DEPARTMENT DF STATE
BEN W. FQRTSDN, JR. SECRETARY CE STATE
ATLANTA 3, GEORGIA

Churches, I^iscopal

Reel No

St, Paul's B^iscopal Church (of Augusta) Positive

Richmond County

filed in

Church History (two volumes) 1750-1933

In ' possession of: St. Paul's P^iscopal Chi rch Augusta, Ga.
Date microtilmedt Feb. 9, I960

MICROFILMED BYI HORACE MEWBORN

Georgia Department OF Microfilm Division 1516 Peachtree ST,, NE Atlanta 9, Georgia,

Archlvea

and History

history of St.PAUl'S CHURCHS3
1750 - 1928

HTDEX. LIST OF St.PAUL'S CHURCHES. BISHOPS - 1821 - 1928 - -

missionaries

PRIESTS IN CHARS

RECTORS - 1826 - 1924 -

-

mSER OF BAPTISMS .COlimiCANTS .COKFIMATIOIJS ,

IIARRIAFES A:H) BURIALS - 1720 - 1930

4

^RLY HISTIRY OF St.PAUL'S PARISH AND FIRST

CHURCH.

7

SECOND St.PAUL'S CHURCH.

17

THIRD St.PAUL'S CHURCH-

18

LAYING THE CORNER STONE OF THE 3rd StPAUL'S- 21

DESC07ERY OF THE CORNER STOKE OF THE 3rd.

St.PAUL'S IH 1916.

22

FOURTH St.PAUL'S CHURCH

25

NOTES REGARDING THE PARISH AND CHURCHES

30

LIST OF THOSE FROM THE PARISH THAT SERVED IN

ms TORLD'S V/AR.

36

THE CHIMES OF St.PAUL'S

_

37

INSCRIPTIONS ON THE BELLS

41

LIST OF THOSE THAT HAVE SERVED 0N THE VESTRY

TEN YEARS OR MORE.

i g*.

44

GIFTS AND MEMORIALS THAT '.IfERE IN THE 3rd

STPAUL'S CHURCH DESTROYED BY FIRE IN 1916

45

LIST OF SUBSCRIBERS FOR THE PURCHASE OF A

BELL FOR THE THIRD CHURCH

--54

LIST OF FXraNISHINGS AND MEMORIALS SAVED FROM

THE 3rd CHURCH DESTROYED IN 1916

56

NAMES.DATES AND EPITAPHS COPIED PROM ALL OF THE MARKERS IN St.PAUL'S BURIAL GROUND IN 1914-58

niUS ORATIONS.

CROSS MARKING THS CORNOR OF FORT

AULrUoTA"*

mm

__

PAOS

BISHOPS OP THS DIOCESE OP GEORGIA

3

PROPOSED PLAN OP THE PIRST ^^'J^2FR0K THS ORIGINAL DRAFTING IN T^ ^EUI. OP THE ARCH BISHOP OP CANTABERRY IN

LONDON

c.

B/iPTISIMAL PONT BROUBHT OYER BT THE MISSIONARIES ABOUT 1751

Pi:OTOGRAPHS OP THE INTERIOR AM) EXTERIOR OP

T1 E 3rd CHURCH.

--19

PHOTOGRAPH OP THE PLATE POUND IN THE CORNOR

STOKE OP THE 3rd CHURCH

---23

PHOTOGRAPH OP THS SERVICES HELD IN THE CHURCH-

Y/JID THE SECOND SUNDAY APTSR THE DESTRUCTION

01' THE 3rd. CHURCH

-34

MIJIORIAL 'lYINDO'i/ OP THS REV.G .SHER'.VOOD '.VHITNEY.SS

Pi;OTOGRAPHS OP THE 3rd AJiD 4th CilURCHES-

35

CHIME OP ELEVEN BELLS.

39

Cl OISTER BET'YEEN THE FOURTH CHURCH AlID THE

Pi.RISH HOUSE.

43

SCULPTURED DOOR IN THE 3rd CHURCH.

- - 46

Cl'JUJE MaiORIAL BAPTISIMAL PONT.

51

Ml MORI Ji T.ABLET IN 1.EM0RY OP BISHOP PDLK. 3\-

55

S'.'ONE FIGURES OF GABRIL AND kiCHAEL THAT NAS

II THE THIRD CHURCH.-

i

57

THE PHOTOGRAPHS .YERE MADE BY Dr.L .Vf.FARGO.

CHURCHES 0? St.PAUI'3 PARISH. 1750 - 1938
1st. St.PAUl'S CHURCH BUILT IN 1750 DESTR0Y3D DURING A BATTLE OF THE REVOLUTIONARY V/AR IN 1780
2nd. St.PAUL'S CHURCH BUILT IN 1786.THIS building -yas rei.;o;'ed in ibis.
3ed. St.PAUL'S CHURCH BUILT IN 1818 ff^KOYED BY FIRE KARCH Snd, X^jLo
4th. St.PAUL'S CHURCH BUILT IN 1916 NO"/ STAI/DING 1928.
4^

BISHOPS.

>

Bishop Bowen

18E1 1837 Confirmed

" Elliott

1841 1866

"

TT

Beoicwlth 1867

1890

"

Helson

1891 1907

. "

n

Thompson 1891

Weed

1910

Reese

1907

Bishop Reese has confirmed to Au^st 1928-4E1

r-

Average oonfimation per year 15#7

1679

Bishop Thompson B.D. was Bishop of Kississippi

Bishop Weed was Bishop of Florida*
3There was no Bishop of Georgia -until 1841. Bishop Bowen of South Carolina offioated up to 1841.

HI3SI0NARIES

TO, ATO RECTORS CHURCH.
I'/SO - 1928 - '

OF- St.PAUl'S

MISSIONARIES.

Rev* " " "

Jonathan Copp Samuel Prink Edward Ellington James Seymore

1751

1765

1767

1771

i

PRISTS IN CHARGE.
Rev* Mr* Palmer Rev* Adam Boyd

1^79- ? ? -1798

RECTORS.

Rev. Hugh Smith

1820-18S2

n

Edward Ford- ----------- 1832-1861

William Clark-

1861-1878

Chaunoey Williams*

1878-1907

G.Sherwood Whitney

1907-19^

Julius A.Sdhgai - -- -- - -- - 1924-4^^1 *3)

^tnwv

"

jofrlN

HtN

---- - -

fin-

FROM THE RECORD BOOKS OF St.PAUL'S
PARISH. JANUARY 17S0 TO AUGUST 1930.

BAPTISMS

Boot 1 Book a Total. 2180 - 366 " 2546

COMMUNICANTS & CONFIMATIONS. 2179 - 381 - 2570

MARRIAGES

512 - 268 - 780

BURIALS

1442 - 287

6313 1312

Marriages two entries

Total names enter!

- 1729
7625 780
8405

ms FIRST St. PAUL'S CHURCH.1750.

Rev. James B.Lawrence, Rector of Calvary Churoh,Amerlous ,0a. for some y^rs has been oolleoting data for a history of the Churoh In (Ja. He has been assisted by Col BeRenne.of Savannah, who is an ardent oolleotor of boohs and old dooaments. In looklnh through the arohlves of the Society for the Prooogation of the Grospel in Forelirn Parts,at their office in London,ColohelaL}^Renne disooverd the drawing of the proposed Churoh, at Augusta, Ga. He had a number of photo graph oopies made of it,and presented one of than. to St. Paul's Churoh. The above is taken from the Churoh Bells,Vol Vll, No.8. January 1914.

Under the drawing of the exterior of the ^huroh on the upper left corner,is the following.
"The froame o^ the Church is of wood,so strong that it will last for many years.Between the sides there is a wall of olay eight inches thick,supported in the oenter of the olay with pieces of wood three inches thick,let into the sides by grooves.
The outside to be left rough,with lime and gravel, appearing like stone* The inside plastered and white-washed, and arched, ffe propose to have these arches handsomely ornamented when we are able to pay for the same. The underpinnong of the Churoh will be bricked,but at present the Churoh is supported with logs of lasting oak."
he Churoh is to be 50 ft.long and 30 ft wide.

In the lower left corner ie a plan of the
Churoh. The Pulpl* is in the oenter with the clerks desk In front of It.The first square pew in front of the pulpit la the officers

along the sides of the Chur^

with throe rows of benches in the rear.

*

HISTORY.

7

after the b4suiblduitnglitotfletheknofwonrtooinno1e7r3in6guAnutiglusta

1749, when Jkhere appears the first authentic

record of this little coaununity. In that year

Mr. John Frazer for himself euid others of AugAsta

delirerd a memorial to the Pirosldent of the Colony and his assistants in Savanah, saying " the

inhabitants of Augusta have subscribed a considerable sum of money for the building of a church, which they wished to build adjoining the fort."

The little town,whioh for 14 uears had been a

without a church,and for 14 years had never heard a sermon,began to build on the present site of St. Paul's church.
On Augvist 8th 1750 the Trustees in London read

a petAtion from the inhabitants of Augusta,requesIng them to procure for the town a Missionary,to be appointed by the "Incorporated Society for 4K" Propagation of the Oospel in Foreign Parts."

This tetltlon was wnterd in the Minutes of the

Society.

The following are a few (juotations

from the petition.

"That the town of Augusta in the said Province of Georgia is large,and con-

tains a great number of Anhabitants,and

is so great a distance from Savannah

(being at least 140 miles) that Mr.zoub-

erbuhler's duty at Savannah,and the adjoining settlements will not suffer htm

tp perform any duties in Augusta. The inhabitants of the said town of Augusta

have at their own ezpenoe erected a hand-

some and convenient church,and have trans-

mitted to the Trustees a petition to

procure for them from this Venerable Soci-

ety.a minister for said town.

f

A copy of this petition is herewith . inclosed,with a plan of the ohunoh.

The smallness of the Parliment Graht for

the Trustees

make it impossible

for the Trustees to engage a Missionary,

or to settle any stipend upon him, but they intend to grant the Petitioners the

ground for the church and church yard.

Also three hundred azres of land to be

cultivated for the support of the Minister

together with a Pulputp Cloth,and other

things they desire. The Trustees there-

fore hope and desire this Venerable Socie-

ty will appoint a Missionary for the '

said town of Avigusta.

One week later the Trustees of the Colony of Creorgla met in the vestry-room of St.torgarets Churoh in London.and passed the following resolutions.
RBS0L7EB,that it be recommended to the Common Council (the Exectutive branch of the Colonial Oovernment) to have a proper conveyance of the ground upon which the chtiroh is built at Augusta,and of the churchyard belonging thereto,also,to grant Three Hundred acres orland, to be cultivated for the support of the minister there.
RESOLVED,that it reoomend to the Common Council,to order some window glass for the windows of said church,as also a Pulpit Cloth,and Curnlture for the Communion Table,to be sent over when the Missionary is appointed by the Inooporated Society, and unCer his care.
Six months later the Society secured the services of the Rex. Mr. Copp as a Missionary to Augusta. He left London about May 1751 bringing with him the window glass,church furniture kk and a deed to the glebe land of Three Hundrel aoses. He arrived in Augusta about three months; later and found the church almost completed. The building was of rough timbers,but it was a church. The hearts of these Indian traders, smd rough frontiersmen would not be satisfied until it bore an outward, and visible sign of an inward and spiritual grace,and so they had | a steeple erected. They put within this a k ball. '.7e can Immaglne the feeling of devout pride when first it rang the call to prayer.
Every man in the congregation was an Englishman,and in their honest pride in the works of their hands,and the difficulties they had overwo#me here in the wilderness,they thought At no unworthy tribute to name the little churoh on f, the Savannah, after the historic Cathedral neat the banks of the Thames in London, and thus think' Ing of the great Missionary Apostle,they named their church SAIHT PAUL'S.

JUDGE JOSEPH R. LAIIAR In an address dellverd ,

on Daoember 2nd 1910 before the layman's Mission ,

of St.'t^aul's Church,has l>he following:

|

"Immediately ^ter the oompletdpn of^the first

St.Paul's Churoh*etters were written to the

Trustees in London,and to his Grace the Arch-

!

bishop of Canterbury expressing their thanks,, *

for what had been done in their behalf in send-

ing l,lr. Copp.in making a grant of the glebeflands,

and for the Church Furniture. One of these^letters

has been lost. Recently,and by accident,! came

across a reference to the other letter of Captian George Cadogan and his fellow Committemen written

I

from Augusta on August 31st 1751. I emmediately

wrote to London for a copy. The agent in London

found it in the Libary of the Archbishop of Can-

terbury in Lambeth Palace. By special permission

the original was transmitted to/ the British Muse-

um,and there the agent was permitted to make a copy

I believe that it;/ is the oldest document

extant that relates to Augusta. It is written in

the ancient style. The nouns all begin with

capitals. There is no punctuation. It is crude

and quaint,but it is filled with a spirit of

courtesy and appreciation for what had been done,

and somewhat naively suggests the need of further

assistance." The following is a copy of the lett-

er.

iLambeth Palace Library 1123)

HONORABLE GENTLEl'LM.

"As we Doubt not the generous Intention of the Trustees for the Establishing this Colony it gives us the greater Encouragement to apply to your Honours for this Particular District in order to render so useful a Frontier as religious as beneficial. - '71th utmost gratitude therefore for your Honours Complyanoe to our Petiton He return our thanks little Indead in Comparson to those Haplnesses you may expect for promoteing % work to which Eternal Rewards are annexed
The Letters from Mr. Martyn & Mr Vereljist from England & from Mr Habersham at Savannah acquainting us with the Arrival of those things you were pleased to grant are further Instances of your goodness for the better Establishment of yhe Township and improvements of its Inhabitants a

township which in our oppinion in its consequence as a Frontier shoul'd not be neglected - You have indead Honourable Gentlemen added a religious

Zeal to our private Interest which Already manlfas-

immediate Contributions of the other transient Persons towards the Minsters House for which purpose 120 pounds Ster., was soon subscribed and agreable to'^the

<w>

Reverend lir,C6pp we have fixed the dimenalona<'b

of it vizt S6 feet by 18 two atorya high, to

wofhioBhrioakKCithcihmenoenyaattoonceonetnadin18thfrotebyFir1e6 aPlaSotaecak

and an Oven - the whole to be oompleated in the

best & most expeditious manner "fe oan. A large

spot of groj^d for a Garden is some time Since

fenc'd in^ Traot of about ton acres quite

clear and good pasturage round the whole is to

bo so likewise the Rails being provided ' most

of

^thietmh

on the regars

ground to Hr.

for that Purpose ready. Copp's Salary the uommittee

have taJcen oare that his first years of 20 pounds

Sterling shall be oollected by the"i & Quarterly

paid without trouble to him - but here arises a

Difficulty - This district not being erected into

a Parish with proper officers,such as Churoh

wardens &o. and the oare of the Committee termat-

ing when we have finished the Hinisters House

we are at a loss without your Honours assistance

in the Case to make Suoh Salary Farmanent and

certain As the dispositions of ihnkind in gener-

al, with regard to Yoltintary Contributions are

not always to be depended upon. '.7e therefore beg

leave to recommend it to your Honour's considera-

tion whether its not necessary to Breot this

Township into a parish with Power to Church war-

dens to asses the Inhabitants according to their

oirounstatnes for the future payment of suoh Sala-

ry at least till suoh time as by-laws may bo made

by a General Assembly relative to whole Province,

We would not trouble your Honours for anything

we cod conveniently get here tho a Pall for

Fenerals Damask linen for the Communion Table A suoh Household furniture for tho Hinister'Houso

as Hr. Copp infer'd us You were so good to hint

the sending to him & whioh ho Seams to expect

would be necessary.

Wo found it requisite to have a Bell for the

Steeple & bought the largest Wo cod get in Charls-

town But wo find it much to small as many of

;

tho Inhabitants live at a groat distance from

the One

Church, & therefore of about 200 wt wod

of small benefit fully answer the

to them Intent-



ion but cannot be got in this part of the world

suoh a present would be highly gratful to \is The Recommendation of Hr. Copp(whloh we hope

he will answer) obliges us among your many

other Favours to Aoknowedge with the most Hearty i

Thanks your oare A goodness and throu your

i

Honours We also beg leave to offer the Same

|

Sentiments to the Venerable Society,

|

1

The goodness of his Grace of Canterbury

req^ulres from our gratitude a partlo\ilar Letter

whloh we hope he will not think presuming as it

oontains only the resxilt of Hearts truly Sensible of his great Benevolence and assureing that

his name will always live in these parts/

'.7e understand that your Honours have several

Books by You & we know no Place in this Province

where some may be more useful than here.

^ee are i'oath to add Request upon Request but

this as well as all matters submit to the sup-

perior Judgment of those who it is our Interest

as well as our duty to obey & to whom We are

with the utmost respect & gratude.

Your most obident Htunble Servants,

Ceo.Cadogn

John Rae

James Fraser

Augblsta

Jaimes Gamble

31 August 1751.

X)a. Luglass

The Rev. Jonathan Copp was the first Missionary sent over by the Society."The records of the Incorporated Society for Propagating the Gospel in Foreign Parts show that there was considerable correspondence between Mr.Copp and the Society. For example,the followli^g,whloh is enterd on the Minutes under the date of June 21 1754."
"A letter from the Rev.d Hr.Copp Mlfsionary at Augusta in Georgia,dated Maroh 30th 1754 acquainting that the Inhabitants have greatly increased of late,but his Congregation is about 80 or loo persons,and the regular Communicants are only 12,that at the request Of the u-overnor of South Carolina and of the Inhabltlants of Now Winstor in that Provience,whloh the House of Assembly were pleased to allow him 17 pounds Sterling P.annum without which gratuity he could not well have subsisted his wife and children. The Parsonage House was not yet finished, not tli the Glebe Cultivated."
Again on April 18,1755 the Minutes refer to a letter from the Rev.d Mr. Copp the Society's Mlfsionary at Augusta in Georgia dated Nov.the 6th.1754.acquainting,that the Parsonage House
was finished between 27ft in length & 18ft.in breadth with Kitchen annexed & would make a pretty good one wore there any glass windows in it; but for want of them it is uncomfortable

IP' Season. Mr.Copp says he oonstatly oiiloltites In the Church & Endeavours to explato k persuade his Congregation to practice of the Christion Religion,* he has the Satisfaction to see it held in great esteem (tho not without galnsayers) & to be more coutanced by many then heretofore: . . The niunber of his communicants is 15.Ho says t|jat his Situation is very dangerous,for that since tho defeat on tho Ohio the French Indians have been almost within tho Hoighborhood at an out Settlement, where they have hilled & scalped 14 or 15 persons <!> carried many into Slavery: he adds that ho had lately received and Invitation from the People of Norwalk in Connecticut,which if the Society shall appovo of * remove their present 2 ifslonary,He is willing to accept."
During all this time these people were asking and receiving assistance,they were at the same time doing all they could for themselves.
They had built a flhuroh.And Parsonage at a cost of 120 pounds Sterling,which considering tho purchasing power of money then,was equivalent to $3,000 now. The chxiroh and the parsonage had been destroyed in tho public service during the Indian war. Uhdl3couragod,they had begun to rebuild,and obtained 100 potuids assistance from Commons House Assembly,which in 1753 had succeeded to tho powers of the Trustees in London. Tho Assembly had established St.Paul's Parish and for awhile appropriated 50 pounds per annum to the support of tho Minister. But tho heavy losses and those heavy charges made it Impossible for tho citizens to bear all the expense,and while they paid a part of tho salery they were still dependent upon the Society in London.
They were not willing to remain without a minister,and again, in 1764,application was made to tho Society which appointed the Rev. Samuel Prink,M.A. a graduate of Oxford or Cambridge. He gave great satisfaction to tho community, wo learn from an entry of the Commons House of Assembly,in December 1765, reading as follows;
"A pottion of the Church wardens and vestry of tho Parish of St.Paul's in behalf of themselves and the rest of the inhabitants of the said Parish, sotting forth that in consequence of an application some time since made by the Petitoners of the Society for tho i'ropagation
tho soapei in Forwi^ Parts to sent them a

Missiomary.tlie Rev.Hr. Seunuel Frinlc A:M: a wor-

thy ,pioua .learned Clergyman has been appointed

for that Purpose and resided among the Petitions

near a Tear and aoq.udtted him in Pisoharge of |

his Function with universal liking and Approba-

tion."

The Rev. Hr. Ellington suooeded Hr.Frink being

sent over by the Society in 1767, Hr.Ellington

was a great Hissionary.and was seldom found

at home except on Sundays. He took Journeys

of over one hundred miles out into the distant

wilds. Under his care the Shurch grew and pr8>J'-

perd.

In 1771 he was followed by the Rev. James

Se0nnour,who continued rector of St.Paul's

through all the vicissitudes of the Revolution- ,

ary far.

During the war the fort was three

taken and retaken,and Hr.Seymour saw the Church

used first by the Americans as a barracks and

again by the British for other military,_pur-

poses. The parsonage house he willingly gave

up as a hospital for sick soldiers. In 1780

Lit.Col Browne,the British commander.realizing

the necessity of strengthing his defence^v

took posesslon of the Church and burying ground

enclosing them within a strong fortification.

In honor of Lord Oonwallls.who had recently

been appointed Commander-In-Chlef of the

Southern Department,the name of the fort was

changed to Fort Cornwalls. It was this strong

fortification which was besieged in 1781 by the

Americans under"Light Horse Harry Lee",father

j

of general Robert E.Lee. It was captured on

the 3d of J\ine after a desperate fi^t.

The old Church Yard became a battlefield,

drenched with the blood and sown with bones

of the slain. The Church and the fort were

destroyed by the f^e of one Am^ican cannon,

motinted on a tower(built of log^ thirty feet

high where the Cotton Exchange now stands.

I corner of Reynolds and Yih Streets)

Hr. Seymour was hunted down by a mob and

driven into the swamps, but after many priva-

tions he escaped to Savannah. '.Yhen hostllltes

were over he was invited to return and assumed

a welcome,but he would never return.

After the Revolutionary war the churchyard and the glebe being alien property \ras confiscated by the state of ^ieorgia. this glebe of 300 acres was a part of the original grant made to the church for the support of the rector by the Crown of England August 16 1750.

it exteniei from Center Street (5th.) to Jaokson (7th.) Street, and from the river to Gwinnett St.
Only fifteen acres had been cultivated, the rest was a forest. It became, whether ri^jhtfully or not,the property of the state, and was turned over to the Trustees of Richmond Academy
for Boys,who/' were also Thrstees of the town.

