Farmers and consumers market bulletin, vol. 100 [i.e. 104], no. 5 (March 1, 2017)

10 0 t1h91A7nni2v0e1r7sary

GEORGIA DEPARTMENT OF AGRICULTURE GARY W. BLACK, COMMISSIONER WEDNESDAY, MARCH 1, 2017 VOL. 100, NO. 5 COPYRIGHT 2017

100 Years Ago Today:

A snapshot of farm life in Georgia when the Market Bulletin began

By Sharon Dowdy
In 1917, Georgia farmers were being affected by things out of their control, namely World War I and a tiny pest called the boll weevil that was just beginning its destructive path through cotton fields.
The majority of farmers in 1917 worked the land with the help of a mule, a trusty draft animal that could withstand Georgia's hot summers and, in some parts, rough terrain. A small farm relied on one mule to work about 10 acres of cotton. According to the 1910 U.S. Census of Agriculture, just shy of 16,000 mules (valued at an average of $170 each) were at work across the state. Sixty-four percent of farmers owned mules, while just 30 percent owned horses.
The average value of a farm, including equipment, was $1,995. This was a 95 percent increase from 1900 numbers.
The average value of farm land was $13.74 per acre, but farms in 10 North Georgia counties were valued between $25 and $50 per acre. Seventy-one percent of Georgia acreage was devoted to farming. The average farm consisted of 92.6 acres.
Cotton was king with 4.9 million acres devoted to the crop at a value of $127 million, but the boll weevil would soon

knock it off its throne. The boll weevil first appeared in Thomasville in 1915, and cotton production began declining rapidly. By 1917, every cotton-producing county in Georgia reported the boll weevil, and production was down by 30 percent.
Many stories are recorded from people who grew up on farms in Georgia who collected the weevils for one penny each. Agricultural scientists at the Georgia Experiment Station in Griffin conducted research to help farmers fight the boll weevil. One UGA publication recommended "starving" the boll weevil by destroying cotton stalks immediately after harvest. Another provided a guide for how to grow cotton in spite of the boll weevil.
Other Georgia Experiment Station publications from 1917 focused, as they do today, on corn and cotton variety trials. The station also conducted trials on soybeans, cowpeas and velvet beans. Researchers planted and harvested the crops and reported back to farmers which varieties perform best. The best cotton variety was pegged as Cleveland Big Boll, which was the most extensively grown at the time. The second best performer was Covington-Toole.
Other leading crops at the time, in order of their importance, were corn ($37 million value/3.4 million total acres),

That was then, this is now
Number of farms in Georgia in 2012 . . . . . . . 42,257 Land in farms . . . . . . . . . . . . . . . . 9,620,836 acres Average farm size . . . . . . . . . . . . . . . . . . . 228 acres Harvested cropland . . . . . . . . . . . . . 3,609,788 acres Market value of ag products sold . . . . $9.26 billion Total farm production expenses . . . . . . $7.5 billion
cotton seed ($23 million), sweet potatoes and yams ($4.3 million), oats ($4.2 million /411,664 total acres), and hay and forage ($4 million).
Peanuts, now one of Georgia's top five commodities, were grown on just 160,317 acres. Most of these acres were in the southern half of the state with the leading producer being Brooks County. A fourth of the crop was grown in Brooks, Decatur, Grady and Thomas counties.
Other crops of the time were dry peas (210,315 acres), wheat (93,065 acres), sugar cane (37,046 acres) and tobacco
See SNAPSHOT, page 14

The Wearing
of the Green
Georgia House Agriculture and Consumer Affairs Committee Chair Tom McCall, R-Elberton, wears his green 4-H jacket in honor of 4-H Day at the Capitol Feb. 8, the same day the Georgia Agribusiness Council hosted its annual Legislative Breakfast in Atlanta. "If it wasn't for me coming up in 4-H from the 5th grade, if the House is anywhere to be I wouldn't be there," McCall told legislators and agribusiness leaders gathered for the breakfast. See more photos from ag-related activities at the Capitol in February on page 9. (Photo by Blane Marable | blanemarable.com)

Mail to: Published by the Ga. Department of Agriculture Gary W. Black, Commissioner

Reader Profile: Georgia Agriculture Commissioner Gary W. Black

Commissioner Gary W. Black with the Market Bulletin archive.

By Amy H. Carter
Editor
On Feb. 11, 1976, readers of the Farmers and Consumers Market Bulletin first made the acquaintance of one Gary Black, a high school senior serving as state president of the FFA. The annual observance of National FFA Week was nigh, and Black was invited to write a guest column for the paper to mark the occasion.
His topic: the future. It was a humble discourse on the opportunities that FFA had afforded Black to that point in his life. His aspiration at the time was to be a teacher of agriculture. There was no bold pronouncement of any intent to be the next commissioner of agriculture for the state because, frankly, that idea was still three decades in the offing.
"I didn't plan that," Black said.

The decision to offer himself for election as Georgia's 16th Agriculture Commissioner came from a desire to be a strong voice for the future of the state's agriculture industry.
"We had a lot of encouragement from a lot of people," he said.
It was encouragement that started long before his senior year of high school.
"I think you just have to be grateful for the opportunities that come your way," Black said. "But for parents who supported me and an ag teacher who believed in me, I would never have had the chance to write the first article (in the Market Bulletin). But for the opportunity to write that first article my name wouldn't be on the masthead (of the Market Bulletin). It all links together."
One of the many responsibilities that come with being Commissioner of Agri-
See GARY W. BLACK, page 14

PAGE 2

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Advertise in the Market Bulletin
Classified advertisements in the Market Bulletin are free to subscribers and limited to one ad per issue per subscriber number. Out-of-state subscribers may only publish ads in the Out-of-State Wanted category. Advertisements from businesses, corporations, dealerships, real estate agents or other commercial entities are not permitted. Advertising is limited to farm-related items.
Advertisers and buyers are advised to be aware of state and federal laws governing the sale and transfer of live animals. The Georgia Department of Agriculture does not assume responsibility for transactions initiated through the Market Bulletin but will use every effort to prevent fraud. Advertisers are expected to fulfill the terms of their offers. Failure to do so through either negligence or intention may require the Market Bulletin to refuse future ads.
Market Bulletin staff reserves the right to designate ad length and to edit for spelling, grammar and word count. Ads run a maximum of two consecutive issues if the category allows. A new ad must be submitted to run longer than two consecutive issues.
Ads in regularly published categories are limited to 20 words including name, address, email address and phone number. The following ad categories are published periodically and allow up to 30 words: Farm Services; Farm Services Wanted; Farmland Rent/Lease; Farmland Rent/Lease Wanted; Farmland for Sale; Handicrafts. Ads for Farmland for Sale are published twice per year, in the spring and the fall.
There are three ways to submit your ad.
Fax: 404.463.4389 Mail: Georgia Department of Agriculture
Attn: Market Bulletin 19 Martin Luther King Jr. Drive SW Atlanta, GA 30334-4250 Online: www.agr.georgia.gov
Please include your subscription number on all mailed and faxed correspondence.
Questions about advertising? Call 404.656.3722

Subscribe to the Market Bulletin
A one-year subscription to the Market Bulletin is $10 and includes both print and online access.
To subscribe or renew online visit agr.georgia.gov to pay via electronic check, Visa or MasterCard.
To subscribe by phone, renew your subscription, update your address or report delivery problems call 404.586.1190 or 800.282.5852.
To subscribe by mail send a check or money order payable to the Georgia Department of Agriculture along with your name, complete mailing address, email address and phone number to:
Georgia Department of Agriculture Attn: Market Bulletin P.O. Box 742510 Atlanta, GA 30374
Multi-year subscriptions may be purchased by mail.

Call the Department of Agriculture

404.656.3600 | 800.282.5852

AI Hotline 855.491.1432

Georgia Grown

Food Safety

404.656.3680

404.656.3627

GATE 855.327.6829

Plant Protection 404.463.8617

Equine Health 404.656.3713
Animal Protection 404.656.4914

Licensing 855.424.5423
State Veterinarian 404.656.3671

Fuel and Measures 404.656.3605

Market Bulletin 404.656.3722

Georgia Department of Law Consumer Protection Unit 404.651.8600 | 1.800.869.1123

Elbert 19.98 acres, 2 pastures, 2 Spalding 10 acres, half is pasture-
FARMLAND FOR SALE barns, 2 paddocks, stream and pond land, county water, septic tank, brick watering, fenced areas, excellent for ranch home, needs repairs; $100,000.

Following are advertisements horses/other livestock, 4BR house Jewell Mccray Griffin 770-228-5460

for the Market Bulletin's Farmland near UGA; $425,000. Jan Thompson Spalding 19.3 acres, wooded, with 2

Edition. Ads are listed alphabeti- Bowman 706-255-4915

older homes; $149,000. Sammy Eng-

cally by county according to geo- Elbert 21 acres, power, drill well, lish Jackson 770-584-5998

graphical regions. The map and septic tank, 1 mile from Pearl Mill Boat Spalding 72.7 beautiful acres in NW

legend on this page may be helpful Ramp lake. Leonard Ridings Cum- part of county, borders Fayette County,

in locating land advertisements. ming 770-887-4786

already cleared, lovely farm, lake, build-

Ads are limited to describing farm- Elbert 60 acres, 40 acres of hard- ing sites, partial roads, natural stream;

land or farm structures; detailed woods with streams, excellent hunt- $4000/acre. Nizam Khan Jonesboro

descriptions of non-farm struc- ing, 1000' paved road frontage, gor- 404-932-2829

tures are not included in these advertisements.
Farmland Northeast

geous setting, old homestead with lots of character; $2995/acre. Jeff Watson Acworth 404-309-8962
Franklin 62 acres river property,

Farmland Northwest
If you have questions about ads in this category, call 404-656-3722.

If you have questions about ads in 1600' river frontage, county water, Bartow 40+ acre farm, pasture, well,

this category, call at 404-656-3722. paved road frontage, 5 miles from I-85, county and spring water available, Banks 12+/- wooded acres, creek financing available; $6350/acre. Don- barn, outbuildings, some fencing, old
runs through, family land, adjacent to ald Major Dawsonville 678-617-0383 farm house; $350,000. Ruby Cowart power line, can be used for access, Greene 151.6 acres, mature pine 602 Towe Chapel Rd Nw Adairsville will finance with 20%-down; $60,000. and hardwood, lake site, good hunt- 30103 770-773-3436

Faye Little 5111 Linda Vista Dr. Sw ing, paved road, electricity, 870' road Carroll 31 acres, south of Carrollton,

Mableton 30126 770-941-1440

frontage on South Fork Rivers; $2500/ 10 acre hayfield, 21 acres of mature

Banks 8.59 acres, 3 barns, riding acre. Morris Moss Greensboro 770- hardwoods, creek flows through the

ring, round pen, fenced, cross-fenced, 546-7204

center of the property, beautiful lake

grass pastures, small animal pens, Hart 10 acres, Lavonia, Hart Coun- site; $5500/acres. Don Williams Car-

4BR/3BA house, central A/C and heat, ty, creek, pond, $95,000; 15 acres in rollton 770-328-2782

w/hot tub. Joan Kiser Carnesville 706- Bowman/Elbert County, creek, pond, Chattooga 47 acres, 25 open acres,

247-0976

$80,000; possible owner finance. Rob- some fenced, catfish pond, deer and

Banks 93 acres, pond, stream, ert George Lavonia 706-356-1420

turkey hunting, city water, drilled well,

barns, poultry operation, covered Jackson 9 acres, fenced and cross spring branch, workshop, pole barn,

bridge, park-like surroundings, 5BR fenced, with water, 3000 sq./ft. metal 3BR house; $395,000. David Luther

house, pool, mobile home, owner fi- barn, 800 sq./ft. 1BR/1BA cabin, 50x20 Menlo dwluther@yahoo.com 706-857-

nancing available; $1.3 million. H.E. shop w/single car garage; $282,000. 8420

Clark 1296 Duncan Rd Commerce Mike Jenkins Nicholson 770-861- Floyd 83.3 acres, between Muck

30530 706-335-5432

9111

Creek and Dunaway Gap Road, backs

Dawson 22 acre plant nursery farm Madison 13.4 acres, wooded tract; up to the Chattahoochee National For-

with irrigated, wells, pond, barn, 16 greenhouses, container tree and shrub growing yards, and barn; $500,000. Luca Gianturco Alpharetta 770-8264738
Fannin 11.2 acres, springs, road frontage, electricity, private road through property. E. Fleming Mccaysville 770-460-1646
Fannin 24.14 acres, pond, 2 outbuildings, 3BR/1BA house w/full basement, owner financing available; $850,000. Thomas Twitty Blue Ridge 706-632-3914
Fannin 7.88 acres, half-pasture, gently rolling, paved road frontage, old

conservation until 2019, 1800' paved frontage; Reggie Ingram Road/McGinnis Chandler Road, 5 miles to I-85, leave message; $5300/acre. Patricia Mahoney Commerce 706-783-3161
Madison 22.3 acre wooded tract, mature hardwoods, marketable pine, spring/creek, paved road frontage on Highway 172, will divide into 2 tracts; $64,500/11.81 acres. Larry Evans Royston 770-530-4650
Madison 36 acres, road frontage, 2000' paved road frontage, 30 minutes from Athens; $5000/acre. Ralp Rice Bowman 706-245-8117

est; $3000/acre OBO. Charles Shaw Armuchee evasamshaw@gmail.com 770-938-3527
Gordon 10.02 acres, 3 acres cleared/ in grass, 435' paved road, city water, GA Power, near Carter's Dam2 building sites; $69,000. C.N. Smith Ranger 706-602-9607
Gordon 16 acre mini farm, mostly pasture, spring-fed pond, some hills, 600'-900' road frontage, 2 barns, water hook-ups, septic, electricity, phone hook-up, 1680 sq./ft. brick house; $199,000. Debbie Wyatt Oakman 770401-2338

house; $74,950 OBO. Arnold Kaye Jr Madison 5 acres, fenced, pas- Gordon 21.54 acres, rolling land for

Morganton 803-315-4313

ture, wooded area, stream, house; pastures, 20 acre right-away to proper-

Gilmer 29 acres, wooded, borders paved county road, 2 springs, seasonal

$158,000. Royce Greeson Danielsville 706-202-1864

ty possible to buy, four class-A broiler houses, mobile home and travel trailer.

views; $5000/acre. Eddy Mullinax Elli- Oconee 128 =/- acres, 43 acres of Pam Duckworth Calhoun 706-346-

jay 706-273-4282

woodland, 85 acres of pasture, barns, 0217

Habersham 35.62 acres, 2000' 19 stalls, arena, 4BR house; $2,000/ Gordon 54.8 acres, 1200' paved

frontage, Apple Pie Ridge, $12,000/ acre. David Vaughn 2070 Hodges road frontage, mostly wooded, county

acre; adjoins 20.85 acres, 900' front- Mill Rd. Watkinsville 30677 706-769- water, 4-corner, new 4-board fencing,

age, private paved road, hardwoods, 6283

owner financing available with 20%

pine, old pasture, $7500/acre. S. Duck- Oglethorpe 20 acres/each: 1 wood- down, trades considered, serious call-

ett Cornelia 706-778-7280

ed, mature timber, bottoms, hills, ers only; $300,000. Kenny Stewart

Hall 19.76 acres, wooded with a stream, dirt road frontage; 1 cropland, Morganton 770-479-9847

creek, almost 2000' paved road front- 1 paved/1 dirt road frontage, homesites Gordon 7.42 acres, mostly good

age, old farm house and barn, ei- are .2-miles from paved road. Lewis pastureland, fenced, agricultural com-

ther can be renovated or removed; Sanders Stephens 706-340-1546

munity, 2 outbuildings, old home, con-

$198,000. Jenny Gillespie Gainesville 678-617-6464

Farmland Greater Atlanta

venient shopping, schools and more; $165,000. Gwyn Bullard Calhoun 678-

Hall 26.47 acres, mostly wooded, If you have questions about this ad 918-0011

city water, large creek, blueberries, lots of deer, 3 homesites; $475,000. Lois Ashley 3447 Baker Rd Gainesville 30507 678-630-3531
Hall 5 acres, hardwoods, pond site, paved road, northern part of county, 1/2 mile off 365, Sloan Mill Road, owner finance with 6% down; $12,000/ acre. Ron Rogers Braselton 706-6543355 770-480-8646
Stephens 23.6 acres, mostly wooded, rolling hills, stream flowing through property, access off dirt road, Red Rock Road; $2900/acre. Bobby Dover Toccoa 706-886-5226 404-731-4506
Stephens 63.72 acres, wooded and pastureland, creek and other water, older house occupied by tenants; $275,000. Bob Wilmot Loganville 770466-1901
Farmland Northeast Central

category, call 404-656-3722.
Cherokee 116 acre farm, two 5 acre stocked lakes, fenced/cross-fenced, rolling pastures, utilities and water, 2 chicken houses, house and cabin; $25,000/acre. Trixie Roukoski Marietta 404-754-7146
Cherokee 27 +/- acres, Mt. Carmel Church Rd., off 108 near 20, rectangle, land slopes off center ridge, bold stream on back line; $17,500/acre. Paula Hill Atlanta hillpaulad@gmail. com 404-256-4633
Cherokee 5+ acres, fenced and landscaped, stocked pond, pasture, upscale and smaller barn, animal pens, additional acreage, large, elegant brick house; $595,000. Bob Rosenfeld Woodstock 770-926-8951
Cobb 11+ acres, pasture, creek, outbuildings/barn, cabin, 5' chain fence,

Haralson 25+ acres, all wooded except 2 acres cleared for house, gravel driveway, mostly hardwoods, streams, deer, turkey, financing available; $2500/acre. Ben Frost Buchanan 770853-3409
Haralson 54.387 acres, pasture land, 2 miles east of Buchanan, 2 creek bottoms, rolling hills, some woodland; $4000/acre. Judy Davenport Bowdon 770-258-2709
Polk 98.9 acres, some open, rest is wooded, highway frontage, good hunting, pond site; $2759/acre. D.A. Langley Marietta 770-427-2268
Walker 37.5 acres, secluded, standing aged hardwood, off Coffman Springs Road; $4500/acre. Sidney Queen LaFayette 423-421-0089
Whitfield 6 acres, wooded, northeast

If you have questions regarding this hardwoods, no liens; $1.65 million part of the county, 1000' road frontage;

ad category, call at 404-656-3722. OBO. Sam Saliba Marietta 770-514- $10,000/acre. Daniel Cochran Dalton

Barrow 10 beautiful acres, large 1431

706-259-9295

horse barn, horse safe fence, sev- Douglas 126 acres, pine, hardwood,

Farmland West Central

eral paddocks, running water, Hwy creek, land assessed at $328,000, land 211, large home, more land available; under Timber Management Covent

If you have questions regarding ads

$387,000. Charles Wellham Statham since 2013; $225,000. C.D. Chase Lo- in this category, call 404-656-3722.

678-764-5097

ganville 404-731-2504

Coweta 20.5 acres, mostly open

Barrow 30 acres, half-pasture and Douglas 90 acres, growing trees, pasture, hardwoods front and back,

half-pines planted in 1999, nice creek, stream, 4 miles from I-20 at exit 24, partially fenced, water, electric, septic,

small pond, with approximately 1400' owner finance, investment residential propane Ideal for horses, convenient

road frontage; $369,000. Tom Bohan- property, rental house; $8500/acre. to I-75, 40x40 metal building w/apart-

non Winder tom.bohannon@gmail. Dillard Buchanan Villa Rica 770-834- ment; $180,000 OBO. Bill Brannan

com 770-601-6147

3667

Sharpsburg 770-527-1634

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 3

USE FOR LOCATING GEORGIA COUNTIES

FARMLAND SECTIONS AND COUNTIES

Northwest
Bartow Carroll Catoosa Chattooga Dade Floyd Gordon Haralson Murray Paulding Polk Walker Whitfield
Northeast Central
Barrow Clarke Elbert Franklin Greene Hart Jackson Madison Morgan Oconee Oglethorpe Walton
Southeast
Appling Atkinson Bacon Brantley

Bryan Bulloch Camden Candler Charlton Chatham Clinch Coffee Echols Effingham Evans Glynn Jeff Davis Lanier Liberty Long McIntosh Montgomery Pierce Screven Tattnall Telfair Toombs Ware Wayne Wheeler
Northeast
Banks Dawson Fannin Gilmer Habersham Hall Lumpkin Pickens Rabun

Stephens Brooks

Towns

Calhoun

Union

Chatta-

White

hoochee

Clay

East Central Colquitt

Cook

Baldwin

Crisp

Bleckley

Decatur

Burke

Dooly

Columbia Dougherty

Dodge

Early

Emanuel

Grady

Glascock Irwin

Hancock

Lee

Jasper

Lowndes

Jefferson Marion

Jenkins

Miller

Johnson

Mitchell

Jones

Pulaski

Laurens

Quitman

Lincoln

Randolph

McDuffie

Schley

Putnam

Seminole

Richmond Stewart

Taliaferro

Sumter

Treutlen

Terrell

Twiggs

Thomas

Warren

Tift

Washington Turner

Wilkes

Webster

Wilkinson Wilcox

Worth

Southwest

Greater

Baker

Atlanta

Ben Hill

Berrien

Cherokee

Clayton Cobb DeKalb Douglas Fayette Forsyth Fulton Gwinnett Henry Newton Rockdale Spalding
West Central
Bibb Butts Coweta Crawford Harris Heard Houston Lamar Macon Meriwether Monroe Muscogee Peach Pike Talbot Taylor Troup Upson

Lamar 9 acres, 2 flag lots, can be divided, small pond, hardwoods, pine, pecan and Leyland Cypress, Fellowship Industrial) Road, call before 9 p.m.; $70,000. Greg Taylor Milner 770946-9310
Meriwether 20 acres, level land with pines, off I-85, close to school, churches and more; $175,000 OBO. Mary Darian Luthersville 404-444-5214 770-471-5613
Meriwether 23 acre horse farm, near I-85, good cross-fenced pastures, 8 stall horse barn, covered round ring. Mack Reynolds Hogansville 706-3027379
Meriwether 50 acres, heavily wooded w/new future timber value, good deer and wild turkey hunting, good commercial use, stream, near Calloway Gardens/Kia plant, off Highway 18; $3500/acre. Lillian Hightower Pine Mountain 404-243-5744 404-2263050
Pike 106 acre farm, beautiful mix of pasture, woods, pond and stream, private perimeter fence, well, shed, wired for electricity, great home sites; $4700/ acre. Michael Schooley Concord fcrfamily@bellsouth.net 770-414-1018
Talbot 25-30 acres of beautiful rolling land, 50% pasture, 50% hardwoods, 5 miles from Talbot, owner finance with 30% down payment; $3000/acre. John Gay Talbotton 706-326-6534 706457-0473
Talbot 6+ acres, off Hwy. 41 outside of Manchester, wooded, potential pond site, power line; $4000/acre. Sean Mcdevitt 1735 Ammons Bridge Rd Monroe 30655 sean@appliedceramics.com 404-307-8371 770-8550000
Taylor 106 acres, 60,000 planted pines, 6 acres food plots, 1800 sq./ft. road frontage, great deer/hog hunting, 3/4-mile creek front, deer stands, 1300 sq./ft. house; $289,000. Wayne Cason Mansfield 770-294-4596
Troup 115 acres, good timber, hardwoods and pines, 15 acres open, located near Pine Mountain, GA; $3500/ acre. Echols Hart Pine Mountain 706663-2520

Upson 151 acres, wooded, near Sprewell Bluff, twice thinned pines and two nice hardwood bottoms, 4 acre pond site, good hunting; $2300/ acre. Scott Nesmith Molena 770-5847449
Farmland East Central
For information regarding ads in this category, call 404-656-3722.
Burke 53 acres, 12 open acres, 10 acres with 30 y/o pines, marketable timber, fish pond, private, gated; $149,000. James Schlein Vidette 706830-7959
Burke 68.2 acre horse/cattle farm, creek, barns, sheds, 4br/2ba home with guest house; $333,000. M. Hughes Waynesboro 706-466-1018 706-437-1074
Emanuel 14 acres, partially wooded, with well and pump, near deer hunting clubs and Ogeechee river, very peaceful, 1905 barn, 1905 renovated farm house, 2015 mother-in-law home. Janice Allen Midville 478-494-1425
Emanuel 24.59 acres, 7 acres cleared, small pond, hardwoods and pine, ideal for hunting or horses, double-wide trailer with ramp, 30 minutes from Statesboro. David Amonette Garfield 404-580-3414
Emanuel 68 acres, 44 acres cultivated, timber, fishing rights in Ogelsby Pond, excellent hunting; $3000/acre. S. Bowen Garfield 912-682-6061 912865-2795
Hancock Retiring: 84 acres, 20+ cattle operation, fenced/cross-fenced, food plots, 2 wells, 4 ponds, creek borders, house and caretaker's apartment; $252,000. Bob Holder White Plains 770-385-0127
Warren 51 acres, paved road frontage, food plots, year-round creek, good timber, small pond, very nice cabin; $200,000. Jeff Walls Warrenton 706-465-2924
Wilkinson 175 acres, great hunting and timber land, cut 3 years ago, mineral rights reserved; $1000/acre southern zone. Dirk Council Milledgeville 478-451-7186

Farmland Southeast
For information regarding ads in this category, call 404-656-3722.
Jeff Davis 112+/- acres, 35 cultivated acres, timber has been cut, frontage on Hwy 268, Broxton Hwy, and McLoon Road, 5.5 miles from Hazlehurst; $250,000. Jimmy Wilcox Brunswick 912-264-5099 912-269-5346
Farmland Southwest
If you have questions regarding ads in this category, call 404-656-3722.
Calhoun 45.5 acres, half wooded, spring and stream on property; $3500/ acre. Jim Andrews Edison jtajr51@yahoo.com 229-835-2483
Crisp 12.5 acres, mini-farm, pond, enclosed pole barn, 2 wells, 3 septic tanks, 2600 sq. ft. home, 5BR/3BA; $180,000. Ray Faircloth Cleveland 229-712-6915
Early 14 acres, 3-4 acres wooded with pines, rolling pastureland, pond, close to Kolomoki State Park, 1BR/1BA with newly built cabin; $50,000. Mike Preston Blakely 229-723-5069
Irwin 84 acres, 65 cultivated, pond, bordered by public road, 7 miles south of Ocilla on US319; $200,000. Kenneth Gray Hortense 912-269-6380
Lowndes Wanted: 500-2000 acres, South Georgia, anywhere a little out of the way like Adel/Hahira, etc., can close quickly, retired private party, can rent back land/house to you. Clyde Chapman Gainesville 813-334-4146
Pulaski 33 acres, pecan orchard, paved road frontage, water/sewage, $4500/acre; 50 acre cut-over, road frontage, will divide, $2500/acre. William Sparrow Pinehurst 478-954-5903
Schley 295 acres, rolling pastures, mature hardwoods, managed timber, lush creeks, trails, vintage buildings, old store, great recreation property. Steve Saunders Decatur 404-323-5459
Sumter 67+ open and wooded acres, good for farming and hunting, deep well, springs, deer/turkey, 1-mile south of Jimmy Carter's childhood farm; $2000. Tom Allen Plains jandtbuy@brmemc.net 706-400-9124

Wilcox 316 acres, 110 acres open, 67 acres of planted pines, large pond, 3 miles NW town; $1700/acre. Gloria Williamson Abbeville 229-425-0400 229-423-7796
Wilcox 38 acres, cattle land, pond, barn, 1/4-mile from Ocmulgee River Boat Landing and Recreation Park, great place to build log cabin; $76,000. David Sheppard Half Moon Rd. Abbeville 31001 229-425-7659 229-4258109
Wilcox 65 acres, 44 acres cropland, remaining is large pine and hardwoods, 8" irrigation well, 15' water level, highway frontage; $3200/acre. Virgil Belflower Sycamore 229-567-7273 229567-3572
Wilcox 92 acres, 62 acres 30+ y/o planted pines, 8 acres cutover, balance hardwood, excellent pastureland location, industrial site w/railroad frontage, Hwy 280 frontage half-mile east of city. Danny Hawkins Rochelle 229-3653097
FARM SERVICES
If you have questions regarding ads in this category, call 404-656-3722.
Farm Services and Services Wanted ads must be related to agriculture. Wanted services must be performed on the farm of the individual desiring the service. Commercial contractors are not allowed to advertise services in this category. Farm Services and Farm Services Wanted ads are limited to 30 words.
35+ years of experience, lakes/ponds built and repaired without draining, new pipe systems, land clearing, swamps drained, creeks rerouted, drainage problems, homesites, licensed and insured. Bobby Karr Fairburn 678-9737645 470-233-2992
38 years of experience, N. GA/metro Atlanta: Bush-hogging/grading, post holes, gardens/food plots, aerating/ seeding, chainsaw work, more; $50/ hour, 3 hour minimum. Rick Allison Buford 678-200-2040

38 years of experience: Horse arenas laser-graded, tree clearing, driveways built/regraded, gravel, barns graded, drainage correction, trucking and demolition. Luke Butler Braselton 770685-0288
Agricultural fences: USDA, wood or wire, NCRS qualified standards; also corrals, barns and all other related work. Robert Hayes Hartwell 706-3766708
All aspects of grading and concrete, concrete slabs and land clearing. P.J. Morgan Shiloh 762-359-8742
All farm fencing installed, land management, woven, board, electric, high tensile fence, bush-hogging, food plots, trail maintenance. Casey Kent Monroe 678-446-8520
Beaver trapper, beaver dam removal, 29 years of experience, reasonable rates/humane treatment, fully licensed by GA-DNR, Henry/surrounding counties only; also remove coyote, fox, opossum, raccoon, etc. Dan Dominick Locust Grove 678-448-2524
Bobcat/tractor work, bush-hogging, lawn mowing, pasture maintenance/ restoration, grading, clearing, plowing, garden, deer plots, pesticide spraying, welding fencing, heavy equipment. Larry Houston Covington 770-2353082 770-235-3782
Bush hog, drives scraped and tilling services. Larry Boatright Dallas 678386-1466
Bush hog, rotary mow, garden and food plot, harrow/plow, cut, rake and bale square hay, Monroe County area. Jimmy Waldrep Forsyth 478-994-0701
Bush-hogging services, 65HP 4x4 tractor with 7' bush hog, plowing, spraying, call for quotes; $55+/hour. Heath Chadwick Ball Ground 770235-6514
Custom cattle freeze branding. Cole Meeks Statesboro 912-601-5283 912-531-3549
Custom harvesting, with JD 9400 combine, 922F header and 444 corn head, within a 25 mile radius; $30/ acre. Jacob Pope Covington 678-7638941

