyeraments under whioh he had seryed. His fears were overdrawn and he was Len remitted to lecture at Robert College, but not to leave the coun^r}. Latterly with the Gursul cabinet safely established the ban on departures

fellowship there with the purpose of thinking. He is doing tr.at on ine subject ## of eommunioation barriers to international understanding.

Yesterday morning my buzzer wakened me at eight o'clock and I could only

ras I0c<ZrarTzzl zsiwr-s^ sr f tu"+ it was a telegram with bad news and went into the hall with my

^

Z wresUingk

declined breakfast since he had something at and another upon arrival in New York. St^ ^*yefr^ might have pleased



opportunity of getting some booL and cgazines to his family S

eventually I brayed the dreary cold wind to go downtown to by some Iodine

Ration, *<* >-

S

fh/U.

(X :Zect they we re import ed f.Zdrfom Clippers, but they are amusing with

turned up Moorish toes,and heels whioh should not encourage turning tne ank-e.)

Of course I never even stopped to buy some needed cooking utensils and cups

L Zoers e by that time I wanted to telephone Aunt Mazy. Louise reported

* C had a bad ni^t and a headache and did not even offer to have me

,, ,

.-u

sohone. It cheered me some 'to have Aunt

call

herself0in the late afternoon, to say her head waB better and she would soon

try to eat a little cereal for her supper.

Wednesday night I noticed gasoline slipping out of Hank's car parked at

my transfer point and already had made a large puddle. Often ^Zettsa

people congregate there for a bus they can squeeze into and

'

I hid visions of a fine fire and damage to the oar. Fortunately the elevator

mar wal stin collecting waste from the building in which Maria has her teach ing studio and I did not have to climb the stairs. They were jus. aoou. to leave and insisted that I go along for a Chinese dinner with them. At.Least
+0 hole him on his current problem of finding possible sources ^ pay the $300,000 to build a small mosque at the Fair for the religions sec ion.

The sudden appearance of Alf Landon on the political scene seemingly supporting the President on cooperation with the Common itarkey-ascinates me. Where has he been all these years? What is behind this speecn .

M./hAfC'Z 7JL*.
December 17, 1961
This must needs be a quick one as I am just back from flitting in Aunt Mrv' s library so that Louise could go to the Christmas pageant and fell her^about it/ Actually I was in charge" only a little over half an hour as the nurse stayed until almost five. Aunt Mary has a cold and did not want to expose me, not make the effort of talking. She spends most of the time in bed, her concentration span is lessening and this morning the docotr told Louise she would not improve. Plans for the future* Two Christmas parties on Wednesday, the FPA* s and to.en ohat ox the Council on Foreign Relations,the posfe all men's organization, jafcose invitation to their members Christmas party is rather special. Friday Aunt Annie comes, Sunday we go to Stony Brook for Christmas, returning Monday. Either the following Saturday or Sunday we go to Martha and Cleve to hear about ifeir Christmas in Germany, as well was their prelimxmnary travels from Paris to Rome to Switzerland and way points, Meanwhile the steady process of speakers and program chairmen on the holiday move, who always "drip in" (Friday there was a Netherlander, who has lived in England nd does net see why I in ve never gotten to Bath, where he lives, and an Egyp tian, Also the steady grind of the preliminaries of the NBC January 9 Waldor luncheon. The paid reservations at $15. a cover have been well beyond on frugal anticipations and the Ballroom flow has already be bespoken. We now say we should return checks when we hit 1400 instead oi letting it run on to over 1700 as last ye ar because <f the increase in price, people have
a right not be to squashed in like sardines.
All of this because I may not get to another chitchat until Janauwy 13, so do" not suspect I had been carried off to the hospital I Last night I dined at the Patrick Dean's, where John fheeler-Bennett is staying for a few days before taking her to New Orleans, Tucson and SanA Francisco after Christmas with her mother in Virginia. A gay dinner (Black tie; for twelve, which I consider the beginning of the holiday festiyites. Alas, John was supported by a fine ebony stick as he had put his left knee out" just before he left Barsington. We managed to cover a lot oi territory conversationally after the men joined the ladies, Fortunatley the snow and sleet did not let down before I have gotten home an* into bed. Today has been dreary, a foggy drizzle at roughly the frQezing point, (I ami afraid Vera may have to sit up in a coach on tne night train to Rochester.) There is more of same forecast for tomorrow, but fortunately this was not all snow, I heard a weather roundup in the early afternoon saying that there was four inches in Albany and snowing
at the time.
Sorry, not mere tonight as I had a Sunday mail delivery with half a dozen cards, most of them needing return oards from me and I* d USe to
aleo to write a few notes, too. I am depressed that several ,.aw.,ta9
oresants I ordered from a catalog weeke ago have not yet been delivered and required notes explaining <Mlay, I'll never learn* 1 had tne same
difficulty last year, b*t that was a shop here in town and I made .hem
miderable with daily telephone calle. Time consuming but effective.