MISSIOS ARIES.

Rev. Rev. Rev. Rev.

Johnathon Copp Samuel Prink - Edward Ellington James Seymour- -

1751 1771

MISSIONARIES OF THE CHURCH OF ENGLAND SENT TO St. PAUL'S BY THE
SOCIETY FOR THE PROPEHGATING OF THE CK>SPKL IN FOHEIGBi ^ PARTS
OF LONDON .ENGLAND.
REV. JOHHARHAN COPP.
The following letter was written by Rev J.A. Copp only a few months after his arrival in
Augusta, November 34 1751.

^

It iA now six months since my arrival to

these parts .during which I have

^

the performance of the sacred and we^hty duties of relilon,axii waltel pationtly in hope

aociual^ing the Venerable Sooiety with eomethi^ agreeanle.both to their glorious and most religi-

^8 Tdews.as well as pleasing to my self,but not being abli oonsistent with truth and a good oonsol^orto magnify the effeots of >"y labors, or to

multiply enoomiums upon the place and the in^bitants^of it, I thought my duty not to neglect writ-

^"fh"e ar^about 80 to 100 persons ttot attend divine worship on Sundays among whom I

ed 16 belonging to this Colony of Georgia.and IZ more belon^n^to Carolina; for which purpose I

Save ;Sde^cS!sionally into ed,there being no clergyman setteled wlrhln 130

miles of this town. My communicants are eight, there

ILso^.

bull. .. yb. ..r Y.%

ir3C tr."^rs"^Sbnbnrb

Sbb.-

things wero

societv.and what I

greater J^^ug%ga^of^our lives - the merciless srtiLrsJf b r-

fTTW=*i

the wild.uncultavat^ wildness.

Upon the 5th of last month I arrived at Charles Town upon some business-two days after whioh. departed this life the Reb* Mr. Stone, the Society's late worthy missionary at St.James, aoos Creek; since whioh I have received a unanimous invitation from the Church ^fardens, Vestry and parishioners to take upon me the charge pf that parish. I hope ety,*oonsidering the many difficulties that I labor under here in a long absence from my fSJly, ^^are maintained at a Haw 'England and under I know not what difficulties, wouia^e pleased to appoint St James Goose Creek, where I trust all iioonvenlenoes will at onoe be I am willing to serve the society in
L-
r Er Sries, within the space of twelve months, having been removed by death.
Ploaae oresent my most dutiful regards to the

I Signed) JOHAIHAH COEP.

- to 5- ^8- ^S ,`'^.tteH r tSC r ^ m^tbs on H that m missio" n.

STw;' o years tJaltteer^inee w wrSt^hLe that thceonit^ inaub e it

ants have

-rUt Concourse of absconding

to increase, by Debtors talcing

" hones of protection, but u *he*same in number, about

his congregation

re^ar communicants are

80 or 100 P"f ^^tiSd In toe province of Georg-

only IS. He had _ P

tshildren from April preced

ia 8ind South arolina

hnnt 15 miles'among the

tng.and he had twice rode

their chil-

new settlers and P^^^ |t hto visit to them;

dren, and

^L^ost of the Governor of

He had moreover, ^,,^`^j.g^bitants of How Wind-

South Carolina

^

^^4 preached dnce

I^'a mVto to^elelir^hlcJ the House of Assembly

pleased to allow him 17 pounds sterling per annum, without whloh grantuity he oould mot very well have subsisted. The Parsonage House, which was promised him, not being yet finished, nor the Grlebe oultivated. Hor were the promised subsorlptins of the members of his oongrefation duly paid.
Later things began to look brighter. A letter from Mr. Gopp, dated November 6th,
1754 stated that the Parsonage House was finished. It was between H7 feet in length and 18 ft, in breadth, with a kitohen annexed, and would make a pretty good one,were there any glass windows in it, but in want of them it is uncomfortable in the winter season. Mr. Gopp says that he constantly offloated in the Ghurch,and endeavors to explain and persuade his congregation to the practice pf the Ghrlstlan religion, uid he has the satisfaction to see it hels in great esteem(tho* not without galnsayers) and to be more coiintenanoed by many more than heretofore; ha has baptised in the preceding half year 18 infants,and the number of his communicants is 15. He says that his situation is very dangerous,for that since the defeat on the Ohio,the French Indians have beenalmost within that neighborhood,at an out settlement,where they killed and scalped 14 or 15 persons,and carried as many more into slavery.
Subsequently,Mr. Gopp accepted a call tp,Connecticut, and was sucoeded by Mr.Frink* who,inaddition t to his salary was to have the Parsonage House and the Grlebe of 300 acres of land.
MR.DUNCANSON.
As it wouldf quite a long time before Mr. Frink oould arrive, tfie Vestry Invited a Mr.Dunoanson to come to them from Savannah, hearing he was nof fixed there,nad were greatly pleased upon the occasion,but unhappily soon found themselves dlmappointed in their expectations,for Mr. Duncahson had not been with them six weeks before an irregular conduct in him showed itself,if an excess in drinking and profane swearing may be termed so. Vftiile they were attempting to reclaim Mr. Huncanson from these irregularites a peace warrent was sworn out against him by on whom Mr.Dun-
oanson at first had challenged to fight a duel,and afterwards attempted to horsewhip him,from which being prevented,he did actually present a loaded pistol to his breast with threats and menaces of shooting him ,and after Mr. Duncanson had complained to a magistrate of some imaginary injury he had received from the other, which being examined into

appered groundless and frivolous. From Mr.Dunoeuison^s conduct they concluded
him incapable of forming the great principals of religion in the minds of many unlearned people that are foundin the remote parts of America, who are more generally more apt to be taught by example than by precept. ;hioh goes to show that Mr. Copp's labors had not been in vain,and yhat he had at least astablished a proper standars of Clerical behavior.

r SAMUEL FRIHK.

Mr. Frink wrote vinder date of 19th,January that the gentlemen who applied to the

a mlBsionary .treat him with respeot and endeavor to

make things as easy as theyjjan,

with eve^ partloular mentlbned

'

because the 17 pounds sterling for preaching at

Hew JlnAsor will be lost to the



removing of Fort Moors.higher up the river, '^e

CtlolTof marriage will fall vastly shor>, as t^e

war has greatly affected this settlement, and from the school nothing can be e^cpeoted.
The followingj year, he wrote that his sit

iiatlon was disagreeable in the highest degree. ^riow sort tove no religion at all, ^d public
nnwahin iq ksot uB Only by a few gentlemen and

fhftir familues whose example may in time introduce hH Maltt la sra.tl, l.palr.l b,

ot tbo ollaata. but not a a Pnoj;"'

the uerformanoe of his several duties, -tll^enaeavor to discharge, so long as the Society

shall be pleased to continue him here. The nmber

of inhabitants in the Parish of

?_.^501

^mcusta is 138 men and 402 women and children,501

neero slaves and about 90 Chickasaw Indiands. communicants on Jhit Sunday wore fowr men

and^thirteenfW^on^e

Wardens and

St Paul's Parish in Augusta in Georgia, dated AUKUsta, May 8th, 1765 acquainted the Society wi^
the arrival of the Rev. Mr. Frink, and returning tt .hanVH for the appointment of so worthy a mission-
whose exceptional conduct has already eggagod of all the parishioners. They are sorry
to observe tLt sevoril of the emolumentac^putdc^ ienUonSrinheir letter of March 1763. are much

reduo^

health broke down under the effect

of the'clim^e! He went to -Savannah and was suocede5 5y Rev.^dward Bllington. a great missio^ry. MK who did much to upblld the Church in Augusta.

jNO

6
RSV. EB'/TARI) KLLXHOTON.
Rot. Mr. Ellington was well received by Mr. Frink, and by the Governor. He arrived Hovember*12, and was "Collated and inducted." Ho performed services once evory Sunday,and praticulay days as were usual,till he got into the Parsonage,which was not quite ready for him, and till then his residencoj was some miles from the Church.Since he has been jt in his hoxLSO,he has had services twice on a Sxinday
In the afternoon he reads prayers and catechies the children, and he has the pleasure to acquaint the Society that his congregation is daily on the increase. He has administered the sacrement thrice, the first time to seven, the two others to eleven persons. He writes that there is not one place of any denomination within an hundred miles of Augusta, either way, and therefore he has endeavored in some degree, to remedythid inconvenience. Ha has been thrice to 3t. aeorgr's Parish, generally setting out on Monday,travelling between thirty and f^ty miles that day, performing ^^7^ ^ervices Tuesday, Wednesday and Thursday, at three differ ent places in the Parish, about ten miles wiCe of I each other, and returning on Friday. other settlements aver the river SaTOnnah, in Carol, na.the one about seven miles where he goes once a fortnight,the other about ten miles,where ho goes
once a month in the week days,at which place nmbers attend. Since he has been baptised 176 Chtldren and two adults, married 15 couples and buried 12 corpses
^The people in general,particularly at a ^istanc< know little more of Christianity than the
His congregation is still increasing, and by the outward behavior of manynhere seems to be some good done. Four communicants
His custom is to officiate every week at some
dace or other around him. He is soon to visit place 100 miles distant, where he tos non aDolication from the people,though travelling at that season is both ^isagreeable^d da^ero^.
Subsoqently Mr. Ellington aooepted a oallj
Savannah and was suoooded by Ur. Seymour,who tos ro^esented to bo a deserving young man, sober
and discreet.

N

/ REV. JAmS SEYMOUR>

Mr. Seymour took upWe work with, enthusiasm

and oontinued Reotor t&rOugh the troblous times

of the Revolutionary War. A letter

^

him in September. 1781, give us "

glimpse of political and social ^d military

conditions at that time in Augusta.

u

special value as giving us the

point of view. He writes that ever 3^"

the Church in Augusta

iJelf

raise her head , and indeed, Christianity itseir

of the rebellion he met with leading men of his Parish who were of

he w^ freauently thrwt^i

11?^^ aJ ^ast,

received no

that thS^^aoontinued

however, became so offensi^ mt J^y^ais

Sgo t^cSS for fear of beU deemed what is mAvaiAA and treated aoooi^ingly

H. *14 so. and TO. v.ry pnnot-

try. as far t^LStLtHhen left

a fortnight* tony

Qft,,th Carolina. The loyalist

Zi

had

*TnJ t

jnasaln. ;oo

""

rjj"

to'ta.

"'`SiSr Sm moLiS"on tDe opposll. sld.

5f UielL5!SS^ting to be plund-

ion are not to oe

nivaa in danger*

.rjd. aM

taallaad tor a Oan.

hugely careful to prevent plundV*

Hine of his prinolpal parishionera besides

himself, were carried as prisioners to the rebel oamp, where they were kept several days, but well used. This <ien. Williamson is now within the British lines, where his humanity is not unrewarded; this is highly to the honor of British offioers*
Soon after Mr. Seymour's release he went to Savannah, whore he stayed nine weeks; but hearing that his family was sink, by the advice of friends and the approbation of the commander-in-ohief, he once more ventured home, where he found one of his children a corpse and the rest of his family very

sick.

From mere compassion to his family he was

spared some months.

^

Not long after, happened the siege of savan-

nah. On the defeat of the French and rebels the

latter took post at Augusta. A whole regiment of

dragoons was quartered at his house, and a rebel

assembly, then sitting under the protection of

the post, the Church was made a hospital for sick

soldiers. Barracks were built on a part of the

Glebe; the Parsonage House and the Glebe, after

being divided into small parcels, were sold.

Mr. Seymour retired to a farm of his own a few

miles from town, whore he remained for a while.

On the capture of Charles Town the loyal

inhabitants s^jain got the direction of affairs.

A detachment of British troops was sent to Augusta that post deemed of importance in the back country.
And now kr. Seymour was once more happy in performing divine service in his ruinous Ch^oh.

Ho was again put in possession of his Parishnage House, which had been much damaged, and the outbuildings destroyed. At the request of ^J'^t.Gol. firowne, the commanding officer, he gave it up as an hospital for sick soldiers.
In September a large party of rebels came down from the mountains in the hope of suprising the garrison. They got possession of the garrison brav

ely defended themselves until they were relived. Mueli blood was shed.
.nen Augusta was invested Ur. Seymour was at

his farm, and, seeing no possibility of escape to Savannah, he fled into a deep, thioki

he remained in the greatest anxiety, for

and nights without any shelter.

'^!/hey

in searoh of him, who threatened hid lii, if they

fou^rSim; Lt it pleased God to have him esoape

undiscoverd.

So guard against

attack, the offiCyg

and ongieers thought it adviiable to make a forteess

at Augusta. The site of the Churoh was judged the most proper spot for that purpose, and the burying around, is now a strong fortifioation. The use of

the Churoh was thus lost. The ^ooiety ^y soon

oxpeot a letter from Col. Browne apologizi^ for this measure. Mr. Seymour has made applioation to Macart-

ney Campbell, Esq..for the use of a large house belong

ing to him, whioh he has geberously given

^

t^porary place of worship. But the continual a^ms

which they have lately been subject, has prevented

`"le^'is^iSS^a second time a refugee in Sav^h.

A nemerous banditti, aboyt two weeks before

this

letter came into the Parish of Augusta, ^d,besides,

committing various outrages, murdered 35

,

loyalists in their houses. Mr.

'

he hears since his escape, have been stripped of II SvervthlAg TOl^ble, even ot their clothing and pro^

<nnsi[ Th^garrlson is sufficiently strong for its own

defense but the rebels still continue in possession

of the Parish, whioh, if not speedily relleved,must

be

g parishioners have unamimously re-

quested hlm^ whilst he remains at oAnf thAin in the Conunons ^ousd of AsseniDly^ iooSrSly be tos ^Ln a seat there, which he hopes

meets wlth^the Society's ^PP^o^ation. He oasionally Assiata Mr.Browne. Governor /fright, bdth olyil ana m??mry^ve used him with the greatest kindness.
His salary from the Province has not as yet ulace the records of the funds from whence it

is draTO having all been destroyed in the fury of the

v^mAQ

TTe left his house in suoh haste that he

""I'brlSI irS.Utl. parocM.!!., a.r .ta.r p.pe

lnd*li tord to rsalld. do. tda blttar polftiaal f.klS of tdoa. ttodbloaa U.as dldrapt.d ta.ll-

"ii."S,STi;iatr, la Aasaata a.dad la a...-

inir disaster, but his example and his life had left their iim Suprreess upon the community. The ^p^eoptele toof htih.e.

Parish, whe he ^d surreru

^

proffer

eS LSJr :trvlcef J^h^ie his name taken out of the

S.' SL^Sar

,iT plao. to ta. oo.tort.

and luxuries of a mordan oity. The young Republio, bom in the thorea of revolution, has grown ito a mighty nation.
The little trading post has become a great oity. The struggling mission has grown into a strong Parish. Le^ us thank God for the work of theae men who laid the foundation of the Parish life of St. radios Church.

SECOND St.PAUl'S CHURCH 1786 - 1818

n SECOHD St.PAUL'S CHURCH.

After the war,one of the first aots of the

Legislature was to rehabiliate the interest of

religAan in Augusta; and by an act in 1783 the

Trustees of the town were instructed to sell

enough of the town lots (formely the glebe) to

pay for the erreotion of a "House of '.Yorship

to the Divine Being," by whose blessing the Independance of the United States had been es-

tablished*

^

The Church vreis built by the iJrustees in 1786,

It was a small wooden structure. While the Episcopal Clergymen still officated

in th4s church,other denominations were allowed

to make use of it. In fact the Trustees in

1804 rented the Church to the Presbyterians

for five years.

For a number of years,services were held

by the Rev.Adam Boyd and the Rev. l.:r. Palmer. On November 26 1789 a solemn and notable

service was held to return thanks for the establishment of peace. Vx. Palmer preached the

sermon for which he received the thanks of the

vmile Episcopal Clergymen still officated in 3t.Paul*s the Trustees had not given a title of either the Church or the burial ground to the Trustees of the Episcopal Society.
i^ater an ernest effort was made by the Episcopalians to recover title to at least the Ch^oh Site.which had been theirs since 1750,and finely
in 1818 the Legislature tardily restored to the Trustees the Church lot,with the proviso, that should it ever be used for other than church,or burial purposes the property would revert to the State of Ceorgia.
Immediately on gaining control of the prop-
erty. the wooden building which the Trustees had erected for a Church was removed to the north-west cornex' of Broad and Kollocktllth.) streets where it stood for 96 years used as a store. It was torn down in 1914.
Used as a Church - 32 years Used as a store--- 96 years
128 years old.
EPISCOPAL CLERCYllEI^

Rev. Adam Boyd Rev. Mr. Palmer

1789 1798 /

THIRD St PAUL'S
CHURCH 1818- - 1916

Third St. Paul's.

Immediately after regaining control of

the ^huroh site,the small wooden Church was

removed and a brick church was planned and

carried to completion in 1?19 at a cost of

^30.000.00.

^

The Rev. Hugh Smith was called to the rec-

torship in 1820. After serving in that ca-

pacity for twelve yearS^&ucceeded by the Rev.

Edward Ford in 1832 who ^d a long and vigor-

ous ministry of nearly thirty years. His health

failed him about the opening of the civil war

The Vestry refused to let him resign,and

called the Hev..7illiam Clark as his assist-

ant. Dr. Ford died on Christmas eve 1862.

On the death of Mr.Fowd the Rev. llr Clark

took over the duties of Rector of the parish.

He carried on the work through the trouble-

som times of the war. He died in 1878 having

served as Rector of the parish for Seventeen

years.

Rev. Mr. Clark was succeeded by the Rev.

Chauncey o. v/illiams D.D. in 1878. Mr Jilliams

hold the rectorship of the parish until his

resignetion on aoco\int of ill health in 1907,

having served the parish as Rectorfan^twenty-

nine years. Dr. ill lams moved to^^tTOffMgli&mjX ;

Ala. where he remained until hid death in 1927.| Ho was followed by the R^v. 0.Sherwood Whit* :

noy who continued the rectorship until his



sudden death on llarch 1 1924.

During the rectorship of Rev.Mr. 'Vhitney,

Augusta was visited on the evening of i*arch

22nd 1916 by a disastrous conflagation, which

destroyed some thirty blocks of residence and

business property, and left six h\indred

ies homeless. Among the unfortunate families

were abot eighty belonging to St.haul's Con-

gregation. One of the greatest

the fire was the destruction o

and the Parish House. The rarish House had

been built only four years.

--^An account of the destruction of the Churchl

may be found in Historical Book No.2.

^

RECTORS OF THE 3rd ST.PAUL'S. ^

Rev. llugh ^mitli - ----- l82o-i8i52

Rev. Edward i^ord- ----- 1832-1861 ^

Rev. William Clark- -

1861-1878 S

Rev. Chauncey Williams- - - 1878Rev. 0. Sherwood Whitney- - 1907-

^ AUGUSTA HKRALD. ?RIBAY JAimARY ZQ 1819

On .Yednesday last at 3 o'clock p.m. the Corner Stone of the Protestant Episcopal Church was laid in Ancient llasonic Order by the members of Social Lod^e No. 18. At 2 o'clock the members assembled at their Lodge-Room with appropriate emblems,insignia and decorations, and from thence a procession was formed which at the hour appoints moved to tge Church Yard in the following order -
Tyler with drawn Sword, Two Stewards with V/hite Rods, Knterd apprentices Two and Two
Fellow Crafts, I.laster i^asons, Secretary and Treasurer, Junior and Senior ,/ardens, Knight Templars,
Ilusio, A Brother with golden vessel containiiig
Corn, Two Brothers with golden vessels containing,
Tine and Oil, Principal Architect with Sqtuare, Level and Plain,
Bible, Square and Compasses, Carried by the oldest member.
The Chaplain, The Chief Kagistrate of the City,
The Civil Authority, Two lights born by Paster lasons, One Li^ht born by a i-aster :iason. The l5ason of the Oldest Lodge, bearing the
Book of Constitution, Tv/o Deacons with Black Rods,
The Jorshipful Poster, The Sword Bearer with drawn Sword,
Citizens,
7/hen arrived at the ground,an impressive prave ms addressed to the Throne of Grace by the Rev'd liT. Bass, which was followed by an appropriate adderess by I.Ir, J.Hutchinson Hsa- in the capacity of Past ^,1-and Master - after which the Corner Stone
place, and v/hile pouring thereon vessels Corn, V/ine 6ind Oil, the Divine Blessi^ was implored on the Church about to be

o oi rTjnte iuln"itH ed nS? ta? tee s,rasntdaa?cfov ppa errplo latu e sbA earino.^i- n nns Puring ^he exercises two hymns were

l^o'rmedf

instrumental music were

DISCOVERY OP THE CORKER STOKE OP THE CHURCH BUILT IK 1819.

It is Icnovm that the corner stone of the church

built in 1819 was laid by Social lodge P.&A.ll.

of Augusta,for a full account of the ceremony is

found in the records of that society,but no stone

was visable around the foundation of the church.

Recently in the clearing of the foundation for

the fourth church,it was found in the northeast

corner at a depth of four feet in the ground.

Upon being unooverd it was found that it was two

stones one on the top of the other,and cemented

together. They were about three feet square,and

about twelve inches thick. UpAn prying up the

top stone,it was found that between the two was

a depression out out in the lower stone,about

one foot square,and a half inch deep. In the cen-

ter of this depression lay a copper plate about

six inches sq\iare,and upon this plate lay six

coin. There was nothing else in the receptacle,

and no sign of any documents ever having been

placed there,nothing but the plates and coins.

The plate was ooverd with virdigris,but on being

oleeuied was found to be engraved in script.

A photograph of this plate will be found on the

next page.

There wereeight coins as follows.

One five dollar U.S.gold piece.

Pour silver U.S.Coins.

One copper penny.

One Spanish Real 8 Real Piece.

The Spanish Keal was dated 1718. The others

ranging from 1804 to 1815.

These coins are in the safe in the office of

the Parish Secretary. (1930)

T

A PHOTOORAPH 0? THE PLATE P0U3JL IH THE COHHER STOHE
OP THE THIRD CHURCH BUILT DI
1819.