PAGE 4

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Livestock Sales and Events Calendar

APPLING COUNTY
1st & 3rd Saturdays, 1 p.m.: Goats, sheep, small animals, feeder pigs; S&D Livestock, 187 Industrial Drive, Baxley; Call Steve Smith, 912.366.9207 or 912.278.1460
ATKINSON COUNTY
2nd & 4th Saturdays, 1 p.m.: Goats, sheep, chickens, small animals; Pearson Livestock, 1168 Highway 441 N, Pearson; Call Roberto Silveria, 229.798.0271
BARTOW COUNTY
Every Wednesday, 1 p.m.: Cattle, goats, sheep; The New Peoples Livestock Mkt., 407 Burnt Hickory Road, Cartersville; Call Haynie Cochran, 770.547.1717; Phil Tuck, 770.881.0502
BEN HILL COUNTY
Every Monday, 1 p.m.: Cattle; South Central Livestock, 146 Broad Road, Fitzgerald. Call Thomas Stripling, 229.423.4400 or 229.423.4436
BERRIEN COUNTY
Saturday, March 25, noon: The 10th Annual Southern Tradition Sale; selling 185+ head of high-quality pairs, bred females and bulls; CSR Farms Sale Facility, Alapaha. Call Carroll T. Cannon, 229.881.0721, CannonMarketingCompany@gmail. com
BLECKLEY COUNTY
2nd, 4th & 5th Saturdays, 1 p.m.: Goats, sheep, chickens, small animals; Coker's Sale Barn, 9648 Duncan Bridge Road, Cleveland. Call Wayne Coker Sr., 706.540.8418
BUTTS COUNTY
Every Wednesday, 11:30 a.m.: Cattle 2nd & 4th Wednesdays, 11:30 a.m.: Dairy cattle; Mid-Georgia Livestock Market, 478 Fairfield Church Road/ Hwy. 16 W, Jackson. Call Brent Galloway, 770.775.7314
CARROLL COUNTY
2nd & 4th Saturdays, 4 p.m.: Goats, sheep, chickens, small animals; Long Branch Livestock, 813 Old Villa Rica Road, Temple. Call Ricky Summerville, 404.787.1865
Every Monday, noon: Cattle, goats, sheep; Carroll County Livestock Sales Barn, 225 Salebarn Road, Carrollton. Call Barry Robinson, 770.834.6608 or 770.834.6609
CHATTOOGA COUNTY
Every Friday, 7 p.m.: Goats, sheep; Trion Livestock Auction, 15577 Hwy. 27, Trion. Call McKinley Evans, 678.276.5127
CLARKE COUNTY
Every Wednesday, 11 a.m.: Goats and sheep; noon, cattle. Northeast Georgia Livestock, 1200 Winterville Road, Athens. Call Todd Stephens, 706.549.4790
COLQUITT COUNTY
Every Wednesday, 1 p.m.: Cattle; Moultrie Livestock Co., 1200 1st Street NE, Moultrie. Call Randy Bannister, 229.985.1019
COOK COUNTY
1st, 3rd & 5th Saturdays, 1 p.m.: Goats, sheep, chickens, small animals; Deer Run Auction, 1158 Parrish Road, Adel; Call John Strickland, 229.896.4553
DECATUR COUNTY
2nd & 4th Saturdays, 1 p.m.: Goats, sheep, chickens, small animals; Waddell Auction Co., 979 Old Pelham Road, Climax. Call John Waddell, 229.246.4955

EMANUEL COUNTY
Every Monday, 1 p.m.: Cattle, slaughter hogs; Swainsboro Stockyard, 310 Lambs Bridge Road, Swainsboro. Call Clay Floyd and David N. Floyd, 478.945.3793
2nd & 4th Saturdays, noon: Goats, sheep, chickens, small animals; R&R Goat & Livestock Auction, 526 Hwy. 56 N, Swainsboro. Call Ron & Karen Claxton, 478.237.4628 or 478.237.8825
Every Tuesday, 10 a.m. & 1st Fridays: Cattle special sale; Dixie Livestock Market, 133 Old Hwy. 46, Oak Park. Call Willis & Tammy Sikes, 912.578.3263
FORSYTH COUNTY
Every Tuesday, noon: Cattle, goats, sheep; Lanier Farm's Livestock Corp., 8325 Jot-Em Down Road, Gainesville. Call Tyler Bagwell, 770.844.9223 or 770.844.9231
FRANKLIN COUNTY
Every Tuesday, noon: Cattle, goats, sheep; Franklin County Livestock Sales, 6461 Stone Bridge Road, Carnesville. Call Chad and Clay Ellison, 706.384.2975 or 706.384.2105
GORDON COUNTY
Every Thursday, 12:30 p.m.: Cattle, goats, sheep, slaughter hogs; Calhoun Stockyard Hwy. 53, 2270 Rome Road SW, Calhoun. Call Dennis Little & Gene Williams, 706.629.1900
GREENE COUNTY
Every Thursday, noon: Cattle, goats, sheep; Duvall Livestock Market, 101 Apalachee Ave., Greensboro. Call Jim Malcom, 706.453.7368
JEFF DAVIS COUNTY
1st & 3rd Fridays: Horse sale, 7:30 p.m.; Circle Double S, 102 Lumber City Highway, Hazlehurst. Call Steve Underwood, 912.594.6200 (night) or 912.375.5543 (day)
JOHNSON COUNTY
1st & 3rd Mondays, 7:30 p.m.: Chickens; Ol' Times Auction, 503 Hill Salter Road, Kite. Call Robert Colston, 478.299.6240
JONES COUNTY
Every Saturday, 6 p.m.: Goats, sheep, chickens, small animals; Buggy Town Auction, 1035 Hwy. 11, Gray. Call Jimmy Burnett 770.358.0872
LAMAR COUNTY
Every Friday, 6 p.m.: Goats, sheep, chickens, small animals; Buggy Town Auction Market, 1315 Highway 341 S, Barnesville. Call James Burnette 770.358.1786
LAURENS COUNTY
2nd & 4th Thursday, 6 p.m.: Goats, sheep, chickens, small animals; Horse Creek Auction Co., 5971 Hwy. 441 S, Dublin. Call Daniel Harrelson, 478.595.5418
MADISON COUNTY
Every Friday, 6 p.m.: Chickens, small animals; Gray Bell Animal Auction, Hwy. 281, Royston. Call Billy Joe Bell, 706.245.4205
MARION COUNTY
Every Thursday, 7 p.m.: Goats, sheep, chickens, small animals; Auction 41, 4275 GA Hwy. 41 N, Buena Vista. Call Jim Rush, 706.326.3549. Email auction41@windstream.net
NEWTON COUNTY
2nd & 4th Saturdays: Pony Express Stockyard Horse & Tack Auction, 5 p.m.; GAL AUNR002843; 1852 Highway 11 S, Covington. Call Scott Bridges, 704.434.6389 or 704.473.8715
PULASKI COUNTY
Every Tuesday, 1:30 p.m.: Cattle, goats, sheep; Pulaski County Stockyard, 1 Houston Street, Hawkinsville. Call John Walker, 478.892.9071

SEMINOLE COUNTY
Every Wednesday, 1:30 p.m., 3rd Saturday Special Sale, 1:30 p.m.: Cattle, goats, sheep; Seminole Stockyard, 5061 Hwy. 91, Donalsonville. Call Bryant Garland and Edwina Skipper, 229.524.2305
STEPHENS COUNTY
2nd Saturdays, 5 p.m.: W&W Livestock, Eastanollee Livestock Auction, Eastanollee. Call Brad Wood, 864.903.0296
3rd Saturdays, noon: Goats, sheep; Agri Auction Sales at Eastanollee Livestock Market, Highway 17 between Toccoa and Lavonia. Call Ricky Chatham, 706.491.2812 or Jason Wilson, 706.491.8840
Every Monday, noon: Cattle, goats, sheep; Eastanollee Livestock, 40 Cattle Drive, Eastanollee. Call Mark Smith, 706.779.5944
SUMTER COUNTY
Every Thursday, 1 p.m.: Cattle; Sumter County Stockyard, 505 Southerfield Lane, Americus. Call Bobby Gooden, 229.815.7127
TAYLOR COUNTY
1st & 3rd Tuesdays, 6:30 p.m.: Feeder pigs, goats, sheep, chickens, small animals; RockRidge Livestock Auction, 1357 Tommy Purvis Jr. Road, Reynolds. Call Melba Strickland, 706.975.5732
TELFAIR COUNTY
2nd & 4th Thursdays: Chickens, fowl, goats and sheep; check-in at 1 p.m., sale at 6:30 p.m. Horse Creek Auction, between Dublin and McRae off Highway 441. Call 478.595.5418
THOMAS COUNTY
Every Tuesday, 1 p.m.: Cattle. 1st & 3rd Tuesdays: Slaughter hogs; Thomas County Stockyards, 20975 Hwy. 19 N, Thomasville. Call Jimmy P. Benton, 229.228.6960
TOOMBS COUNTY
1st & 3rd Saturdays, 11 a.m.: Feeder pigs, goats, sheep, chickens, small animals; Metter Livestock Auction, 621 Hwy. 1 S, Lyons. Call Lewie Fortner, 478.553.6066
TURNER COUNTY
Every Wednesday, 1 p.m.: Cattle; Turner County Stockyards, 1315 Hwy. 41 S, Ashburn. Call Alan Wiggins, 229.567.3371
UPSON COUNTY
Every Thursday, noon: Cattle, goats, sheep. L&K Farmers Livestock Market, 2626 Yatesville Hwy., Thomaston. Call Kathy and Lewis Rice, 706.468.0019.
WHITE COUNTY
Every Saturday, 4 p.m.: Goats, sheep, chickens, small animals; Coker's Sale Barn, 9648 Duncan Bridge Road, Cleveland. Call Wayne Coker Sr., 706.540.8418
WILKES COUNTY
Every Wednesday, noon: Cattle, goats, sheep; Wilkes County Stockyard, Hwy. 78 Bypass/302 Third Street, Washington. Call Kenny Durden and Linda Robertson, 706.868.0160
Notices for auctions selling farm-related items other than livestock must be accompanied by the auction license number of the principal auctioneer or auction firm conducting the auction, per regulations from the Georgia Secretary of State. Auctions without this information will not be published. Have an auction to put on our calendar? Contact Amy Carter at 404.656.3722 or amy.carter@agr.georgia.gov.

Electric fence charger repairs. Wilfred Farm hand, 3-4 days a week, clean-

Milam Douglasville 770-942-4672

ing out flower beds of debris, hand

Environmental clearing options, turn weeding, dead heading flowers and forest into pasture, clean-up after tim- overall yard maintenance. Chris Hunt ber cutting, grinding and mulching, as Smoke Rise beaujardinstables@gmail. well as left behind stumps and debris. com 404-245-9414

Bobby Cochran Commerce 770-527- Full-time employee needed for barn

5571

maintenance, cleaning stalls, bush-

Farm buildings built and repaired, hogging, etc.; $15+/hour. Curtis Crumfences built and repaired, tractor/bob- bley Good Hope 706-338-3622

cat work, hay baling and cutting. Jerry Mature adult male seeking farm work,

Glancy Griffin 404-433-3568

have carpentry skills and am a heavy

Farrier with helper to trim very active equipment operator. Michael Martin miniature mules, overgrown hooves, in Milner 678-416-1424

Coweta County. Claudia Green Grant- MF 50E IND loader, 3PT hitch, Live

ville 678-877-0634

PTO, 1250 hours, power shuttle, ROPS

Fencing, all types: Farm, field, horse open, good tires; $11,500. M. Yearand corrals, all wood, barbwire, board, wood Gainesville 770-231-2868

dog kennels, chain-link; light grad- Part-time experienced horseman

ing, bush-hogging and Bobcat work; wanted, to ride Western horses 1-2

Paulding County. Tasha Grantham Villa times per week for a couple of hours.

Rica 770-459-0074

Don Dodson Douglasville 770-757-

For all of your farm needs: Bobcat, 7030

tractor, D3 dozer work, bush-hogging, clearing, anything in between, free es-

FARM MACHINERY

timates. Kyle Combs Locust Grove 770-880-3698

If you have questions regarding this

Garden plots tilled, raised beds, plas- category, call 404-656-3722.

tic mulch, drip irrigation-tape installed, Only farm machinery and equipment

within a 25 mile radius from me. Lou owned by the advertiser and used in

Cabrel Griffin 404-513-9353

his/her own farming operation can be

Get rid of ticks, fire ants and other advertised; those persons advertising

bugs in the vegetable garden the eco- for machinery and equipment wanted

logical way w/guineas. Theo Engel- must be seeking those items for their

mohr Milner 678-967-9899

own farming operation.

Livestock hauling, horse/cattle, gar- 1 set Tomotoh forks, 3PT, 48" roll of

den and food plot, bush-hogging, any hog wire, will load; $99. Preston Kend-

handy man work. Leland Milton Wat- rick Auburn 678-963-0145

kinsville 706-296-0732

1-row plastic layer, $4000; 18' metal

Logs-to-lumber, will saw your logs F600 body, $1500; 1-row mechanical

into usable lumber, at your location or transplanter, $500; 5-roll hay mover,

mine. Taylor Davis Fayetteville 770- $2000. Anthony Mckee Riverdale 404-

402-1180

447-0739

Mud and water, no problem: Beaver 10' and 12' heavy-duty land levelers;

dam removal, creek channel cleaning, $1600-$1800. Mike Hulett Hazlehurst

drainage ditching, silt removal, lake 912-253-0162

rimming. Jim Moon Oakfield 229-535- 100 Farmall with transplanter and ro-

6562 229-881-0048

tary mower; also a 3-roll power cane

Raised beds, drip irrigation tape and mill, with conveyor, on trailer. Donald

black plastic mulch, installed at your Wooten Denton 912-347-2009 912-

garden site with our bed shaper/plas- 347-2009

tic mulch layer. Buzz Mann Hampton 14" Ford 2-bottom turning plow; 14"

470-336-8351 470-336-8351

Ford 3-bottom turning plow; 16" Ford

Stumps ground neatly below ground 1-bottom turning plow. Darwin Blansit

level, free estimate and reasonably Trion 706-238-0465

priced. Glen Whitley Bethlehem 770- 14' bush hog, new deck, 3 y/o gear-

867-2718

box, needs another gearbox; $2000.

Trailer/hauling services, can haul just Fred Greer Mansfield 770-787-3392

about anything within reason, reason- 16' Chandler pull-type hydraulic

ably priced, emaiI for a quote. Victoria chicken litter spreader, spinner cut-off

Nall Stockbridge victorianall@aol.com valve, looks new; $12,500. Ken Dorsey

470-769-0093 770-760-0404

Cleveland 706-244-0470

Will come to your farm to repair start- 16x20 gooseneck hay trailer, $800; ers and alternators, 6-12V generators, also have small goat/calf trailer, $350. only on farm equipment and tractors. Robert Yoder Jesup 912-256-6411

Randy Thomas Conyers 678-758- 18' equipment trailer, Hooper brand,

5881

two 5/16 hitch, 3-axle, 2 with brakes,

Farm Services Wanted

new tires; $2000. James Sullivan Blairsville 706-781-3531 404-983-

100+ y/o large oak tree, near house 1787

and needs to be cut down/stump 1948 John Deere GN, single front removed, will likely need team and wheel, good condition, nice paint; equipment, you can keep the wood $5500. Eddie Craddock Commerce
for lumber/firewood. L. Hogue Canton jacob71000@gmail.com 706-380-9090

678-464-5429

1949 Farmall C, runs good, with

4 large red/white oak trees and 1 planters, back gang and pull disc har-

huge Ponderosa pine, you cut/haul; $1. row; $2500. Andy Carroll Rome 706-

Gerry Gibson Atlanta 678-595-2790 346-3142

Need drag line for pond, and a worker 1951 John Deere MT with cultivators

who can operate a chainsaw. E. Sims and mower, perfect for restoration,

Carnesville 706-384-5279

need to sell; $2700. Harvel Hamm Car-

Need to level a small section of pe- rollton 770-841-6685

can orchard, but it is not worth buying 1952 Ford 8N tractor, all new tires,

equipment. Dale Foster Bonaire 478- many new parts, call for details and

918-4365

price. Rembert Cragg Alto 706-776-

Seeking someone near me who can 3318 706-499-8063

crack pecans in the shell. Bonnie Mor- 1953 Ford Jubilee tractor, gas, ev-

gan Cumming 770-887-6885

erything works, $4000 OBO; 360 Long

Used insulation from old houses, must be removed

chicken and all

tractor, diesel, everything works, $2000 OBO. James Fitzgerald Abbeville 229-

materials must be cleaned up; keep 424-0824

the insulation and materials as pay- 1955 International cub tractor, culti-

ment. George Brown Forsyth 478- vators/belly mower included, front new

885-2506

tires/tubes, good rear tires, converted

12V; $2000. Anthony Howard Murray-

FARM EMPLOYMENT ville 706-867-5969 770-983-3179 1958 Ford Jubilee 600, good condiIf you have questions regarding ads in tion, runs great, bush hog, fertilizer

this category, call 404-656-3722.

spreader, plows and more; $4000. Wil-

Only farm work or farm help liam Wells Palmetto 678-764-8558

wanted advertisements allowed. No 1961 Allis Chalmers D-10, restored,

commercial, industrial or domestic rebuilt engine. John Gray Perry 478-

employment permitted.

461-5868

Cattle/hay farm seeking full-time em- 1963 Ford 4000 tractor, with 5' bush

ployee, experience and references are hog, diesel, 50HP; $5500. Brett Drexel

required. Michael Harrison Jackson Milledgeville dpmdbd@gmail.com

678-544-3233

478-946-2101

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 5

1972 Ford 3000 diesel, w/5' bush 2012 Bush Hog 2212 rotary cutter, 12' 580C Case backhoe, new starter, Chandler pull-type litter spreader, F3 Gleaner combine, excellent condi-

hog, new water pump/gauges, alterna- pull-type, excellent condition; $10,500. back end, tires, call/text for photos; $8500; Van's 80-gallon boom sprayer, tion, have two F3 for parts; $10,000.

tor/battery, lift and more, fully serviced; Miles Hess Fitzgerald 706-983-0387 $9500. Bill Bleckley Clayton 706-319- $550; Baltimatic fertilizer spreader, Ronnie Singleton Buena Vista 706-

$5950 OBO. Brandon Wall Bethlehem 2012 Exmark Laser Z zero-turn com- 4577 706-782-3310

$350. Lee Rusk Woodstock leerusk@ 566-2937

770-307-8907

mercial grade lawnmower, 52" deck, 6-row John Deere 7000 corn planter; bellsouth.net 770-928-1195

Farmall 140, junked, will sell whole or

1973 Ford 2000 tractor, gas, me- 40 hours, excellent condition; $5500. 18-row sprayer, PTO pump. Everett Cole 12-MX multi-flex 1-row planter, part out; $400. Robert Nealey Canton

chanically in good condition, new seat, Ronald Mosley Eatonton 478-278- Panter Blue Ridge 706-455-7227

4 plates/gears, on Cat-1 gill cultivator; 678-393-9744 770-843-0561

battery, etc. Bob Elliott Buford 770- 7723

6-row Redball hooded sprayer, $800. Gordon Brown Hampton 770- Farmall A, full set cultivators, hand-

313-5456

2013 JD 1026R diesel tractor, excel- 150-gallon tank, direct spray, folding 827-8687

lift, $1500; Farmall Super-A, full set cul-

1973 Ford tractor, 3000 hours, very lent condition, 308 hours, 60" belly tool bar; $2000. Zach Shanklin Albany Covington 2-row side dresser/knock- tivators, good condition, $2400. Cole

reliable, original fenders; $4400. John- mower, auto-connect front-loader, 229-881-6383

er, excellent condition; $200. Jerald Cooper 704 Cooper Rd Grovetown

ny Helton Newnan 678-717-8426

quick disconnect; $12,500. Michael 60" belly mower, old but good, for Douglas Nicholls 912-670-8357

30813 706-863-2555

1975 Farmall 140 tractor, with 8 piec- Magrum Rydal 706-509-8576

parts, has 3-gauge wheels; $80. Paul Cub Farmall tractor w/cultivators, Farmall cub, 1955 year, 1 owner,

es of equipment, excellent condition; 2014 Mahindra 55/30 tractor, with Shellnutt Americus 229-938-6413

needs paint, $3200; Farmall Super A, hydraulic lift, cultivator and planting

$7000. Robert Hendrix Portal 912- front loader, 4WD, 49 working hours; 650 John Deere tractor, 3PT hitch, w/L59 belly mower, $2500; both good equipment, mower, A-model engine;

865-2582

$26,000. Michael Ringering Trenton 60" belly mower, diesel, good condi- condition. James Newsome States- $3000. Travis Gilbert Woodbury 706-

1977 Ford 3600 tractor, diesel, 3000 423-779-6780

tion, sheltered; $3800. Richard Thomp- boro 912-687-3413

575-0593

hours, no power steering; $4000. 2015 JD 3038E tractor, with front son Rossville 770-887-5941

Deutz 7807 tractor, dual 255 heavy- Farmall cub, red model, new clutch,

George Taylor Waycross 912-285- loader, finishing mower, box blade, 650 NH hay baler; Ford TW25 tractor; duty loader; $10,000. David Skin- runs well, throwout bearing broken,

8264

new-ground plow, 200 hours; $20,000 NH TR86 combine w/4-row corn-head, ner Winder 770-867-0827 404-304- $1300; belly mower for cub, $300.

1979 Chevy C60 dump truck, rollback, OBO. Kevin Pittman Springfield 912- 20' grain-head and 16' flex-head. Tiet- 9742

Bobby Young Monroe 770-267-

21', good tires with winch; $8250. Larry 429-9798

gen Edenfield Metter 912-426-9419 Deutz KM 25 drum mower, 7' swath, 7784

Wilkie Cumming 404-277-5720

2015 Kubota 7' cutter, used only 4 6x12 enclosed trailer, rear ramp door 1 owner, sheltered, great condition; Farmall Super A tractor, runs well,

1984 Honda Big Red 3-wheeler, times to cut 36 acres; $5000. Derrell with spring assist, side door, interior $2300. Richard Haines Cleveland straight sheet metal engine, doesn't

runs great, well taken care of, perfect Dixon Reidsville 912-654-2941

light, new spare tire. Ron Byrd Tignall barbwire2@icloud.com 406-570-1325 smoke, new carburetor, newly rebuilt

for hunting/farm use; $1900. Whitney 24' trailer, 20-ton, dual axle, military 614-531-2157

Deutz-Allis 2.50 round baler, excellent generator; $1995. Frank Howell Kite

Mote Gainesville 770-540-9327

hitch, used very little, great condition, 7'x16' heavy-duty trailer, 2-axle, pin- working condition, was main baler but 863-944-0900

1989 F250 flatbed farm truck, with tool box, for dozers; $3900. Richard tle hitch, good tires, ideal for Bobcat; sold cattle in 2016; $3500 OBO. Tim Farmall Super C, full set of cultivators,

toolboxes, 4x4, electric trailer brake, Haigler Hiawassee 706-835-5222

$700 OBO. Darrell Mitchell Monroe Miller Cherrylog 706-455-1664

1 new tire, good sheet metal, selling

7.3I DI diesel, excellent condition; 30' Vans Manufacturing pull-behind 770-256-4732

DewEze 165I bale hugger/unroller, parts off tractor. J.C. Hilliard Eastman

$7500. Nicole Alvarez Dahlonega 678- sprayer, with 500-gallon tank, PTO 700 Ford tractor, tri-cycle, runs/ 3PT hitch, great condition, $1200; 478-374-4904

687-7474

drive; $2500. Chuck Brown Manches- drives, looks good; $1500. David Bow- John Deere Category-II, quick hitch, Flatbed BP trailer; $1000. John Mur-

1994 CIH 7220, w/9294 hours, main- ter lands_farm@yahoo.com 706-977- ers 6932 Bowersville Hwy Bowersville like new, $450. Jerry Mull Silver Creek phy Gainesville 404-379-1569

tained, shelter kept, clean, 3 remotes, 7155

30516 706-436-3294

706-346-4657

Ford 1320 tractor, excellent condition,

duals and weights; $30,000. Darrell 3000 Ford tractor, 7' harrow, 2-row 78" Rake Master brush rake, 2-cycle Ditch Witch trailer, heavy-duty, dou- less than 600 hours, works perfectly;

Waites Norman Park 229-873-5703 cultivator, 2 Cole planters, $5000 OBO; grapple, JD quick-attach, fits JD 721 ble-axle, good condition, $800; also $7300. Melvin Dills Gainesville 678-

1999 Case IH 2366 combine, 20' also 641 Ford tractor, $1500. Warren front-end loader; $1500. Freddy Lott two R-40 Ditch Witch trenchers, not 617-1289 678-617-1289

grain table, AFS Pro 600 yield monitor; Sapp Ellabell 912-661-1443

Douglas 912-592-5156

running. F.G. Hiers Valdosta 229-560- Ford 2000, gas, 1962 year, good con-

$45,000. Tommy Hilliard Camilla 229- 3930 Ford tractor, very clean, 1548 8-disc Taylor-Way harrow 6000, pull- 5415

dition, $4500; 1957, gas, A/C, good

854-1700

hours; $9000. James Marshall 2114 type; $300. Terry O'neal Greensboro DR string trimmer, $400; 5HP mulch condition, $2500. Johnny Keasler

2 antique 1949 Oliver 70, must go, to Sandy Point Rd Lizella 31052 478- 706-467-3373

chipper/shredder, $425; both in good Woodbury 706-538-6315

be restored, for parts or yard art; $500 each. Harry Floyd Elberton 706-567-

214-2303 3PT equipment:

6'

HD/swivel

LP

8400 JD, 8000 hours, GPS ready, KMC subsoil leveler, 500 bushel grain

condition. Imogene Satterfield Cumming 770-887-5661

Ford 3000 diesel tractor, needs work; $1000 OBO. Ralph Gunn Monticello

8922

blade, $300; CountyLine bush hog, cart. Mitch Raley Mitchell sandrasral- Drop-deck lowboy tractors, com- 706-468-6955

2 Ford 16" 2-bottom plows; $250/ $965; JD weed eater, $50; hay spear, ey@yahoo.com 706-699-2442

bines, planters, cultivators, hay equip- Ford 3000, diesel, 108 hours, new

both. Lynn Todd Ludowici 912-9773603
2 JD 9996/2 JD 9965 cotton pickers;

$150. Randall Green Alto 706-7789302
4 Titan skid loader tires, 10'x16.5, HD

8N Ford tractor, 12V, harrow, rotary cutter, $2800; 4-disc tiller, 3PT land/tail wheel good condition, $475. J.R. Sul-

ment, grain drill and plenty more. Harold Rutledge Rex 770-961-6742
Dual-axle trailer, built to haul racing

paint/clutch/tires, like new, $6500; new tractor tires, 11-2-24. Robert Borchert Lincolnton 706-359-3325

Case 820 grain head; Case 944 corn X-tred, new, $1280; also have used livan Vidalia 912-537-4944

cars, winch aluminum ramps, metal Ford 4630 tractor, 2WD, 3-cycle die-

head, field ready. Ralph Nutt Cordele 229-276-5336
2 John Deere 71 planters, on Pittsburg cultivator frame with feet, plant-

tires. Jimmy Garvin Warner Robins 478-396-2409
4-bottom John Deere switch plow; $2500. Johnny Padgett Jacksonville

9N Ford tractor, not running, good for restoration and/or parts, must pick up/ transport; $500 OBO. J.K. Lance Maxeys jlance11@windstream.net 706-

plate runners, haul tractors/equine; $400. Blake Putnam Calhoun 706629-2593
Edko walking tractor, 5HP Briggs,

sel, 60HP, hours unknown, new paint/ dash/tires, front round bale squeezer; $10,500. Chris Wilson Thomaston 770-468-7556

ers rebuilt and painted; $1500. Tommy 229-833-5610

296-0463 706-759-3830

with bottom plow, $350 OBO; Tiller, Ford 5-bottom plow; 5PT subsoil

Braziel Fitzgerald 229-831-4775
2 Titan tractor tires, 14.9x24, very little wear. Billy Waites Macon 478-

4-bottom switch-plow, $2700; KMC cultivator, $1600; 12' roto-vator, $600. Julian Nichols Cuthbert 229-732-

All-purpose plow, 9-shank, 3PT I & II hitch, extra plow points; $500. William Sims Monroe 770-267-8090

Troy-Bilt, 5.5HP Briggs, $125 OBO. Ronald Knowles Fayetteville abeachbum@bellsouth.net 770-461-7062

plow; KMC ripper; Sutortbilt vacuum milk pump, used 7 months. B.L. Kent Millen 478-982-5870

951-5416
2-13-24 grader tires, never mounted, $200 each; all sizes of farm truck

7661
4-disc mower, good shape; $2800. Michael Collins Blairsville 706-897-

Allis Chalmers D17, bush hog, cycle mower; $2000. Don Walls Roopville 770-328-4839

EZ-Flow drop spreader, good condition; $1200. Jerry Griffin Maysville 706-677-3310

Ford 555D backhoe, 4WD, 2975 hours, excellent condition. Jesse Black Gainesville 678-617-6852

tires, mounted on Dayton wheels. C.R. 1933

Antique Allis Chalmers tractors, B, 2

Hayes Conyers 770-922-6930

4-row Allis Chalmers no-till planter, WD40, WD45, not running; also have a

2-bottom trip plow, $500; 7-shank $1600; hammer mill, $900; 2 grain running Ford Jubilee. Jesse Arnett Tif-

Market Bulletin Ad Form

all-purpose, $300; boom pole, good wagons, $1350 each. Dwight Oliver ton 229-382-6517

condition, $125. Barney Kendall Blue Lula 770-287-4816

Asphalt roller, runs/operate, $1300;

Ridge 770-597-9560

4-row Amadas 9997 peanut combine, parking lot/warehouse Tennant sweep-

2-row and 4-row John Deere 71 good condition; 4-row KMC inverter, er, $1400; Stihl post-hole digger,

planters, bottom-plow. Cole Jernigan good condition. Ronald Coody Quit- $1800. Mark Blank Dawsonville 770-

Buena Vista 706-570-2171

man 229-300-7080

905-6235

2-row Covington planter on toolbar, 4-row KMC rip-strip hydraulic row Balers: NH851, $1000; Internation-

2 metal fertilizer cans with seed plates; markers and baskets; $6500. Doug al 2400 round belt, $1000. Rayburn

This form may be used to submit an ad. There is a 20-word limit for advertisements unless otherwise noted under category headings. The 20-word limit includes name, city, phone number and complete address, if provided. Market Bulletin staff reserves the right to edit notices exceeding the word limit. Only one notice per subscriber per issue. In order to advertise in the Bulletin, you must be a paid subscriber with a current subscription.