COHFIRl'ATIOH SERVICSS HELD IN THE rear op the church,oh the SECOND SUNDAY AFTER ITS DESTRUCTION.

FOURTH St.PAUL'S GH0HGH*

mm-^%"

Layin<5 the corner stone of_ the 4th. :ai;. raiu.

ieuiuox*

i^io

FOURTH St.PAUL'S CHURCH

4th. St.* PAUL'S CHURCH.

17

Immediately after the distraction of the

3rd St .Paxil'a steps were taken to rebuild the

Church and Parish House.

f

The following Sunday after the fire.services

were held in the hall of the "Daughters of the

Confederacy" at the Court House.

The pariah purchased a tent 50ft. in diame-

ter that would seat about 300. This was placed

on the west side of the church yard near the

Reynolds Street wall. A floor was laid.and

borrowed pews put in. An Altar from the St.

Andrews Uission was put in place. The first

service was held in the tent on Sunday of Holy

'.Yeek.

In a few weeks on account of the heat

the early ^Tommunion and the 6:00 p.m. services

were the only ones held in the tent. The 11:15

a.m. services being held in the U.D.C. hall at

Court House. After the first of July all of

the services were held at the Court House until

July 1917.

On April 2nd 1916 Confirmation Services WKi

were held in the Church Yard in front of the

Celtic Cross,at which time Bishop Reese con-

firmed a class of 26.

The Corner-stone of the 4th,Church was laid

on September 29th 1916 by Social Lodge No.l

P. & A.K. the Rev. P.F.Reese being present

and taking part in the exercises.

On Saster Sunday April 8 1917 the first

Service in the new Parish House was held. It

was held in the Sunday School Auditorium.

On Sunday April 22nd Bishop Reese con-

firmed a class of 19 in the same place.

All services after this w,re held in the .uditorium of the Parish House tuitil the con-

secration of the Church in I'-ay 1919.

The Annual Convention of the Diocese of

Georgia was held in St. Paul's Church /ednes-

day Ilay 7 1919 at which time the Church was Consecrated and set apart from all unhallowed

and worldy uses and devoted to^the worship of Almighty ftoo. There were four Dishops present

and taking part in the services. The Rt.Rev.

Frederick F. Reese of the diocese of Georgia,

the 8t.SwT* Kdward G.'Yeed Bishop of Florida,

the Rt.Rev. Arthur S.Lloyed President of the

Board of Missions and the Rt.Rev.Kdward A.

Osborn.retired Bishop of Springfirld.Ill.

It was a great and solemn occasion* Nor can the parish be too grateful for the privilege of thuB errecting and completing so ^eautifui a Church in so short a time after the destruction of the 3rd, St.Paul's,
The exterior of the 4th. Church is almost a duplicate of the 3rd. Church. The interior is in the Colonial Georgian style of arahiteoture.

Rev. Julius A. Schaad, Missioner of the National Council came to St. Paul's on l.aro& 1st 1924 to hold a Liission begining Sunday llaroh 2nd.
'Jhile in conference with the Rector,the Rev. G.Sherwood lYhitney on the evening of ilaroh 1st. Kr. Yhitney died very suddenly.
Later a call was extended to the Rev. Lr. Schaad by the parish,v^hioh ms accepted,and he enterd An the duties of Rector of St.Paul's Church on October 1st 1924..

RECTORS OF THE 4th.CHURCH.

Rev. G. Sherwood /hitney -

- 1924

Rev. Julius A. Schaad - - 1924-1931

Rev. John A. `.Tright- - - - 1931- 1956 Rev# John B. Hines ------ 1937.^ 1941

Rt. Hwniltem West ------ 1941 - /94J

HOTSS.

#1In 1770 the performance of ffllTine service
seems not unattended with peril# An act for the better security of the
inhabitants by obliging the white male persons to carry fire-arms to places of public worship, and provides that every such person liable to militwy duty shall on resorting on Soinday or other times, to any church, or other place of Divine VTorship within the parish where sjLCh person shall reside, shall carry with him a gun,or a pair of pistols, in good order,with at least six charges of gunpowder and ball,and shall take said gun o^^pistols with him to the pew or seat where such person shall sit ,remain,or about said church or place of worship,under the penalty of nz ten shilli^s for every neglect of the same#
One half of the fine to go to the Church Wardens and the other half to the informer.

V

Memorial History of Augusta.

Chas# C# Jones Jr# Page 370.

#a#

JOHATHAH COPP 1st UISSIOUARY TO St .PAUL'S

Although the Rev, Jonathan Copp found a congregation numbering one hundred souls,with eight communicants there was no parsonage,and the glebe land uncultivated,and there appeared but little hope of collecting the twenty pounds offerd by the committee# He continued to labor in the isolated field,with indifferent success and extreme poverty, for some five years: when utterly disappointed and fainthearted he accepted the rectorship of St. Johns in South Carolina. He died in 176H.
Memorial History of Augusta Page 170. J.C. J. Jr.

#3

31

RB7. EDWARD ELLIHGTOR

In 1768 this zealous and faithful rector reported that St.^'aul's Church ivas the onlyplace of worship within 100 miles of Augusta*
During his three years service* he traveled over 5000 miles on horseback to minister to ills scatterd flock*
He baptized 428 persons - mostly children married 62 couples and raised the number of commxLnioants to forty*

REV* MR* PRIHK.
Rev. Mr* Frink the 2nd Missionary sent by the Society of Londonfound in 1765 ,
540 - Whites 501 - Slaves.
90 - Chaokasaw Indians* liar

#5*

BURIAL GROUND*

An act of the Legislatxire in 1818 recites that from time memorial that the lot in Augusta boxinded on the north by the river, east
by Washington Street, south by Reynolds St.* and west by land of Jacob Danforth,has been |L used as a^urlal place, and conveys the same to the Trustees of the Protestant Episcopal Church, 80 long as the same is used as a place of interment and of the site of a church,but on the failure to devote the same to such purpose, to revert to the state. The graveyard was foimelly larger than it is now, the western portion haveing been used for the interment of slaves, but In 1826 an act authorized the sale of that part, the proceeds to go to the Vestry, on the remains being removed and carefully intre'd in the new colored cemetery, and a brick wall built on the linScormely dividing the white and colored burial groiuxd*
J.C.J.Jr* Page 572

#6
2nd at.PAlJL'S CHURCH.

The End St. Paul's Churoh was built by the

Trustees of the Rlohmond Academy In |:786,and

was under the control of that board for 32

years.

After thr restoration of the Churoh and

grareyard to the Trustees of the Episcopal Socie-

ty in 1818, the small wooden chxLTOh was removed

to the north-west corner of 11th (Kollook) and

Broad Streets, where it was used for a store for

96 years, bei^ torn down in 1914.

Used as a church - - 32 years Used for store - - 96 "
128 Years old.
T.T.Cumming#

#7.

PRIESTS IH CHAROE.

In 1786 the second Church was erreoted on the site of the first Churoh,
In 1789 the Rev. Mr. Palmer was in charge of the Church. "On November 26 1789 a solemn and notable service was held to return thanks for the establishment of peace. The Governor, Clergymen and State Officials all went in a procession from the State House to St. Paul's Churoh, The Rev. Mr. Palmer preached a sermon for which he received the thanks of the Assembly.
The Rev. Adam Boyed was in charge of the Churo for a nxu^ber of years, his pastorate closung in 1796.
Prom Dr. '.Yilliam's address delivedd in 1906.

,

#8

January 30 I861.

3"3

Moetiing of the Vestry of St.Paul's Church.

Mr Charmlohael of the organ oomoilttee read a

letter from Messrs Jardin & Son Organ Builders

of New Ywrk,

After the reading of the letter the follw-

ing resolution was passed.

RESOLVED that the proposition in said letter to gurantee the payment of the organ^hy either depositing the amount in New York, or getting some reponsible party in New York to give such a guarantee" is hereby preq^ptorially rejected.
RESOLVED further - that the state of Ceorgie having with promptness and almost unamimity, formally adopted, present Inconyeniences and all possible further disasters in placing Herself in a state of virtual Resolution for the sole purpose of securing her political and civil rights,prospectively threatened with violation.She not being under the pressure of external violation nor under fear thereof,it is hereby suggested to Messrs Jardin & Son that they find in the high character of the people of Georgia for principles illustrated by her recent Ordinance of Secession, the assurance that the hardens and Vestry of St. Paul's Church, Augusta Georgia(the Parish being a part of the Protestant Episcopal Church in the late United States,and its Wardens and Vestrymen being citizens of said State Of Georgia) may safely br trusted to fulfill their contract with Messrs Jardin & Son according to the letter and spirit there of.
RESOLVED that the Secretary communicate these Resolutions to Messrs Jardin & Son.

March 29 Meeting of the Vestry

1861

Moved and carried that Messrs

PCrry','"Charmiohel and Force be appointed a

committee to purchase and present to Mr. Edward

G.Jarden in behalf of the Wardens and Vestrymen

a testimonal of their high regard for his kind-

ness, and courtesey during his stay with us,while

putting in the new organ.

Minutes of the Vestry Meetings Page 9A

#9.

WHERE SHOULD THE 1st, St.PAUL'S BE BUILT?

In 1749 there appears the first authentic

record novr existing In reference to the life of Augusta. This record refers to the prelimary

public movement, out of which St,Paul's Church

was built and organized. It shows that there

lived in Augusta the ancestor of that useful

unpopular citizen,and whose numerous desendants

are still with us to this day,who carries around

the subscription paper. He secured the necessary

pledges with which to build the first St. Paul's.

A great question arose as to where the build-

ing sho\ild be erected. It was first decided that

that it should be erected "adjoining the Port,"

as being a place of safety from the danger of

attack of the savages.

But some thought it

should be put on the extreme outer edge of the

town, out beyound Ellis Street on the Common,

where Greene Street is now. These seem to have

carried the day, and on July B6,1749 Mr. James

Eraser,for himself and other Augusta parties,

delivered a memorial to the President and Assis-

tants in Savannah, stateing that "the inhabitants

of Augusta had subscribed a aonsiderable sum of

money for the building of a church there, intend-

ing to build the same adjoining the Port. But as

many inconveniences might arise from such a sit-

uation, they now desire that the same may be built

on some part of the Common belonging to the town."

Thereupon,it was orderd that they be "authorized

to take a piece of ground on the said Common, not exceeding two acres,to build the said church."

But when the committee returned from their long

and perilous Journey to Saaannah, bringing with

them the Deed to two acres of land and permission

to build the church on the Common, they were met

with loud protest from many, who no doubt announc-

ed that they would never attend a church built

in so remote ahd dangerous a situation as Greene

Street. They insisted that they would withdraw

their subscriptions unless the Church was built

"near the Port" as originally intended.

They prevailed, and now the little town,whioh,

for 14 years, had been without a church, and for

14 years had never heard a sermon, were to have

their church built on the present site "within

the curtain of the Fort .under the cover of its

guns."

From Judge Joseph R.Lamar's First Days of St. Paul'^s Church.

#10

SALARIES IM 1865

On April 17th 1865 the Vestry of St Paul's

Churoh voted that the salary of the Reotor be

determined upon for each month seperately,and

d

all salaries in the Parish for the^same length

of time*

1

It was voted,the Rectors salary for the

month of April be jlSOO.OO, and the organist

|250.00 for the month, and the sexton ;j|>75.00

iui

It was also voted at this meeting that

I

the Reotor be requested to have a oolleotion

tfitken up quartely to go toward the expenoes of

i

the church, to prevent the neoessety of increas-

i

ing the pew rents*

#*K#

> I I i
i, --

'iMcir,

Trrr^tl,

iiotog3?aph male from Drawing

'

by Mlsa Martha Lee Mauldin

rtlBt for the ff.P.A. Historioal 'Hotk.

- 1936

FOURTH St. FAUXS CHURCH. 1916

LIST OP !PHOSE THAT SERVED IN THE
WORLDS WAR PROM St.PAUI^S PARISH.
1916 1917

Will Allen Thomas Barrett Clarence Barrinoski Fraser BleaUey Walter H. Blehl Levings Broum RocLney S. Cohen William H. Cozart Henry P, Derry Amory Dunbar Robert C. Eve Oscar Plythe Loyd B* Oreene Lcunar Hull Edmund Jackson Claiborne ICersh Julian M. Lyon
Leroy Muller Wymberly Oakman Thomas L O'Neil John H, Porter James Robertson Oeorge Schley J.Lonnie Stothart Robertson Wilkins J* Fraser SOfge Mrs.Lena Alexander George B. Barrett Louis B. Beckman Edward A. Bleakley George C. Brooke Lowers Brown James W.Cooper Don CTxlly Edward W. Dodge H.Steiner Dunbar Robert Fleming Jr. James Garner Henry HolfmaA Jessie 0. Irv^ Charles John^A\ n.

Pendleton King Alan Meigle Henri McGowan Theodore E. Ortel Harry Rivers Lenwood Pelot J.Righton Robertson Charles P. Mcnzie Glover Bailie Julian Barrett Marian Bleakley Charles M.Broome Charles Brotherton Henry H. Carter Martin Oozart John H. Davidson Estes Deremas Henry M. Duvall James W. Plythe Wyman Goodyear Prank Hull Robert A. Irvin Armand B. Johnson Joe Lee Evans Meigle Wallace Mo Laughlln Rob Oertel Stuart Phinizy Hines RobertsMS Robert A. Roth
Joseph McK.Speer Hamilton 7/ilkins Mrs. Louise Talbert
John H. Smith Rnbert B. Walton Mn?or E.C.B.Danforth Jr

if]W THE CHIMES OP St.PAUL'S

CHIIES. The following is taken from the Churoh Bells
Of August 1916.

If there is one thing more than another

which we have longed for in connection with

the restoration of the Church it is the ability

to put a chime of bells in the tov/er.

7e can think of nothing which would give more

pleasure to the whole city and help to spred

the ohuroh'S message of comfort that a sweet-

toned set of bells, ringing out the familiar

hymns with tneir appeal to all within so\ind

of their tones. A good set of Chimes would

cost about $6,000. and that is not to be thou-

ght of, unless some one or more persons v/oiild

give them as a memorial. If there is no one

in our own congregation v/ho is able to do this,

it would be a great thing for any citizen to do

It would be a great public gift to the city

and especially to St.Paul's.

-^e would fur-

nish the tower and provide for their care,and

use,and many a blessing would be invoked upon

the donor. Let us think about it,and meanwhile

we ttre going to build the tower strong enough

to carry chimes,should they be provided.

I
The CJreat Bell on tojj is the deepest toned bell t)f the Chime. When disconnected from its chiminjr connection, it can l)e used alone like any single church bell.
The ten other bells of the Chime are huiiL' in a s])ecially constructed frame of (Jeorgia Pine, as shown, made especially to fit the tower of St. Paul's ('hvirch. I

!THK CHBIES

The Chimes of St*Paul's Church consist of eleven bells* These are tuned to the feey of S flat with the chromatics ^harp 4 and flat 7 with F for the eleventh bell, virtiioh makes it possible to play in the keys of E flat ant A flat.
There has been arranged for the bells about 350 sacred and secular selections.
The largest bell is so mounted that when dis-- oontinud at the consol it can be used as a regular, or individual church bell.
The combined weight of the bells is 13187 pounds, as follows.

E flat F C A flat A B flat C D flat D E flat F

Bell 3000 pounds, n - 3100 " n . 1500
" - 1350 " - 1050 " - 900 " " - 650 " " - 550 " Tt . 475 n n _ 412 n
" * 500 " 13187 pounds.

The 6himes were placed in the tower of the ohuroh in December 1933 at a cost of 511005*^7.
The following is taken from the "Church Bells" of January 1934.

"The acquirement of the bells is due primarly

to the faitliful labors of a group of women in St.

Paul's Parish

These ladies, and their leaders

deserve the sincere gratitude of the Parish and

Community."

" On Sunday morning, December 33 1933, the

Church was filled with friends anL members of the

Parish.

After Horning Paayer and the Sermon,

the Rector standing in the Chancel began tie ser-

vice of Dedication, which was printed in an attrac-

tive Souvenier Program.

After the first prayer

had been said, the choir formed and marched down

the center aisle singing "For All the Saints ,'.Yho

from Their labors Rest". Stopping beneath the

tower, the Rector concluded the prayers with the

solemn setting apart of the bells for the glory

4.

^0

and. worship of God. Then as tthh<e oomregat:;lon s^od In alienee,the bells were first heard sending out olaarly the note of the Boxology to the tune of **01d Hundred" ,fhioh impressed

and thrilled the audience most deeply.

The choir then returned to the Chanoel and the service was concluded with an appropriate anthem (Gloria,from Mozart's 12th Mass.)
It was a notable and impressive ser-

vice and marks the accession of a most valua-

ble and beautiful feature for our Church prop-

er ty.

Rev. Mr. 7/hitney in the Church Bells.

The Chimes were first rung at noon on week-days Jemaary 19th 1924. Three saored tu4l2s being played each day, and each tune played through twioe. This has been continued up to the presant time.(August 1930.)

Wr!iiiia

Up to August 1 1930 the Chimes tove been ulayed on 2790 ooeaslons, playing 11.527 selections. AS each selection is played through twice it makes 23.054 selections played.

njscRiPTiosrs OK TH3 BELLS> lio* 1 (Oreat Beil"] To the Glory of God
and in Tlianksgiving for the Restoration of this Church
Destroyed by 5'ire, 1916 Rebuilt, 1918
Glory to God in thr Highest. (On reverse side.)
"The living to the Church I call, To the Grave I Summon all."

No. Z This Bell is Dedicated
To the \7omen Workers of St.Paul's Parish V/hose Faithful Labors Kade Those Chimes Possible.

No 3 In Memory of All Those
Who are Commemorated in the Gifts of Members and Friends of St. Paul's Church Toward the Purchase of These Bells.

No.

4 InTTemory of Those who have gone, and in
Gratitude for the life that was spared to us. The Gift of ALFRED S. BOURNE. LOUISE B. BOURNE.

No.

-- 5 ^ Loving Tribute to my Wife "
CORNELIA C. WHITE The Gift of TTTiTjTam B. WHITE.

No. 6

To the Glory of God And in Loving Memory of

JOB ALLEN AUGUSTUS WINANS CLARK 1859-1919

Actively Engaged in the Rebuilding of this Church and Treasurer of the Building Fund,

Junior Warden at the time of His Deat^, And of His Wife
HARRIET FARGO CLARK 1848-1911

Who, a Q.uarter of a Century Ago, Was One of Two Who Inaugurated a
Itovement for the Erection of Chimes in this Church This Bell is the Gift of Their Children

JOSEPH CHESTER FARGO CLARK CAROLUTS CLARK HOOK KAE LILLIAN CLARK
Rli:g out the Darkness of the Land Ring in the Christ that is to be*

7

--

THOMAS JARRAM '.TRAY, M.D.

1781-1861

Senior V/arden of This Churoh, ,'ijid His '.Tife

SARAH

TURPIN

1786-1831

JOSEPH CHESTER FARGO 1809-1878

Vestryman of This Chtiroh for Sixteen Years and His Wife

HANNAH CftLAIAN WRAY 1SS3-1878

Presented as a Memorial to my Parents and Grandparents

by

JOSEPH CHESTER FARGO, JR. Deoember 24|19E3.

8

To the Glory of God

And in Loving Memory of

GEORGE A, BAILIE 1834-1912

SARAH NELSON BAILIE 1844-1915

In Memory of
The Soldiers of our Country Who Made the Supreme Sacrifice in the World War.

10 IN MEMORIAN,
HENRY B. TUTT, 1834-1862 XmX B* TUTT, 1832-1904
Given by their daughter, EKIMIE T.GARDELLE and Grandchildren
MARIE, LOUIS, and ANNA.

1I3T OF THOSE THAT HAVE SERVED OK THE VESTRY TEIT YEARS OR EORS. 1856 - 1928.

'-U-

Gov,. C. J. Jenkins,

Senior '.Varden - - - - Kr. '.Y.K.L'iller
Vestryman- - * Junior 'Varden* Senior V/arden*

19 years.
21 years, 3 months.
14-9 " 96 years.

X!r. 'illiam Crane.

Vestryman-

- -- 14 years

Junior Varden- - -- - - 3 "

Senior Varden- - - - - - 18

35 years

hr. Joseph H. Day.

Vestryman- - Junior Varden*

years rr

32 years.

Smith. Hr. BH. - - - Vestryman- - - - 24 years

Platt. Hr. 9.A. - - -

"

27 years

'Varden 1 " Oaks. Geo. A. - - - - Vestrymar*

28 " 26 "

Dunbar. I'r.Barney- - -

"19 years

'Varden 5

rr

Clark. Hr. Jolui 7/. - - Vestryman*

Clayton. Mr. E.P.

Varden -

Robertson. J.I. - - - Vestryman*

Platt. Hr. V.L. - - -

-.

Fargo. Hr. J.C. - - Powers. Hr. F.F. - - Townsend, Hr. V.J. - -

^

.

^ ~,

"

Steiner.Hr. H.H, - - -

King. Hr. H.B.

-- -

^

.

.

Davidson. Hr. V* T* - -

" -.

Rusell. Mr. B.B.Jr.- -

" --

"

" 'T ^

. 'Varden -

Teague. Dr. N.A.

Vestryman*

Platt. i:r. 'V.E.

" --

Baker. Mr. C.H. - - -

" --

"

Tt ft rt

-Varden -

Ford, Dr. Dr S. - - - Vestryman-

Barrett. Hr. `V Hale- -

Tt _ _ ^ _

m

GIFTS AND ISaiORIAIiS THAT V/ERE IN THE 3rd StPAUL'S CHURCH DESTROYED BY FIRE IN 1916. f
A PART OF THESE mCORIALS VffiRE SATED AID ARE NOV/ IN THE PRESENT St.PAUL'S CHURCH (l^SS)
See note i'Q

THIS SCHXPTURED DOORWAY
WITH ITS DOORS OF OAK AlID BRONZE ARE A MEMORIAL OF THEIR
FATHER,SRANDFATHER AHD GREAT-GRANDFATHER. GIVEN BY CARRIE AND JDIIA CARTER.

aiFTS AIID 1ISM0RIAX3 THAT r3H3 IXI
THE THIRD CHURCH ^SN DESTROYED IN 1916

MEMORIALS IN THE 3rdj St. PAULAS THAT WAS DESTROYED MARCH 22 1916.