$850. Ed Roddenbery Hamilton 706- Carter Tifton 229-392-4632

Hughes Summerville 706-857-1572

315-6658

4-row KMC strip till with Monosem Branson 2810 tractor, 28HP, 4WD,

Category:

2-row Covington planters, with rub- planters attached; $12,500. Chris SS transmission, loader, quick detach

Please note some categories are not published regularly. In addition, some

ber tires, extra plates on cultivator Parlor Hazlehurst 912-539-9772 912- bucket, 309 hours; $10,500. Grady categories require documentation, such as a Coggins test or organic certification,

frame. Melvin Collins Camilla 478-244- 539-2994

Roberts Hiram 770-943-2240 678- prior to being published.

1721

40' Big Tex 22GN trailer, 2014 year, 2 614-7309

2-row cultivator, $250; 7' scrape tool boxes, spare tire, 4" strap winch, Bush Hog 3008-2, for parts or that

blade, $150; 2-bottom plow, $150. Al- excellent; $9500. Granville Morrison can be repaired. Chuck Lee Farming-

len Beasley Statesboro 912-764-5254 Lyons 912-245-3131

ton 706-540-3512

2-ton cherry picker, and 1 heavy floor 4030 John Deere, needs pinion Bush Hog 3210 lift mower, 10'6"cut;

jack; $200/both. Sidney Keadle Thom- and ring gears, front-end loader, very will trade for 8'-9' Bush Hog of equal

aston 706-647-2328

strong engine. Rusty Black Sylvania value. Mike Gurley Americus 229-938-

20' gooseneck trailer, heavy-duty, 912-857-3233

2520

dual-dooly axles, make a good hay 5' finish mower, new belts, good con- Bush Hog wood splitter, 3PT, remote

trailer, needs new floor/tires; $850. Billy dition. Heather Denis Douglasville hydraulic, $425; 2 Post Mount black-

Stewart Calhoun 706-629-2504 706- 770-298-0449

smith hand drills, $125 each. Jimmy

483-1715

5' King Kutter finishing mower, RM Mckinley Thomaston 706-975-7244

200-gallon sprayer, tractor mounted, 60Y, excellent condition, 3PT hitch; C-99 Ditch Witch walk-behind;

boomless, heavy-duty, chemical safe, $600. D.G. Nealis Hampton 770-630- $1500. W.G. Griffin Byron 478-396-

PTO pump; $1100. Greg Hughes 1469 770-946-9160

2409

Phone number:

Ludowici 912-658-9915

5' mowing machine for Ford tractors; Case 1840 skid steer loader, 1996

2001 Ditch Witch 3610 diesel, new $500 OBO. Hugh Darsey Surrency year, 4000 hours, well-maintained,

Subscriber number:

chain, teeth and sprockets; Baltimatic 912-367-4504

good running/operating machine,

500 lb. fertilizer spreader, 3PT hitch. 500 lb. fertilizer spreader, 3PT hitch, work ready; $12,500. Robert Campbell

Slate Long Madison 706-318-0402 very good condition; $300. Lynn Simp- Woodstock 770-617-7951

2001 Kubota M6800, 4WD, 2685 son Blackshear 912-614-7695

Case 4230 tractor, 4x4, 83HP, duel re-

hours, $18,000; Athens 62 tandem 52" Exmark mower, 23HP, good con- motes, bush hog, 2845QT loader, 2735

Please include your name and full address on all correspondence sent to the Bulletin office. The following statement must be signed by the advertiser submitting this notice for publication:

harrow, 10' 6", w/new discs, $4000. dition, $2250/OBO; two 16' HD land- hours, 1996 year; $18,000. Corey Da-

Mallory Granitz Greensboro 706-433- scaping trailers, electric brakes, $2000 vidson Adairsville 678-883-4863

3640 706-433-1458

each/OBO. Steven Hoffman Newnan Case IH 5240 loader, cab, 2WD, big

I hereby certify that the above notice meets all the necessary requirements for publication in the Farmers and Consumers Market Bulletin.

2011 advanced Colombo 4-row pea- s.hoffman60@yahoo.com 678-850- bucket. John Wade Cochran 478-599-

nut picker, used 2 years; $38,000. John 8080

0635

Williams Colquitt 229-400-5827

565 New Holland square baler; CAT 225 excavator, remanufactured

Please mail ads separate from subscription payments. Ads should be mailed

2011 KMC 6-row peanut inverter; Browns 8-bale accumulator with grap- engine, 30' reach, 36" bucket, looks/ to Georgia Department of Agriculture, Attention: Market Bulletin, 19 Martin Luther

$8500. Randy Hill Brinson 229-220- ple, very good condition. Brooks Ed- runs good; $19,000. James Smallwood King Jr. Drive SW, Atlanta, GA 30334.

2679

wards Brooklet 912-657-8644

Greenville 770-463-8697

PAGE 6

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Ford 641, $2500; Farmall H, $1500; both very clean ad run smooth. R. Thompson Vidalia 912-281-3030
Ford 8N tractor, runs and looks good;

ICH tractor, 40HP, $5500; 8' JD bush hog, new blades, $2500; 9' JD disc mower, $2500. M. Lee Taylor Calhoun 770-547-3198

JD 6430 premium, with 673 loader, 3800 hours, 3 remotes plus auxiliary, VGC; $55,000. Al Shanklin Bridgeboro 229-776-5564

John Deere M; 2 John Deere 40, 2 John Deere B; all restored. Jesse Rogers Eastman 478-559-0015 478-2311681

Mini excavator, Schaeffer HB16, 1998 year, turbo 4-cylinder, 28.5HP; $13,000. Doug Hagn Statesboro 912536-1524

$2450 OBO. Wayne Norman Marietta 404-245-5023
Ford 9N tractor, for parts, $400; 1957 Allis Chalmers WD45, runs, $1800. Fred Harcrow Franklin 706-302-1004
Ford L8000, w/ Knight 3030 mixer; Ford L8000, w/16' Chandler litter spreader. Matthew London Cleveland 706-969-9284
Franklin 3000 feller buncher, 16" head, works well, fair tires, needs paint; $6000. Sammy Martin Commerce 706-367-5409
Front-end loader for Ford 3000, 3400, 4000, working condition. Thomas Farnsworth Whigham 229-8723226
Fuel dispensing system, working when removed, used for airport fuel, no tanks or pump; $450. Rebecca Abernathy Marietta 404-697-5994
Generator, 60kW, less than 17 hours, $7000; 8'-10' sections of roller beds, $700. Steve Mouchet Bowersville 706-206-7040
H&S 50 manure spreader, S&A Farms in Cherokee County; $1000. Allen Tothill Alpharetta 770-597-3725 678570-5503
Harrell 5-bottom switch plow, $5000; JD 450 grain drill, $6000. Kenneth Perry Girard 706-833-2154
Harrow, 20-disc; $225. Lorella Giacomelli Blairsville 706-745-6560
Hay cutter: M&W HC6 disc mower; $1100. Jerry Cox Fayetteville 770461-7938
Heavy-duty 20-disc harrow, 3PT hitch, $350; Yanmar 5' box scrape, used very little, like new, $450. Wilson Hortman Byron 478-714-3210
Heavy-duty Gantry A-frame; adjustable 9.5'x16'hx11.5'w; also have CM Lodestar 3T RT electric hoist, sold together/separate; $3500. James Fullbright Appling 706-664-5145
Honda Foreman, farm used only, 2011 year, 4-wheeler, power steering, excellent condition; $5300. Donald Chandler Hull 706-548-7500
Hooper 35' trailer, tri-axle, $4800; Big-Tex 16' dump trailer, $7400; Bush Hog ATH 720 finishing mower, $350. T. Poole Conyers 678-577-9157
Husqvarna YTH2348, like new, 23HP, 130 hours; $1200. Larry Knowles Fayetteville 770-560-3512

IH986 open cab, runs well, new batteries, filters, fluids, work ready, with dual remotes/PTO; $8000. Keith Brown Dahlonega 706-525-9229
Inger-Sol-Rand air compressor, 3-phase, HD, 80-gallon tank, 230/460 tested, runs perfect, starter box, guaranteed to run; $975. James Heatley Hampton 770-707-2397
International cub 154 lo-boy, 4' belly mower, 3PT hitch, new clutch. Michael Jones Griffin 770-468-0860
International Dozer 500C, 6-way blade, very good condition; $5200. R.L. Thompson Richmond Hill 706861-3092 423-991-7530
International Harvester 856, 1971 year, 5450 hours, 100HP, new clutch, remote hydraulics, torque amplifier, dual rear wheels; $8000. Mitch Lawson Calhoun 706-676-0825
JD 1-row planter, fertilizer distributor, $500; 1-row cultivator, $200; JD 2-row cultivator, $250. Jason Harrison Milledgeville 478-251-0009
JD 3020 tractor, good condition; 530 round baler; 8-wheel rake. Emory Carson Bogart 770-725-7205 706-3401298
JD 348 square baler, shelter kept, $7500; New Holland 1049S stack wagon, new back tires, field ready, $15,000. Josh White Cuthbert 229-603-3818
JD 4430; JD 4230; JD 4010 with loader; Ford 2600 tractor; Farmtrac 35 tractor. Andy Sumner Wrightsville 478-484-6984
JD 458 round baler; V rake; Vicon 2400 mower; JD 2350; 150-gallon sprayer. Gene Bankston Stockbridge 770-688-9770
JD 4960, MFWD, 7000 hours, $45,000; JD 7300 planter, 8-row, stack fold, $8500. Henry Walker Eastman 478-463-5566 478-463-5215
JD 6220 cab, 2WD, low hours, $37,500; JD 550 baler, $4500; JD 1350 mower/conditioner, $4200. Mark Hendricks Macon 478-731-0626
JD 630 harrow, 30', $14,000; MF 251XE, 51HP, $14,000; NH 50 boomer, w/loader, 47HP, 136 hours, $22,000. Dar Bohnenstiehl Forsyth 770-4684682
JD 637, 21' harrow; JD 637, 15' harrow; Hale livestock trailer, 5'x16'. Wayne Morrison Whigham 229-3781534

JD 6620, 20' platform; JD 4400, 18' platform; Caterpillar 12E motor grader. Paul Burke Midville 706-466-2196
JD 870 tractor, 915 hours, $5700; Kioto CK-35, 4WD, front-end loader, 150 hours, $12,000. Ben Mcgreggor Macon 478-935-2400
JD 9610 combine, 922F header, 2575 separate hours, duals, extra set rasp bars, under shelter; $50,000. George Chandler Danielsville 709-338-4321
JD 9950 4-row cotton picker, with mud hog, good condition, runs/picks well; $6500 OBO. John Griffin Tifton 229-445-0495
JD cloth seat with mount, removed from cab tractor with low hours, like new; $150 OBO. Barry Collins Milledgeville 478-452-1056
JD diesel irrigation pump traveler, 60" pipe, trailer. Henry Waters Metter 912682-8557
JD LA155 lawn tractor, 48" cutting deck, 137 hours, 1 owner, excellent condition; $1600. Ryan Baerne Nicholson 706-757-2672
JD4640 tractor, JD210 harrow, Brillion 10-shank chisel plow, Forrest City 4-row bedder; $24,000/all. Wayne Rivenbark Metter 912-362-2108
JD4755, FWD, $25,000; Ford 9700, $7000; call/email for details and photos. Jason Jackson Cuthbert koolhandle@hotmail.com 229-343-0877
JD8520, JD9650 combine, JD468 baler, GP2400 turf till, Case IH sprayer SPX3185, Schultz 5026 mower. C.S. Pippin Culloden 770-680-1606
JD9986 cotton picker; 26' JD430 harrow; Redball 420 hooded sprayer; JD450 grain drill; Art's Way 6-disc flip. Donald Wingate Doerun 229-7766145 229-349-0026
John Deere 1026R, 4WD, 54" belly mower, 4' Frontier RC2048 bush hog, 103 hours; $12,500. John Anderson Watkinsville 706-769-8387
John Deere 1050 diesel tractor, 1985 year, 1000 hours, new tires, 5' bush hog; $6000. Marlon Roper Gainesville 770-540-6308
John Deere 2030 front loader, canopy top, mid-1970s; $8500. Brenda Patterson Dalton 706-259-3234
John Deere 40, excellent condition; $2850. Thomas Redfern Warthen 478552-6224
John Deere 435 baler and 52' trans-

KMC 4-row ripper/spider; Parker 250 bushel grain wagon w/JD running gear; Sitrex 10-wheel v-rake; 12' JD115 harrow. Jeff Miller Wadley 478-494-9115
KMC 4260D chicken house litter remover dump bed; $12,500. Sam Story Waleska 770-796-2338
KMC hydraulic digger and Colombo picker, both field ready. Gary Smith Broxton 912-393-5742
Kubota KX71-3 trackhoe, 147 hours, 6300 lbs.; $31,500. Patty Dean Ellijay 706-273-8113
Kubota L275 diesel, 4WD, good rubber, new battery, under 300 hours, runs/looks good, w/5' bush hog; $6800 Fred Hilley Ellijay 803-840-5035
Kubota L3400 tractor w/canopy, 4WD, 34.7HP, hydrostatic transmission, diesel, front-end loader, box blade, bush hog, 200 hours; $15,000. Bob Singley Milledgeville 478-4146255
Kubota M108S tractor, 108HP, less than 1000 hours, very clean; $37500 OBO. Al Clark Portal 912-531-3746 912-531-3746
Kuhn GF5000T tedder, 4 basket, pull-type, fold behind for transporting; $1750. Bob Seaton Cohutta 706-2787073
Kuhn GMD 700G11, 7 spinners, $2500; NH 256 rake, $1500; Farmall 100 w/Woods L59 mower, $2500. Jimmy Freeman Boston 229-221-0606 229-735-3091
Land Pride 20" rotary mower, excellent condition, only used 2 seasons; $11,500. Van Ponder Cairo 229-3780122
Land Pride FDR 1660 finish mower, very good condition; $1100. Richard Barrett Ellaville 229-942-4786
Landscape/rock rake, 6', 3 tines missing, $50; 9 pieces of 20'x2.5' black pipe, $100. Ray Dangar Canton 678-468-8292
Lewis Brothers Housekeeper #2; $6000. Ron Botts Bainbridge 229243-2616 229-400-3440
Lewis Brothers Housekeeper #3; call for more details. Joel Stillwell Ellijay 706-889-7529
Light tower/generator, Magnum MLT3060M, 5200 hours, works well, $3000 firm; trade for non-running skid steer or crawler. Scott Morrison Senoia 678-779-3501

Mowing machine, antique, horsedrawn; $700. Jerry Long 358 Capehart Road Ringgold 30736 706-673-5496
Mulch spreader, side discharge only. Ed Parent Fort Valley 478-822-9483
New Holland 320 square baler, field ready, sheltered. Chuck Brock Leesburg 229-344-2902
New Holland 570 square baler, Hoelscher 10 bale accumulator, 10 bale grapple; $13,500. John Lanier Warm Springs 706-249-3536
New Holland 650 baler, string only, good condition, field ready. Joey Lanier Statesboro 912-682-3756
New Holland 930B finish mower, 5', good condition; $450. Steve Dotson Hampton 770-946-8035
New Holland heavy-duty square baler, completely reconditioned, always stored in barn; $2000. Bobbie Mclemore Waverly Hall 706-582-2595
New Holland TC30 tractor, 30HP, 4WD, front-end loader, R4 tires, canopy, excellent condition, 63 hours; $12,800 OBO. W.H. Cochran Cherry Log 30522 706-632-5744
New Holland TC35, 2001 year, 1573 hours, fork lift included, $10,000; bush hog, $500. Jeanette Chambers Calhoun 706-266-5476
New Holland TN55, 2000 year, 900 hours, front loader, and a hay spear; $15,000. Cleatus Lunsford Blairsville 706-781-6454 770-314-2662
New Idea 1-row picker, pull-type, good condition; $1100. D. Sills Cleveland 706-878-8606
NH 310 square baler, $3400; 256 rake, $1800; Bush Hog post auger, $750; JD sickle mower, $600. Thomas Crowe Eatonton 706-473-2488
NH 65 baler and 472 conditioner, $1250 each; 671 Detroit power unit, $2800; Vicon ground rake, $450. Bill Myers Blue Ridge 706-964-5483
Old International harvester cub Cadet, good condition; $250. Jerry Woods Douglasville 770-942-2644
Oliver 5' bottom-plow, semi-mounted, tail wheel. R.E. Dodson Plains 229942-0795
On Land 995 JD 5-bottom switch plow, with rack; two 6-row Amadas 9097 peanut pickers. Donnie Keene Abbeville 229-425-8055
Pasture aerator, 10', 9 plows that trip,

port auger; $6500/both. A. Brittain Log splitter, 22-ton, vertical/horizon- $850; Cole planters, hi-speed, 2-row,

Jackson abrittain@mindspring.com tal, good condition; $600 cash/firm. on Pittsburgh frame, $975. Ron Hulett

404-328-5756 770-775-7727

Ernest Meeks Milner 770-358-7284 Milan 912-363-5978

John Deere 5320, 4x4, w/loader; Loyal MS23A manure spreader, 28 Post-hole digger, 3PT hitch, with 9"

Lewis Brothers Housekeeper #2; poultry house washer, 40-gallons/minute pump, 500-gallon tank. George Sutherland Rocky Face 706-313-2000 706-673-5000
John Deere 5325, 2006 year, 500 hours, heat, A/C, 4WD, 12-speed autoreverse transmission, loader w/bucket and spear. Keith Phillips Armuchee 706-233-9500
John Deere 6420 cab tractor, 4260

cu./ft., tow-behind, no PTO, call/text; $750. Holly Leslie Griffin 770-4689986
LS180 New Holland skid steer, 2003 year, clean, good tires, 1500 hours; $16,500. Walter Terrell Decatur 404395-5476
Lucas swing blade sawmill, 8"-27HP, 60" slabbing attachment, can see operate; $8500. C.S. Vance Milner 678340-0689

auger, $325; Craftsman tiller, dual direction, $350. Terry Fulmer Lincolnton 706-359-1303
Price reduced: Allis Chalmers B, $2250; Farmall A, $2250; Farmall C, $3250, Farmall F20, $3250. Ted Reeves Sparta 706-878-8562
PTO pump, Ferroni MT300, new/still in box, photos available; $350. D. Helton Cleveland 706-892-8581

hours, 4WD, power-quad transmis- Massey 240 with 232 loader, 1100 Rebel 5410 Vermeer baler, net and

sion, good condition; $35,000. Audrey hours, 1992 year, $10,500; also 5' string-wrap; BR740 New Holland baler,

Hughes Alpharetta 404-822-0843

Woods mower, $350. Dennis Barr Mc- string-wrap only. Lavawn Luke Nich-

John Deere 6430, 2WD, CA, 4800 donough 770-231-0003

olls 912-381-9203 912-345-2102

hours, $33,000; John Deere 5085M, Massey Ferguson 10' grain-drill, Rockwell 10" table saw; McCulloch

2WD, CA, 1470 hours, $32,000. Dale $300; JD 12' grain-drill, $500; Farmall PM610 chainsaw; Troy-Bilt Pony, 5HP,

Wiley Covington 770-464-3276

Super C w/Woods 60" belly mower, rear rototiller. Terry Mikle Snellville

John Deere 6620 combine, corn $1850. Ronnie Hardigree Athens 706- 770-979-8981

and crop 4-row heads, 218 platform 224-3583

Rollover box scrape with teeth, 4' dirt

head, fair condition, always sheltered; Massey Ferguson 1100, with 10' pan, 3PT hitch; $450/both. Jerry Coo-

$14,000. Walter Gillis Glenwood 912- bush hog, $8500; Massey Ferguson per Hull 706-788-3260

523-5441

255, $6500. Chris Moon Loganville Sears garden tractor, 14HP, twin-

John Deere 7300 6-row planters, 770-401-6230 770-466-1150

plows, harrows, tiller, scrape blade,

good condition. Chad Hawkins Ro- Massey Ferguson 43 grain drill, 3PT hitch, good condition; $800. Mick-

chelle 229-425-0283

$3750; Mantis Compos tumbler, $350; ey Waldrop Marietta 770-655-0375

John Deere 8-row vertical planters; $8000. John Torpy Wrens 478-4554208
John Deere 8300 grain drill, double disc, 13'. Morgan Trapnell Metter 912682-4347
John Deere battery, HDSWCOM-30H700CCA, new with warranty; $135. J. Archer Dacula 770-963-6036
John Deere bush hog, 2 and 3-bottom turning plows. Lamar Camp Adairsville 770-773-9661
John Deere deer plot drills, 7'-8'W, works on 3PT hitch; $2200-$2500. Royce Hulett Hazlehurst 912-3753008 912-253-0161

both in great condition; electric fencing supplies. Ted Smith Washington 706678-4011
McCormick F90 vineyard/orchard tractor, 90HP Perkins engine, 60 hours, cab/radio, A/C, MFWD, 2 remotes, 64"W; $29,000. Henry Glover Stone Mountain 770-934-3808 404-6261501
MF 240 tractor, 2WD, 1500 hours. Larry Clayton 1675 Chandler Rd Ne Conyers 30012 770-922-4589
MF33 grain drill, good condition, field ready, will consider any condition for parts. Adrian Parham Tennille 770355-4394

Shaper saw with new blades, minimum use; $395. Ann Daniel Macon 478-741-2067 706-646-4874
Shur Farms 8' portable orchard/vineyard frost fan, low hours, PTO drive; $6800. Brian Heatherington Tallapoosa 770-714-8381
Square baler, Ford 532, stored indoors, perfect for custom hay business; make an offer. B.A. Lewis Brunswick 912-580-1855
SS steel spreader, for grain or fertilizer, 1000 lb. hydraulic controls, great shape; $6000. Wendell Nix Bainbridge 229-515-0344

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 7

Taylor-Way 8-disc harrow, 20" disc, Fertilizer and planter attachment for 24x16 tarps, 2 available, good for Flooring, oak and pine, tongue & Lumber custom-cut, Wood-Mizer

good shape, $375; cub lowboy parts a Farmall Super C tractor. Dell Bentley covering hay and other farm use; $100 groove, various widths, also have sawed, kiln dried, milled for homes,

tractor, $500. Michael Richardson El- Buchanan 470-955-7668

each. Jean Loomis Cumming 770- beadboard and trim, call for prices. flooring, cabinetry, barns, fencing, resto-

berton 706-283-7134

Front end loader, for Ford 6610 trac- 778-2790

William Briggs Atlanta 404-349-2315 rations. John Sell Milner 770-480-2326

Tiller for Bobcat or any skid steer, new tor, complete and in good condition. 250-gallon diesel fuel tank with pump; Ford flatbed body stave, sides raised, Propane/butane tank, 500-gal-

hoses, quick connects, works great; Jerry South Martin 706-491-4006

$275. Ed Rider Murrayville 706-864- Ford letters on rear, any size consid- longreat condition, heavy-duty, 2 regu-

$1450. Roy Pruitt Douglasville 770- Front loader for Kubota 2900, 4WD, 3152

ered. Cliff Livingston Midland 706- lators; $500. Dan Skipper Ludowici

595-7891

must be in good working condition. 275-gallon plastic tank tote in metal 329-7170

912-294-5901

Timbermill brand truss saw. J.T. Aus- Charles Barron Newnan 770-253-3219 cages, 5" top caps, bottom valve; $50 Front load washing machine and PVC pipe, 1.25", 2" and 3"; new 200A

tin Douglasville 770-942-2057

John Deere 2630 tractor, with canopy, each. C. Stovall Dahlonega 678-491- dryer, both work well; $200/both. Judy electrical box; lots of electrical sup-

Tory-Bilt chipper, attachment fits 5HP field ready. Clifford Camp Adairsville 0838

Gunby Sharpsburg 770-823-6825

plies. W.O. Bell Glennville 912-237-

and 8HP tillers; $500 OBO. Janice 770-608-2103

36" fans, LB White blow heaters, Fuel tank, 500-gallon, electric pump, 0222

Morris Waynesboro 706-551-4455

John Deere 9965 or 9970 cotton pick- 25,000 BTUs, LP gas, $35; 10-ton feed 2 available; $500 each. Wesley Rowe Quality synthetic chinking, 5-gallon

Tractor tires, used, 50% tread, 1 rear er, boll buggy and cotton wagon. J.P. bins, no rust, $350. R. Tatum Ranger Griffin 678-544-7627 770-227-4551 buckets. Phil Boswell Concord 770-

16.9x30 and 2 front 9.5x15, will sepa- Horton Rhine 478-893-7004

706-334-2918

Good used building materials, 2x4, 884-5789

rate; $185/all. Russell Huffman Jeffer- Litter spreader truck, good condition, 4 old-style metal gates, two 10', $35 2x6, 2x8, 4'x8' sheets of chip board, Rocks, good for erosion control, etc.,

sonville muley29178@windstream.net prefer diesel, hydraulic bed. R. Wilhoit each; two 12', with very good hard- priced to sell. Royce Brooks Acworth Stephens County, call for directions.