PACE

PRESENTED BY Altar of oarved. walnut. F.H.Miller Mosals Reredos - -- Mrs.J.P-King

IN THIS BOOK. - - - - 75-
48

Chanoel Chairs.Bishop A Jriest.

C.A.AW.A.Platt

48

Brass Altar Cross - Mrs. K.A.Steiner- - - - 48 Altar Vaoos (small) Mrs. F.H.Miller - - - - 48

Tjarice Altar taoes^Memorial to A.Taylor.

*

gift of brother & sister- 48

Brass Diptych. Gift of Mrs.T.Barrett Jr. -

48

Purple Hfiuigings . gift og Mrs. J.H.Day - - - 48

EmbroideqWhite Altar Cloth & Dossal

'

aift Mias ifUnny Cashin - 48

Communion Linen*in Mexican Work Mrs. L.L.Force.- - - 48

Embiroided Communion Linen. Mrs. F.F.Miller -'48 Communion Linen & Dossal. Mrs. H.B.Kimg- - - 48

Chalice Veils.Mexican drawn work.Mrs.G.W.Rains - 48

Chalice Veils (lace)

Mrs. St.Joim Moore- 48

Linen Cover for super-altar.Mrs.Alfred Martin- - 49

Dossal if Green Velvet. Mrs.

*4* * to

Candelbra. Seven Branch, (large 1 Mrs. W.Muiher^.- 49

Historical Tablet,commorating the founding of the

Parish. Erected >ytlie vestry

49

Credence and Table (Marble) by the Clark Memorial Society .Names of members.- - - - - 49

Bishop PoUc tablet, lilven by Bishop's Staff. ~ " ^9 Altar rail. From ohilhren of Bishop Polk.- - Baptismal Font. Ur. & mrs. iIf.E.Crane. This tos
destroyed in the fire. Repaoed by Urs. Crane. Also in memory of Ur.Crane.- - -43

Baptistry. Carrie & Julia Carter, daughters of

Urs. U.Uassengale.

,, ,, ,,,

.o

Uoaslo picture of the Christ Child.Mrs.S.T.J.Uoore-49

Baotismal Ewer. Mrs. Geo. w. Rains. ----- -49

^otem Lamp. (Antique) Augustine T.Whlte

50

Stone pedestal. - - Mrs. R.G.Tarver. - - - -

Set of service books for the Chanoel great Prayer Book of Edward vll.W.K.Miller-50

Stone parapet,with balustrade and stairway,

together with the Archangel statues in

stone. Mrs. Barney 3. Dumbar.

50

PulPit Brass, with base of gray marble,by the children of Mr. C.A.Platt. -

50

Brass Cross in the floor of the middle aitole

where the altar stood before the o^]^roh

enlamged.

Mrs. Mary Bulkleyi - 50

Sroupe of paintings whioh oover the wall over

the front door. - Mrs. John P. Kl^

Chanoel Window

Ladies Aid Sdoiety- - 50

;^elf on the side of Chanoel -Tinaow one_ ^

^ by Rev.H.Clark the other by Mrs.Clark

Window in memory of Mrs.Theodosia Ford .Nrs, Artemas Gould, Mrs.John P. King ^

Window il^memory of Josephine^P^tt^Mrs.C^s A^^

Window ii^iSmory of Mrs. Katherine Gregg_ _

MoCoy.Wm. H.

" "

Mrs.J.P.King-50

Window in memory or &raoe i>.

Window in memory of Miss Louise_W.Klng. Window iS^ieiory^S^Miss Mat tie ale^nder

,"refrd"S^hlin

bv Dr. DeSaussure Ford* ^ Tablet. Lmpbell. by Kdward F. Campbell.

. ^53 5S

Btorm Doors. Gift of Mr. James MoGowen. -

53

Brass Leotern. Memory og Rev.^W^H.Clark^

Chapel Altar!

The Messers Platt

Chapel Font. Members of the congregation.

63

wood Alms basins, memorial to Miss 5arah V.Hall-53

Bell for Churofe. - List of 42 names oontributing-5S
list op MKMORIAIS SAVED AT THE TIME OF THE pipj: may be fohhd oh page 56.

The picture hanging

slnf^ord

laat Supper was presented ^ty Krs.

(iaruer. March 19 1933

the Silver CODununion Service Trtiioh. was giver to the Church by the Trustees of the Colony of Ceorgia in'-1751 was lost or destroyed in the general ruin of the Church during the Revolutionary War,when all the Parish records were destroyed. The communion service now in use (1903)was bought by general subsoriptipn and each piece is marked with the name of the Church and the date 1820. Subsequently,the large Alms Basin was given by Miss Mary Clark,in memory of her father, and a small flagon of glass and silver was the gift of Mrs# Franklin Parrel#

IQ.:0RIALS.

The present Chancel (in the 3rd Church) which was added to the church in 1888, v/as undertaken and built in memory of the Rev, V/illiam H. Clark,

The Altar of carved walnut was the gift of I.Ir# and }'rs. Prank H. killer.

O^u. cLax

- .,

T

The mosaic

is a memorial of X.rs. John

P. King, the gift of her son Kr. Henry B.

King.

The chancel chairs for Bishop and Priest were given by kessers C.A.& 7/llliam L.Platt.

The brass altar cross v/as given by krs.Katherine A. Steiner.

The Altar vases tliat stand on either side of the cross and also the brass rest on the altar were given by krs. P. H. killer.

The large vases are a memorial of kr. '7illiam A. Taylor of Hew York, the gift of his brothers and sisters.
The brass ^iptyoh, framing the consecration prayer in the Communion Office, is the gift of lirs. Thomas Barrett Jr., in memory of a little child.

The purple hangings for Advent and Lent, are the gift ajid handiv:ork of Urs. Joseph H.Bay.

The embroidery of the white altar cloth and Dossal, the gift and handiwork of kiss Parmy Cashin.

A set of Hommunlon Linen in kexican drawn wonfck the gift and handiv/ork of I.Irs. L.L.Force.

A set of embroidered Communion Linen,the gift of I'rs. p.H.killer.

A set of embroidered Communion Linen and a Dossal of white silk, the gift of krs. H.B.King.

Chalice veils in kexican dra'wn work, the gift of krs. C.'.7.Rains.
A set of lace chalice veils, made ^d. given by

A linen cover for the super-altar, the gift of i:rs. Alfred i:. Llart in.

A Dossal of green velvet, the gift of I.rs h.P. Baldwin*

The seven-branched candlesticlcs are a memorial of lirs. Sarah Virginia Butler, the gift of her daughter Krs, 'Villiam L.ulherin*

The Historical Tablet commemorating the founding of the Parish and the services of its Colonial Rectors v/as erected by the Vestry, December 1st 1916.

The Ilarble Credence and Table are a memorial of the Rev. -M. IT. Clark, and given by the Clark I'emorial Society, composed of the girl
in the Sunday School (In 1878, vis. Horton, Josie Platt, Carrie and 1-aud I.ntthewson. lizzie and Sarah Simmons, Daisy Jessup, Certrude Butler, lula Kean, Ida Goodrich,Belle
King. Louise de I'Aigle, Jessie Burtm,Frankie Ford Sallie and -^^nnie HacV/horter, l.aty Eppes, with*3arah A.Simmons as directress. Its cost
v/as .5669*00.

The tablet to Bishop Polk v/as given by the officers' of his military Staff.

The altar rail is a memorial of Bishop and 1-rs. Polk, the gift ot their children.

The

font of white marble is a memorial of karia Isabel Crane, aged 4 years and '-/as given by
her father and mother, kr. & Ii.rs Jilliam H. C rane.

The Baptistry with its tiled pavement and its steps of stone, and the sculptured doojr.vay, with its doors of oak and bronze, are a memorial of their father, grandfather, and great-grandfather, given by Carrie and Julia
Carter, daughters of krs. k.kassengale.

The moasic picture of the Christ Child is in memory of a little boy, Flournoy Carter hoore, and was the gift of his mother, k.rs. St.John lloore*

The brass baptismal ewer is the gift of krs. George '7. Rains*

so

The Antique Lectern Lamp is a memorial of An^s-

tine T.White, the gift of his wife.

|

The Stone pedestal is the gift of l.:rs. H.G.Tarver-

The Sagle Lectern was given by Hev# Oliver H. Raftery in memory of his wife Uary Clark,, only child of the Rev. W*H.Clark.

The folio Oxford Bible and a full set of service books for the Chancel were given by i:r. and Hrs. F.H.riller, to mark the beginning of the Rectorship of Dr. Williams, January 13th 1878-

The bookmarks were given by Urs. '.V.H.Crane ,and the silver crosses by I'.rs. 7, Edward Platt.

A set of service books for the Chancel and the great Prayer Book of Edward Vll was given by i:r. v;. IC. filler.
The stone parapet, with balustrade and stairv/ay, together with the Archangel statues in stone, are a memorial of Pr. Barney 3.Dunbar and the igift of llrsi Dunbar.

The brass pulpit with base of gray marble, is a memorial of Pr. Charles A.Platt, and ms given
by his children. rrs.Pary E.Shepard, Prs. Sarah A.Simmons, Prs. .inna C. Heard, llrs. Lily T. Goodrich, I-iss Hatherine D.Platt, Kr.Charles
IT. Platt and Pr. '.V.Edmrd Platt.

The brass cross in the floor at the head of the middle aisle,is the spot where the altar stood before the church v/as enlarged. The Rev. hr. ^ord v/as, at his own request, buried there under the altar and the cross in its setting of Sienna Parble and mosaic, v/as the gift of Prs. Pary Adams Bulkley to mark Dr.Ford's grave.

The group of paintings which cover the v/all over the front door \ms given by Prs. King in memory of her husbeuid, th Hon. John P. King. The central figure la a painting of St.Paul,made from an original cartoon by the English artist Hojliday. The other panels are copies of the famous Evangelists of ICaulbaoh.

m

(Riitr
the CRAHE HEKOHIAli baptisdial pout

In the group of ohanoel windows, the central panel with figure of the Good Shepherd,was given by the Ladies* Aid Society!in memory of Rev. DR. FORD. The panels on either side were given,one by Rev. H. Clark and the other by l"rs. Clark.
The window in memory of Mrs. Theodosia Ford was given by some ladies, her personal friends, LIrs. Artemas Gould, Krs. John P. King and others. The window next to it was given by lirs. Chas. A. PlatYin memory of her daughter J03EPRIRF.
The KcCoy window is the gift of l!r. %n. H.lIcCoy in memory of his wife l.Irs.KATHARIKE GREGG KcCOY..

The

two windows near the organ were given by Mrs John P. King in memory of her daughters Mrs. Grace Sterling King wife of John B. Connelly, and Miss Louise .Yoodv/ard King.

The next window,wlth its suggestion of the resureotion, was given by Mrs. .Yllliam '.`'r. Alexan-
der in memory of her daughter Miss' MATTIE
ALSXAITDSR .

Mural tablets, in memory of Mr.RIGIIARD TUB1>-A1T, Dr.AITDERSOR '.YATKIRS ,Mr.GERRARD MoLATJGIILI!l, and Mr. SD'.YARD F. CAMPBELL, were erected by the Vestry. V
The tablet in memory of Dr.and Mrs. LEWIS D.FORD v;as the gift of their son,Dr. DeSaussure Ford,
The Ceuapbell tablet was given by Mr.Edward F. Campbell.

The church bell was b.oaght by means of a general contribution.

The storm door^ were the gift of Mr.James McGowan.
The brass lectern in the Chapel was given by the children of the Sunday School in memory of the Rev# `V. H. CLARK.

The Chapel altar was given by the Messrs Platt. Inlaid in the top of it is the small marble slab which once rested on marble columns and was the altar of the Church for many years.

The Chapel font was given by members of the oongre- ; gation .

The wood alms basins are a memorial of Lliss SARAH V. ItALl.

The ladies' Aid Society has made many and constant

gifts to the Church. They gave the cassocks

and cottas for the vested choir and replace

them when needed.

They pSiid for the steam

heating plant wiien the Church v/as last enlarged.

V/ith the aid of a legacy of $1,600 left

by Gov. Chas. J. Jenkins, the ladles built

and paid for the brick Rectory on Greene St.

In the past 28 years they iiave painted the

outside of the Church, they have decorated the

chancel,they have painted the whole interior

and have twice carpeted the Church and chancel. These are for the 3rd St.caul's.

List

of persons subscribed for the purchase of a Communion Service of Plate,a Communion Table
and a Baptismal Pont for St.Paul's Church Augusta, Georgia

Ann llilledge

- Jas.^^arrison - Karia H.Campbell

*^ohn Campbell ~ Sleanor L.Smith E. Gardner

Hrs. A-I;.Carter i-ary I'cKinne - Lrs. Hl .Valton

llary Sluyter - I'rs.A.Ounningham -L.Coleman A.P.E.Sla'nghter-Eliza R.Bacon-^^ary Smelt-

Samuel Hale-Laura Bryan-Samuel G.Starr-lIargaret J.Woolfork- I.Cunningham- toulsa L.Woolfolk

I'^ry G. .Talker-l'^arla VebstSr-Agnes I Clark A.Gregory*^ary Read-lirs.Course-R .H. ./ildT'rs.Caroline I'cLean-L.C ,Cantelon-S. Clayton

James JohnsonT Jane .r.llusgrove- icon Rebecca T.Baldwin- T.A.Brev/er-Rebecca Oocke- James Frazer- George ,7. Svahs-Ji.H.T'dLbmanI'rs. Ann Hampton- E.Hornby. S.Adams-l^r.Billon a.'.Vatkins-John Peterkin- G.I.Burroughs-J.Blaok-

John Garner-R.Thomas-Jno.H.Kimball-C.LaurensH.L.Sturges- S .I.C.Uorgan-Thos. J.V/ray-J.Phinizee

S.Hussell-Krs.Sohultz-Thos.n.Penn-J,J.PhillpH.Lamar- Auselm Bugg-John Bent-Val. 'alker-

LIST OF SUBSCRIBERS FOR THE PURCHASE OF A BELL FOR THE USE OF THE THIRD St.
PAUL'S CHURCH.
Rlohard Tubman - Geo. W,Evans - L.C.Cantlon - 1'. T.I.Parmelee - John Course - James M.Jones Anderson '.Tathins - John T. Gilchrist - F. Clarh E.F.Campbell - Htigh Smith - Henry wooster H. Lord - R.H.Muagrove - Fielding Bradford W.Waoon - D Sheldren - H. & G. Webster - R.D.thomas J.G.Cowling - James Harrison - ASloughter C.Lubuzan -- E.P.Ccunpbell James M. Carter Mrs. A. Milleie - Benj. H.Warren - Mrs. Sarah Adams - Richard Allen - Samuel G. Star S.B.Groves. - C.W.Gregory - A. Mitchell - William Jones - i.E.Clemn.
The picture of the Last Supper hanging in tha sacristy was presented by Mrs. Sanford
Gardner. March 19 19S2.
Bought of At Jt GOULEY, --^^WHOl^EPALE AXn RETAIL DEALER
BOOTS, SHOES, HATS and TRUNKS, 722 BROAD STREET, OPPOSITE THE MONUMENT.

^a^PEClAI, NOTICE-All Acconnis are to be settled Monthly.



thin Role must be by Speelal Arransement. PROMPT PAYMENT OP YOUR BILL Mill

be appreciated.

r

LIST OF FUHHI3HIEGS AHD IvEIiORI'iS 3AV FROM THE 3rd StPAUL'S CHURCH LESTROTED MARCH S2 1916.

40

" * The Altar, Brass Altar Cross, '^ichari: t

Candle-Sticks, two pairs Brass Vases, Bc-.;

Rest, Byptiohs, Processional Cross, Giiai. e

Rail, large 7-3ranoh Candelabra, the Bisho

Chair, Priests Chair, two Chancel-Seats, o

Prayer-Desk, the Old Communion Silver of 1

as well as the Small Silver Set of more re

date, four Silver Alms Basons, four sets o

Colored Altar and Chancel Hangings, all Hi

Altar Linen, the Altar Books and thr^e Cl.f!

Books, Brass Eagle Lectern from Sund y cf*3

Room. Antique Lectern Lamp,Brass Pul^iO-

and Desk, Brass and Oak Font-Cover, Brat .

Ewer, the Old Colonial llarble Font, Cilvt-r Baptismal-Shell, llemorial Hymn-Boarc , thf

Litany Desk, Hiller lemorial Tablets ;.:vo

the Lectern Bible and old Bible o'*

1;

all the Choir Vestments except Hen's arH I Cassocks, the Bronze Coat of Arms from . tr

Doors, pair of Vooden Alms Basons (wore t. safe), a Framed Photograph of Bishop Fll_o'

one Bench from the Old Sunday School Roex.

There were two other articles '.vhich \3

removed from the chancel by someone who ,.a

assisting, but which have never been foual.

They were the large Ring Ed\mrd VI Altar

Book- a very beautiful and valuable illu. i: :i

volume.

Also a small carved v/ooden cio. i:

mounted on a panel, v^hicu hung in the 3h:iic(!

It is of course possible tliat these Ji e

not taken from the church, but they liad baen

removed from the chancel before the Altai* aj.

other furnishings were taken out. In tha

confusion things were carried to many pi li;:

- and it is possible that these things may j:

From"Churoh Bells" Vol#lX Ho .

STOITE FlOtlEES OP OABRIEL AHO MICHAEL.

: SIZE PIOOTES AT HEAL OF CHAHCEL STEPS

IH ::lmory of la. barhsy s. IH THIRL St.PAUX'S CHURCH.

dotbar,

IIALIES, BATis AUD SPITAPHS COPIED FROE AXl THE 1IAEEER3 IH St.PATJl'S BURIAL GROUND 1914

YOU ARE INVITED TO ATTEND THE
PREACHING MISSION
Paul's (Ulutrrb Sixth and Reynolds Sts.
Sunday, March 2nd, to Sunday, March 9th.

Thr Rrv. Julius A. Schaad. Missioner

SERVICES

Holy Communion, Daily Service and Address. Daily

,7:30 a.m. *"*

Evening Service and Sermon

-

Sunday Services 8:00 a. m.. 11:15 a. m. and 8:00 p. m.

Services Informal. Question Box. Congregational

Singing. Sermons that will help you.

The Missioner may be seen for consultation at the close

of anv service, or by appointment. Keep this part of the

card for daily use and reference.

l^ver

DeUch and Mail This to the Rector or place on Alma Basin Sunday
For the good of my Church, as well as for my own nirimll benefit. I pledge myself to daily prayer f^or the success of this Mission, and to daily attendance at the service^ unless prevented by reasons which would also keep me from business or social engagements.

Name . Address

(over)

TO THE NAMES ON THE MARKERS ON GRAVES Dt St.PAUL'S CHURCH YARD AUGUSTA, GA.

The figures on the left of the names indloate the location of the.lot on a map in the front of the Index Booh of Baptisms eto. This map being too large for this book.
"R" indicates that the marker is on the right of the gate on entering from Reynolds St
"L" on the Iftft side.

i i . . 1-24 Anderson. Mrs Hannah

Page Ti

R- 3 - Barnes. John Beal

1

R-16 - Barrlan. John '^Tllllam

3

R-34 - Bowen. Commodore Oliver

6

L- 3 - Blair. Alexander

11

R-44 - Bacon. ohn

10

L- 3 - Blair. James

12

L- 4 - Blair. Thomas Alexander

12

1- 4 - Blair. Alexander

12

L-14 - Ballard. Mrs. Sarah

15

L-15 - Bignon. Bearnard

15

L-17 - Bowie. Rose

15

1-18 - Bull. David

16

1-20 - Buckle}^. John

16

-0

R--4 Cormiok. Joseph G

1

R- 7 Cooper, lewis

S

R- 8 Couillon. John Bay raneis

2

R-25 Cooper Bridget

5

R-47 Campbell. Edward Fenwick

10

R-47 Campbell. Marla

10

1* 8 Clark. James

13

1- 9 Campbell. James

13

R-37 Danforth. Nicholas

8

L-3S " De La Cave, Catherine L-30 - Danforth,Andrew & Raohel L-13 - Dill. Daniel

F R-15 - Fullerton. R_41 _ Foayth. Robert

-- - --G--- " "*
R-17 - Gordan, Col Ambrose R-17 - Gordon. Julia R-39 - Gardner. Mrs. Sarah

R-30 R-31 L-24 L-B4 L-24 L-E4 x--a4

H* Howard. Ann Howard. Thaddeus Adam Hutohins. Adam' Hutohins. Hutohins. Alexander Hutohins. Adam Jr Hutchins. John

R-15 - Isaacs. Klizabeth R-15 - Isaacs. Charlotte

R-12 R-aa R-a3R-34 R-as R-38 R-3a R-3a

J

Jones. Corally



Jones. Seaborn

....

Jones. Robert .Vallcer..

Jones. Josiah Sturges.

Joyner. Mrs. Kliza....

Jack. Mrs. Kitty ....

, . . . Jackson

-;ackson. James Lander.

L

Rv38" R-35 L-ia
L^ll TXXft

Lauder. James Lauder. Frances .... Longstreet. Silliam... Longstreet. Rachel....


R- a R- a R-ao L-IO L-IO L-IO L-10

-- -- --M- " "

Moore. Dina Shepheard

Moore. Elizabeth ...

Moore. Kesiah

...

Mooro. Patrick

...

Moore. Eleanor

...

' Moore. Jilliam

...

. Moore. Thomas



17 17
1^
"
3 ^
9 o i l 17 17 17
3 3
3 4 5 5 6 8
7 7 14 13
1 1 4 13 13 13 13

(p!

R-11 - Miller, Samv-el

^

R-19 - Moffett. Thomas P.