478-214-7272 478-214-9604

Cohutta 423-619-6416

ware, $40 each Jimmie Garrett Griffin 770-378-2564

Gene Laws Toccoa 864-710-1152

Trailer, 8'x16', 3-axle, flat wood deck, Massey Ferguson 124 baler for parts. 770-468-6764

Greenhouses, Stuppy, 6 bays, Rough cut lumber: White oak trailer

no rot, sturdy frame, bumper hitch, Melvin Coulter Byron 478-955-2466

4-cycle Perkins diesel engine, runs 30x144 each, Elevan brand fans, 2 bio- decking, walnut, pine, poplar siding,

well-maintained. Ellen Mayers Milledgeville 478-452-8445
Troy-Bilt Horse tiller, 8HP, new coil, points, rebuilt transmission, good tines; $475. Jack Tinsley Cleveland 706-865-4421 706-338-8719
Troy-Bilt Horse tiller, new motor, tines and tires; $550. Allyn Bell Moreland 770-253-2987
Troy-Bilt rear-tine tiller, 7HP Kohler, complete with original owner's manual; $400. Gene Perry Auburn 770-9629988
Troy-Bilt tiller, 8HP Kohler engine with electric start, original owner's manual and furrower. Lamar Cox Fayetteville 404-824-7569
Troy-Bilt Tuffy tiller, excellent condition, Tecumseh 3.5HP engine, walkbehind model; $300. James Chapman Winder 770-725-4477
Troy-Bilt, 21HP, 42", excellent condition, $750 OBO; Craftsman 18HP, 42" good condition, w/grass catcher, $450 OBO. D.B. Hart Smyrna 404-660-3107 770-432-4898
TSK Super Sickle bar mower, to mow hay, used very little; $900. Anthony Mcstatts Adairsville 770-773-7114
Two 12" heavy-duty table saws,
FARM SUPPLIES $400/each; Stiles 43" Btfering su-
per sander, $5000 OBO; Powermate drill press, $400. Davis Atkins Dawson 229-942-6693
Unstyled John Deere L, disassembled for restoration, have most parts; $3500. John Cannady Statesboro 912-865-2278
Utility trailer, 8x6; $500. James Bond Jr. Blue Ridge 706-632-5229
Vicon 4000S disc mower, $7500; Unifarm CD210 disc mower, $2200; JD 336 square baler, $4000. Tracy Boyt Thomaston 706-656-8481
Woods RB72 heavy-duty scrape blade with angle and tilt control, 3PT hitch attachment, great condition; $650. Mark Woodham Madison 404379-8037
Market Bulletin Subscription Request Form Farm Machinery Wanted
1-row potato digger, 3PT hitch. Leonard Lester Hawkinsville 478-2307400
12" backhoe bucket, for Woods brand, 3PT hitch backhoe attachment. Hershell Norris Mount Airy 706-7544612
14" pull harrow, field ready, leveling board. Fred Warnell Groveland 912658-3190
4'-5' bucket from loader, any brand, will modify to fit, reasonably priced. Robert Watkins Douglasville 770-9428687
4-row no-till planters. Randy Groover Statesboro 912-690-2281
48" pallet forks, with an optional 3PT

Pat's 3PT quick hitch, reasonably priced, within 100 miles. Don Lively Jake 770-880-3486
Plastic layer for tomato beds, usable with a 45HP tractor. Jerry Dasher Glennville 912-654-2225
Post-hole digger, 3PT hitch. William Collins Lyons 912-526-6415
Small bulldozer, Case 350/JD 350, or similar. James Lundy 1259 Findley Cemetery Rd Lyons 30436 912-2932480
Strip-till 4-row vacuum planter, 4-row hard hose traveler, 3"-4". Rany Deloach 1636 Allen Sykes Rd Claxton 30417 912-739-4124
Tiller for Ford 3000 tractor, PTO, must have shaft and work satisfactory w/ good tines, reasonably priced. Donald Chambers Fayetteville 770-487-2478 770-487-2478
Tilt blade cylinder, for CAT D4D dozer, 1974 model, straight blade. Claude Harman Greenville 706-672-4717
Tractor tire sought, 13.6x24, 50% tread, no cracks. William Mashburn Morganton 706-374-6329
Vicon disc hay mower, for parts. Tom Stanaland, Jr Doerun 229-392-0258
If you have questions regarding ads in this category, call 404-656-3722.
100 used 2x6 pines, used tin, recently sawed oak, cherry, Tiger maple, poplar and basswood. David Gray Bowdon 770-655-4674
112-cell Styrofoam, 1.5"x1.5"x2", 20 available, clean seed trays, used once; $4/each OBO. Thomas Taunton Butler 478-862-3138
12 corral panels; $50/each, negotiable. Bruce Zeager Barnesville 678588-7352
12' corral panels, 15 available, $600; 4' corral gates, $150; great shape. Linda Hoff Loganville 678-283-7256
12'x24' factory built utility building, 48"x72" door, 2 pull-up windows, light switch, light, electrical receptacles; $2500/cash. Jim Bishop Franklin 706675-3943
15/20/30/55-gallon plastic drums, 2 bung plugs, 55-gallon plastic or metal lock ring, 55-gallon burn drum. Jimmy Cannon Canton 770-889-2342
15HP electric motor, new, 3-phase, 3-speed, $450; Toolroom bench top lathe, 2" swing, $995; 20'/40' shipping containers. Peter Dean Monroe 770267-9425
16-MW windows, have been dismantled, could be used for greenhouse, etc. David Taylor Rome dlt51758@ bellsouth.net 706-291-6015 706-2916015
2 generators, 100kW Cummings, 500

well, in frame on trailer; $750. Robert Fergison Sharpsburg 404-388-5548
40x60 pole barn materials, trusses/ tin/lathes, ridge cap, $2950; rooster house, 40x150, delivery available, $9000; 48" fans, $75. Bill Durham Summerville 706-252-1084
5 stainless steel, adjustable hog feeders, 300 lb. capacity; $200 each. Rusty Simmons Twin City 912-682-8753
5000 bd./ft. air-dried lumber, white oak/poplar, hickory/pine, 12'-16', 4"24"W, some edged, 1"-2" thick. John Scoggins 1211 Veterans Dr Danielsville 30633 706-255-9388
6 super sacks of bentonite, 2500 lbs.; will trade for pond project. Tim Haynes Canton 404-697-8398
600' Chore-Time feeders, 4 hoppers. 8 low-speed motors, 600'+ Lubing drinkers, 2 available; $1500. Kevin Hewell Gillsville 770-530-0157
60kW Cummins Onan generator with auto transfer switch. Richie Mccants Butler 478-862-3868
60kW Cummins Onan generator with auto transfer switch. Richie Mccants Butler 478-862-3868 478-952-1023
65 black planting buckets, for shrubs and trees, 2-gallon-50-gallon size; $1. John Wilson Tyrone 770-486-0304
7 chicken houses, equipment and parts, and 98kW generator. Charles Chappelear Madison 706-453-7772 706-817-0866
7.5kW generator, 4-cycle; $675. Wayne Wood Cleveland 706-8652528
8' concrete feed bunks, 6 available; $250/each or $1400/all. Omer Mccants Talbotton 706-573-5725
Antique ice box, 120 y/o, 21"Wx51"H, 2 storage areas, small items in top, larger items in bottom. Patsy Skinner Sylvania 912-863-5744
Barrel, stainless steel, to make cooker; large stainless steel double-sink on legs. Bill Sewell Brunswick 912-2708278
Barrels, 55-gallon, plastic, used, rinsed and cleaned; $20. Larry Heslep Milledgeville lmheslep@gmail.com 678-472-6919
Brooders, heaters, fans, shutters, fill systems, 18-ton feed bin, other equipment. Gary Johnson Jasper 770-8938168
Chest freezer, Sears brand, 110V, 41"Lx32"D, $150; European showcase refrigerator, 1 meat showcase refrigerator. Mehmed Mammoth Fairburn 770-969-0151
Chore-Time pullet equipment, fans, motor, drives, augers, controllers, 22ton feed bins, etc. Donald Morrison Folkston 912-462-5811
Clipper Super X-2968-D seed cleaner; $6000. Troy Chandler Ila 706-3389144

therm systems, cooling pads, misting also buy logs, Southern Oak Lumber.

system; $30,000. Thomas Johnston Peter Jones Monticello 478-256-3857

Thomaston 706-647-9239

Rough-cut lumber, perfect for furni-

GSI used grain bin, 48"diameter, 12 ture or your next structure, call/email

rings high, 54,000 bushel capacity, for photos and availability. William Liv-

ready to move, good shape; $5000. ingston Milner fdslumberco@yahoo.

Linda Ekkel Americus ekkelss1961@ com 678-972-0843

gmail.com 229-337-0289

Sawmill lumber, pine and hardwood

Hay tarp covers, heavy-duty, 14x48', available, custom cuts, trailer boards;

$60/each; covers for equipment, trail- as low as $.35-cents/bd. ft. Mitchell

ers, etc., can deliver within 75 miles. Smith Griffin 404-867-5106

Chris Mcpherson Cumming 770-356- Scythes, 4-grain cradles, $40-$50/

3528

each, 2 mowing scythes, $40/each;

Heavy-duty truck loading ramps, 1-mule hay rake, steel wheel, $75; gin

2000 lb. capacity. David Blasczyk Dal- steelyard, $100. R C Johnson Lexing-

las 770-445-5646

ton 706-743-5248

Hen nests, metal 4-hole or 6-hole; Stainless steel dairy and food pipe,

$85 each. Lamar Bryant Cleveland 1.5"-2" new and used fittings; $2-$10/

706-878-8509

ft. De Bryant Covington 404-425-4559

Hundreds of used concrete blocks 770-314-2661

from chicken house; $1/as much as Storage container, $1200; shop smith

you want. Larry Rodgers 321 Roseber- mark V, $1500. M.P. Bailey Redan 770-

ry Ln Murrayville 30564 770-654-6319 482-2812

Insulated metal panels, 4" and 6", dif- Tomato cages made from rebar, good

ferent lengths. Roy Carl Jackson 678- condition. Alfred King 274 Owens Cut-

794-0563

off Rd Ne Calhoun 30701 678-332-

Iron press, $125; motor lift, $100; 9288

electric pumps, $225 each. Tillie Harris Tyson building, 5000 sq./ft., clear

Preston 229-939-0214

span 50x100, 14' tall at eves, com-

Kawasaki 4-wheeler, 1000 lbs., fat plete/disassembled, ready to load;

lighted; $600. David Powell Monticello $12,000. Zeke Lambert Madison 706-

706-476-0637

474-0900

Large gas powered concrete mixer, Various plastic nursery pots, will ne-

on wheels, towable, Briggs & Stratton gotiate price for bulk buys; $.25-cents

industrial engine, runs/operates well; to $5. Rosie Johnson Roberta rosie.

$1000. Jack Moore Griffin 770-229- johnson518@yahoo.com 478-290-

4208

8747

Large quantity of field rocks, good for Wanted: Cistern well water pump,

erosion control and landscaping/build- heavy-duty, in good condition, shallow

ing; also concrete block rubble, you- well. Glenda Lynch Dallas 770-445-

haul; $1. Al Jett Rome 678-200-5825 4869

Lincoln arc welder AC, 225A, helmet, Wanted: Front rim Ford tractor, 6-lug,

15 lbs., welder rods, gloves and chip- old rye grass seed. Connie Powell

pers. W. H. Clark Hiram 770-942-5143 Monticello 706-476-0637

Locust fence-posts and rails. Eugene Wanted: Old rusty barn tin and old

Cook Blairsville 706-745-8724 706- used porch columns. Brenda Slade At-

994-2600

lanta 404-569-0001

The fee for an annual subscription to the Farmers and Consumers Market Bulletin is $10 (26 issues). This includes both print and online access. If you do not wish to receive the printed version of the Market Bulletin by mail, please opt-out where indicated below.

New Subscriber Renewal

Subscriber Number

I do not wish to receive the Market Bulletin by mail. I will use my subscriber number to log on to agr.georgia.gov and read the digital version.

Name:

Address:

City:

State:

Zip:

hitch. Larry Meyer Gainesville 404242-8347
A narrow front Ford row crop tractor. Chuck Phillips Cumming 678-414-

hours, fuel tanks, $15,000/each; seven 18-ton feed bins and fill systems, $1300/each. Ray Barnes Ringgold 423-718-7965

Cypress shakes, $2; small transport cages, $10; farmhouse sink with side board and faucet, $200. Wallace Ratliff Jenkinsburg 770-775-4439

Email address: Phone number:

2313 Auger, gasoline, 1-person operated,

2 Maxx Air high velocity fans, 42", good condition; $200 each. Har-

Dry yellow pine, 4/4, 8/4 quarter random sizes, will mill to your specifica-

(We will use your email address only to inform you when a new digital

6" or 8". Lajos/Rita Bode Cumming 770-886-5943

old Morton Locust Grove 404-2722833

tions. G. Mattison Newnan 404-4561844

issue is available on our website. We will only call if staff has a question about your subscription.)

Caterpillar 953, D-5 dozer, good run- 2 old stainless steel milk tanks; Electrical conduit pipe, 10'-12'L, .5"-

ning condition, for farm use, would 16x8x24 industrial lug backhoe tire; 1"; $5 each. A.G. Beasley Fort Valley

prefer a 953B. C. Williams Cumming cast iron bath tubs. Bobby Yarbrough 478-319-7707

404-432-5256

Pine Mountain 706-333-1998

Field rocks, good for erosion control,

Please make your check/money order payable to: Georgia Department of Agriculture

Covington planter with plates, work- 2-horse wagon parts for wagon, etc., call for appointments and direc-

ing condition please. Glenn Smith Ath- Rockdale County; $3.50. Mack Henry tions; $50/pick-up load. Steve New-

ens 706-207-7878

Stockbridge 770-483-8453

man Eatonton 706-485-8760

Farmall cub tractor, for parts or repair, 2000 bd./ft. of rough sawed lumber, Floor joist, 2x4, factory built, 8'-20'

running/not running, prefer a red mod- old growth pine, 8"-12"W, 1"-2.25" lengths, $10-$12/each; plywood, $/

Please mail your payment to: Georgia Department of Agriculture Attn: Market Bulletin P.O. Box 742510

el, no white or yellow. Thomas Tucker thick; $1.25/ bd. ft. Terry Greene Avon- each. Scott Odom Buford 770-945-

Atlanta, GA 30374

Lithia Springs 770-941-2354

dale Estates 404-271-5330

7945

PAGE 8

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Arty's Garden:The Sharing Economy

Hello World!

By Arty Schronce

Even the clearest photographs and most detailed documents give

an incomplete picture of the past. As I looked at advertisements for

flowers and plants in copies of the Market Bulletin from the 1930s,

I tried to envision the gardens back then. It was like looking at the

Grand Canyon through a keyhole or reconstructing the Age of the

Samurai by reading haiku.

The ads gave a peek but

brought as many questions

as insights.

For example, I was sur-

prised at the number of

people offering lilacs and

dahlias, generally known

for doing better farther

north than here. And there

were numerous ads for

gooseberries, a more north-

erly crop. Only last month

I advised someone asking

about them to try another

fruit. Obviously all of these

were growing well enough

for people to enjoy and of-

fer to others 80 years ago.

Perhaps the ones offered

were more heat tolerant

strains that are now un-

common or unknown in

the nursery trade. Perhaps summers were cooler and moister then. Perhaps we have heard for so long that they don't do well here that we stopped trying.

Dahlias were among the most popular flowers offered in the Market Bulletin during the 1930s. This is Little Beeswings, a variety that was introduced in 1909 and was lost to the gardening world until a gardener shared it with a commercial

I was not surprised to grower. (The vase is an old Anacin bottle.)

read "old-fashioned" as a

description for some plants.

There was, and still is, an

appeal in the charm and du-

rability that is often associ-

ated with the term in regard

to plants. I was surprised

to see ads for rock garden

plants, the idea of rock

gardening not fitting into

my notion of what Georgia

gardeners, especially ones

in rural areas, would be in-

terested in or even aware of.

However, Staci Catron, di-

rector of the Cherokee Gar-

den Library at the Atlanta Spider lilies were among the many bulbs

History Center, informs me offered in the Market Bulletin during the

that rock gardens were all 1930s and are still being offered today.

the rage in the 1930s.

They are not as common in commerce as

During the Great De- some other bulbs, but are often shared pression people were among flower lovers.

impoverished but their

gardens were not. If you think of the 1930s as a black-and-white

Dorothea Lange photograph, please remember that people then ap-

preciated color even if their cameras couldn't capture it. If the ads

are any indication, gardens were bursting with color and there was a

wider selection of plants available than I thought. The different offer-

ings in a typical issue are too numerous to list here.

We can never know the exact reasons that prompted people to

place an ad in the Market Bulletin. Some did it to earn a little extra

money. Some, perhaps realizing that money was scarce, were will-

ing to exchange one thing for another. The abbreviations "exc." and

"exch." were so common they were never explained. Consider this

ad from April 1934:

30 dif. pot flowers, such as begonias, geraniums, fuchsias, 5 eac. one of each $1.25 or exc. for garden seed, cabbage, onion plants, cornfield beans. Minnie Louise Willis, Talking Rock.

I recently had the privilege of speaking with Elizabeth Engelhardt.

She is the John Shelton Reed Distinguished Professor of Southern

Studies at the University of North Carolina and the author of several

books, including A Mess of Greens, published by the University of

Georgia Press. What brought me to her was her scholarship on the let-

ters between garden writer Elizabeth Lawrence and the people, usu-

ally farm women, who corresponded with her through the southern

state market bulletins. If you

have internet access, please

check out https://southern-

spaces.org/2012/forgotten-

locavores-letters-and-litera-

ture-market-bulletins.

I shared some of the

things I was reading in the

Market Bulletin with Dr.

Engelhardt, including the

many exchange ads.

"People talk about `the

sharing economy' today, but

that is nothing new," Engel-

hardt said.

How true. We often think

Blue Roman hyacinths offer the same fragrance and refreshing color as "improved" larger varieties of hyacinths, but do so with a lot more charm. They were offered by gardeners in the Market Bulletin during the 1930s. They are still

we discovered the world or are the first to come up with an idea. We fail to recognize that "heirloom" and "heritage" are just new labels for "old-fashioned" and "old-

available today and are worth seek-

timey." Long before "locally

ing as they are usually only available grown" was a movement or

through gardeners sharing or from

a marketing slogan, it was

specialty bulb dealers.

common sense that tomatoes

grown down the road were

fresher and tastier than those

shipped from 2,000 miles

away, or that plants grown

and proven by gardeners like

yourself in your own state

might perform better than

those from elsewhere.

Engelhardt discussed the

interactions between those

advertising and those re-

sponding. The bulletins were

not just a marketplace, but

Mock orange was named for its wonderful fragrance. It was frequently offered by advertisers in the Market

also a way to connect with others and to share knowledge and experience, some-

Bulletin during the 1930s, but is not

times with people of a differ-

common in Georgia landscapes today. ent class, educational level

or race. The more we talked

the more I started focusing

on the gardeners rather than the gardens.

Consider these ads from 1933:

As long as supply lasts, one tuber large white, dble. decorative type dahlia will be sent for 4 in stamps to cover mailing. A.D. Todd, Sarah.

Folks come see my selection of rare and good flowers, shrubs and trees. Wm. C. McGinnis, Carey Park, Atlanta. River Car Line, Rt. 7

I want to know more about these people. The plants, however rare, seem less interesting than these two sharers. The same is true of the others who reached out through the Market Bulletin and who continue to do so.
I am happy to be able to share a few thoughts through this column and am especially proud to appear in this centennial edition. Thank you for being a reader and thank you for all your comments, ideas and feedback.
Let's keep the sharing alive.

-Arty Schronce is the resident gardening expert at the department.
Write to him at arty.schronce@agr.georgia.gov, or in care of the Market Bulletin.

The very first issue of the Georgia Market Bulletin debuted on March 1, 1917. Suggested initially by a field employee of the Georgia Department of Agriculture, the paper came to fruition as the fulfillment of a campaign promise made by J.J. Brown in his successful run for election as Georgia Agriculture Commissioner.
What else was happening in 1917?
l The annual Girl Scout Cookie Sale tradition begins with a service project conducted by the Mistletoe Troop of Muskogee, Okla., U.S.A.
l On Jan. 17, the United States pays Denmark $25 million for the Virgin Islands.
l On Feb. 8, Kennesaw Mountain near Marietta is declared a Civil War Memorial. The War Department transfers ownership to the National Park Service.
l On Feb. 20, hundreds of women gather at New York City Hall to protest rising food prices. On the eve of U.S. entry into World War I, the average cost for a family dinner jumped from 76 cents per meal ($22 per month) to $1.99 ($59 a month), based on these prices: 2 pounds of onions = 40 cents 4 lbs. of potatoes = 28 cents 2.5 lbs. of meat = 60 cents 4 lbs. of bread = 37 cents lb. of butter = 14 cents 1lb. of cabbage = 20 cents
l On Feb. 23, the Smith-Hughes National Vocational Education Act of 1917 is signed into law. The act led to the creation of the FFA.
l On March 5, U.S. President Woodrow Wilson is inaugurated for a second term.
l On April 6, the United States declares war on Germany and enters World War I.
l On May 21, the Great Fire of Atlanta starts in a cotton warehouse near Grady Hospital. The fire burns for 10 hours, destroying 1,938 buildings spanning 73 city blocks and displacing more than 10,000 people. Mansions along Ponce de Leon Avenue are dynamited to create a firebreak.
l On May 29, John F. Kennedy, the 35th President of the United States, is born in Brookline, Mass.
l On July 27, Bacon County is created.
l On Aug. 10, the Food and Fuel Control Act is enacted to conserve supplies and control prices during World War I.
l On Aug. 15, Atkinson County is created.
l On Aug. 21, Treutlen County is created.
l On Sept. 14, poet Byron Herbert Reece is born in Union County.
l On Oct. 15, the Chicago White Sox beat the New York Giants four games to two, to win the 14th World Series.
l On Oct. 27, 20,000 women march in a suffrage parade in New York City.
l On Nov. 3, the price of a first-class postage stamp rises from 2 cents to 3 cents.
l On Nov. 29, Georgia Tech, coached by John Heisman, completes a 9-0 season to win the NCAA Football Championship.
l On Dec. 18, actor Ossie Davis is born in Cogdell, Clinch County.
l On Dec. 31, Seaboard Air Line Railroad commences service between Savannah and Charleston, S.C.
Sources: OnThisDay.com; National Women's History Museum (nwhm.org); GPB.org; GeorgiaEncyclopedia.org

FARMERS & CONSUMERS MARKET BULLETIN (ISSN 0889-5619)
is published biweekly by the Georgia Department of Agriculture 19 Martin Luther King Jr. Drive Atlanta, GA 30334-4250
404-656-3722 Fax 404-463-4389 Office hours 8 a.m. to 4:30 p.m. Monday Friday

Gary W. Black, Commissioner MARKET BULLETIN STAFF
Julie McPeake, Chief Communication Officer Amy H. Carter, Editor
Mikki Dixon, Executive Administrative Assistant Caroline Phillips, Intern

Subscriptions to the Farmers and Consumers Market Bulletin are $10 per year. To start or renew a subscription, go to our website to pay by Visa or MasterCard, or send a check payable to the Georgia Department of Agriculture along with your name, complete mailing address and phone number to PO Box 742510 Atlanta, GA 30374-2510. Designate "Market Bulletin" in the "for" line. To determine if an existing subscription is due for renewal, look for the expiration date on the mailing address label on page 1. Postmaster: Send address
changes to 19 Martin Luther King Jr. Drive, Atlanta, 30334.

The Department does not discriminate on the basis of sex, race, color, national origin, age or disability in the admission or access to, or treatment in, its employment policy, programs or activities. The Department's Administration Division coordinates compliance with the non-discrimination requirements contained in Section 35.107 of the Department of Justice Regulations. Information concerning the
provisions of the Americans with Disabilities Act, and the rights provided thereunder, are available from this division. If you require special assistance in utilizing our services, please contact us.

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

Agriculture at the Capitol

PAGE 9 Photos by Blane Marable | blanemarable.com

Georgia agriculture was the talk of the Capitol in February during a series of events honoring youth and adults engaged in the state's No. 1 industry.
"This is always an occasion where I know many members of the General Assembly look forward to visiting with you," said Gov. Nathan Deal in his address to the Georgia Agribusiness Council's Legislative Breakfast Feb. 8. "We acknowledge and understand that agriculture is the primary economic driver that keeps our economy going."
A number of high-ranking state leaders followed Deal to the podium to voice their support for Georgia's farmers and agribusinesses. They included Lt. Gov. Casey Cagle, R-Ga.; Speaker of the House David Ralston, R-Blue Ridge; Senate Agriculture and Consumer Affairs Chair John Wilkinson, R-Toccoa; House Appropriations Committee Chair Terry England, R-Auburn; House Agriculture and Consumer Affairs Committee Chair Tom McCall, R-Elberton, and Agriculture Commissioner Gary W. Black.
Deal and Black also addressed young winners of local, regional, state and national equine events on Feb. 9 when the Georgia Agricultural Commodity Commission for Equine hosted its 8th Annual Equine Day at the Capitol. Deal, a former horseman, praised the youth for their discipline and achievement. Black, whose own children showed livestock, praised the

parents in the crowd for making the tremendous investments of time and money in their children's futures.
Georgia Farm Bureau Day at the Capitol was Feb. 15, and the legislature celebrated FFA Day at the Capitol Feb. 21.

Bryan Tolar, president of the Georgia

Agribusiness Council

Georgia Gov. Nathan Deal

Photo by Amy H. Carter
Georgia Agriculture Commissioner Gary W. Black, center, onstage at a luncheon during Youth Equine Day at the Capitol with (from left) Greer Cofield, 9, of Cartersville, and Evan Manning, 10, of Loganville.

Photo by Amy H. Carter
Cole Laughhunn of Adairsville enjoys lunch from The Varsity during Youth Equine Day at the Capitol.

Rep. Terry England and Lt. Gov. Casey Cagle

Georgia Rep. Buddy Harden, R-Cordele, chair of the House Special Rules Committee, with UGA College of Agricultural and Environmental Sciences Dean Sam Pardue and Georgia Rep. Tom McCall, R-Elberton, chair of the House Agriculture and Consumer Affairs Committee.

Georgia Sen. Frank Ginn, R-Danielsville, chair of the Senate Committee on Natural Resources and The Environment, with Chip Bridges, program manager of agriculture education for the Georgia Department of Education.

Seated, from left: Sen. Butch Miller, R-Gainesville; Sen. John Wilkinson, R-Toccoa, chair of the Senate Agriculture and Consumer Affairs Committee; Sunbelt Agricultural Expo Director Chip Blalock. Standing, from left: Georgia 4-H Foundation Executive Director Mary Ann Parsons and Georgia Secretary of State Brian Kemp.

Cook Georgia Grown: Collards Three Ways

Collard Green Salad with Satsuma
Vinaigrette
Ingredients:
16 cups shredded collard greens, stems removed
1 cup slivered onions cup pecan oil*, divided (can substitute
canola or sunflower oil) 1 cup Satsuma juice** (can substitute
tangerine or clementine juice) cup cider vinegar

1 tsp. minced garlic Salt & pepper Garnish: sunflower seeds (optional)
Preparation:
In a large bowl, combine collard greens with cup pecan oil and kosher salt. Massage greens until they become wilted. Add onions to bowl and mix well.
In a separate bowl, combine remaining ingredients, whisking to combine. Pour Satsuma dressing over greens, mix well, then refrigerate several hours or overnight. Serves 12-16. Recipe can be halved.
* Oliver Farm, Pitts | oliverfarm.com; Pecan Ridge Plantation, Bainbridge | pecanridgeplantation.com
**Florida Georgia Citrus, Monticello, Fla., 229.224.7698
Collard Green Salad with Straw-
berry Pepper Jelly Vinaigrette
Ingredients:
12 cups shredded collard greens, stems removed
cup slivered onions cup pecan oil *, divided (can substitute
canola or sunflower oil) 1 tsp. minced garlic 2 Tbsps. Wisham's Jellies Strawlapeo** (can
substitute other pepper jelly or combination of strawberry jelly and pepper jelly) cup cider vinegar Salt & pepper Garnish: sunflower seeds (optional)

Preparation:
In a large bowl, combine collard greens with cup pecan oil and kosher salt. Massage greens until they become wilted. Add slivered onions to wilted greens, mixing well.
Combine remaining ingredients in a small bowl, whisking to combine. Pour dressing over wilted greens mixing well. Refrigerate several hours or overnight. Serves 8-12.
* Oliver Farm, Pitts | oliverfarm.com; Pecan Ridge Plantation, Bainbridge | pecanridgeplantation.com

Asian Wilted Collards
Ingredients:
8 cups shredded collard greens, stems removed
- cup slivered onions 1-2 tsp. minced garlic cup Infused Peanut Oil* (can substitute
sesame oil) cup soy sauce Salt & pepper Garnish: chopped peanuts (optional)
Preparation:
Heat oil in large skillet over medium high heat. Add slivered onions and garlic, stirring until softened. Add collard greens and cook until just wilted. Add soy sauce, stirring to combine. Adjust seasoning with salt and pepper. Serves 4-6.
*Oliver Farm, Pitts | oliverfarm.com

PAGE 10

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Wanted: Reynolds dirt pan, 5 yard. Vinh Ta Buena Vista 229-314-0530
Wood burning buck stove, with glass doors, good condition; $400. J.B. Wells Macon 478-957-2347
Wood-Mizer lumber, 1x12 pine, poplar or oak trailer flooring, any thickness. Larry Moore Newnan 678-278-5709
Wood-Mizer sawed lumber, black walnut, cherry, poplar, pine, cedar and maple. Wayne Crow Cleveland 678997-6985
Ziggity drinkers, Chore-Time feeders, fans, winches and assorted control room equipment. Eva Adams Clarkesville 828-361-2563

4 y/o registered Black Angus bull, semen tested, LBW, great genetics; $2500. Chris Little Lula 770-561-8091 770-539-3700
45 cows, 1 bull, cows calving now and very soon; $50,000 J.M. Ricketson Denton 912-551-2083
5 Angus heifers, 14 m/o; $1000 each. Tommy Willingham Bolingbroke jaywillingham2@gmail.com 478-3208332
5 registered Black Angus bulls, 18 m/o, AI sired, calving ease; $2300 each. Jes Strickland Glennville 803617-8415
5 y/o registered Black Angus bull, proven breeder, will consider a trade;

Polled shorthorn bulls, breeding age, can deliver. David Nixon Commerce 706-255-9837
Purebred Angus bull, Traveler and EXT bloodlines, not registered, DOB 04/03/15. John Lunsford Dewy Rose 706-283-6243
Purebred Angus bulls, 6 m/o, good bloodlines; $600. Charles Chastain Talking Rock 706-972-1103
Purebred Black Angus bulls and bred replacement heifers. Eric Hutto Alma 912-286-0568
Purebred Black Angus bulls and bred replacement heifers. Eric Hutto Alma 912-286-0568
Purebred Guernsey cow, 3.5 y/o,

Registered black Simmental, SimAngus bulls, performance tested; cow/ calf pairs, heifers, heavy milk, AI embryo bred, satisfaction guaranteed. Milton Martin Clarkesville 770-5190008
Registered bulls, BSE tested, black and Hereford, $1600-$2500; also have yearling Baldie heifers. Lalla Tanner Monroe lalla_tanner@hotmail.com 770-267-7179 678-823-5742
Registered Charolais and Simmental Bulls of breeding age, great selection, gentle, semen tested, guaranteed; $2000-$2500. Adam Marsh Garfield 912-536-1430
Registered Charolais cattle, bulls with

Service-age purebred Black Angus, Simmental, SimAngus bulls, registered/semen tested, extensive AI over many years. William Clanton Odum 912-221-1383 912-586-2388
SimAngus and Simmental bulls, 1216 m/o, AI sired, calving ease, semen tested; $1700-$2500. Chet Barrett Mount Airy 706-499-8008
SimAngus bulls, 14 m/o, vaccinated and wormed, excellent bloodlines. Earl Williams Hawkinsville 478-230-9983
Watusi cattle, choose from herd or get a great deal for all 19. Steve Mcallister Rock Spring 706-996-3254
Swine