^

R-42 - Mathews. General George

y

L- 1 - Murry. Ann

L- 2 - l.^o}cintosh. l^Iary

11

L-19 - Mitohell. Robert

lo

L-J.7 - Matherson. Dunoan

17

R-27 -

Roderick .Yilliam

o

L- 5 - Mrrie^94re. Felix

R-E9 i-.,MoS:ni^ht, Rev. -Washington

6

L- 6 - McKlnne.LIrs. iilizabeth

13

L-21 - MoKinnie. V/llliam Wigfall

16

L-22 - MoKinnie. Georgiauin

16

L-23 - McKinney. Sarah Foixlk

16

Ii-16 - McKinney. Alexander (ort-cLaws).. 15

R-18 - Nesbit. Mary

4

R-18 - Nesbit. James Wi

4

L-26 - Newton. James

17

R-28 - Ponce. Alexander L-28 - Phinizy. ilrs. l^iargaret
- - - 3- - Rt 6 - Starr. Maria R-ae - Sttiell. Marian Slizabe R-43 - smith, louisa L- 7 - Spencer. Isabelle L-21 - Stearnes. Daniel
T R-40 - Thompson, ffilliam

R- 9 - Yilson. John R-14 - /White. Yilliam Henry r-36 - .Yallaee. Martha r-46 - -Vright. Albert (Colored) R-46 - (Whitehead. Benj "
/Wife of the pastor of the Presbyterian Ch\irch in Augusta, Ga.
Y
R- 1 - Young. (William
R- 2 - Young. David

^ 3 8 10 10 ^
^
1 I

TKSCRIPTIOITS OH TOIIBS ,HKAD STOH3S,STC.
HJ St.PAUX^S CHtTRCH YARD ,AUOTTSTA. 1914

RIGHT aiPilS 0? SHTRAHCS

Vault. SaorecL to the memory of l.r..fUliam Yo^, a native of Cumherland County.in
-f I vriio departecL this life February 11th 1818, ^ in the 58th year of his life.

Vault. This monument was erected by Yilli^ and

John Koore to

seotem-

David Young, who departed this

her 5th 1801. Aged 73 years. An affecti-

"lllrSS'SrLXSwr

3h.shrd

SiUS? 01 Joh. and aioaboth llooro.

Who departed this life November E6th 1802

^AlsiV^stEllzabeth r.oore,the wife of Joto
roore who departed this life October A2th 1808 *A^ced 40 years. She was an affectionatf;i^! An attentive parent and a faithful
friend.

Afoul t

Sacred to the memory of John Beale Barns

,

departed this life 6th of; November

1815 in the 36th year of his life. (Foot J.HaliC.S.C.)

Tomb. In this tomb encloses the mortal remains
of Joseph G. Comick. He w%s a native of T-.Tnnfl and in common with the majority of Ss Coiitr^en.?elt the varied wrongs which

m

from th^nslaved shores of Europe to America,

the onlv asylnm of liberty. He died on Sth S^ne^st. 1806. in the 26th year of his

n.a

-Obverse side of tomb-

^ Of firmest soul oppos's to

power:

Tiu

By honor hallowed to freedom drar, ilse rhi ^iitu^''Sort1SL"lnd''frienlshiEs'lasting woes

Head Stone . In memory of (inscripton cannot be read.) Foot Stone

Head Stone. In memory of 3tarr;She died Hovember 5th 1817.Ae. She vra.3 the daughter of Eben.H. & Hannah .Thite, of Banbury, Conn.
Head Stone. In veneration of his oharaotor and as a teibute to his memory, this stone is erreoted by his disconsolate widow and survivimt children to mark the spot where lies the resins of 1E.7IS COOPER native of Kemri;, Hew Jersy, who departed thisaifa September 26th lja7. Aged 32 years.
Vault. I.H.S. Sacred to the memory of Joto BaptvUr Franois, son of F.B. and Jane Couillon.born 16th December 1784,Died January 16 1818 Ae.34. OH SOD OF IJERCY SAVE HIS 30TJ1.

Tomb. In memory of John 'Jilson

,

city, who departed this life on the 2nd day of

Uay 1813, in the 74th year of his lif*

He was a native of Ireland and a resident of

this Country for upwards of 54 years.

In worthy hearts

^.r **

.

"He was one of the Stoolcholders of the "Banx:

of Au^sta," charted Beoember 6th 1810; Georgia's Oldest Bank."

Head Stone. In mempry of the wife of the of the Presbyterian Church in Augusta, who departed this life on the 14th July 1814.
Aged 21 years. She walked with God, and
was not, for God took her. Gen. 5.2. No marker for the above, in 1928.

Head Stone. Sacred to the memory of Samuel Hilliam ITiller, who was born in Newport R.I. 21st 1791* but resided in Charleston until within a few years of his death when he rLoved to Augusta in Georgia,where he closed
this life on the 18th day of September 1817. Aged 25 years, 8 months, and 30 days.
He lived and died respected.

3.

Heaa. Stone. To the memory of hrs. corally Jones, Consort of Capt. TTilliam Jones of the TJnlted States Army, who departed this lire
on the 6th day <3f Hovemher in the Year or our lord, 181S, in the 22nd year of age. ,
^Uo marker for the above 1928.

Memory of Rebecca Fullerton, the wife of Hugh Fullerton, who died May 9th 1810, in the E9th year of her age.
Ho marker for the above 1928.
TTaaA c^+AYiA Sacred to the memory of V/illiam Henrf^Ite! who departed this life on the 30th of August 1802, aged 7 months and 10 days.
Head Stone. This stone marks the grave of I'rs. Elizabeth Isaacs, wife of Ralph Isaacs Es^,eS^. ""?tViS*-S-ihrg;;--of*fhl;fo-
tte '7 Isaacs, youngest daughter of L.alph and siiza^th'lL^. Oht. September 1809.
"Ood^s glorious image freed from olayIn Heaven's eternal spere shall Shine.

Vault. In memory of Innocence. This Tablet records the death of John William Berrien,
only son of John and Elizabeth Berrin, who^departed this life at Augusta on
E2nd of August 1810 Aged 1 year.10 months.
His sorrowing parents find consolation
of the Saviour of Ilankind. "Suffer little children to come unto me forbid them not for such is the King-
dom of Heaven.

Tomb.

Sacred to the memory of ColonelJfflbrose

Gordon, who in the various

life discharged his duties with fidelity

and diligence. He was born in the state

of New Jersey on the 28-th of June 1751 and departed this life in the state of Georgia on the 28th. June 1804. Aged p

vears.

Also in memory of Julia Gordon,

^ughter of Ambrose and

`

who departed this life on the 14th o

SeptemLr 1805.Aged ttot

years.

"Col Ambrose Gordan,a soldier of tn^. Revolution and an officer in the ci+o+.e Troops. He was father oi

William .7ashlngton (Jordan, the of the Central of Georgia

rri

4.

Vault, In memory of llary, the wife of Hugh Hesbit, who departed this life the 8th day of December A.D.1808. In the 25th year of her age. Also James '.Vilson Hesbit, their son, who died the 7th day of January A.D. 1803.Aged 7 weeks and 2 days.

Vault. Sacred to the memory of Thomas P.Moffett, who departed this life llay 22nd 1818. Aged 22 years. "Here lies his head upon the lap of earth; A youth to fortune and to fame unknown; His noble virtues spoke the man of worth; But dire misfortune marked him for her own,

Ho further seek his merits to disclose; Or draw his frailties from their dread abod
There they alike in trembling hope repose; The bosom of his Father and his God.
Ho marker for the above 1928.

Tomb.

Saci^d to the memory of Keziah Louisa,

Consort of Augustus l*oore, who was born

the 9th of April 1789, and died the 1st of

l!aroh A.D. 1818..

\

(Left Sides) A faithful Servant of the

Living God; A sincere Besciple of the Lord

Jesus Christ; Regenerated by the Holy

Spirit of the r.ost High.

[Right Side) Leaving to her connections

and friends the consolatory belief that

she is now \mited in the innumerable com-

pany ofO^els and their general assembly

and ohutoh of the first born, where names

are written in Heaven. An Angel*s arm

couldn't snatch her from the grave.

Legions of Angel's can't confine her there.

Vault. Inscription defaced and cannot be read. V Hot founi in 1928

Tomb.

Seborn Jdnes, borh in Halifax, H.Carolina January 15th 1759, died in Augusta, Georgia July 24th 1815.Aed 56 years.
(Right Side) Emlnant as a Jurist;
A Christian without guile.

ivjw

(left Side.)

3. H.

(Rear) Monument of filial

gratitude to the Memory c

Venerated Father*

^Seaborn Jones, an Uncle of t.

v/ho bore the same name, H<

speaker of the House of Assji

adoption of the Federal Cons'

Head Stone, Sacred to the memory oC son of Searborn and Eliza J tithe 11th of June 1810, and 3i July 1813.Aged 3 yrs, 1 md.

Head Stone. Sacred to the memory' o? son of Seaborn and Eliza June the 18th of April and died 5C Aged 2 years, and 9 mont'ie.

Head Stone. Sacred to the menci.;!

who departed this life

'

Aged 70 years.

Tomb.

Sacred to the memory of lam.

child of Dennis and Mar.v

.

28th December A.D. 1800 a.

ember A. D. 1617 .

"In the bloom of youtu ai..>

prospects of years cf

^

from on high arriveC v/hi^h

the bonds that attac'iei 1m t

ed the dearly belovc oj; i j

from the arms of hei- uff :C1 i

and removed her to the mantio

ual peace and inoonceiva'^ It

No DU

tc

Sacred to the mempr;, jf ' son of Alexander and hary born April 19th 1815 ani i 1st 1817.

HERE LIES THE RELICS OP IN HEAVEN.
In memory of Alexa: I second son of Dimas an; who was born Aug, 6th ; >
July 22 1813.

C. at
n
.n.

' This Stone aced by Fraternal alFeciK-M ^to th^ Memory of

C.

OLIVER BO\Vf<:i

af

6^ the State of Rhode Ifland,

Ml

3 fpranglrom an honourable

le departed this Life >

July the u`^A D. i8oO.--, /

the 59* Year of his Age.

\ Patriot of IS among the firft m tths Statc/i
who fteped forth. ^ Vindication of ourRrghtSw,^ fc equally with his properly . ; pften rifqucd m the Cau^.

Ii

w.his Relations, and his many Friend

yet regret the departure'^

df the Bcnevolcnu.,,s i and Hondft

^ ' M an. " ^ ^

* Si

c;> ^

6

I

Head Stone. In Memory of the Rev. ?/ashlngton Mo.Kni- I

ght, who ' depurted this life on the 5thof Sept-

I

ember 1805. Aged 26 Years. By an affectionate

I

Father. (Foot Stone W.MoK.)

I

Head Stone. Sacred to the memory of Ann Howard,

I

daughter of Rhesa and Hannah Howard, who de-

1

parted this life the 5th day of January l?f07,

I

in the 18th year of her age.

1

Head Stone. Sacred to the memory of Thaddeus Phelps

I

Howard,infant son of John and Louisa Howard,who 1

departed this life the 23ed day of December 1817, j

Aged 3 years 4 months and 10 days.

I

Of suoh is the Kingdom of Heaven.

j

Ea^t. Sacred to the memory of Mrs. Eliaa Joyner,

j

wife of -.Yilliam H. Joiner, and only daughter

of Dr.James Hartley of South Carolina,who de-

parted this life on the 10th day of October

1813. Aged 19 years and 65months. Also their

infant sou.

fault. This stone is placed by Fraternal Affection to the memory of Comodore Oliver Bowen. A native I of the state of Rhode Island,where he sprang from an honored stoolc. He departed this life J\ily 11th 1800 in the 59th. year of his age. A Patriot of 1775 and was among the first in the state who steped ^forth in Vindication of our Rights. His Lifellpqually with hds property were often required in the cause. His widow.his relations and his nlanylfriends will regret the departure of the Benevolent and Honest Llan. "Comodore Bowen,at the outbreak of the Revolution,was a resident of Savannah. Most of his life was spent on the Ocean front and how he oame to buried in Augusta is unknown. Dr, Chaunoey 7/illiams a former Rector of St.Paul's,
in speaking of his services to the cause of Independence, makes this statement;"V/hen Wash-
ington was at Cambridge and powerless to dislodge Lord Howe from Boston, because he had no ammunition, Comodore Bowen, by a clever and daring attack, oaptured a ship load of powder Offobf TJl)ee (about 16000-lbs.)that was being sent to the English Army.A large part of this Was sent to Ceneral Washimgton and enabled him drive Howe out of Boston, which was a turning point in the Revolutionery War

7.

blried in St* Paula Church Yard,made

the success of the Revolution poasible'J

"Underneath the horizontal slab of

marble, in the foreground of the Church

Yard, lies the ashes of the gallant of-

focer who commanded the very first vessel

commissioned during the Revolution. On acco-

unt of the recognized priority of his cairns

in this respect, he has sometimes been

styled by pre-eminence, the ^Admiral of the

American Navy."

Tybee;First Capture of the Revolution

here made.

On Tybee Island,at the mouth

of the Savannah River,the first Light House

on the Georgia coast was built under the

supervision of Orglethorpe, in 1733. The

present handsome structure,is the tallest

Light House between Charleston and St. Aug-

ustine. This as the scene of the famous

capture made by the first vessel commission-

ed for navel warfare the American Revolution

The boat was converted schooner.officered

by Commodore Olive Bowen and Captian Joseph

Habersham. To meet the exigences of the time

it was hastily put in commission,in 1775

and within a few days thereafter, off the

coast of Tybee, 16.000 pounds of powder

was captured, some of which was sent to

Boston,where it was used .in the battle of

Bunker Hill. At Fort Screven,on Tybee

Island,the United States Government

Maintains a strong battery,the numerical

strength of which at present is 14 officers

and 460 men."

Vault.

To the memory of James Lauder and Francis his brother, who both died suddenly at Augusta. James on the ;i8th. of December 1789. in the 29th year of his age. And Francis on the 26th. of December 1787,in t the 19th. year of his age.
Theii Disconsolate ^`other hath erected this Monument.

"They lately smiled in Youths gay bloom;,

Thdir agd4

trtuiti But now,alas,

their silent tomb; Contains their sleeping

dust. Then pause and view life's chang-

ing scenes; How Flattering prospects ope;

How sudden death, oft intervene^;*And

blasts the fairest hope. The yo\ing,the

old,the good,the brave; without distinc-

tion fall; But let us look freyound the

grave ;\7here Gdd is all in all.

8,
'/here time its endless circle runs; Great source of hopes and fears; There may the llother meet her sons; And joy reward her tears.

Vault.

Here lies the body of XIartha, the wife of

`.Villiam 'Vallaoe, who departed this life the

23rd day of October 1789, in the 20th year of

her a^e.

" Death I fear not, the grave lias no terror

for me. For I trusted in my Redeemer and

His promise v/as my support."

Vault. In memory of Hicholas Danforth, son of Jacob and llary Danforth, who died 6th."of November 1805. Aged 2 years and 13 days.

Vault. In memory of Xlrs. Kitty Jack, the wife of Gonl. Samuel Jack, who departed this life in the 37th. year of her age on the 15th of July 1792. "i:y life is spent, i:y glass is run; tly Soul to a new State is gone; But once I was as you now be; Prepare with speed to follow me."

Vault.

In memory of lirs. Sarah Gardner of Augu-

sta, who departed this life on the 22nd of

July 1801 in the 29th year of her age.

Vault.

ORDER OF CINCIITNATI. Here lies the body of 'Jilliam Thompson,

Esq. who w:d3"an officer in the 9th Pennsyl-

vania Regt.,of the late American Army, from

its foundation in 1776 to its dissolution,

and amongst his American Bretheren made an

offering of his blood on the Altar of Liber-

ty. He departed this life on the 19th day

of Inarch 1794.Aged 45 years. As a Testymony

of regret and in remembrance of him, his disconsolate widow hath caused this stone to

be placed as a covering to his bed of rest.

Vault.

Sacred to the memory of Robert Forsyth,

who in discharg of the duties of his office

fell a victom to his respect for the laws of

his Country and his resolution in support of

them, on the 11th of January 1794 in the 40th

year of his age.

Fis virtues as an officer of rank and iinusuAl confidence in the vra.r which gave Independence to the United States and in all the tender and endearing rela4^tions of social life, have left impressions on his Country and His Friends,more durably engraved than this monument.
"Robert Forsyth while holding the office of United Spates l.'-arsiial for Georgia was killed in Augusta by th" noted Beverly Allen, a kethodist Preacher, whom he was seeking to arrest."

Vault.

In memory of George Uathews,who died the 30th. of August 1813 in the 73rd. year of his age.
"Perhaps the tomb which attracts the chief interest on the part of visitors to St. Paul's is the tomb of old Governor George ^thews, in the area of the groiofr^ n^ to the right of the Church. An officer of note during the Revolution,He is credited with having saved the American Army from rout at the battlejof Brandywihe. He was notoriously a bad speller. At one time kl wanted to thrash John Adams. ,7hile Governor of Georgia he committed the fatal blunder of approving the"Yazoo Act."
"In 1784 a colony of Viginians under the famous George i^thews, came to this state (Georgia) and settled upon Broad River,in what was the original county
"of v/ilks." "Governor ^athews, a soldier of the Rev-
olution who brought a colony of Viginians to the state in 1784 and who afterf^ wards became Governor, lived in Oglethorpe for a number of years, after this^ part of the county was cut off from ,7ilkes." "George Itathews, a soldier of the Revolution,after\mrds Governor ofl the state, established, in 1784 a famous colony of Viginians on Broad River, in what was the county of V/ilks. Some who,came with him were F.eriwethers ,the Gilmers.the Freeman, the Taliaferros and the Barnetts. Governor ^thews has been greatly misjudged because of his part in the famous Yazoo transaction. Though he signed the bill,he was guilty of no malfeasance in

10

office and there if nothing to show that he expected to reap any profit therefrom." " An^sta was the Capital of Georgia 1786 1796; Oeorge i`^athews was Governor while the Capital was in Augusta."
Head Stone. Sacred to the memory of Louisa, w^fe
of '.Viiiiam Smith and daughter of Claiborn and -Elizabeth '.Valkor of Abingdon, Yiginia,who departed this life on the 26th. of November 1817 in the 17th year of her age.
,^No marker to the above in 1928.

Tomb.

To the memory of John Bacon,who v;as born 28th. September 1769 and died 15th. of April 1812.
"Say,who shall bask in joy's elivening ray Shed but a moments ,thro * life's fleeting day, Or who shall prouily boast the present hour Fearless of Death's inexorable power. 'Yhen all the kindred virtues could nbt save Lamented Bacon from the narrow grave. The tears of anguish o'er his marble flew, And here are breathed the bursting sigs of woe. A widow weeps a husband buried here^ And friendship sorrows for a friend sincere. A brother mourns a darling brother deady And orphand infants bend the pensive, head. Cn every sigh and every gushing tear Shall ...his parting spirit linger....

Head Stone. Inscription defaced.

Head Stone. Sextons of St.Paul's Church, Albert 'bright died September 5th. 1887
Benj. '.Vhitehead, Died April 2nd. 1894.

Tomb.

The resting place of Edward Fenwick Canpbell and his wife llaria Campbell ^^ablets within the Church tell the

lOi

^

story of their Christian walk anl oonver

sation till they fell aslepe in Jesus,

DOKIiraS REASTTRHEXIT.

Vault,

In memory of

Jackson, ller-

ohant of this town who ms born June the

25th 1765, Departed this life, l-laroh the

2nd 179S Aged 28 years.

Also their son James lander Jackson

who was born the 13th of April,and died

October the 13th 1793.

"Reader whoe'er thou art,when choice hath

led

To trace these sad memorials of the dead Learn, since life's airy visions soon is

o'er

To wait the great teacher Death, and God

adore.

XEFT SIDE OF EITTRAIICE.

Tomb*

Saored to the memory of Ann^ wife of Doc*John ITurry, who dei^aryed this life the 21st of December 1806, in the 49th year of her age.
"Biassed are the dead who die in the Lord, for they rest from thrir labours*

Vault* Sacred to the memory of Frs. I'.ary I-ackintosh, wife of John i^ckintosh; she died on the 10th of ITovember 1806, in the 26th year of her age. "Vfhile oer this tomb from heart engraven woe The tears of sorrov/ unrestrained flow. '.7hile busy memory still selights to trace The beaming beauties of her charming face. VHaile all her virtues, flashing on the mind Declare she was one posesses a Soul refined* Defined by !'eek, Religious Koly laws Led by her guidance, ardent in her cause. Tis ours to follow tliat example bright Vhich led her soul to Realms of endless light.

Vault.

Sacred to the memory of Alexander Blair, who \ms a native of Scotland and early in life became a citizen of the United States. In Public and Private he discharged his duty with liAnor to himself and satisfaction to others. As a friend he was sincere, as a husband and father affectionate, as a master indulgent.

12

yt'

After a short illness, he an the 16th, day of September 1804, in the 36th. year of his age yealdig up his soul to him who gave it,under the full hope of a happy resurection. Reader. Thou also shall Icnow a resurection, i.Iay it be unto eternal life. Here also, lie the remains of his son James, who at the age of 13 months, on the 3ed. of September, 1802 exclianged his abode on earth for an habitation not made with hands, eternal in the Heavens. A sorrowing widow and affectio: ate mother hath caused this monument to be erected to their memories, under the consoling belief; Tliat "Tho an .ingel's arm can't snatch them from the gcave. legions of Angels can(t confine them there.
Robert Allen Sculpt. Savannah

Vault.

To the memory of the sons of the late Alexan der Blair, by whose side they lie. Thomas Alexander Blair, died 11th October 1805, aged 2 years and 6 months. Alexander Blair, died 18th. llovember 1805, aged six years and 2 days.
READER "Behold the fate of these two lovely boys.
Place not thine heart on sublunary joys.'-Yith peace,and love ^and plenty round them smiled;
A mother's tenderness their woes beguiled But crual death,alas hath laid them low Where all on earth must ultimately go; Removed to Heaven,they now no longer share The changing scenery of a world of care. This is inscribed by their unfortunate mother, Eliza Blair,1807.

Tomb.

To the memory of Ur. Felix UcKinne, who departed this life at Sanannah, the 30th day of December 1845, in the 39th. year of his age from where his remains were removed and here deposited. (Left Side) READER. If an unblemished reputation, a heart formed for benevelence and love^ a souL glov/ing with every sentiment which can ennoble human mture,could command thy esteme, respect this stone,let the dust it covers lie sacred. It was once animated by as pure a
dwelt within the breast of man.

Tomb.