LIVESTOCK All livestock must have been in the
advertiser's possession for at least 90 days before they can be advertised. Livestock listed must be for specific animals. Generalized ads such as "many breeds of cattle" or "want horses, any amount" will not be published. Ads for free or unwanted livestock will not be published. Ads for cats, dogs, reptiles, rodents and other animals not specifically bred for on-farm use will not be published.
Cattle
If you have questions regarding ads in this category, call 404-656-3722.
15 black Baldie pairs, some 3-in1s, $30,000; also have Brangus bulls, $1700 each. Albert Cosnahan Metter 912-667-0118
16 registered Angus and SimAngus bulls, 15 m/o -24 m/o, AI, embryo genetics, semen tested. Jerry Ellis Calhoun 678-986-5420
16 registered Red Angus bulls, 12 m/o, 1000 lbs., One classmate, 2nd ADG, Midland Bull Test; $1250+. Joe Gibson Rome 706-506-3026
2 Black Angus bulls, 8-12 m/o; also have Black and Red Angus heifers, 6-12 m/o. Carole Harris Carlton 678232-9847

$2500. Morgan Harvey Bolingbroke 478-747-8660
6 Black Angus heifers, 8-13 m/o; $750/each, or $700/each to take all. Ellis Holcomb Clayton 706-782-3283
6 herd bulls prospects, Simbrah, Braford, SimAngus, 14-22 m/o, semen tested; $1600-$2400. Larry Partain Elberton 706-283-5058
6 registered Black Angus bulls, 24 m/o, one 3 y/o, UTD shots, AHR/AI, BW under 2.5. James Miller Hawkinsville 478-892-2839 478-955-0224
6 registered Hereford, Angus, Baldies, cow/calf pairs, open and bred, 2-7 y/o, UTD shots, LBW, great genetics. John Watson La Fayette 423-834-3457
6 y/o registered Angus bulls, 2 available, semen checked, Lemmon bulls. Jay Jarrell Butler 478-391-2318
AI-bred, registered Angus bulls, 16 m/o, 1400 lbs., semen tested, LBW; $1500-$1800. Lanny Benson La Fayette 706-397-2329
Black Angus bull, 17 m/o, LBW, will make good herd sire; $1625. James Fincher Lagrange 706-298-1156
Black Angus bull, 9 Black Angus cows, 6 have 2-3 m/o calves at side; $15,000. Earlie Mcquaig Broxton 912359-2665
Black Angus bull, 9 m/o; $750. Jerry Ban Lumber City 912-363-4643
Black Angus bulls and heifers, calv-

bred to painted miniature Jersey, due July; $1800. Kelly Maxwell Winder 404-925-2369
Purebred Shorthorn bull, sired from Sho-Me-Goldstone, 2.5 y/o, $2500; registered Shorthorn calves, DOB Sept.-Oct. 2016. Trent Sellers Brooklet 912-842-4111
Red Angus bulls and heifers, registered, BSE exam on bulls, heifers UTD on shots including pink eye. Michael Smith Newnan 770-253-7099 770301-1945
Red Angus, 19 cow/calf registered pairs, herd bull, dispersal, 20+ years in making. Jim Hudson Po Box 287 Broxton 31519 jimdhudson@windstream.net 912-359-5546
Registered Angus and SimAngus bulls, 3-4 y/o, SimAngus is an excellent heifer bull from Gibbs Farm. Gerald Driggers Ochlocknee 386-209-0209
Registered Angus bulls, 15 m/o, SAV Resource sons, semen tested; $1800+. Larry Maney Baldwin 706-886-9551 706-244-4348
Registered Angus bulls, bred cows and younger heifers, from P&D Farm. Dean Ferguson Cedartown 706-5062434
Registered Angus bulls, excellent quality/performance, LBW, will add pounds to your calves, delivery available, Gillis Angus Farm. Windell Gillis

superior calving ease. Bobby Burch Eastman 478-718-2128
Registered Dexter cattle, bred cows, calves and bulls, small cattle but are great beef/milk, docile pasture pets. Sammy Hall Milledgeville 478-9325662
Registered Hereford bulls, 18 m/o-3 y/o, top bloodlines, semen tested and vaccinated; $2250+. Hardy Edwards Winterville 706-714-9012
Registered Hereford bulls, polled and horned, rugged, pasture-raised, gentle, excellent bloodlines/EPDs, 36 years of experience. Bobby Brantley Tennille 478-553-8598
Registered Hereford bulls, polled, excellent EPDs/bloodlines, pastureraised, gentle, service ready. Joey Yasinski Senoia 678-471-7106
Registered Limousin/LimFlex bulls and heifers, 6-8 m/o, double black, double polled. Kelvin Irvin Eatonton 404-569-9881
Registered Santa Gertrudis bulls, service ready, ADG/EPDs available soon. Wayne Jernigan Buena Vista 229-6497724
Registered SimAngus bulls, 18 m/o, 2 available, AI sired, excellent quality/EPDs, vaccinated/wormed; ASA3069942 and ASA3069943 Donald Lane Vienna dkl31092@gmail.com 229-938-7845

If you have questions regarding ads in this category, call 404-656-3722.
Advertisers submitting swine ads must submit proof of a negative brucellosis and pseudorabies test from within the past 30 days. Exceptions are swine from a validated brucellosisfree and qualified pseudorabies-free herd; these operations must submit proof of that certification. If you are faxing or mailing in an ad, the test needs to be sent along with it. For ads submitted online, the test can be attached using the attachments button. Buyers are urged to request proof of a negative brucellosis and pseudorabies test prior to purchase.
4 pigs available, $45; 5 pigs available, $50. Billy Speer Summerville 706857-4189
4 pot-bellied pigs: 1 male, 3 female; $50/all OBO. Michael Ebright Alpharetta ebrightr@bellsouth.net 678270-7669 770-363-5092
Duroc purebred boars and sows, good bloodlines; show pigs available. Harry Freeman Statesboro 912-6817867
Hampshire pigs, 3 gilts, black and white, pasture-raised, all-natural, 230 lbs.; $160 each. Nathan Joyner Gray 478-718-8968
Heritage boar, 2 y/o, $350; Hamp-

2 Black Angus cows, 5 y/o; $1800/ both. C.D. Gravitt Buford 770-9454371
2 bred Black Angus heifers, registered; $1500/each. Jeff Frankum 555

ing ease, maternal values. John Bryant Eatonton 706-485-8321
Black Angus heifer and 3 m/o bull calf; $1800/pair. Bill Crawford Madison 678-429-1535

Eastman 478-231-8236
Registered Angus bulls, SAV bloodlines, performance tested, semen tested, docile, 16-18 m/o, Marty Clark Jefferson 770-294-5579

Registered Simmental and SimAngus bulls, 12-18 m/o, semen tested, great bloodlines. Steve Watson 7029 Elliott Family Pkwy Dawsonville 30534 706429-5349

shire sow, 4 y/o, $350; Yorkshire sow, 5 y/o, 2 litters/year, $300. Karen Carlton Newnan 770-630-6541
Hogs, 450 lb.-550 lb., will deliver if needed, also have a few smaller pigs,

Stock Gap Rd Monroe 30656 770307-7343
2 high quality Angus/Limousin, CC-7, Mytty In Focus, Oak Bowery Alliance, JCL Baxter. Jim Raptis Lyerly 770712-5883
2 Limousin bull calves, 5 m/o and 7 m/o, 400-500 lbs., both back polled; $900-$950. L.C. Lairsey Waycross 912-285-5149
2 registered bulls, 10 m/o, 3/4-Angus and 1/4-Simmental, AI sired by Comrade, UTD shots, wormed, gentle. Edward Allen Marble Hill 770-894-2195
2 registered Gelbvieh bulls, 29 m/o, will transfer registration papers; $2500/ each or $4700/both. Bud Self Adairsville 706-252-5221 706-295-4918
2 y/o Angus bulls, registered, semen checked. Gary Brock Arabi 229-3227608
23 cross cows, March calving w/4th calf, 2 registered Red Angus bulls, 3.5 y/o, nice/gentle, service ready. Roy Strickland Villa Rica 770-459-5997

Black Baldie cow and Angus X cow, both 6 y/o, both fat with black calves; $1350/pair. Carolyn Griffis Covington 770-786-1093
Bulls: Angus, horned Hereford, nonregistered black Hereford, semen tested, 15 m/o. Wes Smith Thomaston 706-648-4210
Calving ease, milking ability, gentleness, registered polled Shorthorn bulls/ show heifers/steers, excellent quality, Club Calf member. Kenneth R Bridges Commerce 706-768-3480
Charolais bulls, breeding-age, registered, polled, LBW, great EPDs; $2500. Marshall Bennett Adel 229-300-3164 229-549-8654
Gelbvieh bulls, all registered purebred, bred for easy calving and fast growth. John Kiss Gainesville 770531-1126
Great starter herd, 6 registered Angus cows, 2 Final Answer, 2 New Design, 2 Grass Master. Michael Sigman Covington 678-313-3639

Registered Angus, 10 m/o, excellent genetics, vaccinated; $1200/bull, and $1000/heifer. David Strawn 6566 Stringer Rd Clermont 30527 dastrawn@myemc.net 678-617-9717
Registered Black Angus bull calves, calving ease lines, good feet, docile, moderate frames, grazing genetics, vaccinated; $1500. Clayton Leathers Dallas 678-836-6793
Registered Black Angus bull, 16 m/o, Bismarck, top CED, $B, RE, SC, BW, Thompson BB Black Angus; $2500. Cliff Thompson Mineral Bluff 706-3745964
Registered Black Angus bull, 5 y/o, sire SAV Final Answer, gentle, good EPDs. Teresa Jackson Chickamauga 423-779-8058
Registered Black Angus bull, 6 y/o, good bloodlines/genetics, muscle, calves; $2400. Stacey Burden Comer 706-783-5840 706-714-7194
Registered Black Angus bulls, 15 m/o-2 y/o; $1500 each. Eugene Ridley

Registered, polled Hereford bulls, 23-26 m/o, top bloodlines, 14 open F1 Baldies. J. Jeanes Macon 478-9720912
Registered, polled Hereford bulls, good EPDs, ultrasound carcass information provided. Larry M Lane Carrollton 678-378-5170
Registered, polled Hereford heifers and bulls, 16 m/o, excellent bloodlines. John Bailey Po Box 468 Summerville 30747 coveyset1@aol.com 706-8591061
Registered, polled Shorthorn bulls/ show heifers/steers, excellent quality, calving ease, milking ability, gentleness, Club Calf member. Ken Bridges Commerce 706-768-3480
Registered, polled, black Beefmaster bulls, several to choose, 1-2 y/o, semen tested, UTD shots/wormed, gentle, good conformation. Vernon Turner Dalton 706-278-7814

300 lbs. Jake Phillips Dawsonville 706-974-8113
Miniature male piglet, Juliana mix, 5 m/o; $125. James Stewart Carrollton 678-372-2855
Piglets, 15 lbs., $50; neutered males, 60 lbs., $100; 3 bred sows, $350 each. Leroy Everette Homer 706-658-5025
Piglets-butcher hogs, all sizes, Hereford cross, Berkshire cross, Hampshire/ Hereford/Yorkshire cross; $40-$175. Donald Brown Ranger 770-548-0118
Purebred Tamworth boar, Duroc/Tamworth cross sow with 6 nursing piglets, can text photos. Matt Brown Canton 678-739-7176
Registered Hampshire boar, 2 y/o, produces large/healthy litters. Mike Hardy Warner Robins 478-396-6394
Yorkshire X piglets, 4 cut males and 1 female, wormed, DOB 10/14/16; $80 each. Mike Nalewako Newnan 770630-6541
Goats And Sheep

24-28 m/o registered, purebred, black Heifers, bred cows, cow/calf pairs; La Fayette 706-764-6110

If you have questions regarding ads in

Be it home-raised bees Limousin bulls, polled, free delivery; $900+. Joseph Bryson Dawsonville Registered Black Angus bulls, 17-30

$2000 each/if both taken. Sid Arnold 706-974-8952

m/o, semen tested and docile, also

this category, call 404-656-3722. 2 billies, DOB 01/17/17, great youth

Nicholson 706-207-6113

Hereford bull, purebred, polled, 8 cow-calf pairs. John Stuedemann

project, will grow big, photos upon

28 commercial cows with calves, m/o, DOB 03/16/17. D.L. Jaillette 4290 Comer 706-202-2371 half bred back, Angus bull included; Jersey Walnut Grove Rd Covington Registered Black Angus bulls, 18

or handmade beads,

request, call/text; $120 each. William Gallian Byron 478-960-6254

$55,000/all. Jack Beckom Barnesville 30014 678-490-6493

m/o, UTD shots, semen tested. Ricky

770-358-2678

Hereford bull, registered, DOB Hix Comer 706-248-5851

we've got something

2 Boer billy goats, 2 y/o; $225 each. Matthew Allen Athens 30601 deb-

29 healthy beefalo, 1 is a white buf- 10/25/15, good, quality bull, service Registered Black Angus bulls, perfor-

biedaa@att.net 706-224-3630 706-

falo heifer, selling all due to personal ready. Charles Johnson Millen 478- mance EPDs, high $B values, range of

illness. Alvin Strickland Patterson 904- 299-1216

ages/prices, limited area free delivery.

for everyone!

340-6287 2017 lambs, ready end of March; also

335-7463 3 belted

Galloways, black

w/large

High quality Angus bulls, 15-48 m/o, Tex-X, All-In, 50-50, McMichael Angus

Allen Morris Mount Vernon southerncrossangusfarm@gmail.com 912-293-

Advertising in the

have 1 Romanov/Dorset-X ram, Tunis/ Dorset-X ewe, Tunis-X/Dorset-X ewes;

white belts, 16 m/o heifer, 6 m/o heifer Farm; $2000-$3500. Ken Mcmichael 6471

$150/each. Joan Blose Cartersville

and bull. Ladon Bandy 236 Gray St Monticello 706-819-9295

Registered Black Angus bulls, per-

706-236-2242

Trion 30753 706-676-1849

Murray Grey yearling and mature formance tested, add pounds to your

3/4 Simmental bull, 18 m/o, Built bulls; Murray Grey, Hereford and com- calves, free delivery; $2500. C.L. Cook

Right and Venom bloodline; $1500. mercial heifers and cows. Kyle Knight Social Circle 678-910-4891

3 m/o purebred Nubian babies, friendly, healthy, will text photos on request; 150/doe, and $100/bucks. Buzz

Wayne Ansley Cornelia 706-499-3869 Sylvania 912-690-5097

Registered Black Angus: Long and

Glover Moreland 404-520-0420 770-

4 registered SimAngus bulls, 2 Baldie and 2 solid black, polled, gentle, LBW,

Piedmontese, exceptional pedigree, EPDs, registered, see website for bulls

short yearling bulls, bred cows and pairs, Indian Hill Farm, delivery avail-

semen tested, call/text. Shannon Irvin Alto 706-768-1410 706-778-2014

and bred heifers. Patrea Pabst Dewy Rose www.beavercreekpiedmontese.

able. Steve Deal Statesboro 912-5313549

gets your farm goods, services and land seen by

713-9417 4 Pygmy billies, 3 m/o; $50 each.
Mike Powers Winston 770-827-5342 5 Nigerian goats, closing, all animals

4 registered SimAngus cow/calf pairs, com 404-217-8471

Registered black Limousin and Lim-

heifer calves by side; $2500/pair, or $9600/all. Jessie Driggers Glennville 912-237-0608

Polled Hereford heifers and bulls, 11+ m/o. Ronnie Lancaster Milan 229-3624619

Flex bulls, 14-23 m/o; $1600-$1800. Deborah Jones La Fayette 423-4133416

40,000 people each issue!
See page 2 for advertising guidelines!

must go. Andrew Thornton Carrollton 470-213-0594 404-213-5297
ABGA buck, black and gray, 5 y/o. A.D. Bryan Blairsville 706-745-2223

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 11

Angora buck, 3 y/o, good breeder, beautiful fleece; $200. Polly Ward Elberton polly.b.ward@gmail.com 706283-3749
Beautiful mini-Oberhasli buckling, 2nd generation, 4 m/o, very sweet, hands-on manageable, registered TMGR; $150. Alexander Flaherty Royston 706-254-7717
Black male goat, call after 5 p.m. Paul Williams Conyers 770-483-6038
Black/White Nigerian Dwarf kids, vaccinated, dewormed, healthy babies, mother/father on-site; $225. Dana Anglin Cumming 678-300-3045
Boer billy, 250 lbs., photos available by text; $240. Jimmy Pittman Valdosta 229-245-7459
Boer billy, 3 y/o, gentle, selling because I need a new breeder; $350. Chris Woodward Williamson 770-8335538
Boer/Kiko/Nubian crossed, DOB 11/2016, 4 doelings and 2 bucklings, beautiful kids; $125 each. Sherrie Liford Canton 678-521-8689
Commercial Boer bucks, excellent ABGA bloodlines: $175/ 7 m/o; $300/11 m/o, 140 lbs.; $125/Spanish. Michael Pollex Waynesboro 706-5513801
Dairy bucks from heavy milkers, 1 Nubian and 1 Saanen; $45+. Jewell Wood Hampton 770-946-8619 404353-2498
Katahdin/Dorper ram lambs, 4 commercial ram lambs, 2 breeding quality; $250-$275. Susan And Phil Cobb Cedartown 404-215-1615 770-546-9601
Kiko billy, 10 m/o, solid white, parents on-site; $85. David Combs Jefferson 706-367-4107
Kiko does, purebred, 6 m/o, 1 black, 1 brown, 1 white, from black buck, can be registered. William Landress Loganville 678-414-2505
Kiko mixed billy, 3-4 y/o, proven breeder, white with wide spread horns; $150. Wayne Malcolm Covington 770464-2486
Large male goat, yellow and black. Bob Emmett Byron 478-960-9181
Nubian babies, please email for details. Heather Phelps Ball Ground h5phelps@hotmail.com 954-554-5729
Nubian billy, spotted, dehorned, very tame, proven breeder, 4 y/o, not registered; $225. Tim Stanfield Tyrone 770656-2965
Nubian buck, purebred, unregistered, very nice conformation, call/text; $185. Rennie Mussell Milner 770-584-4318
Nubian/Oberhasli doe, 1 y/o, bottlefed, should be a great milker, please call before 9 pm; $100. M. Reynolds Pelham 229-224-4158
Pygmy goats, 4 nannies and 1 billy; $75/nannies, and $$100/bill. Randy Seay Griffin 404-697-8454 770-2277371
Registered black Nubian buck, 4 y/o, good bloodlines, $250; also have other goats. Bonnie Eubanks Sandersville 478-456-6606
Registered Boar billy, 6 y/o, sires pretty babies, selling to prevent inbreeding; $600. Herman Thames Perry 478-9521305
Registered Katahdin rams, grandsons of world-famous Diesel, perfect conformation, large, fast-growing yearlings. Duke Burgess Louisville 478625-9542 305-923-0262
Registered Lamancha kids, nannies and billies; $150-$300 each. Shane Duncan Elberton 706-961-3695
Registered New Zealand 100% Kiko buck, DOB 03/17/16, colored; $300. Bryan W Maw Tifton 229-382-6832
Saanen kids, does and bucks, registered stock, DHIA records on dams, CL and CAE-free herd. Joseph Lashley Lagrange 404-274-1702
Wanted: Pygmy goats, close to me. James Snow Hampton 678-759-8277
Stock Dogs
If you have questions regarding ads in
this category, call 404-656-3722.
Advertisers must submit a copy of a current Rabies Vaccination Certificate signed by a licensed veterinarian for dogs 12 weeks and older. Ads submitted without this information will not be published.
Great Pyrenees puppies, 7 w/o, friendly, best protection for goats, sheep and chickens; $300 each. Deborah Shuman Winterville 706-546-8610

Great Pyrenees puppies, DOB 12/28/16, with 1st shots, dewormed, parents on-site, excellent guard dogs; $275 each. Judit Varga Conyers 770402-5357
Equine For Sale
If you have questions regarding ads in this category, call 404-656-3722.
Advertisers in the Equine for Sale or Equine at Stud categories must submit current negative Coggins tests for each equine advertised. This includes horses, ponies, donkeys, etc. Buyers are urged to request verification of a negative Coggins from the advertiser before purchasing any equine. Negative Coggins reports are valid for 12 months from the date the blood sample is drawn. Falsification or altering of any Coggins results can result in fines and suspension of advertising privileges. If you are faxing or mailing in an ad, the Coggins needs to be sent along with it. For ads submitted online, the Coggins can be attached using the attachments button. Generalized ads, such as "many horses," "variety to choose from," etc., will not be published. Equine at Stud ads will also require a current stable license in order to be published.
15 y/o Palomino/Quarter mare, rides, loads, stands easy, keeps calm, loads of personality, beautiful color; $1200 OBO. Susan Singleton Comer 706202-5734
2000 AQHA gelding, smart, friendly, athletic, 90 days professional training, moving and must sell; $1200. Bill James Danielsville bill.james01@ gmail.com 706-540-9009
AQHA, 12 y/o mare, 13H, charcoal, mild-tempered, needs tune-up. Joseph Douglas Villa Rica 770-402-6590
Donkey, standard jenny, 5 y/o, gray, gentle, good companion, pet or guard donkey, will deliver; $200. Wynn Copelan Greensboro 706-453-7687
Miniature donkey, jack and jenny, very gentle, good for guard. H.N. Ralston Eatonton 706-473-3119
Standard jenny, 4 y/o, gray, very gentle, $200; also have a jack, very gentle, $75. Jackie Copelan Madison 706474-5066
Equine Miscellaneous
If you have questions regarding ads in this category, call 404-656-3722.
1997 Sundowner Sunlite 2-horse gooseneck, slant-load, dressing room, rear tack, lightly used, very good condition; $7900. John Hicks Canton jddhicks153@gmail.com 770-490-3407
2 sets of draft team harnesses, 1 spotted leather and 1 nylon work harness. Tom Clark Winston 770-5960273
2-wheel pony cart, pneumatic tires, includes harness; $350. Donald Hodges Leary 229-344-6875
2003 Sundowner 3-horse slant trailer, customized interior, A/C, furnace, awning, Goodyear fully-insulated tires and more; $15,500. Annette Bowman Senoia annette-ld@earthlink.net 770318-8035
2004 Exiss Frontier XT8 3-horse trailer, full living quarters, excellent condition; $25,500. Bobbi Maddox Monticello bobbimaddox@yahoo.com 770-616-6034
2007 Ponderosa 2-horse bumperpull trailer, slant load, large front tack/ dressing room; $3200. Judy Wallace Jackson 404-427-4142 770-775-0876
Billy Cook 15.5" and also a 15" roping saddle; $250/each, or $450/both. Dan Kane Sale City 229-336-7181
Black all-purpose 16" black English saddle, rarely used; $250. Deborah Perreira Hampton 678-283-4364
Doctor's horse-drawn buggy, red and black, good condition; $1200. T.E. Bolden Waycross 912-283-0787
Full CH snaffle headstall, $30; 3 pairs Davis splint boots, $20. Mary Jones Waverly Hall 706-580-9883
Pony saddle, padded seat, hooded stirrups, floral tooling, fleeced-lined saddle pad; $125/all. Susan Sohn 668 Hill Farm Rd Alamo 30411 sres10@ wildblue.net 912-423-9299
Silver show saddle and bridle, grooming items, bits, leg wraps and stable blankets. Patti Mcleroy Kathleen 478987-0019

Poultry/Fowl For Sale
If you have any questions regarding ads in this category, call 404-656-3722.
Mallard ducks must be at least three generations removed from the wild before they can be advertised. Advertisers must include this information in ads, or they will not be published.
1 y/o black Silkie rooster, leave a message; $10. Bill Lanier Canton 770720-7095
10 white homing pigeons, will ship; $10 each. Ken Hatley Barnesville 770358-1300
12 RIR and 4 Golden Laced Wyandotte hens; $12 each. Hoyt Howard Cumming 770-887-2039
13 varieties peacocks and peahens, including Javas Greens, game roosters and hens, also have peacock feathers. Ray Watts Macon 478-361-3468
2 white Leghorn mixed roosters, 6 m/o, $15; female Pilgrim goose, 9 m/o, $35; 12 Leghorn mixed chicks. Hank White Atlanta 404-755-0505
2016 hatch, Silver and Dark Throat Golden pheasants. Eugene Truman Gray 478-733-0057
22 Rhode Rock and Buff chickens, 3 roosters, call before 8 p.m. Sandra Waters Shoemaker Newborn 706-4687521
5 black, purebred Australorp laying hens; also have small cages and large/ moveable pins; selling due to health. Bedford Woodard Dalton 706-5811563
5 w/o Brown Leghorn, 5 w/o Anconas and 1 m/o Silver Phoenix, males and pullets available; $5/each. Darren Wilkes Demorest 706-768-2683
African, Buff geese; Crested, Pekin, Cayuga, 5-generations removed Mallard ducks; Australorp, Orpington, Buff Rock, Cemani, Bantams guineas. Douglas Williams Bluffton 229-3080925
Ameraucana, lay blue eggs, $20 each; guineafowl, 6 m/o, pen-raised, $15 each. Graham Thompson Danville 478-962-0668 478-308-1317
American Fantail pigeons, multi-colored, and young Ser. Bantam rooster; $5 each. David Patton Williamson 770-228-4415
Australorps, Orpingtons, Ameraucanas, Cochins, Brahmas, Silkies, chickens, chicks and hatching eggs, many colors to choose. Donna Harbosky Leesburg info@thunderingoaks.com 229-869-9995
Baby chicks: American Dominique, Rhode Island Red and Buff Orpington, purebred, various ages. Monte Poitevint Lakeland 229-482-3854
Baby chicks: Redbro, barred, tricolor, necked neck, color yield, can ship. Kathy Hales Chatsworth 706-8473646
Bantams, BB Reds, Silver Duckwing, Red Pyle; $10/pair. Bobby Owensby Nicholson 706-224-3284
Bantams, Gold and Silver Sebrights, Cochins and guineas. Gerald Hayes 4408 Sasser Rd Flowery Branch 30542 470-208-0309
Black roundhead eggs, leave a message; $50/dozen. David Kelle Arnoldsville 706-424-7325
Blue Copper Maran roosters, 072016 hatch, show quality, $25; Lavender Orpington roosters, 05-2016 hatch, show quality, $25. Harwood Dunn Tate 706-977-8431
Buff Orpington roosters. Charles Painter 116 Brown Circle Homer 30547 706-677-4019
Chickens, roosters and guineas; also have fresh eggs. John Kendrick Yatesville 706-741-1629
Drake duck, white adult. Ted Ridgeway Lexington 706-286-8874
Ducks: 1 y/o Metzer, 300 hybrid layers, 40 birds total, excellent health; $15 each/all. Bill Sheeler Jefferson atlantaradon@gmail.com 404-791-8163
French Black Copper Maran, Rhode Island Red, speckled Sussex hens, $15/each; roosters, $10/each; lavender guineas, $15/each. Lester Cook Milledgeville 478-456-1479
Gamefowl: Law Greys and Leipers, stags and cocks; no calls after 9 pm. Keith Vickery Royston 706-4366567

BERRIEN COUNTY Southern Grace FarmS Crops: strawberries 11946 Nashville Enigma Rd Enigma 31749 229.533.4314 10 a.m.-6 p.m. M-Sat 1 p.m.-5 p.m. Sun Containers provided
CHATHAM COUNTY ottawa FarmS Crops: strawberries 702 Bloomingdale Rd. Bloomingdale 31302 912.748.3035 8 a.m.-6 p.m. T-Sat 1 p.m.-6 p.m. Sun $2.75/lb. Containers provided Open mid-march
COFFEE COUNTY red Brick Farm Crops: strawberries 225 Lake Demie Lane Douglas 31533 912.381.7366 912.381.4667 Call ahead
EFFINGHAM COUNTY hodGeS Farm Crops: strawberries 8705 Hwy. 21 Newington 30446 912.754.7257 8:30 a.m. until, M-Sat 1 p.m.-6 p.m. Sun Open mid-March
FLOYD COUNTY LccL StrawBerry Farm Crops: strawberries 3743 Old Dalton Road Rome 30165 706.295.2587 8:30 a.m.-6p.m. M-F 8:30 a.m.-5 p.m. Sat 1 p.m.-5 p.m. Sun For availability: www.lcclstrawberryfarm.com

NEWTON COUNTY mitcham Farm Crops: strawberries 750 Macedonia Church Rd Oxford 30054 770.855.1530 9 a.m.-6 p.m. M-Sat 1 p.m.-5 p.m. Sun Follow us on Facebook
OCONEE COUNTY waShinGton FarmS Crops: strawberries 5691 Hog Mountain Road Bogart 30622 706.769.0627 www.washingtonfarms.net Follow us on Facebook for updates
SCREVEN COUNTY JacoBS Produce Crops: strawberries 2695 Scarboro Hwy. Rocky Ford 30455 912.863.7522 8 a.m.-6 p.m. M-Sat Containers furnished
TIFT COUNTY Berry Good FarmS Crops: strawberries 930 William Gibbs Road Tifton 31793 229.821.0746 9 a.m.-6 p.m. daily Call for availability
WALTON COUNTY waShinGton FarmS Crops: strawberries 270 Willowwind Drive Loganville 30052 770.554.8119 Follow us on Facebook for updates

When using the pick-your-own list, remember that the maturity of fruits and vegetables is directly influenced by the weather. The dates and availability provided on this list are approximate. For up-to-date information, detailed directions and hours of operation, call before visiting a pick-your-own farm.

PAGE 12

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Bulletin Calendar

Swedish Blue Isbar breeding trio, lay light green eggs; $50/trio. David Cobb Bishop 706-340-0931
Turkeys, Bourbon Red, Eastern Wild,

ALTERNATIVE LIVESTOCK

2016 Alicia Bermuda hay, UGA tested, square bales, horse quality. Danny Fausett Dawsonville 706-265-8432
2016 Alicia hay, cow quality, round

March 7 Northwest Georgia Row Crop Weed Control Update

Master Gardeners Volunteers of Central Georgia
Spring Home & Garden Show

Bronze, Spanish Black, free-range with If you have questions regarding this net-wrapped rolls; $40 each. Michael

pen roost. Ty Cowart Snellville 678- category, call 404-656-3722.