This monument,saored to the memory of Ivlrs. Elizabeth KcKinne ,who after having spent a long life in the performance of those Christian duties Yrhich are the greatest ornament of the human character,and evinced by her conduct the finest faith in her Saviour,fell asleep on Friday the fifteenth day of September in the sixtyfirst year of her age, leaving a bereaved and afflicted family to mourn,and an extensive circle of friends to lament^the loss of one who as a mother,exhibtea such affectionate tenderness,and watchfull solicitude. As a neighbor,such uniformed benevolence and unbounded ciiarity; and as a Christian,such cheerful piety and humble resignation,as will render her example impressive ,and endear her memory to those who knew her in these respective relations.

Vault. Sacred to the memory of Isabella Spencer, Spouoe to Alexander Spencer, who depatted this life ^uly 11th. 1797; Aged E6 years.

Head Stone. In memory of James Clark,who depart-

ed this life the 21st. December 1797.

He was born in Killead Eingdomel,Ireland.

'

Aged 21 years and 6 months.

Head Stone. In memory of James Campbell, merchant of Augusta. Died Sep. 14th. 1802
in the 37th. year of his age. He was a native of Randalstown, Antrim County, Ireland.

Tomb.

Sacred to the memory of Patrick Koore, a native of Ireland, born in the Parish of Bangor and County of Down, on the 25th of November 1751,and died in this city
on the 23rd. of August, 1803 Aged 32 yrs. Also, Thomas Moore, Hepfaew of Patrick
Moore. Also, Eleanor Moore, daughter of Thomas and Fanny Moore. Also, William Moore, nephew of Patrick Moore, born Sept. 22nd. 1778, died Aug.. 28th. 1803. Aged 25 years.

Head Stone. In memory of Rachel, daughter pf Hannah and '^^illiarn Longstreet. Died Jan.
12th. 1790.Aged 2 years and 4 months.

14.

>> 4-

Head Stone*

Sacred to the memory of ^J7illlam lont^street, who departed this life Srpt. 1st. 1814 Aged 54 years, 10 months S6 days.
"A11 the days of the afflicted are evil but he that is of a merry heart hath a continual feast

t

"Here sleeps the famous "Inventor" who twelve months before the keel of B^ilton's boat began to plow the Hudson, was successfully applying steam to navigation on the waters of the same stream which his grave today over-

looks. (Sanannah River) He died the victim of adverse fortunes and in the simple epitaph inscribed in the timeworn slab above him there is a world

of pathos.

He vra,3 the father of

the celebrated Judge Augustus B. Long-

street,who wrote "Georgia Scenes".

He was also the grandfather of the^ess distinguished Genl. James Longstreet,

Lee*3 "Old War Horse." Georgia issued its first patent to Longstreet for a Steamboat.

On February 1 1788, an act was passed

by the General Assembly at Augusta, Ga. conferring upon two inventors,Isaac

Briggs and v/illiam LonggtrOet .exclusive pattent rights for a term of 14 years,

to a steam engine, constructed by them j

for the purpose of navigation. There

|

are certain things,in regard to this

Legislative Asst, which gives it a

peculiar interest to students of Amer-

ican History, in the first place,it

constitutes the only patent ever

Issued by the State of Georgia. At this

time,the Articles of Confederation were

still in vogue btit within a few months

a new Central Government was organized,

under the Federal Constitution of 1787,

after which the right to issue patents

became a special prerogative of the

United States. ,

;

Tradition credits '.Yilliam Longstree:

with a series of experiments on the

I

Savannah River, extending over a period!

of twenty years.

1

15,
Sonerville Cemetery, on the Kill, An^ista, Ga. Underneath a square headstone, in a remote corner of the Cemetery,sleeps the widow of '.Villiam Longstreet, a npted inventor. She was the grandmother of the noted Confederate General lee's Old '7ar Horsjt. The inscription on her tomh reads;
^ SACRED TO THE rJIMOHY OF Hannah Longstreet,. She was born in lionmouth Co. H. J. llarch S3 1765 and died on Sand Hills, Feb. 12 1837.
I HAVE 7/AITED FOR THY SALVKTI0K,0 LORD
)ne. In memory of Daniel ^ill, who died Augu 15th. 1816, in the 88th. year of his age-.
^^ead Stone. Sacred to the memory of Mrs. Sarah Ball* wife of Mr. Frederick Ballard,who departed this life on the 9th. day of January in the year of Our Lord 1806 aged 48 years.
Sympathey and Friendship long shall mour: her loss. Her memory and virtues long su Vive letter! marble. And her departed me cause silent tears for her.

Head Stine. Sacred to the memory of Bernard Bignon, a native of France and a resident in the United States for 23 years,who departed thi life on the 14th. day of August 1816 in the 73ed. year of his age.

Vault.

His daughter has placed this stone oyer the body of Alexander McLain.(or Mo Laws)
(Remainder of marking obliterated.)

Vault.

Sacred to the memory of Miss Rose Bowie, daughter of i^^jor John and Mrs, Rose Bov/ie South Carolina, aged 11 years.
She departed this vale of disappointmer
on the 20th. day of March 1798 in the city of Augusta,where she was completing her ed\ tion with more than moral enegy. Universal benevolence to her fitter pupils
who deplore her loss with sorrow unfeigned. "6f humble manners and grace refined with all the glory of a Heavenly mind, She moved amidst the glare of public s And seemed an Angle^sent to us below On errand full of love^anddthat we

16. With her bright form might all her virtues sesj And emulate her worth, thus last sustained Heavens touring heights she has again obtained ,
Legions wait to guard her home. Sublime; Eternal Bleast; Three in one. Reader v/ho e*er you art,for thy soul's sake Go do likev^ise, an AVrFTJL vra.rning take.

Head Stone. In memory of David Bull,native of Hartford,Conn, and for severil years a respected merchant of this place. He died Oct. 2nd. 1809 in the 26th. year of his age.

Head Stone, ^^`o the memory of Robert Kitchell of Queen's County in Hew York,who died March 22nd. 1808. in the 32 year of his age. He left his home in search of health but sunk under his disease at Augusta, Georgia.

Head Stone. In memory of John Buckle, who departec this life July 20th. 1809 Aged 31 years.

Head Stone,. In memory of V/illiam .Vigfall McKinney, who departed this life Hovember loth. 1809 Aged i month and 3 days.

Head Stone In memory of Georgiann McICinney,j/ daughter of David and Sarah l.lcKinney.

Head Stone. Sarah Foulk McKinney, who departed this life October 10th. 1809 Aged 26 ys. and 3 months.

Tomb.

Sacred to the memory of Mrs. Hannah Anderson, widow of Robert Anderson late merchant in Charleston South Carolina.
She was a native of Pennsylvania and for 30 years a resident of Charleston but was arrested by the hand of death on the 30th.of September 1814 while on a visit to her daugliter in Augusta, Ga.
She was tznily an upright and benevo-
lent woman,a most affectionate parent, a kx kind mistress and a sincere friend. '.Yho lived beloved^^and died lamented by all who knew her.

the depar-- Head Stones. Here lies^the remains of ^
ted children of Adam and Elizabeth
Hutcheson wrapt in the arms of death.

Alexander,born 7th. Of Aii^nist 1809,died 2nd April 1810. Adam, born February 1811, died 7th llarch 1812. John, born SOth. October 1815, died EOjsh. June 1816.

Head Stone. Defaced, cannot be read.

Head Stone. In memory of James Newton,son of Amos and Harriet Newton, who departed jthis life the 6th. of June 1807, aged 12 days.

Head Stone. Sacred to the memory of Duncan llatherson, a native of Ross-shire Scotland, who departed this life 20th. Of September 1812, aged 32 years.

Tomb.

Sacred to the memory of lira, llargaret Phinizy, wife of llaj. Ferdinand Phinizy, who having adorned the dooterine of God her Saviour by a life of :"emplary piety and usefulness,was called to the enjoyment of the Blessed above on the 22nd day of August 1812 aged 55 years.
"The dust which here in silent lies, Shall at the Archangel's trumpet arise. And form'd anew by Power Diving, It shall in endless Glbry Shine.

Tomb. Defaced, cannot be read.
Be%d Stone. In memory of Rachel Danforth, wife of James H. Danforth, who departed this life 1816, In the 22nd year of

Also Anderson Danforth.
Head Stone. In memeoy of Daniel Stearnes. He did^* on the 4th. of February 1814, aged 30 years This stone was caused to be placed by his brother Samuel Stearns.

Brioh Vault. No marlcer. Brick Vault. No marker. Brick Vault. Ho marker.

D. 0. M. HlC JACET DOM Catherine De La Cave Nanoerana. Ilata 13 M*artii 1746 Oblit 20th. October 1813 REQISSCAT IK PACE.

9^-

MEMORIAL CROSS.
This stone marlces the spot of the colonial Fort Aii^sta, built by order of &en Oglethorpe, and the Trustees in 1736 and known during the Revolution as Fort Cornwallis.
Saint Paul's Church was built in 1750 under a curtain of this fort.
This cross erected by the Ceorgia Society of Colonial Dsunes of America Kovember 1901.
VIRTXTTIS MARJORUM FIALE COKSERVAKT.

D. 0. M.
" Deo, Optimo, Maximo." To G-od, the best, the greates
In the crypt under the altar are buried Rt. Rey. Leondas Polk.
1st Bishop of Louisiana. Bom April 16th 1806. Died June 11th 1861. He tried to do his duty.
Frances Anna Devereux wife of leondas Polk. Born ^^rch 22ne 1807 . Died April 17th 1875.
'.Te shall make thy righteousness as clear as the light; and thy just dealings as the noonday.

Also in the Crypt are the following. Rev* V/illiam F. Clark Born Jan. End 1820 Died Aug. nth 1877
Blessed are the dead #hotdle in the Lord.
Mrs. Sophia Green Clark. Enterd into rest January 8th 1870.
But the souls of the Rigjtous are in the hand of God.
Brick Monument, in the south west corner of the yard, in a very dilapidated condition in 1930.
NOTE. Ur. B.B.Russell Jr. told me that as a boy ho remembers seeing this monument. It was then coverd with cement, and had on it the name of Captain Joseph Ashton. Also^ there were c erl;ain"Easonlc Emblems. May 1930..

AGE AT DEATH,
Dhder 1 year 1 Year old 2 Years old 3 4 6 11 15 17 18 19 20 21 22 25 26 28 29 30 31 32 34 35 36 27 39 40 43 45 48 49 53 54 55 56 58 59 67 70 73 74 88
Average age of death

DATE - OP 'BURIAL
1787 1789 1790 1792 1794 1797 1798 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1812 1813 1814 1815 1816 1817 1818

1845 1887 1894

l(Colored)

MISSION PRAYERS
O Almighty God, Who art ever ready to crowo with blessing any work undertaken in Thy Name; Bless, we pray Thee, the mission to be held in our parish. Send Thy Holy Spirit upon our Missioner. that with grace and fervor he may preach the truth end bring us to a belter knowledge of thee. Arouse the careless, convert the impenitent, strengthen the weak, give more grace to the faithful. Let Thy fatherly hand be over our parish, that all may be done according to 1 hy will, to the glory of Thy great Name; Through Jesus Christ our Lord. Amen.
or thtai O God. the Father of all the families of the earth, bless the Mission to be preached in this parish, and grant that through it Thy Holy Spirit may bring many souls to Thee. Through Jesus Christ, our Ijord. Amen.

Kindly give names and addressesof persons who might be interested in our Mission, especially of such as are not members of any Church.

Name

Address

Name

Address

Name

Address

(OVER)

Marker for George 9teptoa Washington, placed in StPaulB Chureh yard, Oo** 5,1956 , by the Got. John HLUedge Ohaptr, U.aD# 1812, Mro. S.T.Agerton pjrea. Accepted by --

George dteptoe Washington, 4th child of Ctoi. Saauel and Anne Steptoe,

Wellington, bom in Harenoodi' Berkl^ 06. Va. about 1775. He attended

the ReT* Stephen BlooaMr Belch* a Academy in Georgetovn and liie Alexand^

ria Aoadeny,( of idiioh Geo. Washington uaa one of the trustees.) ( P-452- Geo.Wa^ngton himself by Fitsspatrick.)

George Steptoe Waahingt6n, married at Phila. about 179^, Lucy Payne,

daughter of Mr. Payne of Va. and Phila. Later he rmtved to S.G. and

died in Augusta, Ga. Jen. 10, I809* He requested to be buried by his

dear friend, Ambrose Goi^don.

Cttofte , from the Augusta Htoald Thurs. Jan. I809*-

* Kxrled In Sb.pul* Ohuroh

Oa<Mrse Ste^ton Washington,Bequire

of Va. a nephew of the late President^" in the 57^ ysar of his age.

His remains were yesterday deposited in St. Paul* a Ohuroh yard.- He was

an officer and buried with Military Honors. Oapt. 8th Va. infantry,1799

Honorably diachargad June 10,. 1800." Extract from George Waahingtonfc will

" To each of my nephews, William Augustine, George Lewis^ Geo. Steptoe^"

Budurod, and Saiaiel Washington, I giro one of the sworde or outteaux of

idiioh 1 nay die poaaeeed and they are to chose in the order they are

named.-- These awards are aecosq>tnied with an injunction, not to unidioH

1h them for the purpose of bedding blood except it be for self defmce^

or in defense of their country and Its rights, and in the latter case to

keep them unsheathed^' and prefer falling with them In '^air hands, to the

relinquishment thereof.**

--- George Steptoe Variilxigton

2 --

Theee oeorde hare ell bean preeented by the Werijingtoa h^ve to the people of the UB. through Congrese. They ere uauelly to be seen aaosig the relueble Veahlngteix relics in the Petort Office at WaA, D*a* Ikirii^ the Oeotezmlal Eacpoeltion they aay be seen in the Sor't Building in Fainont Park.
( P- I80- tfartiington Faiaily by Vellee.)

Oon^iled by, Alice 0.toabard ( Mre. G.S.) Hietorian Nat'l U.fi.L. 1812,

* ^ 4.tffwo J?/V/C7 .iRwij^o

'/n

.

4}' ^t'T'ii^i^t

^*'**^

t) f

^jC. /f/'A-^

/*r f^4v^'tr^i/ t'?int'A`</

/^<5t3u ytWA^"ZS

7;-f"'

dJj Auh<

Blxvi4^ u-.'TJAt

^

7h^ 4'ftt fCu4^^

<!WX' El
l_ ,,

^ /C^Odn, i^u^

9^^^ lU /'/QJI'^^ *9^
lyU/1V/S6; T-TT^'^y/f

A'

^ lyuj. -yYi'^^pdU^'Cy-*^-^ /W^^XttS } `'`7*2/x<7^^fcft^^ff_jr_'_~2v2^W

Irrf5^^ /%4<^ 'py^yc

^

OP ^t:!lu^ JfiCf htf-^Y

/k.^

.tWH.

<^9>-<-t- tx> 4> 7~^ ^

7^

^Uaa/I -- 3

^ fj^ ^

J

^

%^Kvu^^^

4

^[mA ^!u^ _

'?l|i&UiW <f{t.<JUM. tjncU^Jyl c-
?