Joyner Perkins 30822 706-551-0217

481-9246

Baby emus, and fertilized emu eggs; 2016 Alicia horse quality hay, square

Olin Tatum Agricultural Building

Georgia National Fairgrounds

Turkeys, Heritage Slates, $50; Red also have adult emus. Louie Estep bales, no weeds, irrigated. Keith Yawn

320 W. Cherokee Ave. Cartersville, Ga. 30120 770.387.5142

McGill Market Building 401 Larry Walker Parkway Perry, Ga. 31069

Ranger meat chickens, 5-6 w/o, $12. Newnan 678-378-0686

Hazlehurst 912-375-7743

William Boyette Claxton 912-739- Beautiful silky black llama female cria, 2016 Bahia hay, square bales, excel-

0638

raised with cows/horses, will email/text lent quality. Keith Roberts Macon 478-

Auxin Herbicide Classroom Training April 21-22

Olin Tatum Ag Building

2nd Annual Georgia AgriScience &

320 W. Cherokee Ave. Cartersville, Ga. 30120

Outdoor Recreation Expo Jim Miller Park

770.387.5142

2245 Callaway Road

March 11

Marietta, Ga. 30008 678.376.9518 or 770.365.2593

Georgia Iris Society

www.gaurbanexpo.com

St. Bartholomew Episcopal Church

1790 Lavista Road

April 22

Atlanta, Ga. 30329

Help-a-Horse Day Teaser Event

404.202.3888

A.H. Stephens State Park Equine

Campground

March 14

456 Alexander St. NW

Auxin Herbicide Classroom Training Crawfordville, Ga. 30631

Elbert County Extension

770.905.7091

1088 Ruckersville Road

Elberton, Ga. 30635

April 29

706.283.2037

Help-a-Horse Day Grand Event

Walton Co. Ag and Ed Center

March 18

1208 Criswell Rd.

Wilkes County Young Farmer Equip- Monroe, Ga. 30655

ment Auction

770.905.7091

McGill-Woodruff Ag Center

U.S. Hwy. 78 By-pass

May 13

Washington, Ga. 30673

Marietta Gardeners Club

706.678.4044 (day)

Annual Plant Sale

706.285.2863 (night)

Marietta First United Methodist

Church

March 20

120 Loop & Polk Street Parking Lot

Georgia Peanut Commission's PB&J Marietta, Ga. 30064

Day at the Georgia Capitol

770.443.7675

South Wing

MariettaGardenersClub.jimbo.com

206 Washington Street SW

Atlanta, Ga. 30334

Have an event to put on our

calendar? Contact Amy Carter at

March 23-25

404.656.3722 or amy.carter@agr.

Master Gardeners of Central Geor-

georgia.gov

gia Spring Plant Sale

Macon State Farmers Market

We accept calendar submissions

2055 Eisenhower Parkway

for food, craft and agriculture

Macon, Ga. 31206

festivals and events. Submissions

for festivals that do not specifi-

March 24 Cover Crop Workshop

cally promote those industries will not be printed.

Gordon County Extension

1282 SR 53 Spur SW Calhoun, Ga. 30701

Additional pesticide recertification training notices are available on

706.629.8685

the Department website under the

Plant Industry Division tab.

April 7-8

Hall County Master Gardener Spring Livestock auctions listed in The

Garden Expo

Market Bulletin may offer related

Chicopee Woods Agricultural Center items for sale. Notices for auc-

1855 Calvary Church Road

tions selling any items other than

Gainesville, Ga. 30507

livestock must be accompanied

770.535.8291

by the auction license number of

HallMasterGardeners.com

the principal auctioneer or firm

conducting the auction, per state

regulations. Notices without this

information cannot be published.

Welsummer roosters, 10 m/o and photos; $500. Maureen Orr Jackson 214-1983 478-986-4118

Rhode Island Red hens; $15 each. celestial_labradoodles@yahoo.com 2016 Bermuda grass and peanut hay,

James Young Metter 912-682-2917 404-357-1553

4x5 net-wrapped, shelter stored. Hugh

White peafowl, males and females, Female emu, 8 m/o, hand-raised, Lightsey Bristol 912-240-0667 912-

2016 hatch. Denise Jaramillo Madison gentle, very loving; $400. Walter Lee 240-0877

706-818-3249

Cumming 706-429-8000

2016 Bermuda grass, excellent

White Silkie hens, $10/each; 2016 Georgia bison, 100% grassfed, 13 horse quality hay, fertilized, weed free,

purebred black Silkies, $20/pair; buff yearlings and 6 calves, Tantaka Hills square bales, can deliver. Mike Council

Silkies, $20/pair, extra roosters, $1. Farm; $5/lb. Derek Jolly Rocky Face Cordele 229-406-8105

Jack Jenkins Harlem 706-556-3261 706-397-2177 706-260-6338

2016 Bermuda hay, 4x5 net-wrapped

Poultry/Fowl Requiring Permit/License

bales, fertilized, excellent quality, barn
LIVESTOCK WANTED stored. Robert Mcnair 1426 Fox Run Rd Junction City 31812 706-575-5697

If you have questions regarding this category, call 404-656-3722.

If you have questions regarding ads in this category, call 404-656-3722.

2016 Bermuda, square bales, excellent quality, UAG tests by request,

Advertisers selling wood ducks must submit a USDA permit with their ad. Ads for wood ducks that do not have this permit will not be published. For information on these permits, call the US Fish & Wildlife Service Atlanta office at 404-679-7319. Advertisers

Any breed horses, goats and hogs, except pot-bellied pigs, will pick-up and pay cash. Wayne Green Bremen 770-841-6815
Bred Jersey cow or Jersey heifers, seeking 2-3. Matt Baxley Dearing 706829-1911

delivery available; $4 each/picked-up. Garrett Ganas Waycross 912-2883264
2016 Coastal Bermuda hay, horse quality, delivery available; $5 each/ at barn. Glenn Brinson 1800 Corsey Grove Way Tarrytown 30470 912-288-

selling quail must be accompanied by a copy of the commercial quail breeder's license. Ads for quail that

Piglets, preferably Yorkshire but will buy others, call or text. Nathan Umberger Dawsonville 706-807-9456

5960
2016 Coastal Bermuda, horse quality, fertilized to UGA specifications,

do not have this license will not be Will buy cheap emu chicks. Michael barned, square bales/4x5 round bales,

published. For information on these Phippen Newnan 770-755-8702

delivery available. Olin Trammell For-

LIVESTOCK HANDLING licenses, call the Georgia Department
of Natural Resources Wildlife Re-

syth 478-960-7239 478-994-6463 2016 Coastal Bermuda, horse quality,

sources Division at 770-918-6401. If If you have questions regarding ads in well-fertilized and limed, stored in trail-

you are faxing or mailing in an ad, the this category, call 404-656-3722.

er, not weather exposed; $75/round, or

permit/license needs to be sent along with it. For ads submitted online, the

16' bumper trailer; $1500. Jeff Taylor Byron 803-331-3146

$7/square. Rhonda Mccracken Newnan 770-328-9453

permit/license can be attached using the attachments button.
Bobwhite quail, flight birds, call for pricing and availability. Gabe Robinson Bowdon 770-258-4075 770-580-9702
Bobwhite quail, flight conditioned and weathered, delivery available; $3.65 each. Chris Scott Box Springs 229314-0222
Bobwhite quail, flight conditioned, now available for the 2016/2017 season, call for pricing. Rembert Hancock

16' gooseneck cattle trailer, dual-axle, new tires, good condition. Charles Mathis Nicholson 404-317-6173
Alleys, tubs/sweeps, panels, hay feeders, etc., in stock/built to your specifications, heavy-gauge tubing, we deliver. Randy Floyd Hartwell 706318-9468
Gooseneck cattle trailer, 20', new floor, new top, new wiring; $3000. Herbert Tante Buena Vista 229-3140867

2016 Coastal hay, sheltered, 200 lb. rolls, 100 available, horse quality, weed free, can load; $60/each. Gerald Scott Twin City 478-494-2880
2016 Fescue hay, 4x5 net-wrapped rolls; $45. Bob Pruitt Villa Rica 770445-2423
2016 Fescue, Bermuda and Bahia mix, horse quality, big bales, netwrapped; $60/inside, $45/outside. Coy Baker Loganville 770-466-4609
2016 first-cut Fescue rolls, 4x5 rolls,

Fairmount 404-376-0550 706-3375711
Bobwhite quail, fully feathered and

Wanted: Someone to move 3 horses about 10-15 miles in Winder, GA. Diane Hobbs Hoschton dahobbs52@gmail.

barn stored, delivery available; $60. Jason Strickland Watkinsville 706340-7225

flight-conditioned, table birds, taking com 404-754-8992

2016 high performance, UGA tested,

orders for eggs and chicks. Mickey

Alicia/Russell hay, round/square, shel-

Cash Toccoa 706-491-7081 Bobwhite/Coturnix quail eggs:

RABBITS

tered, delivery available, PBI Farms. Heath Pittman Vidalia 912-537-9721

$70/100, $155/500, $290/1000. Willie If you have questions regarding ads in 2016 millet hay, round bales; $40

Strickland Pooler 912-748-5769

this category, call 404-656-3722.

each. Alan Mobley Griffin 770-560-

Poultry/Fowl Wanted

Lionhead/chinchilla cross and chin- 3441 chilla/Flemish cross; $10 each. Kate- 2016 mixed hay, square bale; $3

12 maximum wanted, assorted fe- lynn Struve Dawsonville 706-974- each/at barn. Hugh Weaver Wood-

male day-old baby chicks, Arcana, Ar- 9661

stock 678-445-3628

aucana Leghorn, Minorca, Polish and New Zealand pedigreed rabbits, vari- 2016 Russell Bermuda (squares),

Plymouth Rock. Shari Martin Roswell ous colors for meat, breeding, fur show horse-quality only; 500 bales available.

Guinea breeder pairs, $25/pearls; also have two chicken roosters, $5 each. Annette Combs Hephzibah 706592-1030

Old English Bantams, black, barred, Brassy Back, Silver Duckwing and Spangles. Mitch Pohlel Loganville 770-464-5052

678-596-4111
Bantam buff Cochin chicks, 6 hens and 1 rooster, Jackson County area, call/text. Anna Jarrett Commerce 706-

or pets, call for more information. Roger Bonds Alpharetta 770-356-9541
San Juan or Redback rabbits, purebred, near GA/FL line and Hwy 75/10.

Carl Crews Newington 30446 843696-9111
2016 Russell hay, net-wrapped, 4x5.5 rolls. Leslie Jones Jacksonville 229-

Guineas, 6-9 m/o, lavender porcelain and pied; $10/each, or $8 each/10+. Wyndle Bates Blue Ridge 706-632-

Peacocks, blue pair, male and female, 1 y/o; $150. Roy Hall Macon 478-8089128

202-8093
Barred Plymouth Rock rooster and New Hampshire hens, must be pure-

Harrell Whitener Coosa harrellwhitener@yahoo.com 386-330-0335
Silver Fox, $15; California mixed, $10;

860-1277
40 bales of Bermuda hay, weed free, in barn; $5 each. K. Morris Barnesville

7584

Pekin ducks, 9 males and 3 females, bred. Cleon Couey Dublin 478-279- whole litters with deposit, $75. Grace 770-358-6800

FEED, HAY AND GRAIN Heavy breed laying hens, 5 m/o-2
y/o; $25/each firm. Donald Allen 3647 Spain Rd Snellville 30039 404-5787758
Kearney Whitehackle, Bill Roberts butchers, Lacy Roundheads/many crosses, Brown Red OEB, Sid Taylor, Red Quill, Grays/Hatch. C. Callihan Cleveland 706-809-9786 706-2193680
Laying hens, 2 Rhode Island Reds, hatched 03/2016; $15 each. Imogene Nash Lilburn 770-931-7977
Laying hens, mixed breeds. Douglas Capps Comer 770-490-5537

purebred; $10 each. Mary Kent 88 Sam Hill Rd Sparta 31087 706-444-5017
Production reds, 10 m/o, $8 each; 2 Marana, 2.5 y/o, $1/both. Robert Burt Atlanta 404-284-4249
Rhode Island Red pullets, and Golden Comets, good quality birds. Brian Sturdy Dahlonega 706-865-9201
Ringneck pheasants, $30 each; blue or black Sumatras, $75/pair; Thai gamefowl, $120/pair. Vladimir Polumin Duluth 678-907-5744
RIR, Ameraucana, Brahma, Australorps, Sussex; $15/laying, or $1/babies. Gary Ridley La Fayette 706-638-1911
Saxony ducks, 5 males, 2 females;

4508
Looking for fertile eggs, close to Cobb County, email is preferred or may text. Ali Faisal Marietta alifaisal01@gmail. com 404-432-8110
New Hampshire Red hens, prefer laying hens or pullets. Cleon Couey Dublin 478-279-4508
Peacocks, blue. Troy Crumbley Mcdonough 770-328-4403
Phoenix roosters and hens. Terry Mchone Oakfield 229-881-5320
Purebred Americana rooster, reasonably priced, will pick up, please text pictures. Allen Glazier Blairsville 706970-7756

Walsh Jonesboro 404-307-8113
If you have questions regarding ads in this category, call 404-656-3722.
All feed, hay and grain ads must include the variety offered for sale. Ads for mulch hay will not be accepted in this category; they will be published in the Fertilizers & Mulches category.
100 bales, 4x5 net-wrapped rolls of peanut hay, under barn, $45 each; 4x5 rolls of grass hay. Walt Dockery Broxton 912-359-3153
100% pure alfalfa, square bales,

4x5 net-wrapped rolls of Russell Bermuda hay, in barn, fertilized; $40 each. Wayne Bartley West Point 706-8823250
4x5.5 net-wrapped Bermuda grass JD round bales, top quality, weed freed, in barn, delivery available; $75. Josh Pennino Sparta 706-340-3146
50 square bales of 2016 rye hay, excellent quality; $6 each. Laurel Whitmire Bishop 706-207-4336
Alfalfa, 4x5 round bales, 1200 lbs. average, call for pricing. Roy Embry Eatonton 706-485-9848
Alfalfa/Orchard and pure Alfalfa, Timothy mix, mid-western hay, 2-string/

Laying hens, Pearl Whites, no calls after 9 pm please; $9 each. William Edes Elko 478-952-7381

$14 each. Wayne Niemeyer Morganton 706-374-5111
Selling out, show quality OE Blacks,

Silkies near me. Margaret Crosby Brunswick 912-265-2438
White Carneau pigeons, I would pre-

stored in barn; $16.50 each. Robert Lujan Moreland 770-328-9876
15 rolls of Bermuda mix hay, 4x5 rolls,

compressed, high quality, analysis, pick-up/delivery. Larry Jones 1273 Smithonia Colbert Rd Colbert 30628

Muscovy ducks; $8 each. Hubert Ar- Blues, Splash, Blue Brassy Back, BB fer descendants of birds I sold in the stored in barn; $55 each. David Chad- 706-621-1037

nold Jeffersonville 478-945-3910

Red, Columbian, Sports, Opals, oth- MB 5+ years ago. Jerry Williamson wick Waleska 404-386-8194

Alicia Bermuda hay, sheltered; $50

Mute swan, white, very friendly. Sonia ers. Randy Shoemake Carrollton 678- Dexter 478-875-3158

2015 Bermuda hay, 500 bales avail- each. Andy Parker Hartsfield 229-

Mesry Suwanee 678-525-8883

796-9222

able, delivery available; $5 each/at 891-6553

OE Bantams from show stock: BB Strait run chicks, Dominique, dark

barn. Al Guillebeau Monroe, 770-267- Beautiful Alicia/Bermuda square

Reds, Splash, Blacks, Brassy Backs, RIRs, Naked Necks, Lavender Orping-

Opals, Fawns and Silver Duckwings. ton, others, $1.50/each; true Arauca-

William Mcburnett Tyrone 770-487- nas wanted. Seth Weaver Ellijay 706-

2233

889-7291

8929

bales, wholesale/retail pricing, will de-

2016 Alfalfa hay, square bales; $10 liver statewide to drop box trailer for

each. L.D. Carver Jasper 770-735- high volume customers. Matt Shirley

3432

Commerce 706-983-0276

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 13

Bird seed, brown-top millet, 50 lb. bags; $10 each. Ed Burrell Monticello 706-476-0021
Cattle hay, under roof, $60 each; Alicia/Bermuda hay, under roof, $75 each. Alan Mobley Griffin 770-560-3441
Coastal, Alicia and Cheyenne, rain free, stored in field; $50/4x5 rolls, or $65/4x6 rolls. Nathan Goering Keysville 706-551-2475
Cow or goat quality hay only, Timothy/Orchard grass square bales, stored in barn; $3 each. James Bassett Loganville southwindstables@msn.com 770-761-1591
Feed oats, bulk only, bright color. John Bullington Cordele 229-2733597
Hay: $85/round; $4.50/square. Rick Anderson Taylorsville 404-402-8470
Hay: 2016 Alicia Bermuda, highly fertilized, horse quality square bales; $5 each. A. Johns Bronwood 229-3433627
Horse quality Bermuda hay, 5x5 rolls; $60 each. Jack Thompson Senoia 770-283-9345
Large quantity of round and square Bermuda hay; also have round peanut hay. Paul Harris Blackshear 912-6700222
Regular large volume whole corn/ grain stillage, available for feed, must pick-up; $1. Bobby Rohla Savannah 912-298-1075
Wheat straw, 2016 square bales, very clean, stored in barn; $3.50 each. A.G. Morehouse Mansfield 678-618-2148
Wheat straw, small square bales, quantity discounts, $4/each; also have 4x6 round bales. Wendell Unruh Louisville, 706-833-0074
Wheat straw; $3.50 each. Wade Whitaker Rutledge 706-318-4526
Whole shelled and hammered yellow corn, 40 lb. bags; $6/bag. Janie Willis Dahlonega 706-867-5177
Feed, Hay and Grain Wanted
Straw bales sought for straw bale gardening, within 50 miles. J.O. Jones Valdosta 229-455-2058
AG SEED FOR SALE
If you have questions regarding this category, call 404-656-3722.
Advertisers must submit a current state laboratory report, fewer than nine months old, for purity, noxious weeds and germination for each seed lot advertised. Ads submitted without this information will not be published. If you are faxing or mailing in an ad, this report needs to be sent along with it. For ads submitted online, the report can be attached using the attachments button. Seed lots must be uniform and cannot exceed 400 50-pound bags. Certain varieties of seed are protected from propagation unless they are grown as a class of certified seed. These include Florida 304, Coker 9152, Coker 9835, 6738 soybean, Haskell, Bennings and others. For questions regarding certified seed, call the Department's Seed Division at 404-656-3635.
Bermuda grasses, Coastal, Tift 85 and Tift 44, as well as available custom planting. Chester Kight 5551 Old Louisville Rd Tarrytown 30470 478290-5558
Cream 12-pea seed, 89% germination, 50 lb. bags; $80 each. Emory Harrison Whigham 229-221-8170 229221-8116
Italian pepper seeds, Corno Dr. Gordo, sweet, mild, wonderful; $1/25 seeds + SASE. Roberta Watts 2252 Whitney Rd Se Monroe 30655 770464-1979
Non-certified Tifton 9 Bahia grass seed, germination over 80%. James Gaston Americus gaston7460@bellsouth.net 229-924-7460 229-938-9115
Old-timey cowhorn pepper, red Peter pepper, cayenne pepper, German pink tomato; $1 + SASE. Amory Hall 130 Ellison St Maysville 30558 706-6522521
Rooster Spur, old-timey cayenne seeds, 25+ seeds; $2 + SASE. Terry Madaris 2017 Cloud Springs Road Rossville 30741 423-883-7264
Tall Fescue turf blend seed, 50 lb. bags, 2 available, certified 0% weeds; $60/bag. Ronald Harris Ball Ground 770-479-0590

Velvet bean seed; $20/lb. + postage. Mack Chambers Uvalda 912-2236743
Ag Plants for Sale
Angel trumpets, yellow and pink, rose of Sharon, Confederate roses; $9-$12 each. Paul Chernutan White 678-3866760
Brown Turkey figs, mulberries, $5; self-pollinating Issai kiwi, $6; sweet shrub, $3; dewberries, $2; no shipping available. Carla Houghton Marietta 770-428-2227
Pecan trees: Grafted and seedling, growing in 3-gallon pots, Desirable, Stuart and Elliott, 2'-3'T. Jimmy Crum Bainbridge 229-220-3907
Seed cane, call for more details. Ray Freeman Dublin 478-272-1307
Tift 85 and Russell Bermuda sprigs, with custom planting available. Alton White Dry Branch 478-214-1197
Ag Seed/Plants Wanted
A cup of cut short or creaseback bean seeds, reasonably priced, will pay shipping, leave message. Ginger Marine Ellijay 704-273-1128
Old-fashioned deutzia shrub. Anna Evans Griffin annaevans280@gmail. com 770-229-1210
FLOWERS AND ORNAMENTALS
FOR SALE
If you have questions about this category, call 404-656-3722.
16 Crystal White miniature Zinnias, 25 seeds; $3/cash + SASE. Donna Miltimore 1766 Pleasant Hill Rd Ne Ranger 30734
350 varieties of 4" perennials including helleborus, $1.50 each; 1-gallon grafted Japanese maples, $20-$25; display garden. Selah Ahlstrom Jackson 770-775-4967
Achimenes, a.k.a. Widow's Tears, order now for April shipping. Evie Bowker Griffin 770-530-1708
Azaleas, large growing, 1-gallon pots, all colors; $2.50 each. Jack Maffett Montezuma 478-954-2111 478-4727133
Cleome, Mexican sunflower, Shasta daisy, four-o-clock, touch-me-not, money plant; $1/each + large SASE. B.L. Savage 3017 Atkins Dr Gainesville 30507
Cosmo seeds, tall variety, 6' not unusual, 60+ seeds; $1 + SASE. Ira Bray 70 Wilkes Ct Newnan 30263 770-2530693
Four-o-clock, mixed, tall, old-fashioned, or old-fashioned Rose of Sharon; $2/teaspoon + SASE. Mary Pursley 253 Ryan Rd Winder 30680
Japanese maples, grafted, many varieties and sizes to choose, Weeping red and green colors. James Veccie Senoia jveccie@yahoo.com 770-6526127
Loofah gourd seeds, cash only: $3/25 seeds; $10/100 seeds + SASE. Joy Shelnutt Loganville 678-345-8400
Luffa sponge seeds, 40 seeds; $3 + SASE. W B Mattox 696 Water Works Rd Crawford 30630 706-743-8942
Milk and wine lilies, all sizes, you dig; $2-$5. Brenda Gooch Jefferson 706367-5757
Old time castor oil bean plant seeds, baker's dozen; $2 + SASE. Brent Nichols Brunswick 912-266-5688
Pindo palms 1-7-gallon pots; large and small aloe plants; also have herbs. Vicky Washburn 124 Castleberry Loop Forsyth 31029 circlewplants@gmail. com 478-994-4334
Ponderosa lemon seeds, confederate rose, Texas star, helleborous seeds, beauty berry, butterfly weed, pindo palms. Pamela Hornsby Thomaston 706-975-3712
Poppies, swamp lilies, t. cosmos, amaryllis, zinnia, butterfly weed, hibiscus, call before 10 pm; $2/packet + SASE. Gerri Ward Attapulgus 229-465-3641
Privacy trees: Leyland Cypress, Thuja Green Giants, we deliver and plant statewide; buy 5, get 1 free. John Cowherd Monticello 770-862-7442
Red Spider lily bulbs, $5/dozen + postage; gourd seed, short/long neck, $.25-cents/each + SASE. Clifton Sapp 6620 Nine Run Rd Screven 31560

Reseeding petunias, mixed; Angel All bees: Will pick up swarms for free;

trumpet, double-purple or double-yel- seeking new locations to keep bees;

low; $1/pack + SASE. Carolyn Arnold Russian-hybrid NUCs, $150. David

644 Lynn Ave Jefferson 30549 706- Larson Mitchell 770-542-9546

367-4700

Bee removal, work guaranteed, Metro

Saw-Tooth oak seedlings, 3'T, ready Atlanta and West Georgia areas. W.O.

for planting; $2 each. Jerome Bunn Canady Villa Rica 770-942-3887

Forsyth 478-954-9044

Bees/Supplies: NUCs, 5/8/10-frame

Seeds: Foxglove, poppy, sweet Wil- equipment, veils, gloves, tools, more;

liam, money plant, Cypress vine, may- swarms: Buford, Flowery Branch, Oak-

pop; $1/pack + SASE. Sara O'shields wood, Suwanee, Winder; honey. Har-

40 Cameron Way Tate 30177

old Lanier Buford harold@lanierbee-

Small Leyland Cypress trees, 8"-12" barn.com 678-471-7758

tall, will ship, see website for ordering; Carpenter bee traps: I make traps

$4 each. Hans Gruetzenbach Dalton to catch them, 5 per order; $85/5

www.MuscadinesAndMore.com 706- shipped. William Timmerman Harlem

483-4221

803-640-6265 706-799-5311

Staghorn fern, 20 y/o; $50. Tony Coo- Carpenter bee traps; $10/each,

per Moultrie 229-985-1970

$25/3; shipping is extra. Billy Middle-

Thuja green giant and Carolina Sap- brooks Monroe 770-267-7084

phire privacy trees, 3-gallons, 3.5'-4' Free removal of bee swarms on/near

tall; $14. Kelly Wilson Griffin 770-365- the ground; will remove unwanted bee

1530

hives, east of Atlanta. Robert Pruden

Flowers and Ornamentals Wanted

Monroe 770-466-9100
Free removal of low hanging honey bee swarms, structural removal of

Plants or seeds of the Franklinia tree, bees for a fee, Rockdale area. Ronald

also seeking seeds of Stokesia Myrtle. Johnson Conyers 678-357-1814

Robert Russell Bonaire 478-923-1951 Free swarm removal, remove unwant-

ed bees from a structure for a fee; want
MISCELLANEOUS bee equipment, pick up. Leonard Day

Macon 478-719-5588

If you have questions regarding ads in Gallberry, voted best-tasting honey in

this category, call 404-656-3722.

Georgia; $52/gallon, includes shipping.

Freshly cut solid black walnut stump, Ben Bruce Homerville www.bruces-

20" diameter, 15" dark center. Denver nutnhoney.com 912-487-5001

Davis Fayetteville 404-903-6228 770- Honey bee 5-frame NUCs, $150;

461-8246

8-frame hives, $220; must pick-up.

Hardback blueberry cookbook with Rich Apiaries Cobbtown jimmyr@

150 recipes, order online; $18/each, pineland.net 912-426-9099 912-684-

includes shipping. Joe Kilpatrick La 3774

Fayette www.theblueberryfarm.com Honey bee NUCs, pick-up only, ready

423-301-2717

04/01/17; $150. William Craft Elberton

Kero Sun portable oil heater, 23,000 864-617-7630

BTU, new; $85. R.F. Pollard Kennesaw Honey bee NUCs: $160/your box;

770-427-1201

$195/our 3/4 Advantech box; $135/

Miscellaneous Wanted

packages. D. Haught Chatsworth

www.barnyardbees.com 706-508-

Antique sewing machine stand legs, 2257

in my area. Johnny Lancaster Loganville 770-394-2946

Honey extractor, stainless, 19-frame, new and used hive bodies, lots of su-

Equipment trailer, at least 8'Wx18'- pers with frames, all must go. James

20'L, tandem-axle, bumper-pull style. Perry Rome jperry3434@comcast.net

Dan Harrell Eastman 478-231-8321 706-346-6795

478-374-4716

Honey in bulk: $125/2.5-gallons;

Manual platform beam feed scale, $230/5-gallons. Jan Wooton Canton

Fairbanks, Toledo, etc., 500-1000 lb. jmwooto@gmail.com 404-422-6952

capacity. Ken 243-9750

Parker

Smyrna

678-

Honey, PTS wildflower, $65/case; 35-gallon heated sump tank, $600;

Museum seeking pre-1920 wood beeswax, $4.50/lb. Gary Gailey Cleve-

cook stove, repair or refurbish, low land 678-316-9791

cost or donation, contact Historic Italian bees, NE Georgia, 5-Frame

Westville. Leo 706-940-0057

Goodsell

Columbus

NUCs, 3 lb. packages, 2017 spring queens, pick-up only, order online.

Syrup kettle, good condition, any Slade Jarrett Baldwin www.jarrett-

size, will pay reasonable price and pick bees.com 706-677-2854

up. H.J. Hine Conyers 404-310-6490 Pure all-natural unprocessed honey:

Wanted: Whiskey barrels. Gene Gay quart, $14; pint, $8; 8 oz. bear, $5.

275 Gene Gay Rd Leslie 31764 229- Jimmy Brown Jackson 770-775-0157

853-2713

Sweet honey combs. Brandon Co-

Bees, Honey & Supplies thran Lavonia 706-680-4938

10-frame bee hive, $85; 5-frame bee hive, $65; also make inner covers, supers, top bar bee hives. Eliseo Delia Mineral Bluff 706-492-5119
100+ NUCs, $120; less than 100 NUCs, $160/my box or $150/your box; permitted plan bee farm. Mike Wilingham Taylorsville popeanyoung@aol. com 770-891-1943

Taking orders for spring: $100/packages, $170/NUCs; complete line of beekeeping equipment. Bill Posey Cartersville billsbeefarm@yahoo.com 770-595-9332
Used brood boxes, $64; supers, $23; with frames, each piece cleaned, repaired and painted. Bill Slack La Fayette 706-638-3791

3 lb. package of bees, late March

Things To Eat

pick-up, $125; May NUCs, $175; queens, $30; tons of supplies. David Mcdaniel Rome 706-234-6585
5-frame and queen NUCs, $150; queens, $35; 10-frame and queen hive, $325; taking orders. Jimmy Webb Elberton webbbeefarms@gmail.com 706-340-8362
5-frame NUCs, $160; complete, empty hives, $80; 50 new metal telescope lids, etc., closed Saturdays. Edward Colston Taylorsville 770-382-9619
5-frame NUCs, 2017 queens, pick-up only, weather dependent late March-

Advertisers submitting ads using the term "organic" require Certified Organic registration with the Georgia Department of Agriculture. Ads submitted without this registration will not be published. If you are faxing or mailing in an ad, the registration needs to be sent along with it. For ads submitted online, the registration can be attached using the attachments button. For information on this registration, call the Organic Program Manager at 706-595-3408.