f

jOld Grave Evokes Memories
'Of Man Who'd Whip President
Gen. George Mathews Buried at St. Paul's
By JOHN BOOTH The non-committal headline "nCewomspmapuenricatdioante"d inSepatnemAbuegrust3a, 1812 headed a brief story announcing the death here on August 30 of Gen, George Mathews, Revolutionary soldier and ex-Governor of Georgia, j The writer outlined the gener.,I hdJyby.IIIalwVrptglaStttHtigtaajjIj'bhlpdha-fanieihiJIIMaheheieashtaowrucgmwmnanouaiapeaIturcioipvwneaigmio[Igwtsepildh'IsehjIaeatlcintuo:IIsftadorfIIGtenmaIIIIIh,,MogsdaaaMTias1aTMTresahuaftbuTydsvgdadtnemeptuirOoamoaaheVHnnaatppiTahaeDtAfeurimesacmrnlbepaIhlAtonaheadmPattthrdfhonhttagnEcuaHgnntnarnnmSdaawtawnee,r.ngerrdTfruhiblernehrswhmnohhrhceurenhHaYolhvoanfHpsteTnndsinrletiidahhesltgickci`sinsaoo.eaiShweaynadotsidariurdhCtaccgndueiHssheetHsilltdn1pstirh^eh.luseyatlheeeegeirt`enrsmhelMieeseun,essattihtoTngai.etstnidrneieoteenhastasioitruioliLsoeslhsyths8Wonurrstgeaa.ecteehordo"odlmtotrneceafattthterehTnraschkdelewgslenihs"ieneewesdtrzet0hidacphJtovuffittlhhgynhWihuydegpioeacivewtsatniaatyIlaarawiWenzBsfnsirsdreannhbtaRrMrdhpietimMhtpctds(GyieroveaoastgiedenenihaeheliaadwnVeMGasau^meiaelreddr1,h<soiceyesatyllhpwevfnoreaTtdahnyeedtnt'vwentagewobaeetdasmsorocasfsvFfphrrtseshiiareafoorhcwchiie`ErhttkgBphrengRhoirstnuedwdrrnaedriekadMbsdoe,EwAieaaf,rinayroohaowfclhpcosafistneeen-tlstanatiRornueehlenfmgioudslsltneeoehteeoatobphsyaenLshneeitrif^iruO"aonlenustuitwahoatnpBbslwtlcvwoyogSrteeD.rmrttorehktthyf..giorronefhbulioegtwcwlieeehntdh'hdegrsraeetsrveadhriresV1tihhtesvneteisohsylbcrLitrotshfasniyaedpaeflcruhuemt--oerrhc,RbeeoeeowtjrTdrsnosxosdeaeeedeaold\glarete'daipihfeovi0pttcufia'heceehuiieietifndimmoaeMasuvaehpswwiit-rawoMyievrentucioehoabIwuaiiangtcasaepunl"ngttsdsdkep,wrerdfuiroNltecmuoenrsttutdir^aek1sndherlrsescgsbioNttoecobetelgiincdohstvroowbg(KheoedtoeeieGtiiirtchnsgstGigontinaartwagatuae,tlalGuslcSrrsrmn7rploAtdemteenhoa1ozbtiaahdoeeansapGamdntmrksweulo1irhmholoigiawcrihe"pGtdburetiehilnteetnooscttttPio9htmpoNfpnBnwnirgeeeAiednte7glodteocrapnsilceeh7eepsaiarmpaiulnwolhrpKneiWL"tdhotconmrenetthnfporhmledIJttae8n`totlrabswoerelsdodcnseespei9ustrokttgeeuts7edonnaaihawuibtltnitodeciwhhOaiBfeohlNdekfiWbchotmhegrweaadrfpveiaefoclateoerseOse"tsvneowonahannnmwetho.nreecNor34aas.qherarnironooeiraoalp.ls^nturdootirgnae"lomeranfyaegocre.nw'wgirennsaasognbtfriWpioa.ccfnitic,edditeto,-crieesflwapoorwytasieeodfamauGbqlofvuoro"rojgslsamarnsdsuvoeiyreteieasismaprcfy9lsatlifrgottitstbareiimdoedureesfaaerpmhbcnnewde'oohUesid'eaGhahtidiahtyheauswtVsaolwhry.apetwlennvwhept6pscoaieaefymNertap,nsiPGbVtesoanfts"rmnlacs"otrioe"msrssNeepaclssuhu.tpiFhs-iterhdeeinHWotrinoudeteh)esagtsdaaiatshintGMspmEendouueytoeehynosgnIcesnsrtinNoesprlldoaufcaphftsthtdnuaghecmasioeesneiraerfrnfbshlmtnoeraibwbsRhfdeiiGtyene.ayoemgeorluietcosrfraWrioOrpgO:cnwirdayjaYoeeninienrinuohreaHGarohdogsdtduoetem.ttkaailvIaiwrdtoooiardigdnnnadueaemuowhsdtostr"rgnsMtinot1eGerrearteuhcnthevoeoilsehpCroribnearnbmcnenruUbsehretnRtnpthrnsiatids,ewefonaoT rfcihnndhEt,eeawTtaate.7unaftecisdtritmdhqkegTgh-seonoenaoordlehnnooraMfs,oayihoyaoasyasIdgeifbredtdnreiNmernbiwt3OiaeetoinrsctGatSeugtto'uen.'aitrseRowiehirebneiriutiNmnetltgieolfcriiaossnantbkrdamigndofwahftrmshxcnohu9aamscrpanni>ortnnsmaSahegorvagnPsVdldiGwruEvsAeaudtuagcsotanafesekerpooutInerhnhabdsarrEs-s"cle.iuaiahhgssek"eleei,Inahocai,tton.tarprpegeudhnii'egrAehAc,rSIteioilendtriyelvtgsgeg^ar.na,tpnsoareleemworAyceeoeioeotegh,e'sasBprnodwhaasrcenitaketnrnhceghaliawpplndfmasatnrtswttoreiarwdsmidntctnsoattvihibarnsagdwrpedstudemuattvidufalitocsMuoahfeuaasinasgat-hoaatldndNtanrgnnanuua1tteterrwetdwCwelsoirliCoeihahwelfdsthnattiftlessteeuhnotclihstrwehhehoahagp.tenhrimnnttipagyoervsrogpvinou7nseiotaaolvekhtbihd.ia\dnatcnotrr,HiiiestwiwsrnhecnnieaeitileoidnhriaticcdnensmelbaitdcnpHoniosinsieuaieseiysie8shshsprman-wraruhri-nssifac-hinvy-w.-heeni...reuAntirgoplurpdsucstdocrtddnsetardskridineiis-sede.S apdn5toenaie-slf!,noithhelhobhrro-dag.oenei'eaette.in-h1sphi-(-n"--flhaicltolunt,nsesom-nh.rItgtry--tr--n-ftsmpl,lv-enaasbSRetaeemtduWdgo-tegsst,sMeoww--ntbbyr-a-ftraeoafhoggitaasttuasndrhih.yhptJBfaprroJsdRePoePsHaHWah'abGWBCnCRotELBivenrCtLV ngotroMln.nsrrMioaMtsryautsTTmeTodsayaoihmno.noalrsiM .anrasyHineeytEuhaaae|eFyee"dtWhhs"aeuduhsdotealeadraeeenmsoedeanoestsnsisgshhehwTBthloPsrihgasant.rrctrlmoFPaaicrHTryleBtnouwnrhnrmomagreinhlieedEa,ileiwxrtmd,etbdsrhtrtedeettoneyerykedflegiyybhPlicehorwarosil.nmeatrhwrbr,hwnierpebtohGOomhriitiycnitycodcaiyeimtSeaad.esrsrEnaoto,dmei\iigieanhsnlstRieeynuhaahNoSregdnocsne.OJehhofeMatieofrsogatoseeayoyCthtrzandeoDrtenUhodgeets,mrneeesJgmrlgTselTeaneoeu2CnahfheennP.grcmgyrRaorndeodonlldo'nnki.eey'emgodlrnCsrmealdt,tt)orsit"d.rosrl1misgotJiSuoatShosryohsSasVwUHeodsdhSwr,ng.hckReaff.srirllmssem.doystJkenmEm,ryWcooaswevlLythGsr"irCmMeutOmenfeeANonhqiiimdeftBrdorieuiepdWhantaaEtafd-nbTnimE.apsoinlhteniiettgnhhlicor.roetaF,efp(Dcecti.unuef.nsiaetfHochranerheidfaaF.eloaoeeiloimpooshc,rcefbtg.'eDeiogihdnnetoifkvnerhrrllaogIopkiarrckacaoafttsnLRerlrre.e'aHwChfJTagataWkarnlfocsfelntb,eeaedshnwolnhnSFetfsnersuylatBelolifdSuthiyabeplvsTfsronrCeMerddvtC etresiDfreyhfeifsdsi2garulaea,tenohwhIdedtIa.rdnoc,mtWgyiilasylhnonaarrvdrebr)corwmttdrrioosiotsttoaitsIhsirhtah;vnte,WialEuslebsgbuncsetaias,.ooooedrre.o.dnrcegiinLheeha2Genltisaahwprtdrfwtealoafctce.efge.eaieatweremAhrioaDngHemeopCnmmJdpendwddtodtndSs-- NJrhn,,rrteeetoiMlcLtc-odomflyilPSllaee1taaeisiaeoireynCPumkredekTTGeeheiaor'leullslregoaecJlrnraohnnsnbcnrtMfioro.neg,nwntldlafbHltlaFG.hvsexga,nnatmcmaaIse'cM"wfrwanb;ctorlWhsoaovrbolirdrgMD,hoyuWdsm.syreaeGpisreLeosULdtearonmeEyyecaip,iddilmbuaiyheiistaorongeeiiraiuoVrhaearBandhnppwoeestdtSevcrlshlttmRfOnadiselleamdrWAFsscaruil1edcanibTosuiteelm,lellaiElgcmlrlttWkeernaonlTrktanleielot^tttecszoeroeceetvidleer:reCl'htsdrnedodvodonerabcngolteeMiinhhtwyMsytnsdsaepttr,serdtaCfiCihiehwtntrkwsOilcaehfcnrenmpgiriaiwdiiABsytlBdnhhec)geGoceosnnoeirotaoianof.eerleRlomrgsdhLr,nlsotheaaneua"oae,lc-shdoioEloodcakkrenhrre,ctrnmnfylrIeuitperitWrR--rcoelnoe"V iilsnhodoh^tlnsMoheetsmt.tsmstowouenyemWrlduWASmhionedtoaoaayventacDG^f,itednwarlenlsahhaw.LchtlnoeselvnCSiyshhsetofreGcr,lminuagt.seufpohirrassT>ldchi-hltaaebraWedaueIsdelorai,ege,iinuHreaBTHotito,taWrieneMuwvsaaatbnrswr--tG.h.eytWOrneGegisoiCil'egiaeaomnetEucglodnasP--eosBSo--tusdneoaohuunllcrlHKbromHeodttecpmldtcHouH(deeinanrusmrifdE.retsiederuNsF,teeucntp6cgairafaaikmhtgdRenoonaloaaiefoiTtbuctolptJwn;hnnticaoiewfeweoinBstfoaaeprabBebeaorirt8nngcalvoaeEFheiietmekttsrtiwegbbonwalO uMhirneicneeeaoTgtrannecoyvtlhssreth.csncarvtJM osronrddnihsuieudatuclrehtddnnedod-eieiierE.ahylytodegageh---r-errnlgeg-ericoh-r,fke-ls.s--rhrr-fenidr.--ennhheelos-hsse-t.ntsrrnltl-rr-ts,,trynylyeE rs.ey1Anea|nlye--,d:-,ni,--,,*,en-::-,el.,-teicRtnbrwdtfeomewtscsmnmTttacvyfaw3F--dmBsdTTtdaothhAmtostpvofbodaaeleoanJtohlPlrGhlCsJLFELdRm1aoor-olhA JrjlbiLTEoShWareeeraJmWGeianLDC iieLRWheeeeWarelrSTeosu7ecoceeaRFoehwDttyHoontCAe2euenetoCeereootaCodciuCleoorsscnnoudweiMeuudioclitmnauer7heyrtnahmnnhemnerfyds.h5in.frynoahfornecogcmniaihFostnustdeid"haeruaelccc.awrye1ohoshibrrElnfhesraerrsfr0tem,nccOinrlrenoatldeesbt,unetFuinlesvaibdecarwnsneFss1eaiesyuiehrmcoinlheMLaleannltaCc,plaFlhlnirseetJocenerKruiuandiNosiWnweddbionos.yhwodeicdurler.eodldr.WeonrdhtsspenpnaepadlWLaohCrlreesfiamtopho,ntHAcosslarugusme,yeseordferyb,aJClear.baantslifrfe"mr.aaieSdnlrnm liiaalchtmsCeJWoi,ofraofaEboooddufnsM,oa.aSaeeyaorneeSatdyrsur.RW.nw.olGtalyuJc,trrarttCwcsxosniESoonsEaetmlnuaoioppaCriets.ietdgpaseahresdreio.bcPlrcencnnohWfBWheennsthnaKcetMtenfmMJoDtul,dTDR SektonnotraemiHbrsrppvtnrOilAb1eghiletoNeeWwhdohhentenep--CaweyolbawnhtMcenhbliuepDgtDiMfokhetdw2o,uttersaae,lhenpeaehFltJrassanseCa(feicaneonahtgiahcaoefmesKceErbEbretrgseeaa.,rohhi,FhalcneaJnnseoFsroCr,inTostvtinaoCrnRnhurrragbeumakekfasloulvoetneGeisnrWnhecErhoeo,bC,fegerei.esyrlJeirnedrhmfrtiricCaOJmursw,wrravstpdtshatPtsririduonGdeordoeakehduneAdtraeuercnttrodDlderyihooeOSttaeCtpeiitesFoamewrbePousyhhmlsneawGdlnccKosr.rnPaddfnrrehuiSonhrrnaaaejHivMopeeoedremevahH etEs,uniiin,FdincM"eyutoelNy,frnrnooleetwcolneldeorfnrdiraimcrehaahoetddmnaaoyePaosayvTnrilteeDthmaetnGildam.serclnsemimmbreabMyk-JlltoienheAonenaBy,iuenahcercss.nlem,ctnslthn,resnIealenaeCLHftrhlhltan.irrriaaaigosgoGumr"Dnsr.rntoreAlecSasm.eglt,ioenoyGCaanpr2iyorSDnoyntla.BtPncwndanohdryPaensrasductreeasniSrrekE,yo,ectLfGfintm sETordBu8corWreoexao.3oiyegbataaeemNsskeeihephmmanc,em eaoa,ooc,MLHplaayhgnittredemsofo6tds,dntsdBrovsJ:imeowmdglftehnuneeclwedsnnhnhoeWaeilacalieyoftoTdirrnsrliisidet.OHeynori,prcaaManeaioriluJcSabtaooydsafJfntelrnleomrrhraoA,odmraeitDXtesndrBtoroagynf.d.nglieWs-uoiJserainldyotobihdgoelarnhnrsopoGyrsng,retween,wirpaedvlckeiohecsydwwu.eraaroeoaicenimenlee,sedlfr..ervaansg,eMntpasttn,clknnseaSfoaskeojtiensAehyaslloporiahMRhsdhlRtGeV,rtWJednlyvnerohetiabap-odcdvrarslt,bt,nddihe.vnvapogdeli^aeioodraoienpoaieMdhyrngtWDoutrniFMotiaeahyn,PaBaennTeearsuereAttyaaiwa.aeaadiWCndeeennnrrsnWCsahtnnfohEPyriiemsslicdldnoro,rnmtnu,IyppWrgaocnonny,htoieStwrreecuomnutuoweogHCsaleoinnbCutmht^oneoodannuottlronowSituANlogeshcoiao,srdvscMBalltimrnattaroacfcidaeatlpyauelcnlMPslaaocWtRloiagmnooh.gwsHgaceiidimlolm2OmcouiaioduealmabakiihehnnmnoJrcabrrmhttnoseelmosotyearoAJvlbkerhiibLiglanleno7iiutnipeatlrmyo'nynerwloorlcteoepeerdugedtoesaay-ednd-leoienfneesmgsam-ayosn--be,ue--ee-fs--kssre.y--h-fe-l.iwl-dJrlontslrh-s-i---,--,-s,,-err-,lr-,-,,.,Riii4<iii<iii

IITDEX. LIST OP VESTR^IEN ^856 -

PAGE --T

REV. JOHNATHAN COPP ^ IIISSIONARY

- Z

ACCOUNT OF THE KILLING OF ROBERT FORSYTHE - 6

FIRST IIXB OP AGUSTA MADS IN 1780

10

CONSTITUTION OP THE PROTESTANT EPISCOPAL

CHURCH IN THE STATE OF GEORGIA 1823.

16

ACCOUNT OF ST PAUL'S PARISH TAKEN FROM THE

RECORDS OF THE FOURTH COIfVENTION OF THE

DIOCESE, HELD IN MACON 1826.

20

CHANGES MADE IN THE CHURCH BUILDING.3^

23

LIST OP BECiUESTS LEFT TO St.PAUL'S PARISH - 25

COPY OF A PAPER BY MARY C. GUMMING ON THE

"EARLY DAYS OF AUGUSTA."-

32

PAPER ON THE COLONIAL DAYS OF AUGUSTA,READJ

BY ms. JOSEPH R. LAMAR AT THE UNVEILING OF '

MaiORIAL STONE PLACED ON THE EAST EXTERIOR

;VALL OF THE CHURCH.

38

JILLIAM LONGSTREET 1760-1814

47

V/ILLIAI.: LONGSTREET-a^-ai

49

PRESIDENT GEORGE V/ASHINGTON'S VISIT TO AUG-

USTA MAY 18-21 1791.

52

RIGHT REI.LEONDIAS POLK OCCASION OF HIS DEATH AND ACCOUNT OF HIS FUNERAL SERVICES.- - - - 55

DESTRUCTION OF THE THIRD St.PAUL'S CHURCH

MARCH 22nd, 1916. -

61

SERVICES OF St.PAUL'S AFTER THE BURNING OF

TEE THIRB St.PAUL'S.

- 65

CONFIRilATION SERVICES HELD IN THE REAR OF

THE RUINS OF THE THIRD CHURCH. ^

67

LAYING OF THE CORNER-STONE OF THE FOURTH

St.PAUL'S CHURCH.

- e9

CONSECRATION OF THE FOURTH St.PAUL'S ON MAY 7th, 1919.

72

NOTES REFERIHG TO GIFTS AITO MSI>IORIALS STB.

OF THE FOURTH CHURCH.*

t

-

73

CENTENIAl CONVENTION OF THE DIOCESE OF

GEORGIA APRIL SEnd, 1923.

-

79

HISTORICAL PAGEANT HELD IN St.PAUL'S CHURCH-

YARD ON APRIL 23rd, 1923.

81

LIST OP VESTRYMKN 1856

/ LISI 0? VESTHYMEH 1856

KLSCTSI).

W> ^ -

shop. --

il

Mxaherin. Dr. J.Morgan. Geo.W.- - -

1856 - - 1856 - - -

Carmlohel. T.C. -

1856 - -

Blaily. A.

- - - 1856 - - -

Ford. L.D.

- 1856 - - -

Wright. C.M* - - - 1856 - - -

Oonly. B.

1857 - - -

Ferry. G.W* - -

1857 - - -

Baker. Chaa, J. -

1857 - - -

Wright. J.S* - - -

1858 - - -

Russell B.B.Sr. -

1858 - -

Reese. John C.- - - 1860 - - -

Adams. L.A- - - '

1860 - - -

Platt. C.A-

- 1860 - - -

Hewbry. J.M. - - - 1860 - - -

Force. A.C* - -

1860 - - -

Adams. li.A.

1863 - -

Oates. Geo.A. - - - 1861 - - -

Fargo. J.C.

- - - 1863 - - -

Jenkins.Got.CJ-

1864 - - -

Ballook. R.B, - - ' - 1864 - - -

Cummin^.J.B. - --

1866 - -

Jones. J.C.

- - - 1866

Dunbar. Barney S. - 1869 - - -

Evans. W.E. - - - 1870 - - -

Steiner. H.H. - -

1873 - - -

King. H.B

- 1873 - - -

Barrett. W*H. - -

1875 - - -

liiller. F.H. - - - 1878 - - -

Crane. W.H* - -
Day. Joseph H.- Clark. John W. - - -

1878 - - 1880 - - 1880 - - -

Smith. B.H.Jr.- Green. John W. - Davidson..W.T* - Platt. W.l - St^^fford. T.H.- - -
Ford. Dr. D.S*- Miller. W.K* Greinleaf. F.W. Robertson. J.L. - -

1884 - - 1887 - - 1887 - - 1888 - - 1888 - - 1888 - - 1893 - - 1893 - - 1895 - -

Martin. Alfred Jr. - 1895 - -

Fargo. Dr. L.W. -

1895 - -

Clark. J.A.A.W. -

1898 - - -

Cook. J6hn S. - - - 1899 - - -

porter. A.H* - - - 1901 - - -

Pressly. C.P. - - -

1901 - -

Died while holding

SERVED ^ 6 years..
-36 " .

SLECTSD

SE

Davidson. A.h.

1902 -- - -

Powers. F.F. - - - - 1906 - - - - -16

Kitchens. W.H.

1906

6

McGowan. J.T*

1907 -

2

Hill. Audely

1909 -

3

Coffin. Geo.R.

1912

3

Teague. Dr. N.A.

1912 - -- 12

Townsend W.J.

1912

-16

Dunbar. H.Stiner - - - 1913 - - - -- 9

Hull. James Jr.- - - - 1913 ----- 9

Russell. li.B.Jr.

1913

- -15

Coffin. Frank ',T.

1916

7

Platt. W.E.

1916

12

Marshall. F*!. -- 1919 -- - 9

Twiggs John D. - - - - 1920 - - -- -

Clark. J.C.F.

1922

6

Kershaw. Dr.T.G*

1922

1

'Shite. ,T.B.

1922

lowe. B.T*

1923

Gulley. F.B. - - - - 1926

Danforth. E.C.B.Jr.- - 1927 -----

Cranston. Dr. 'S.J - - 1927 ----- J

Martin. Sam - _ - - 1927 - - -

3

Sohley. Geo. - -- - 1928 - - - - -

Flythe. J.H*

1928

CAzart. A.M.

1928

2

lewis. J.R. - -

1930 - - - - -

Duvall. M.H.H.

1930

REV. JOHNATHAN COPP FIRST MISSIONARY SENT TO St.PAUL'S CHURCH
1751

The Rev. Johnathan Copp was in 1751 sent over as a Missionary to Augusta,Georgia.
This gentleman was a native of Connecticut, and a graduate of Yale College. There being no Bishop in America he was obliged to go to England for orders, where in December 1750 he was ordained deacon and priest by Dr. Sherlocfc Bishop Of London.
Before his arrival, the gentlemen of Augusta had built a handsome and convenient church opposite one of the curtains of the fort and so near as to be protected by the guns, which was the fatherest point the Church of England had ye,t penetrated Anto the Indian territory. The inhabitants also agreed to build a parsonage, cultivate the glebe and give SO pounds per year towards his salvy*
Such evidence of zeal inspired Mr. Copp with hopes of comfort and success; but when he reached there, though he found a congregation of pearly one hundred persons, and eight communicants, he did not find any parsonage or glebeland under cultivation, and had but little hopes of receiving the 20 pounds per year offerd by the committee.
Separated from any brother clergyman by one h"^-

dred and thirty miles of wilderness, on the frontier

of civilisation, bordering on the Indian territory,

and daily liable to the merciless attacks of say^es.|

with but little cheer, euid much to discourage, with |

<?uoh small remuneration and ardeous labor he contin- j

Sfinie

Of .

I

to the rectorship of St. jonn s parj.aii |

siuth cLolina, where he labored until his death =

in

,,

1758 the General Assembly of the 1

there

'^and'^lso to^e^ipo*er"the Churek

Church of

^.p the respective Parishes,

;

gardens and Vestrym

repair of the Churches, and

to

^pf'^the poor and^ther paroohiel devices." !

"'Sifact JurtLr provides, that the District of Amrusta (including what was afterwards known as Riboh- , m^d and Columbia Counties,) Shall be and continue forever a parish by the name of the Parish of St.PaukS " and that "the church selected in thettown of Augusts
with the cemetery or burial place there to belonging. shall be the Parish Church and burial ground
of St.Paul's."

In the year 1764 the Rev. Samuel Prink, was sent to Augusta by the "inoorprated Society for Propagating the Gospel in Foreign Palrts."^
He found 6h?his arrival fifteen acres of the gl^beland under cultivation, and a good Parsonage belonging to St* Paul's Parish.
He was followed in 1767 bythe Klssionary Edward Ellington, and in 1771 by James Seymore.
F0

KIIilNG OF ROBERT FORSYTHE. 1794.
1

7 AK ACCOOTT OF THS KILLING OF ROBERT FORSYTHE
BY BEVERLY ALLEN IN 1794.

Beverly Allen carried on the business of mer-

chandise in the County of Elbert (Georga) in

179S-4. His storehouse and residence were on the

hill rising from Beaverdam Creek, on the south

side of the road leading from Pishdam Ford on Broad

River to the Cherokee Ford on the Savaonah River.

He was Young and handsome,with a fine voA.ce and

ardent tempei*ament. He came ,to Georgia an enthusi-

astic Methodist Preachef. VAthout the learning of

'.Yhitfieldjhe had much of his inspiring elo(iuence.

Preaching was a rarity when Beverly Allen settled

in Georgia. Men's souls were stirred within them

when they heard vivid descriptions of the punish-

ment in the lower world fior sin,and the happiness in

heaven for those who died in the faith,and left

their good works to follow them. When Beverly

Allen held forth on these subjects, the whole pop- ^

ulation orouded together to hear him.

;

Some time in 1794,he went to Augusta to bi^ goods j

with the money he had, and the credit he

^b- j

tain.

.Thilst there, the foreign merchant of whom

he had purchased his first stock, found him

goods of others,instead of discharging the drbt to |

himself. He caused a writ to be issued for the arrest

of Allen, returnable to the United States District

Court. Being informed of his libality to arrest,he ,

armed himself,took possession of a room in a

.

house, and fastened the door.

was the father of the celebrated John Forsyth, pur-

sued him, broke open the door and was upon his en-

t^^ce, shot dead. Allen was arrested upon a clmrgt^

of murder, escaped and fled to his home in Elbert.

William Barnett, upon redeiving the warrant, assem-

bled a ^rf^d went in search of him. He ascer-

|

tained that Allen was concealed in his house. 5ier m^ f^itless attempts to get him out, the

waa^set on fire an!

burn^^til he

deliverd himself up. He was confined in the jail n-f the county. The news spread among the people Sth ellctric quickness, that their favorite preach-

er was in jail for resisting the process of the United States Ciurt, the object of which had been

to take away his liberty,and to separate him from

his home,friends and flock. The process of the

Circuit Court of the

3tats was then very

unpopular on account of the violent political con-

test between the democrats and federalists, in whichj

the power of the United States Courts made one of

the subjects of party disagreement. In those

days the people were a law unto themselves. The

restraints of Goverment had been very slight duri

ing the domimion of Great Britain. They were

soaroely felt at all on the frontiers of Georgia

at the time of the arrest of Allen. Voluntary

Associations, called Lynch Men, afforded some

protection a^inst thieves. Personal rights

were defended by the fist. Liberty and OpOO

ally liberty of person, was, from habits of speaking, act ing, and feeling of the times of the Revolu-

tion,and immediately after, considerd by many the

chief good. In such times, among such people,

operated upon such causes.

It was not wonderful

that the imprisonment of Allen produced popular

commotion. The sheriff,finding that the rescue

of his prisoner would be attempted,set off with him

for Washington, ^Wilkes County. He was h-^aded off

on the road and compelled to return. He increas-

ed guard to sixteen men. One or more of them pro-

ved to be friends of the prisoner. On the night

after V/illiam Baenett's return from his attempt to

secure the criminal in Wilks Jail, the J^^^

KLbert was attacked by two hundred men, the doors

forced open, and Allen permitted to espe.

The friends of the prisoner, had, previous to

the attack, taken the powder from the looks of the

guns of all the guards from whom any da^er was apprehended, except one, and he was held so that

Beverly Allen fled to the most distant frontier of the United States, where history says he lived to an old age, doing a great deal of good.

Prom Sketches of some of the

Settlers of

Upper Georgia,

Gilmer. (Pages 105-106.)

FIRST HAP OF ATKJTJSTA HADS IH 1780.
\\ t

AUGUSTA, GEORGIA>
Previous to 1780 and at that date the streets of Augusta were not laid off; there were then a few hundred inhabitants and the houses of logs were scattered where the owners of the l*ind fancied. The limits of the town were laid down in this plan but the streets were not laid off or named. In the year 1780 commissioners were appointed by the legislature to lay off, strai^ten the streets and sell lots in squares, which will appear in the earlier records clerks office, Superior Court,
The attached, is printed the original plan and map of the city of Augusta as laid off in 1780, Ibl years ago. Previous to that time the Streets of Augusta were not laid off.
It is interesting to note that of the five commissioners ^o originally laid off the Streets of Augusta, that William Glascock was the greatgreat grandfather of Hon, Thos. Barrett, Jr,, the present Mayor of Augusta; that Daniel Mac Murphy, one of the commissioners, was the grand father of A. M. MacMurphy, now living in Augusta, and that John Twiggs was the great-great grand father of Albert Twiggs, also a citizen of Augusta, The other commissioners were George walton and George Wells, who also have descendants now living in Augusta,
The first map of Augusta shows six ning east and west. Bay, Reynolds, Broad, Ellis, Greene and Telfair, which are the names of these streets to-day. Running north and south seven streets are shown, commencing on the east at the lower end of the city with Houston, Lincoln, Elbert, Center, Washington, McIntosh and Jackson. Center street was then in reality the center of the city, three streets to the east and three streets to the west of it.