April delivery, call to reserve; $150. Phil 2016 black walnuts, $20/lb. + post-

Swindell Ludowici 912-320-7324

age. Jeanette Cole 119 Old Millertown

5-frame NUCs. Caleb Lachmann Rd Temple 30179 770-459-4970

Blue Ridge www.mountainmanbees. 2016 Desirable pecans, $11/lb. +

com 706-851-8639 706-851-8639

postage; will crack, shell and separate

500 spring singles, spring NUCs, packages, queens and honey. Bob Bin-

your pecans, $.50-cents/lb. Russell Eaton Stockbridge 770-506-2727

nie Lakemont bobbinnie@blueridge- 2016 frozen blueberries/blackber-

honeycompany.com 706-782-6722 ries, $4.99/lb.; shelled pecans, $7.99/

Albany/SW Georgia, complete bee lb.; call for shipping expense, 1-day

removal, also hornets, wasps and yel- delivery in Styrofoam box. Davis Yaun

low jackets, licensed and insured. Dale Soperton dayaun@gmail.com 912-

Richter Leesburg 229-886-7663

399-1988

is proud to welcome these new members:
Silver Level Allqua Water AllquaWater.com Atlanta, Ga.
Florida Georgia Citrus GeorgiaGrown.com Monticello, Fla.
The Fritz Farm TheFritzFarm.com Cordele, Ga.
The Georgia Zoo & Safari Park GeorgiaGrown.com Madison, Ga.
and these returning members:
Platinum Level Premium Peanut PremiumPnut.com Douglas, Ga.
Gold Level Southern Valley SouthernValley.us Norman Park, Ga.
Silver Level New Era Olive Farm GeorgiaGrown.com Americus, Ga.
Georgia Grown is a marketing and economic development program of the Georgia Department of Agriculture. For more information or to join, visit GeorgiaGrown.com or call 404.656.3680.
2016 pecans, in the shell; $5/lb. + shipping. Charles Sawyer Mount Airy 706-768-4776
2016 pecans, shelled and cleaned; $9/lb. + shipping. Peggy Griffin Clarkesville 706-768-8417
2016 shelled pecan halves; $9/lb. + shipping. Jesse Bailey 7198 Ga Highway 24 W Louisville 30434 706-3605169
2017 shelled pecans, mostly halves, bagged in freezer, leave message; $9/ quart + postage. Frank Eaton 4441 Bethany Rd Buckhead 30625 706342-0727
All natural Black Angus beef, grassfed/grain-finished, sold by the whole, half or quarter. David Sharpton Commerce 706-367-0876
Cane syrup, call for more information. Howard Burnette Mershon 912-2880091
Farm fresh brown eggs, gathered daily, room temperature stored, never held longer than 3 days; $4/dozen. Joseph Durante Alpharetta 305-318-2337
Farm fresh eggs; $5/dozen. Bill Mcmahan Lula 770-869-7132 770-5406667
Free-range pork, GMO free, ready in April, price doesn't include processing fees; $3.99/lb. hanging weight. J. Mooney Midville 478-589-7645
Fresh eggs, free-range, large/jumbo brown eggs, quantity discounts; $4/ dozen. Julie And Jim Souter Milledgeville 478-454-6679
Grain-finished Angus beef, sides, quarters; $3.50/lb. hanging weight. Jason Cox Social Circle 404-9255412
Marview Farms provides grassfed/ pastured beef, pork, lamb and goat; also pastured, free-range eggs and pecans. Fernando Mendez Arabi www.marviewfarms.com 305-9894647

PAGE 14

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Pasture-raised, all-natural, custom All fish species, bluegill, shad, crap- Aged horse manure, very few shavprocessed beef, taking orders for fall pie, shellcracker, minnows, shiners, ings, great for gardens, you load and

Oddities

Fully seasoned oak firewood, delivery available: $100/half-cord, $200/full-

2017, whole/half/quarter; also have catfish, pond surveys, aeration, feed- haul; $1. Jim Campbell Monroe 770- Gourds: Close-out sale due to health, cord; hickory/pecan BBQ wood, $60/

eggs Gloria Malcom Social Circle ers, vegetation control/consultation. 617-2912

call before coming, any size/number; quarter-cord. Bob Lewis Fayetteville

770-464-4303

Ethan Edge Lumber City 912-602- Chicken litter, delivered and spread $2. Thelma Moon 3226 Hoot Owl Rd 770-461-4083

Pawnee large pecans, halves or piec- 1310

in the middle Georgia area, minimum Royston 30662 706-245-4218

Oak, split wood, pre-seasoned, no

es; $10/lb. + shipping. Roy Bramblett Morven 770-548-0206

All size bass, bluegill, channel catfish, threadfin, gizzard shad, shell cracker

of 25-tons. Tommy Copelan Eatonton 706-473-0087

Lucky buckeyes, $.25/dozen; planting buckeyes, $5.25/dozen; instruc-

delivery, great price. David Ulfik Oxford 470-891-1853

Pecans and free-range eggs. Joe Clark 508 Mauldin Rd Thomaston 30286 706-975-1096
Premium pure cane syrup, three 25 oz. bottles shipped anywhere; $42/ all (includes shipping). Ben Parrish Statesboro ben@benparrish.net 912536-2200
Sugarcane syrup, no additives, no preservatives, $9/25.4 fl.oz., or $6/12.7 fl.oz.; certified organic sugarcane syrup, $10/12.7 fl.oz. Mickey Morris Odum 912-586-2241
Sugarcane syrup, pure premium quality, three 25.6 ounce bottles, shipped anywhere in the USA; $42/3. Ben Parrish Statesboro ben@benparrish.net 912-536-2200
Water-ground meal, whole wheat flour, grits, will also grind your grain;

and more; free delivery or pickup. Danny Austin Roberta 478-836-4938
All sizes catfish. minnows, shiners, bluegill, shellcracker, sterile carp, crappie, feeders, threadfin shad, aeration, consulting services. Keith Edge Soperton 478-697-8994
All sizes grass carp, channel catfish, bluegill, shellcracker and red-breast bream, delivery available. Brian Simmons Hawkinsville 478-892-3144
Bass, bluegill, hybrid bream, channel catfish and sterile grass carp. David Cochran Ellijay 706-889-8113
First class Big Reds, $35/lb.; Red Wigglers, $25/lb.; worm castings $1 + shipping (not included). Lew Bush Byron bigreds1@cox.net 478-955-4780
Fresh worm castings, extra microbes, best in GA, pick-up in Acworth or Cumming; $5/gallon. Shane Jones

Clean rabbit manure, no shavings, 40+ lb. bags, leave name and number. Louis Tompkins Danielsville 706-7892414
Compost horse manure and shavings; $1/as much as you want. Jerry Riles Douglasville 770-337-1516
Cow manure, have Bobcat to load, great all-purpose fertilizer; priced based on quantity taken. Scotty Ingram Ballground 770-596-7718
Horse manure with shavings, easy access, you load/haul, Bobcats loaders welcome; $1/as much as you want. Billy Burke Covington 770-8614574
Horse manure/shavings, for composting, from Little Creek Farm. Tamara Dillard Decatur www.littlecreekfarmconservancy.org 404-3991750

tions included, please include postage. Jules Simmons 495 Royal Oaks Ter Stone Mountain 30087 828-2264700
Martin gourds, plain or fixed, ready to hang, other varieties, at farm or will ship. Crystal Lang Cordele 229-3221321
Variety of gourds, dried since summer 2015; $2 each. Dean Fletcher Canton 678-472-3035
Notices
Plains Farmers Market and Trash Treasure, Plains City Park, May 20-Oct. 14, Saturdays, 7 am-1 pm. Henry Coleman Plains sam@sowega.net 706897-9870
Out-Of-State Wanted
Ag seed, Candy Roaster winter

Seasoned and split hardwood, 18"L, you pick up; $60/short-bed pick-up truck load. Larry Barber 168 Jim Turner Rd West Point 31833 706-884-3430
Split oak firewood: $60 picked-up/ shortbed truck, 40% cord, or $75/delivered within 20 miles; $175/full-cord, delivered. Daniel Dollar East Dublin 478-278-7352
Timber
Timber must be individually owned and produced by the advertiser on his personal property. No companies or businesses are allowed to advertise timberland in this category. Timberland advertised must be at least one acre. Timber wanted ads will not be published.
3+ acres of standing cedar timber. Fred Johnson Pelham 229-403-0493
Hardwoods and pines, plenty avail-

$5/5 lbs. + postage. Mike Buckner Junction City 706-269-3630

Cumming 404-964-7534 Grass carp, bluegill and shellcracker

Long leaf pine straw, delivery and installation, also semi-trailer loads avail-

squash, in North GA. Larry Brandon Murfreesboro TN 615-618-0541

able, must pick up. David Blum Stockbridge 770-922-4217

CORRECTIONS We machine shell your pecans while
you wait; $.30-cents/lb. Jody Glidewell Jackson 770-775-6592

bream, channel catfish fingerlings, bass, fathead minnows, delivery/pickup, by appointment only. Robert Brown

able. Joshua Bulloch Manchester 404-925-1076
Pine straw, delivery extra; $2 each/

Good, usable 12' corral panels wanted to make a 50'-60' round pen, leave message. Roger Missildine Fort

Huge poplar trees, you cut. Vickie Hogan Clarkesville 706-768-5441

Fish & Supplies

Brooks 770-719-8039

at farm. Donald Akins 1122 Jim Rowe Mitchell AL 478-494-1575

Advertisers selling sterile triploid grass carp must submit a current Wild Animal License from the Georgia Department of Natural Resources. Ads submitted without this
We eat license will not be published. If you
are faxing or mailing in an ad, the license needs to be sent along with it. For ads submitted online, the license can be attached using the attachments button. For license information, call 770-761-3044.
AI quality farm grown channel catfish fingerlings, graded/priced by size, ac-
FOR BREAKFAST, curate weights/counts, guaranteed live
and healthy. J.F. Gilbert Thomaston
LUNCH AND DINNER. 706-648-2062 770-468-0725

Trout, good stocking quality, various sizes, hatched and farm-raised, delivery available. David Cantrell Ellijay 706-273-6199
Fertilizers & Mulches
2016 wheat straw, delivery available; $3 each/at barn. Gary Brinson 6786 Old Louisville Rd Tarrytown 30470 912-286-3191
Aged garden compost, horse manure/shavings, we load, by appointment; $5/small truck, or $10/full-size truck. Charlene Cook Fort Valley 478825-1981
Aged horse manure mixed with shavings, can load with tractor; $1. Monti Hight Macon 478-960-2008

Hightower Rd Collins 30421 dakins@ windstream.net 912-557-4616 912245-9837
Pine straw; $3 each/at farm. Randall Lynch Gay 706-538-6347 404-5977259
Worm castings: $25/50 lbs.; $14/25 lbs.; $15/gallon worm tea. Aron Walsh Jonesboro 404-307-8113
Poultry Litter/Compost
Poultry litter, we load and you haul; $3/yard. Kenneth Mallonee Winterville 706-202-5375
Wanted: Compost and clean fill dirt. Mohammed Shoaib 140 Forest Lake Drive Fayetteville 30215 770-4606335

Multiplying onion sets. Jason Gore Trenton FL 352-535-5404
Seeking sugar cane stalks, on a monthly basis, for fresh cane juice planting, call/text. Gary Pancholi Cary NC 919-525-0585
Firewood
Firewood must be cut from the advertiser's personal property. Ads for firewood must use the cord when specifying the amount of firewood for sale.
Firewood/smoker wood, pecan, cherry, hickory, oak, pick-up or delivery. Tommy Phillips Jefferson 706-3624872

2 Limousin bull calves, 5 m/o and 7 m/o, 400-500 lbs., both back polled; $900-$950. L.C. Lairsey Waycross 912-285-5149

Snapshot: Cherries were a popular crop in 1917

Continued From Page 1

(2,025 acres). A little less than 6,500 acres were devoted to growing rice, a crop said to have been brought to the south from Africa by enslaved workers.
Peaches, nectarines, apples and pecans topped the list of Georgia-grown fruits. The state's orchards were filled with 10.6 million peach and nectarine trees, 1.9 million apple trees, 357,323 plum and prune trees, 277,658 grape vines, 262,982 pear trees and 49,424 fig trees. Much less common today, 18,465 quince trees and 50,723 cherry trees were also planted across the state.
Just 75,519 pecan trees were grown in Georgia at the time. (Pecans are now among the top 10 commodities by value. Georgia has ranked first in pecan production nationwide for the past 20 years.)
Georgia poultry farmers raised 244,453 chickens. They also raised turkeys, ducks, geese, guinea fowl, pigeons and peafowls. They produced 18 million dozen of eggs. Farmers sold an average of 6.1 million dozen of eggs. Farmers of the time relied on their food crops to feed their families and also bartered with their crops.
Dairy farmers in Georgia produced 75 million gallons of milk and sold 3.9 million gallons. They produced 97,564 gallons of cream, 17,286 pounds of butter fat, 27 million pounds of butter and 399 pounds of cheese. Excluding what was

kept for home use, dairy products at the time were valued at $6.7 million.
Aside from work stock, hogs were the most valuable livestock. Of livestock sold or slaughtered, 97,060 were swine and 211,562 were cattle.
-Sharon Dowdy is a news editor with the University of Georgia College of Agricultural and Environmental Sciences.
2015 Georgia Agricultural Commodity Rankings:
1. Broilers. . . . . . . . . . . . . . . . $4.4 billion 2. Eggs. . . . . . . . . . . . . . . . . $937 million 3. Beef. . . . . . . . . . . . . . . . . $923 million 4. Cotton . . . . . . . . . . . . . . . . $713 million 5. Peanuts. . . . . . . . . . . . . . $684 million 6. Timber. . . . . . . . . . . . . . . $681 million 8. Dairy . . . . . . . . . . . . . . . . $407 million 9. Pecans. . . . . . . . . . . . . . . $361 million 11. Blueberries. . . . . . . . . . . $255 million 12. Corn. . . . . . . . . . . . . . . . $252 million 13. Hay. . . . . . . . . . . . . . . . . $218 million 16. Onions . . . . . . . . . . . . . . $149 million 20. Soybeans. . . . . . . . . . . . $128 million
-Sources: U.S. Census of Agriculture; University of Georgia College of Agricultural and Environmental Sciences

FIND GEORGIA'S BEST
LOCALLY GROWN FOODS Online at georgiagrown.com

Gary W. Black: Paper is a link to the past

Continued From Page 1

culture in Georgia is being publisher of the 100-year-old Market Bulletin. Like many of the bulletin's readers, Black remembers his parents receiving the paper. Like his father before him, Black said he bought and sold items through the Market Bulletin over the years.
"I have a couple of buildings on my farm that are from Market Bulletin advertised materials," he said.
Also like many readers, Black and his wife, Lydia, have old recipes their mothers clipped from the pages of past issues.
"I think for the majority of our readers the Market Bulletin is a link to their heritage," Black said. "I suppose we have quite a few readers who are a generation or two removed

from their family making a living on the land, and so they feel like their home wouldn't be a home without having a current issue of the Market Bulletin on the coffee table."
That nostalgia for the paper itself has made the bulletin a bit of an anomaly in the publishing industry. For several years the Georgia Department of Agriculture has offered subscribers the option of receiving the paper in digital form only. Fewer than 10 percent of the paper's 40,000 subscribers have elected that option.
"It's not just that it's acceptable in print form. It's expected in print form," Black said. "As long as that's what our readership wants that's what we'll continue to do because we are providing a service."

WEDNESDAY, MARCH 1, 2017

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

PAGE 15

50 Years Ago Today:

Celebrating Weights and Measures Week

Georgians don't have to farm to benefit from the services provided by their Department of Agriculture. In fact, the way most Georgians know Agriculture Commissioner Gary W. Black is by seeing his name on the inspection stickers affixed to gasoline pumps statewide. Inspectors from the department's Fuel and Measures Division attach those stickers to some 169,000 gas pumps statewide every 18 months after verifying the accuracy of the pumps.

But drivers aren't the only ones who benefit from the division's work. Fuel and Measures inspectors verify the accuracy of more than 3,000 large scales annually. These are scales calibrated to weigh objects 10,000 lbs. and heavier, such as those found at truck stops and livestock yards. They also inspect more than 18,000 small scales annually, such as those found at grocery, hardware and feed stores, and pawn shops.

Fuel and Measures inspectors check 1,300 commercial propane meters each year, and more than 3,000 high-speed fuel meters in places like airports, truck stops, trucking companies, and wholesale bulk plants.
Other duties of the division include inspecting grain moisture meters, compressed natural gas meters, tanks and meters at dairy farms, and firewood sales.
March 1-7, 2017, is National Weights and Measures Week.

PAGE 16

FARMERS AND CONSUMERS MARKET BULLETIN 404-656-3722 agr.georgia.gov

WEDNESDAY, MARCH 1, 2017

Comrades in Farms:

Market bulletins still appeal to farmers and consumers in many states

By Arty Schronce

incredibly loyal readers, said Managing Edi- from Fayetteville to see it for themselves.

tor Andrea Ashby.

New Hampshire lies well north of the bul-

The Georgia Farmers and Consumers "They watch for it to arrive on the first of letin belt, but its Weekly Market Bulletin has

Market Bulletin has a long and storied histo- the month. If it is not in their mailbox, they served the residents of the Granite State since

ry, but it is not the only bulletin on the block, are on the phone with me on the second," she 1919. The newspaper currently has 5,000

nor even the oldest. There are sister publica- said.

subscribers via mail and online.

tions in other states that also meet the needs The Ag Review is an institution in North "Readers appreciate the advertisements for

of their farmers and residents.

Carolina, and has been a fixture in many New Hampshire goods and products and es-

Up the road in Columbia is the South Car- homes for generations, Ashby said.

pecially look forward to Commissioner Lor-

olina Market Bulletin, which began in 1913 "I have worked for daily and weekly raine Merrill's column," said Gail McWilliam

as a column in The State newspaper. The newspapers but have never seen such a de- Jellie, director of agricultural development.

Weekly Bulletin of Information was designed

The Florida Market Bulletin was first

to unite buyers and sellers of

published in 1917 and went by the name For

farm goods. Soon other newspapers around the state picked it up as a weekly column, and in 1925 the South Carolina Department of Agriculture began printing it as a stand-alone publication.
Public Information Director Stephanie Sox remembered waiting for the bulletin to arrive in the mailbox as a child and reading it in the recliner with her father. Today, it is published twice monthly. It is distributed in both print and digital form to nearly 14,000 subscribers.
The South Carolina Market Bulletin merges old and new technologies, according to Sox.

PO BOX 3336, MONTGOMERY, ALABAMA 36109-0336

AlAbAmA

Farmers and Consumers Bulletin

January 2017

Volume 65 No. 1
MMceMsisllaagne's

Satsumas -- A Tasty Alabama Treat!

Fresh, sweet Alabama

grown school

satsumas were served in lunchrooms across the

Commissioner

state in early December again this year as part of the Farm to

John McMillan

School program. This program not only brings local and/or

Reflecting on Ahead

2016, Looking to 2017

regionally produced food into school cafeterias, but also allows students to learn about where that food comes from.

As we end 2016 and start the New Year, it's important to reflect on the accomplishments our department has made this past year. Employees in each section work consistently to serve the farmers and cdfIoonarndy.sutushJmtirusyestrpsSaaesotcffteiywothenaisrt,osstotahauftifreghsPelpilagaechnnhttt this summer conducting citrus scouiftrrvuecsyitsprusyslloliodgkrie(nAegnCinPgf)o, radivAseescaitsaoenr,
and spent the fall combatting Emerald ash borer.
On a daily basis, inspectors
Public Notice: By Alabama Pork finromthenufimeledrocuosllseeccttiinognssaamrepoleust

oppttwsafsoaepfOefropaontrasohrtamurueudrtofrdootirootmrretnpuhftaelohedglesceecncadesotfui.tirotgasas,osrssmliif,gereolmofWffennruernaacopcoteertearnateaymossdenldskpltbrl,btidisyteheirvicaalensisscoaecnnnnegltvvosoeitaigtegh.tmaevdxnbidotresrenoesseT,caiarguocaaeklifohafsnumnuetlenceastdgsitarrsieepnpboutnoserirdesotagsosltiicuwihdrfsstszttdhseeeseofoeeatttreuomshrlrrhunvtrtl,eysrieoirs,den.s task.
I would be remiss if I did not mention the hardship this past year's drought placed on Alabama agribusinesses.

The smiles on student's faces tell the story of how much they enjoyed the delicious and easy to peel Alabama grown satsumas they were served at lunch that day.

Educational materials were

displayed on hallway bulletin

boards among other locations

throughout the school so

students could get to know

their farmer. Posters had

photos of the farmer with the

saAlloolagnbaganmwi"atMhshaeoemwt aiYpngoouftrhtheFesastrutmadteeenro,t"sf

where the farmer produces the fruit

lives and they were

able to eat.

Sswtuedeetn, tdselaict ioDuaslrAaliadbaamElaemgreonwtanrsyaStscuhmoaosl.in Montgomery enjoy

"It's exciting for students to see exactly where in Alabama the satsumas are grown and to

and make that to also lay the

connection, groundwork

but for

lifelong healthy eating.

be able to see the person who

This

December's

worked so hard to grow this delicious fruit, it's truly `their farmer,'" said Don Wambles, director of the Alabama Farm to School Program. The ultimate goal is not only for students to have a better understanding

dlw3gsaie2rrseorg0trvrwee,ie0sbnd0tu08tdii,beno0ypln0iovs0ocueAfhnrsylodacaostabtslosaueomlmdsuf,aanatcsseahtw.fotarsToatruamsohmltmieehnraresgess. (continued on page 8)

where their food comes from

Producers and National Pork Board Little or no rainfall in some

cases from early summer to

December created severe drought conditions. Our staff, through cooperation with our stakeholders, worked to put together a hay listing page on our website to make it easier to locate available hay. The goal of the hay listing page is tloivepsutot ctkheprhoadyucperrodiuncerdiraencdt communication. We continue to meet with our stakeholders omnaanyregcuhlaalrlebnagsiesstothaedddrerossugthhet
has created for all livestock producers. The rain received

pfPB1BtABSoCiACrhMprnoooruooseerpolTddasioeadan.mtoyhrumetbdreuAtMdhdceetcsaumcwi.elirremn,oceoaaooraiergnbtfiloHasidt2rnl.taoemsDgid30oFm(tlntoaeP0eacy1tAiaekarlmcro0o8reelleotemnrlgicTefkoPjiiptarNaeunn&onyoAtlAlrnvear,talrshasclikcctOatipteFeteCoidcbmt)orooedhaPnuaFgoodfDneenEmarrtaenseeoiodlenmbanftrwadilieia.agdenSzbupPritSt7gataegitatcopohote,rtatnsearetoreinntoasckhorktseera'dyetsfeenkst.

in the month of December (continued on page 8)

Any resident

producer who of the state, at

is a least

1orabcipe8nflaerlpnorddyetcphiuesaoodeeacsnransrecstsetriieeassdnltseeeoimvrcslaedtehneid,,aoondnunt/isaoial.smdnrsdAaadblaplsurlhapiedanrr,tesoeogilcldrieigupmpgwicaaabiaieitnttldysrehet

thaFAB3ehnoom6eoldgarm1xasb9miaal11twmho-sg10eearh0aer0la0ee0Pls0icl1nos@,hr;foereokMclacdrelkmPfoioa3pirnanffo3tttafgpd4irotoru-mhon6dmceve1eeicerir2drnsors-u.ygnn,5oc,at1PtrtahmgeA.8cOad.1teLt.:.;

Volume: 92 - No. 2

February 2017

rNfYaeoacrusomhngevngriilsszloeefydrobmean uCporfonravsosetessFmeebn. t2r2enewal dBroolpl ws teoev7i5l acsesnetssspmeernatcre Greg Manning, a soybean
producer from Nashville, and his girlfriend, Jessica Smith, have been named ASA/DuPont Young Leaders for 20162017 by the N.C. Soybean Producers Association. Manning and Smith will represent the state in a leadership development program that includes participants from across the U.S. and Canada.
"The Young Leaders program provides training in key areas, including communication and leadership, while growing the leaders' peer network," said ASA Chairman Richard Wilkins. "The Young Leaders program continues
N.C. Bioenerg to have an enormous impact

North Carolina corn growers will vote Feb. 22 on a six-year continuation of their commodity assessment program.
The Board of Directors of the Corn Growers Association of North Carolina is asking that farmers assess themselves at a rate of 1.25 cents per bushel on all corn marketed in North Carolina.
The association is involved in the following areas: international and domestic marketing; research and education; grants to Cooperative Extension offices; and legislation that will be helpful to corn growers and other farmers. A 24-member Board of Directors, representing all corn-producing areas of

North Carolina, governs the organization's activities. The board also gives support to issues of a local nature that members believe will benefit farmers.
Growers may vote at local Cooperative Extension offices from 8 a.m. until 5 p.m. All farmers currently engaged in the production of corn, including tenants, sharecroppers or other persons sharing in the production of corn or income from corn, are eligible to vote. A two-thirds favorable vote is required to approve the referendum.
If approved, the assessment would be collected by the first handler or purchaser of the commodity from the producer and
(See Corn assessment, pg. 2)

The board of the Boll Weevil Eradication Foundation of North Carolina has set the 2017 boll weevil assessment at 75 cents per acre of cotton, dropping the fee from $1.
The fee supports the foundation's efforts to monitor cotton acreage in North Carolina for any re-introduction of the boll weevil and to respond promptly with eradication treatments if necessary.
"This trapping and monitoring program is a great investment for farmers who already have a lot of variables to manage in raising a crop," said Agriculture Commissioner Steve Troxler. "Eliminating the boll weevil from our state years ago has allowed us to

have a viable cotton crop. We certainly don't want to see the return of this devastating pest, and this program helps us keep an eye on cotton fields in case of any spot re-introductions."
Foundation contractors will install and monitor traps from late summer until after harvest and frost. Because the focus of North Carolina's program has shifted from eradication to monitoring, the number of traps in fields has decreased. As such, each trap is critical, and farmers are encouraged to contact the foundation if traps are damaged or knocked down.
More than 5,500 traps were placed and maintained
(See Boll weevil, pg. 2)

y Research Initiative announces grant on not only the soybean inrecipients dustry but all of agriculture.
The class of 2017 is exceptional; they are engaged, talented and passionate about agriculture. We are grateful to DuPont Pioneer and DuPont Crop Protection for making
From the tractor this program possible."

The N.C. Bioenergy Research Initiative recently awarded $1 million in grants for 13 research projects to boost bioenergy opportunities and production in the state.
"These grants continue to push our knowledge of bioenergy applications in North Carolina forward, creating the potential for future market opportunities for farmers, agribusinesses and forestry industries," said Agriculture Commissioner Steve Troxler.

Below is a list of grant amounts, recipients and projects:
-- $43,618 to N.C. State University's Department of Biological and Agricultural Engineering for the third year of its study of fertilization rates and yield response of the giant reed Arundo donax. The project will focus on collecting field data needed to establish realistic yield expectations and nitrogen fertilization rates under various North Carolina growing conditions.

-- $55,835 to the NCSU Department of Forestry and Environmental Resources for "Loblolly Pine Biomass Genetics/ Cropping Study 2016-2017." The project will continue genetic evaluation of loblolly pine varieties with high potential as an energy source.
-- $148,804 to the NCSU Department of Crop and Soil Sciences for a project titled "Nutrient Dynamics and Production of Bioenergy Crops in Swine Efflu-

ent Sprayfields, 2016-2017." Funding will continue research on the nutrient requirements and uptake of proposed biomass crops grown in a sprayfield environment.
-- $148,650 to Carolina Land & Lakes RC&D for the development of "Pellets for Pullets." This expands a previously funded project into areas of the state with a higher concentration of broiler production. Wood pellet (See Bioenergy grants, pg. 3)

by Agriculture Commissioner Steve Troxler

Commissioner Troxler
This is a particularly newsy edition of the Agricultural Review, and I want to use my column to encourage you to carefully read the articles this mont.
The beginning of a new year often ushers in changes in rules and laws across the board, and this year is no exception for those in agriculture.
On page 8 of the newspaper, I hope you will pay special attention to two articles that highlight

changes involving the Worker Protection Standard and new labeling requirements for products containing 2,4-D or dicamba intended to be used in conjunction with 2,4-D or dicamba-tolerant cotton and soybean crops.
The new labeling requirement for dicamba means there is now mandatory training for applicators before they can use this product. A series of classes in February and March will be offered across the state to ensure growers wanting to use these products have access to proper training. We have listed the dates and locations of upcoming classes in the article, and I hope readers will be able to attend. By attending class, growers will be able to earn two hours of pesticide recertification credits in categories N, O, D and X upon completion.
New changes to the Worker

Protection Standard rules represent the first significant revisions made since 1992. I would strongly encourage farmers to read these changes carefully so you will be up-to-date on requirements involving workers.
Changes cover annual mandatory training, the minimumage requirement for pesticide applicators, display requirements following pesticide applications and safety data sheets that must be kept on file, new respirator requirements, the need to add an eye-flushing system when eye protection is required and other items.
The article spells out new changes to the rules in more detail, and you can also contact our Structural Pest and Pesticide Division at 919-733-3556 if you have additional questions. We are here to assist with compliance.

If there is one thing I have learned over the years, it is to expect change. It is an inevitable fact of life, but it doesn't mean we are ever ready for it. Again, educate yourself so you will be in compliance with any rule changes.
It is also worthy to note the Feb. 22 referendum on the continuation of the corn assessment to support the work of the Corn Growers Association of North Carolina involving international and domestic marketing, research and education, grants to Cooperative Extension offices and legislative efforts.
It is a busy time of year as growers are attending commodity meetings, repairing equipment and making plans for the upcoming season, but it is critical to stay up on changes involving your operations.

Sale, Wanted and Exchange Bul-
letin. Its mission was to provide small farmers with a statewide advertising forum that was not otherwise available or affordable to them, said Walt Land, chief of education and communication for the Florida Department of Agriculture and Consumer Services. It still serves that mission but is only available online.
The Market Bulletin of West Virginia debuted in 1916 and has gone through many redesigns, the most recent of which added color to the paper in 2015. The publication is released monthly and made available free of charge to 53,000
mail and online subscribers,

"We get digital and handwritten

submissions," she said. "Like agriculture itself, we bring together low-tech and high-tech. We offer

VOL. 100, No. 2

www.LDAF.la.gov

January 19, 2017

New crop of Louisiana Master Farmer graduates

something for all."

Next door to Georgia, the Ala-

bama Department of Agriculture

and Industries offers the Alabama Farmers and Consumers Bulletin. It began in 1918 as the Alabama Market Journal and counts about 10,000 subscribers to its print edition. Digital editions are posted on the department's website one month after each printed issue is

fSAsLDottgroeeowrupnAiihaacsguevrirandalitncnsAuuahrTulietMpasutv.ariaennPess,dtiBc(LettrFihoullouFirrRrieadsedriiscfamtrhfnroreayaomrrmLCdfraosoionlrgmendhfhmttaBi)snaiawscrdnseoaikJomsEonCamherwErnniaOteMPmrs,dtiLeitekrGnSdeetUi,trStNhooVteuRricOarcCoaeiunnSdPts,.,serDtLerasv.AnViadd.CtMeiioDnn.ngt,,tFaCAoMHPHPPwUPaVGWgT"ElCaE(nTa1orAaaeaPaaWeReaLnormevrt1rahwbihedrTitrrrhiildbioAeaisFhslamodsseoeeeisesoiuahhotr-nshterrxhongenhCrgcrnnoilith,rgF.r,daFudLdrsil,,eenyCcanDaeieaonri,PearooeKhnJJvvlmytRtaTnd)lniaernPuaieSdteiiFernPe.trfodohrcedsmoEi,raeihiaieiosaJpnineoayeautnrnswreaaIiPihrenhdoyil.lh'aamboPpsinssllsaatgIe:nslnV,otehteRhaan2svrshrmr,sHaLnrn,iarPeeta0BeDo,oaiswPuiSrooraydoCEaKs1hdDrzAnidJdaeghtuehuerwlr6a,dvaa,Wa,reisPlioeoradsi,asesinriadhsneascnatnstt,rhSdHWSniMi.totrioeonohornOaalEeahodtgciss,tceog,1ltnv.onlseniea,voloouefistlrn2hTaanAloaadhdalontagttLl,tin,,iyEttsroufino,cz,neciMmPsatrLnoBga2eeTFatEMtaeoetRnDTakhhscnhdae0nedaoacnrvdrtneieohHalerio1dvisoinmSParia,raosgbeto1rn7ieygf,tantanCePhnLeoweeaof4see,nyDwgrr,hPagrnvn,aWrvoiieHPnesParsoCroaozE.oeFeou,,ilethraaureiotlstnJiniaoaowWlL,ri,ahn,ErsdhaswtdasrseinliTliheeemosEm,lvhstvl,aepKsfaihehhJaua,nooCvrPeswrireJeJ,Pen,ePinetoranrdaaroBseafJrviDeoaganag,frCiJtirfarsnarMtaeehigorecefrgr.hamThsiEaiDHtetnsoralhrt-sesnihueisa,rtacramaalohetihnlM.orno.asrlvoedesissn,o,W,eonwyntLveP"trugFlcetnceMsSelaaRaWriiPeSRCCrDoTl,nfamrtofasPiPaunoDeaoaiDaaadgFictisnsrawgsetsbaevscrlynutasiaaehnalrtrtnorrgksbeeeatuararvieno.vianiihtnsssiesimtlsetmsroiolrcietd,he,,rhslrseentti,esa,,,,s,n:.,rt ptcdPcehctclioPaSoAnhohLaossrpopfsmpPytreIncaevifnsama"orstnhlsonrsseaLhoirsseiaosrTsmTuotdi,vrgo,eiepm.sAwannoisdSodihgnirhrtowlsossscucaUnava.egairpseueiritdimtsetacmhwtrdumaarwdraheeieMidmti"onitecintVetea.icacioesiosyTi"odrctatironoursahhihnosen-enutdhcnaanlssdirrtpesrttwceeptngiaFeuptwuhoepsiwenaherlb,seeleafqhrarrrePcroyesumheycaceratsuaaspFeltrnrmaonlifecuteiaeakh,efosafgteirrrtnd"diwaisrrosodnaerienercrptsencinemtrsmisaestaBdoiRamicetdLhessvrsrpeorcgeNuseusotteiideotaenrotsrhcnpptel.nraanoslaitonuFttthnPtee-rontlneouhthddfieoloaasurprcfodsriyabternaoeodursbropacriihferrdeeyahpdrUuagu,erlemedovfts.snlilagsrcrawaSuApetodnacatanterpsrrhishLcv.tDlnome'yecrfmgwrsiaRoeeiiTsaa,ioeooiersAcennnetas-inienudhsawsscgtanttotLsrLiucieatohepuiaosvcosriibooatdcwproe.oentilooiuvt"lmhatutni.rurcqnhgeiuesmmromanoeisoiiiu,ecn"lsrfclmseanwlonriiieaeuoWiditrrcnamapfaelsinLpdvhiidcnMBrnonenttaeiatyeoSoeeayamceawosciltnsrderUaCrloaicttutrdy.ltoynphnrsurhne.fCgoDuetenlivacRcangseIohesnrcaAreineaeegiufrmiprstgmtqprupnrrtctriotlegeosoovtoiluarhnadeFpinrcerCoiatnfernavdaranhummisifmttgseorectiaitremigalteednironcmateentorusooaudlisgeventtnnasedostnmnieoer,i.no,ne'totnavarbrsantd,nlleel Feb. 2, 2017_Jan 32013.qxd 1/27/2017 9:40 AM Page 1

distributed. Editor Amy Belcher credited the
longevity of Alabama's Bulletin to its good reputation.
"It is a trusted, consistent publication," she said.
Belcher shared the story of a member of her church who sold his first horse through the bulletin in 1969. He continues to advertise in the paper to this day.
In addition to the advertisements, the bulletin is a valuable tool for distributing information that farmers need to know, such as disease updates and scams targeting the agricultural community news items that are often buried or ignored by mainstream

MARKET BULLETIN South Carolina South Carolina Department of Agriculture

Volume 91

February 2, 2017

Number 3

Next Ad Deadline: February 7, 2017, Noon

agriculture.sc.gov

Market Bulletin Office: 803-734-2536

SC Watermelon Association Hosts Annual Meeting

Seasonal Featured Products
South Carolina State Farmers Market 3483 Charleston Hwy. West Columbia, SC 29172
803-737-4664 Apples, greens, citrus, onions
Greenville State Farmers Market 1354 Rutherford Rd. Greenville, SC 29609
864-244-4023 Dairy products, green peanuts
Pee Dee State Farmers Market
2513 W. Lucas St. Florence, SC 29501
843-665-5154 pecans, Irish potatoes
Log on to agriculture.sc.gov
and click on Daily Market News Reports

By Stephanie Sox Communications Director SC Department of Agriculture

and the people in it." Blakely comes from a family with strong ties to farming and agriculture and has interned

PSeAregdcrurieectuNalrtayumroeefd sftmwmatSSAm1pa2ghiaaQaaoarbaempfaiscb2BBgcieAptooaanr0Jaw0oWswienvuasfetsxetorfodueeuD0talearbuptarTrosl0ffet1udcaoeapkMaetowuweeai"t-rntnoe1snhooetttoihuitvthekr7ttieJnIrihtrehunneriehleusieihtfadurrrri7noceaevieeicnernsrarnseetaaltnoeidmtlfshnititraatnirorrgewligedgasieneenyesayorn.argmsntuqCSsttatandnnaes,.snnlSemhwgrusroawkyrituigRnJJctamvenonmasuepdnciwaetsltCea,tnfeoooeadh.neaboiereoeutgutlleracaedsjdiraoCpeehihmiphe,hnnotiuotnnrsnErntevyttnrneughWsDnnntklaslrenhadosiaaeoaeeyml,dodedoeavagodeaoneihse,issneltaxnaitnutonnneuncgSimrntilonynmhcaeCodoonaocrsritoastasdeosgfermrowsetnsoceevoh.ganenlsidynnoitwtaph,ssmlentoctrhrhnrmb.henleeubsgturtiathWysFmoiwruieehssenwineiJ.tr,eeJsepemiCe.otrossltaealfwaithasSeootuione$ireughaTdaBntailntruleibs.nserennerifuethtl1motenhoreif-tnorcyegrhhvlsiWmeCcneysmawujdegdatrn0ecimediu.rrnrueiha.eaphintcnsiaoa,srvks0rahssineteaisdn"initotTidmtmhanesrfsoAe,wtPncriheao1mWanroht0dyugoorfoiuhAssonsnlsssinrnb9,eraerrreyni0hCanraeo,ntslecessasenapdgogitei-isis0ltaurdpeosvntnynshdaychoeUtomhprtroahms'of.s.rerqafmienietsgtsdaaiecreviteooenlocnicenykghsnf,obrhaoulTiarerDshtlnuamoieeemlvheawnneahrani-imptlneansnnneetisroeoriitasoueuoesnnesptgfasrotnnontkesyslbrimligrstheedrnosyaaoir.SeytoelWpwtwrriifgoeaynlBttocoCplmdCostdemrd`epaorthiauaElrpkulohakdtwoaaQslr2euakehtnpWBaeW,rad,watufacnnskeprh0ltrertoegrs,tuorlnpuenrgsttkosrSoaheiae1hesaoehkaponmnfeoladchumslknprtmahre7yCvtoseygjoeenvdewoe.ekauneteieeeaeektreerorrSarutSeaaurstdDetlJnTasoilnrmaliaamysirslihnnossntghdjcunooavptospthoelnhmhhgtspettohtnewhleo,eiuenansrgnlorhlsenrsdne'eeiee,eflyfrtluv.n"iomohalsrlaaansnmefnsagpsnCAbrsWtabocafwyhCsncbiywAaeOtacgrltQeoioreepnoneatohrepeJkgoatMuonaraoatsehaaenA1mddnnnSourvuoi,eeoatmtnrndfmtstnromcntswh4lotoseeevereShcredeoroaeotahCtgalaee.mh,trnreifiioeronsrmiCplitwtnacrdausitmlmvnnmrmioeettensopssytunfiaaelevsohrsaetiaasgiaeroelsetyoeseaherdet.rdeenfrufstcrernaeict.sjulinaollivrur.oodmfcoo"onrnoirDaytrnoigsfeaCasninhnnanoncduaTrivedietelincesep2wlmtaaktsreslfo,rhceiiphhlcwap0snetssmyrrSasarmwiiehSarorgroos1uoadtttmoo7osenorepohahoiwtwoCpgraEleE7tfftfaSwniutawuA.5oxiiraehriciestsruaemrtr.rnnftny,lrmdyiatSpighaereeoetDwretdaoi"hattmetsieuin"midauymhotheghhrpaCnmcipcmugeSAvmretnetrarosigciChanEatnhoeekglbhri.alnaeatvftoaClsiroaaubtDetipolt2hhtlaeWuasseshlrlmiglendoiesaoetwdnltroipogdeav0eanpyoiritsdsrtoyrsclcnrrirooinnoMaenhiyr.aiCei1supiuetimofeseteshohcngg5relhntneawtEt6hMlrirtwmfGeustaesipnlhe$Aoomgat3coooniotutaieleeg"xhnirCiuisoalfir1fercetrua0ndfoar.geimtWtlomtoetldhyeumeoeoieliu.hhehs8oeuanntdtrbysArnyfroCenwt.eeclneeeSiranhhaRncondnteweicieelmefInmidfthddlnlislxeesCaeatosetnretlouasalvaearenosesePwsivnatrraatrunarpofsitnelrroVettfsrrao2slsboenncetoer.aoenioclomtlo.dn,uopfoiriwmh0MioegyaiioiniAstckyrttfrryaln.O-ennarmmafslaowaMm1eoniiaacanreseuasCenusedwieansfgttmv5twcnstrtgluaaprhror!Bsoe-gsnichhhalslsadmrteu,dehiecolomtSewrpyaaotairnloytielerlteehrrmnoetumrasilhee,eunyts-orccCho.trwoploaseinsom,cro,csbeerrirsltesenewuahnpmaiorrterisGekfofenFaasnuGrmlSyAkrordkcnwetlfvahveshduahrawiiurtaeagugesartkov,oohiratvghea,eenlhhaiolienoboilhateneellslctnieitturtounteillBelstaialsoiiundholohwhfdwesetsnirprrnsoltdh'plrtuno.iutshtyss6syfer.gnuerewhgin.n.nnetsl,.t

Hugh E. Weathers Commissioner
What seemed to be like a carousel turning around and around with regards to naming someone to lead the agricultural industry finally came to a stop when former Georgia Governor Sonny Perdue was picked by the President as United States Secretary of Agriculture. Prior to being nominated for this office, Governor Perdue served on President Trump's agricultural advisory team. I have had the privilege of knowing Sonny for several years now, and I believe him to be an excellent choice for this office.
There have been 30 Secretaries of Agriculture since 1889 when the U.S. Department of Agriculture (USDA) was founded, and though some were raised on a farm, only two actually lived and worked in agriculture as adults. Once confirmed, Sonny Perdue will be number three. He grew up on a farm in Perry, GA and is formally trained as a veterinarian.

SC Commissioner's School Applications Now Available

He has been involved in several agribusinesses in his career, from grain to eggs,

nChpDULoneoirfoaenfRfSoleewmdpitviguCrasSiemarnrirCacrantatgismispCmgeSlsistpenylrAieaho'neclcsmyninetsogidesCssoohof.rofouopr'SsnadsAlorrlteccitSuUgnetpghedrchnnaeiorsechiitetvoiusnoeaotemlltohdltfsruyljscriAuraeeobfiaetongryrauyrerir,e(ogriAscSJeet'rhhsuuurgCsxslleprmtyDwuiSaocin2rSAmnousoe2e)ldora,ute-kudu2gatFrssrh8rtnetoehihoc.adrno(ueCcaSCiCplsoactaCutaslarrderrys,Crdoemeo,eSflcmliasaimieAnanonnilin)aandcddc, satsetcgucThdrhohiicneoeuislc,laataplulsnrroadoengilndaarcbascloumardwareeteoseclrlroiteravsisppes.seresctomifiCcbprlheionmaafossdriosmntaaoUtripoeniniacv.sesTrsfhoiitneyr

RwaisacsntorheuTedlisidlthneeeaecegwanuiCetaSrtrsscretCeaehrf1tnnrriCofd4tFrilemayotadf4hmtrsi0tmnShmty%ugeCseidstapyFraasirripiarnnooerdagngdmerwnoaEorwdtom'orxsrnpk.hsTSeittaanhucOrbsgehdilmfeoieCigooneddrhulnianaarfatodnnatatgreoullruAaroaiF.cmgggtourreaniirlcctdieu,Ruusr7lli4tettvu6u,6er%riare5ne, fcam8Siebl6CeaAlod4mrDup.k-tAp6seSo'ld5siCcn6baE.C-ey6tlSiid6zoMAua6n,a/b2sccreacotohfnhalrtsa3rW/echs1tuco, Cclo2sasld0eevam1@aa7asitl.cona8lndbe0F'slm3oem-Krs7uaoi3nsotni4etfno.-lbe0Bri mne3dlae2uacp8,tkoiooaosanrttrt ewood@scda.sc.gov.

fertilizer and exports. He also has several agribusiness operations in South Carolina.
Perdue served two terms as Governor of Georgia from 2003 to 2011, and during his tenure, he succeeded in returning agriculture to the centerpiece of the Georgia economy. Notably during his term as governor, amidst the historic drought of 2007,
See Perdue Named Secretary of Agriculture,
continued on page 8

news sources.

In the Tarheel State is the Agricultural

MTAHERKET

Bulletin WEST VIRGINIA
OFDEAPGARRICTMULETNUTRE

Kent A. Leonhardt, Commissioner

Volume 101, No. 2 February 2017

www.agriculture.wv.gov

Kent's

mWemaybneersChoip. FsakrymroecrkseCtsoionpfeirrasttiyveear

Reflections

lastTyheearWanaydnaelrCeaoduynthyaFs aarmmeerms bCeors-ohpiplathuantcmheadny

Reflecting Upon My First Few Weeks in Office

Since the November 8th election, I have

had plenty of time to think about the great

responsibility have chosen

the me

people for and

of West Virginia the challenges we

face as a state. In my first Market Bulletin

column I would like to reflect on the first

weeks as your Commissioner of Agriculture

and the transition that has taken place at

the West Virginia Department of Agriculture

(WVDA). First, I must say it is a great honor,
privilege and I am truly humbled that the people of West Virginia have selected me to speak on behalf of our farmers and run one of the largest departments in the state. Wyoiuthtotheavt eI rjyusWt wesatnVt itrogisnaiaynthfoarnkthyeoirus;uthpapnokrt, faith and votes. The farming community was solidly behind our vision for West Virginia and showed it time and time again during tahgerieculeltcutiroenocnylyclme.aWkehiuleptahboosuetofifvuespienrcent of the electorate, it is humbling to be so
strongly supported by my peers. Secondly, I just want to take a moment
and reflect on the willingness of outstanding professionals to leave quality jobs and join me in serving our state. These gentlemen sVdhairaygrsienaitahheeaagsdraicmoufelttuhvreiesmiao.nnTdahtnehdreebfsoetraleiet,evpehleaWavseeesbtmeteteert my top advisors as we move forward. Joe Hatton will serve as Deputy Commissioner and a liaison to organizations that we work wthiathnt2h0royuegahrosuot ftheexpsetariteen. cJeoeanhdasprmevoiroeusly worked for the USDA.
CONTINUED ON PAGE 2

gaWFusrnonloaudueuy"ttmwyphnWseepemerl'oCno'vaflyteolWtimuetbgsrneere-sttoonyyatwftpV-yFhenfeiaaerawtrcgromretiolnoayaeuilb.nrladsdo"d, DutCtehththnuoie1seve-1ocycpt5o.poor-memPotshprieeenemnisgfstiabdMspceetutarnasstotre,hcf"Piohtnsahf,gateryisck

agriculture." The effort

has

galvanized

the

community.

Eighty people showed up for the

group's first meeting last spring and several became substantial contributors to the co-op's summer farmers' market in Dunlow. A building was donated to the group and renovation is almost done to have it ready to operate as a store and headquarters for the cooperative.

"Our goal is to create agriculture jobs. People have land and can put it to use so we're pushing ourselves as much as we can. We work on this every day."

Besides typical produce items,

Wayne County Co-op

co-op members are also becoming

President Patrick Fluty

involved in mushroom cultivation

atahHhnnaeeddsrsemaaabbaiaodorpeuulhtetteh11pre,0er0xoe0mpd0meueclcmeottmsigbotsebhnrera.sertFsagmldrsuotyotawyrrfetoisinrntahgygiansmnmocu3ausp0hllarfetoaiproomrnmosdtsh.wuiOcsitlniyloeebnaer.

said Fluty. "I
can't believe the amount of food I'm

st"bssomhwupgtmufeebruiaioeclsalActnlddltoelo-aslhnurwte,hn-iue"coraaitlb,tgipplanpsa.elhal,oeltTopnkoasnapnuhesniynrpgt-rledosmdsecu,dwcxharolmoupacoiun-ectshewahoseesenanpswr$ssstayeseuiu2pnvrwinop5tuentewnfpi,erfa0et2crlbtolui0ihlh0lsegsny0emai1s.etns7emhrdRtueeao.eoslsdaetsanhhethmvh8daroceoye4tboulitorp-enorlogdmatrsnmfhasitblurataeieauhennglrmrlcooeeoutttsbcohewpffeuedeea.teerlnvrAalsodaacaotruniirrglnogtsiyrngpneaigronn,rtt

2017. "You can't sit still farming; you've
on. We have to be very productive and

got to move efficient,"

growing compared to traditional fasciDasmOcerna1Aooroorgu9mtuamDvunhuHrn9r"niiniFeknuelTn9cotneodryetlnug,lghmyuwtdamllWb.eg'tootdi"esyuursanatwrdmaec'htrversey'mH,ehkidensbdsnpeoeuoeuiepufeltgyotdcwrnfuirshhelsnaouCotsaaitftbgrcaapnoitorwtbuaolr,esgourtle"teinhertipnlhtatoodesFhsytthsaenrniyiemrlyvoonelunersleapptngvaeteiahtnynerrsieaaraihonkdgmerslsattiggesoagrWtatfco.trhehii.ihalohTdvnrsersWmboao.eooshpstevpcuHtueshieobimehlegrgnelreieoreoehnhogoaisfwodanhurtuiRttelliexgnharhstosvxleudoeevasemcpthfrthneroceWbplaomaeoerdo.nveorrsreieiuesekmithelnnimhnndedodptAatattoepebnryRsrtapdokreeotstiaeshpgnerhnomidwseatrenuiaalanpaceatmnrselctedlhsh.a.ainat.

agricultural center.

TKWeHVnEtDLMeepAoaRnrthKamEreTdntt,BoCfUoLALmgrEimicTIsulsNtiuorneer 1900 Kanawha Blvd., East Charleston, WV 25305-0170 February 2016

Non-Profit Organization U.S. Postage Paid Permit 80 Charleston, WV 25301

Mississippi DepartMent of agriculture & coMMerce Volume 89 Number 4

cinDy HyDe-sMitH, coMMissioner

FebruArY 15, 2017

JAcksoN, ms

New Year's Resolution: Plan for a Successful Calving S By Dr. Jane Parish

eason Extension Beef Cattle Specialist Mississippi State University With the New Year comes a new calf crop for many Mississippi cowcalf producers. Calving season is getting started in many cattle herds around the state and can be a very intense time for producers. Here are a few simple management techniques that will help ensure a successful calving season.

Nutritional management Adequate nutrition is critical dur-
ing the last two months of gestation since most of the fetal growth occurs during this time. Keeping heifers separate from the mature cow herd is important from both nutritional and

Hbreeiefedrisngarme asntialgl egmroewntinsgtaannddpohinatvse. higher nutrient requirements than mature cows. A beef female's energy lnaecetdatsiofonrmmuasitnbteenmanecteb,egforroewethnearngdy is used for reproduction.
A cow or heifer that has just

stamina to expel the calf. Avoiding calving difficulty starts
long before calving season with proper bull selection, proper heifer development and culling of females with extremely small pelvic openings. A calving ease bull should be

a 60-pound live calf is better than a 100-pound dead calf still holds.
Place cows and heifers ready to calve in a pasture where they can be easily viewed and checked often. Research indicates that nighttime cattle feeding will result in most of the calves being born during daylight hours. It is a good idea to pay special attention to first-calf heifers since they are the most likely members of the herd to experience calving difficulty.

prevent infections. This is particularly important in heavily used calving grounds. Calves should be ear tagged at birth with a unique identification number so that they can be matched to their dams and properly identified for herd records. Calf birth date, sex and birth weight, if possible, should be recorded at calving for use in herd improvement programs.
Make sure that the calf nurses

Check that all calving areas are clean and free of items that might injure cattle. Observe cattle fre-

properly. Calves need to receive colostrum as soon as possible after birth to build calf immunity and re-

quently and have calf pulling and sistance to diseases such as scours

disinfectant supplies readily avail- and pneumonia. With each passing

able. Calving assistance may be needed if reasonable progress stops after the feet or water bag appears. Contact a veterinarian if a calf cannot be safely delivered without help. After calving, monitor cows and heifers for retained placentas.

hour, the amount of colostrum in the dam's milk declines along with the calf's ability to absorb colostrum.
Know the signs of a sick calf: rapid breathing, scours, lowered head and ears, dry muzzle, inside of mouth cold to touch and abnormal posture

ecnaltvsedfowr itlhl erefqirusitrefeawddmitioonntahlsnaufttreircalving. Having cattle in proper body condition at calving will posiatinvdelhyeiimfeprascitnrtehbirneebdoidnygcroantedsi.tiConowast calving time are slower to rebreed,

mated to first-calf heifers. If a significant problem with calving difficulty has been experienced in the past, then it is time to reevaluate the herd sires being used. The old saying that

Calf processing

Once a calf hits the ground, make

sure that Dip naval

it is cords

breathing properly. in a 7% iodine so-

lution or use blue lotion spray to

to name a few. Move the cow-calf pair out to clean pasture as soon as possible to reduce disease exposure.
For more information on calving management, contact your local county Extension office.

produce
Spring Calving Cows Nutritional Nee likely to

less colostrum, and are less wean a live calf. Effective

ds nutritional programs match forage
and feed resources to animal nutrient requirements.

Avoiding calving difficulty

Calf losses associated with calving

difficulty can be herd of any size.

a train wreck for a In addition to calf

losses, weak calves and longer post-

partum intervals (the time between

calving and result from

return to cycling) difficult calving.

can Un-

derfeeding cows and heifers prior

to calving will not decrease calving

difficulty but can instead reduce calf

vigor. Thin cattle may have diffi-

culty calving if they lack muscle and

By Clay Wright The Samuel Roberts Noble
Foundation, Inc.
At this time of year, a spring calving cow experiences two periods of increased nutritional need, which are significant and must be accommodated or her performance for the rest of the year can be negatively affected. One of these periods, of course, is at calving.
In the first month of lactation, her protein and energy needs will increase by 0.7 lbs. and lbs. respectively. By the second month, as her level of milk production nears maximum,

her protein and energy needs have increased 56% and 27% respectively.
She is not only producing milk but also trying to prepare her body to breed again very soon. Without an immediate, adequate increase in nutrition at calving, a dramatic loss of body condition is common as she uses body stores to meet these new needs. The most common effect of inadequate nutrition after calving is low conception rate during the breeding season.
Possibly the most often overlooked nutritional need for a spring-calving cow, however, comes during the last 50 to 60 days of pregnancy. In the

first seven months or so of gestation, building a calf does not require a lot of nutrients. In the last two months, however, the fetus makes 75% of its total growth. Additional protein, energy, and minerals are needed to build the calf and maintain the cow's increasing weight.
The same ration that maintains a cow through most of her pregnancy will result in weight loss during the last two months. The fact is that if a cow is dropping condition in late pregnancy, whether rapidly or imperceptibly, she will not cycle as quickly after calving.

said Editor Beth Southern. "We have had an uptick in
subscribers in recent years," she said. "The ads are very useful and the What's Cookin' recipe column is perhaps the most popular feature."
The Louisiana Market Bulletin was first published in 1906 and has about 11,000 subscribers. It is posted online after it is printed. Editor Laura Lindsay uses social media to recruit new subscribers who are unfamiliar with the publication.
"We still have our faithful readers who have always subscribed and who read it from cover to cover," she said.
Lindsay described the bulletin as an instrument of education and conservation, as demonstrated by the advertiser who offers mirlitons for sale. A mirliton is an edible member of the gourd family that is known in Louisiana as "the unofficial squash of New Orleans." The advertiser selling them is working to save different local varieties. It is thought that many were lost to Hurricane Katrina in 2005.

Review, published by the North Carolina De-

The Mississippi Market

partment of Agriculture and Consumer Ser- voted readership," she said.

Bulletin may be the best known of all the mar-

vices. It grew out of a publication at North

Ashby learned just how devoted they are ket bulletins, having been written about in the

Carolina State University before moving to when she accompanied former Agriculture fiction of Pulitzer Prize-winning author Eu-

the agriculture department in 1926. The Ag Commissioner Jim Graham to the North Car- dora Welty. The Mississippi Market Bulletin

Review, as it is nicknamed, is the only similar olina Mountain State Fair in Fletcher. A cou- was started in 1928. Today it has 37,500 sub-

state publication that does not have the word ple told Graham that after reading his column scribers and is posted online five days after

"bulletin" in its name. What it does have is about the fair, they drove nearly 300 miles publication, according to Claude Nash, who

has served as editor for 28 years. "We still fill a need and what we do still
works," he said. Whether they seek hundreds of acres of
farmland, second-hand machines to plant and plow with, heirloom seeds like their grandfathers sowed or handmade quilts like their grandmothers sewed, thousands of market bulletin readers scattered across the South and beyond still find comfort and aid in the pages of their market bulletins.
-Arty Schronce is a regular contributor to the Farmers and Consumers Market Bulletin.
A sampling of masthead designs for the Georgia Market Bulletin
through the years.

Find Georgia Agriculture Online! www.agr.georgia.gov

www.facebook.com/georgiangrown

@GeorgiaGrown: https://twitter.com/

@GaPoultry

@Iamgeorgiagrown

Georgia Grown: https://www.pinterest.com/GaDepAg/

Notice
Ads for the March 29 issue -- including Farmland for Rent or Lease -- are due
by noon, March 15.