// THE FIRST MAP AND PLAN OF THE CITT OF AUGUSTA

Laid off by commissioners in i7ao 4

Plan of Augusta Laid off by Ooimnissloneifij, 1780

William Glascocki

George Walton,

Daniel IfcMurphy, John Twiggs,

Commissioners, 1780.

George Wells, . ^

\ii
(JNVl ^A/V^loW

/V

MIGnOH

'A

01

/vioofTrj

SA\AJVJVAU TiWtK

T4 T

XhUJ`^13 ^ to lii Qc
y^MA/^O
To ^AV^A'A'A // <
HSOJA/f W

MS

A/o`i>i:)YT

first IIAP OF AUGUSTA, '
1780.
bloclcs wide and seve^n bloolscm s alollngo,ityac,coJurdsitngsix
ijw Soanu. This map was decscoomvmeridssiboyneMrsr. thJoehrenoDf . in of A\igusta, descendant of Major General
pv^gs in the archives of the state capitol in
hbVyr the commissioners rehvadeatlhs irttheaetn thsetreceittys, pelavnenryed one of which maintains the name by which it was disignated at the time it was laid out.
there were six streets running parallel to the Savannah river and skft seven cross streets. Begin with Bay Street next to the Savannah River, the parallel streets in oinier were Reynolds .Broad. j,nis, Greene and Telfair. The length of these streets was limited on the original map to seven biocxs, running from Houston to Jackson and including in the cross streets, Lincoln, Blbert.Center, (which at that time was the center of the town); iashington, Mcjntosh and Jackson.
The commissioners who laid out the town were .Tilliam Glascock,George '.Yalton, Daniel McMurphv John Twiggs and George Jells.
An explanatory note on the map reveals as the reason for an officially symmetrical Augusta that "Previous to 1780 and at that date, the streets of Augusta were not laid out; there were a few hundred inhabitants and the houses of logs were scattered where the owners of land fancied.
In the year 1780, commissioners were appointed to draw up this map."
The original map was lost for many years in the later history of the city, probably resulting from the removal of the capital several times before the v/ar Between the States.A-ugusta was the capital for ten years, 1786 - 1796 Louisville in 1799 Milledgeville in 1804 and finely in Atlanta in 1866*
The first map of Au^justa v/aa found by Kr.Twiggs in Atlanta, when in company with attorneys he was searching for land titles: for the county of Richmond, of which more than 40.000 were abstracted by the attorneys, llany of the original titles were rempved to Atlanta with the state capital and it was while engaged in the work that the me disooverd. A copy was made, which is one of the few of the original plan of Augusta in exis tenoe to day.

Of oourae, there was a day, prior to 1780

wrien Augusta had not yet attained suoh met-

ropolitan corpulency as to necessitate any

definite plan of streets* its growth actual-

ly be^an In 1735, when Otjlethorpe sent a colony of troops up the Savannah river to establish a

trading post with the Cherokee Indians. Its

expansion seems to have begun immediately, for the Indians soon became accustompd to the com-

in^j of the white man*began forming commercial contacts through the trading posts where they

bartered deerskins and other possessions for rum and other products from across the sea.

Augusta was then begixining to take on the form of a trading post in the center of the

Cherokees. Hhen G-eneral Oglethorpe sent out

a handful of men to establish the fort in 1735,

the Indians had a trading post in Charleston, 9

one at Savannah west of the river and one fur-

ther from the coast. A fort was set up about

XZO feet square on the bluff of the river and

fortified with eight small iron cannon brought

over from England.

Flat boats were put on

the river and made irregular r\ins to Savannah.

Iniiabitants of South Carolina and Virginia

poiired into the little settlement, bringing rum

and various articles; and after several years

the little fort which was named Fort Augusta,

after Princess Augusta who in 1736 married the Prince of Yales,and become the mother of Ceorge

111 had several hundred inhabitants. Yarehouses were built, families moved fjirther

out on the edge of the settlement in order to

become first among the barterers with the Indian

traders. Irregular log cabins went up more adven-

turers wandered in,i90re rum v/ent out to the

Indians (and it was preceding the first and only

visit of Oglethorpe that more than a thousand

Indians died from smallpox which they contrib-

uted partely to rum), and mention is made of

debts that the Indians made with the traders

and were never seen again.

It was in 1751 that Rev. J.Copp, first mission-

ary, wrote "People lived in Augusta in fear of their lives,"and again"A great concourse of ab-

sconding debtors had taken refuge here."

So we find a little more than a decade after

the establishment of Augusta,that a body of commissioners,consisting of five members,was

formed to rule the town and act in the nominal capacity of a mayor.

The first land grant made to the town was a glebe of 300 acres for the purpose of erecting

a church# the church was built in the form of a small log cabbin near the fort, and given the

naiie of St*paul*s Chitroh. {See page 6 in Histori-

cal Boole Not !)

The story of this bhuroh is

of especial interest becauae it is the only institu-

tion in Augusta which has come: down to us from Col-

onial times; which survivrd the shook of the Revolution and holds its ancient site to day, and whose

cemetery was turned into a battlefield in 1781; where many monuigents of the heroic dead were destroyed.
It was these same commissioners, in name.Daniel McMurphey, iVilliam Glascock, George llfalton, John Twiggs and 3-eorge V/ells who in 1780 were instructed to "straighten out the streets," draw up a layout

or map of the streets and submit it for aproval.

This was done, and the original streets being

Bay Street, Reynolds, Braod Ellis Greene and Telfair streets more or less parallel to the river, .Vashlngton, Center Elbert and Houston at right ang-

les.

In a certain history written of Augusta,nsearch

was made for the original plan but it was never

found. Yet it was generally believed that such a

plan was at one time in existence, or that the

traders and Indians formed paths and small roads by

the side of which small'log cabbins were built,

forming irregularity of streets. Since no proof

is existing of such an ancient plan this is possi-

bly the natural assumptibn.

The above was written by Mr. Jack Bates, a correspondent of the Augusta Chronical, and publish-
ed in that paper. On page eleven is a copy of the map tiiat was desooverd by Lr. *^ohn Twiggs in the state oapitol in Atlanta.

CONSTITOTIOK OF THE PROTESTANT EPISCOPAL CHURCH IN IHE STATE OP CJEOROIA. lazz.

COHSTITOTIOH ~ OP THE
PROTESTAHT EPISCOPAL Tg

CHDHCH.

STATE OP GBORaiA*

/ 4

7?^ unanimously adopted by a oonvention

S,"L'lS?h''S "

*'*"'*

Article 1.
The several oougregations of the Protestant . ^isoopal Church in this state now ^represented in this oonvention ishall be oonsiderd as one church or Diooese to be known,and designated bv
the ^e of The Protestant Episcopal ohxiroh in the state of Georgia?,with a view to an union with

of

Episcopal Chxiroh of the United States

Article 2,
Any congregation of said Church in this State not now^presented in this Convention.by makiruc application to the Convention for admission,shall on adopt^ this Constitution, be received into union with this Cnuroh or niocese*

Article 3

A Convention of this Church shall be held on the third Monday in April A.B. 1824; and on the same day of each succeding year, at such place as the previous Convention may appoint. Providing however that np convention shfEll be opened for the transaction of business u^ess there be at least two Clergymen and delegates from two congregations present. And in case no Convention be formed^the standing officers of the last Convention shall hold their respective offices until sucoesors shall be appointed.
Article 4.
All Clergymen of the Protestament Episcopal Church of regular standing residing and statedly cpffleiating in this state shall he oonsiderd (ex officers) members of the Convention.

A

Church / 7

Mpraaehtation by one

K

exceeding three at

r/iarcSrsiX""" Article 5.

Se?^l^

`* -P"'i with Divine

b,'T5rpS5i;jr";.S.V'"*`" ` `'

Artlole 6

The Convention shall deliberate and act as on ^ody, unless when ahy mamber shall call divlsslon 0 ^ auction, L^lL''S8e^oh

I' entlteled to one votl.^M the

on

^*^ Congregation jointly to

n neeeLeIsar^y'?t^o^aadm eoaljaolrointy, of both orders shLl be

Artlole 7.

the Convention,a President 8^11 be chosen from among the Clergy,until a

Bishop be appointed for the Diocese who shall t-hAn

be (ex office) President of the ConvInSloS

"

Article 8.
meeting of the Convention a seo-
tthhe ^mnem,rbers thereof, each tobehoelldechteids rfreosmpeam otoln^^ office until the next Annual Convention.
Article 9.
A standing committee shall be chosen at aanh Amual Meeting of the Convention to consist of
Cierlcal, and three lay meib^rol tJe time and place of whose meetings, due notice in writing, 3^1 be given to all the mLbe^s ^^eof at least four weeks before the time of such meeting. At a meeting thus ndtifled; any four
^ ClergymaA) sLn"?orm The standing committee shall mmet as soon as practicable, after their election; and choose a president, and secretary from among their own members, And it shall be the duty of the President to call a meeting of the Committee,whenever he shall deem in necessary,or whenever he shall be

req,ueate4 ao to do, by any three or mote memera of the Committee*
The atendlng oommittee ahall have power to of thda Churoh, when
ever paeculiar oiroumstanoes may reader it providing at leaat four weeka notion
tionn^, ahall be given in whroitldiningg, atouoah lCl otnhveen-

wuK?a "wS

"^eation8 oonneoted

aa are deaignated by the general constitution of the Churoh.

Article 10*

elect ita ballot; eaoh Clergyman to be entitled to one vote and eaoh Congregation to one vote-

to be expreaaed by ita dele^tibn.

'

Article 11.
After the close of this Convention no tion of this constitution ahall be made hut nt"
Convention^^tSe^

Of"lbTM5"Iets"`` "

"> 28tb. dajr

(aigned)

Abril Carter.Pra. pf cony. Hugh Smith R.st.Paul'a

James Bond Road M.: ffilliam Parker. P* Guerard

Augusta*
Delegates from Christ Ch Savannah.

John Course Campbell 4 Thos P.-yiay. )

St. Paul's Ch\iroh Axjgusta.

ACCOUNT OP St.PAULS PARISH TAKEN PROM THE RECORDS OF THE FOURTH CONVENTION OP THE DIOCESE, HELD IN MACON IN ISSe.

THE FOLLO;VINCr IS TAKEN PROM THE JOURNAI OF THE PROCEEDINGS OF THE FOURTH CONVENTION OF THE PROTESTANT EPISCOPAL CHURCH,JN THE STATS OF GEORGIA: HELD IN THE PARISH OF CHRIST CHURCH,MACON,ON THE 24th AND 25th OF APRIL
1826.
The Parish of St.Paul*sjAiigusta, was incorporated a considerable time prior to the Revolution. By a report of the "Society (In England) for the propogating of the Gospel in foreign parts," it appears that the Rev. lr.Frihk*was rector of the Parish in 1764. He states to the Society that there was then a good Parsonage, and a glebe of land. In 1770,the Rev. Hr. Ellington^wrote to the society,that,in the three years past,he had baptized 428,married 62 couple, and that his communicants amoTinted to about 40.
After the Revolution the Glebe was confiscated and applied to the endowment of an Academy.
A Church was subsequently erected on the soite of the present St.Paul*s which was open to all denominations. The Rev. Mr.Boyd,however was ffearded as the Rector of the Pariah. He took charge of the Parish sometime previous to 1780, and removed from Augusta in 1798 or 1799
The members of this Parish afterwards became attached to other denominations.In 1818 or 1819 an act of Incorporation was obtained from the Legislature ,wtiich was later altered and amended.
The corner stone of the third Church was laid in the spring of 1818 but the building was not in a state for occupying until March 1820, and was not completed until 1,'^rch 1821.
St.Paul's is built of brick. Its length is 94 feet,its breadth 62 feet. It contains 124 pews on the ground floor, and 14 in the Organ gallery, there being no side galleries. The pitch of the ceiling is 28 feet. It is of the Grecian Doric order,and in point of c^steness,simplicity, and beauty, is scarcely exceeded by any Church in our Country. The design was furnished by Mr.John Lund, the Architect by whom it was built. The cost of the building was upwards of 25.000 dollars. It has been furnished,by subscription, with an Organ of superior tone and finish, built by Mr. Hall, of New York, the cost of which was 2.500 dollars. The female part of the congregation subscribed the sum of four hundred (400) for a service of Communion plate, and a bell of 15 owt. has also been procured by the liberal contributions of the Congregation.

St Annio

Smith,at that time Rector of

Reot^ahlS^]^?qi Brooklyn,1.1.was elected to the Md ef nterd uponSth.Pisaudl'u3tieins itnhe thseprfinagll oof f 18th1e9'

was at that time, only four

period,the whole number deaths and removals have reduced that number to 55.

above may be found in the book of Records of St.Paul's Church,1855 to 193,

% 3r-dnf^lrarissionary sent olvieisrsiboynathrye SanodciH etry/Eilnlington London*
rector of the 2nd. St.Paul's after the Revolutionary \7ar*

CHAWG-ES MADE IH TffTC CHURCH BUILDING.

VOTES PASSED REG>VRDING OHAIiaES iJLDS IN THE CHURCH BUILDING.

September 11 1860.
Voted -- That the cheinoel be lowerd one step. The rail to be of blackwalnut, six inches in width, and the ciiancel to be altered to corrospond with the window above.

Voted - that the rector be informed of the size and shape of the ciiancel, and request him to purchase desk and furniture for same.
October 12 1860. The rector plaaed before the
Vestry the plans for the chancel furniture.
Voted - to have a Bishops-chair and a Rectors, a Leeturn, Heading Desk and Altar.
Voted to have the door in rear of ciiancel taken out and the wall under the window in rear of chancel pannelled.

tlaroh 29 1869. Voted-that llr. ICiller of New York
be requested to draw plans for the onlarglng and Improving of the church and that he be paid one hundred dollars for doing the same.

August

10 1869. Voted - to make a contract for the
extension of the church as prepared in the plans submited at a cost nfit to exceed ^2200.00.

November 17 1869

Voted that a committee be appointed

to solicit subscriptions for the exp

pence attending the enlarging of thy;

church.

^

LIST Oi^ BEQUESTS LEFT TO st.PAU'S PARISH. AS EHTERP IH THE RECORDS OF THE I^ISTINGS OF THE VESTRY.
1855 to 1923 BOOK E.

^Legacy of Chaa, J.Jenkins.
July 23 1883. At a meeting called for the purpose of hearing a report In favor of uselng the legacy left by the lateSenlor harden Chas. J.Jenkins, twoard building a new Rectory. committee were authorized to dispose rectory to the best advantage, and build a new one on the same site.
Page 194.

JLegacy of lir. M.P.Stovall.

llay 1 1887, Called lleeting of the Vestry. The rector read a letter addressed to
the "ardens and Vestrymen of Sj. Paul's Church from Ar. C.S.Pressly Exectuor of the will of

advising them of a bequest of ^500.00 left them. It was voted that the

Secretary acknowledge the receipt of the same

^d pother receipt for $500.00 when paid over

to them. Page E18.

^

llay 30 1887. Called Meeting of the Vestry.

Voted that the legacy of $500.00 left by

Hr. Stovall be donated to the enlargement of

the Sunday School room.

Page S19.

Legacy of J.P.King.

The annual statenient of the treasurer made for November 8 1890 to November 9 1891 contains

the following.

"By legacy received from J.p.King - $1,000.05

There is no further record of this legacy in th

records.

Page E47.

e j n cn

Legacy of James Bowen.
April E4 1901. Called Meeting of the Vestry. The Rector read a letter from Misses Carter Hughes and Dwight of New York in reference *

to the legeoy left by Janes Bowen of |3.000,00 ^0 St.Pa41*s Church. The following resolution was adopted.
"Resolved, that the Rector and secretary be authorized to execute in the name of the corporation, the power of Attony to Lisses barter, Hughes and Dwight, Attorneys of Hew York, in order to collect the legeoy passing to the church under the will of Kr. James Bowen, deceased. Page 303.
April 24 1905. Annual Parish lleeting. At this meeting i-r. 'J.K.lIiller,stated
tliat he had placed on the plate Saster Sunday a check for $1790.88 the amount collected from the legacy of llr. Bowen of New York.
322

Legacy of V&vy Adams Buckley.

April 24 1901. Called Meeting of the Vestry.

There was re%d at this meeting a letter

from the|i Surrogate of Hew York State eisking

for a fee of $100.00 for the tax on theUegacy

_passing to the church under the will of^

llary Adams Buckley of $2,000.00. The secretary

was instructed to acknowledge the receipt of

sane, and to inform the Surrogate that the

Church accepted the legacy of $2,000.00

under will of Mary Adams Buckley, that they

authorize the Executor to pay the legacy

tax of $100.00 from the same, leaving net to

the church $1,900.00, and if this cannot be

done, the Treasurer be authorized to remit

$100.00 to the Surrogate in payment for the

same.

Page 303.

November 4*^1901 Regular monthly meeting. The Rector read a letter from Ir.Buckley
in which he stated that he hoped the matter of the legacy left to the church by Mrs. Buckley would soon be arranged. The secretary was requested to send a telegram to Mr.'J.Ki:iller, who was in Hew York, requesting him to see the AttO)([rnies and try to arrange the payment of the amount left the church.

Copy of receipt for same on page 309. Dated March 10 1902.

In the ^'inancial Statement for 1901 is the

V

^7
follow!^, "Reoelved from legacy of 7.T. Davidson $150.00'.' There la no meition of this legacy in the Minutes of the Vestry I-eetings. Page 307.

--I'egacy of Mrs. Y^inia II. Pinhinton.
Kovemoer 24 1911. Meeting of the Vestry.
legacy of the late lira, viginia i;. Pinkinton be accepted and that tae clause in her will under which it was granted be spread on the i-inutes as well as a copy of the receipt given to her executor.
James T* Gardner* Voted that the amount of the legeoy reeo-i-
rece ived from the Kxecutor (5858*13)be invested in loans on property, or as may be determined by the Finance Committee. Peige 379

_ Copy of item la in will of I.:rs*V,PinklntQn.
''lUlve and bequeath to the v/ardens and Vestrymen! of St.Paul's Church, Au^justa, Ga. to be known as the I.:rs, Annah.Sdmondston fund, the sum of one thousand dollars (s^l.000.00) the principal to be kept intact, and the income to be used for the benefit of said Church, with the proviso; namely -"That so much of the interest as siiall be required to keep in good order the section in the City Cemetary in which the severil members of my family lie buried, and where I expect to be laid to rest."

Oepy of receipt given by the Treasurer.

"'.Ye the -hardens and Vestrymen of St.Paul's

Church, Augusta, Ga. have thisj^ day received

from *^araes T Gardner the sum of Eight Hundred

fifty Sight Pollard and Thirteen Cents(858.l3;

left to the iVardens and Vestrymen of St,Paul's

Church under item I'd of the last will and

testement of said Viginia ll. Pinkerton in ful*

payment of said legaoy.the estate for distrubu-

tion amounting to only 85/8133 per cent of the

sum bequeathed.

(Signed) F.P.Powers Treasurer

for the V/ardens and Vesterv

St.Paul's Episcopal

pt

1911.Church. Augusta. Oa,

1g-

this le^aov In

f

mejition of

-legacy of ^s. Vi^mia i:.

;in: EIL'Hr? f-"-amount Of the legeov roool
determined by the FinancI Co^ittee! vt^e%9 item 12 in will of I.:rs.v.Pinv<^^..'

=yH"=5S;Ssr

#5".",".'ri"i";

^

benefit of saia Church

thrinten^r'^^ V

SO mu^ of

ginoowdhi'c^hrtthhfeafsceU veorinl'^mL em'tb^eers'colftvm'cy ef'a^m"?il^y^^

Lst"^ ' and where I expect toVe

to,

_Sepy of receipt ^Iven by the Treasurer.

cwj,'X-S!"L?"L;rsssr4

cSS.r.^SLisrL'^? srsr;L"`Af"^'" testement of said Vi^inia I . PinJcerton ?n f> i Wnt of said le^-acy.the estate fo^dlstrubu

tion amountine: to only 85/81SS per cent

sum bequeathed.

(Sii^nedl w p -d^

srLrss";

^a.

2^
legacy of Ira, Julia F. Moore,
tTxily 5 19E7. Regular Meeting of tlie Vestry.
Resolutions passed regarding the legacy, llrs. Julia Floxirnoy Moore
of ^5.000.00, also the use this lagacy should be used for. Book 3 Page 62.
The Hess Fund.
I-ay 1 1928. Regular meeting of the Vestry.
A communication was read relative to the Ness fund, which was voted to be received as information. Book 3 Page 70.
May 20 1928. Meeting of the Vestry. It was stated at this meeting that it was
called for the purpose of entertaining a change of committee for the handling the Ness fund from the present committee to Bishop Reese * of the Piocese of Georgia, it being considerd that said fund could be handeled more expedently with such a committee. Book 3 Page 70
Memo.
On page 73 of Book 3 is enterd a communication headed as follows,
"IN RICHMOND SUPERIOR COURT. APPLICATION FOR CHANCE OF TRUSTEES.
appointmsi:t of f.f.reess BISHOP AS SOLE TRUSTEE."
This refers to the Ness fund.
The Mrs. HAlexander Legeoy,
l!ay 30 1928. Meeting of the Vestry. A communication was read from Hull, Barrett
and .Yillingham asking for instructions from the Vestry as to the persons*to take title under the Alexander legacy.
A committee was appointed to get legal advice as to which of the following titles should be used.
Chixroh'^^ '`hardens and Vestrymen of 3t. Paul's

t.

29

or ^The Rector, 7/ardens and Vestrymen of 3t.Paul's Church."

instructed to investigate

placeing the Alexander legacy in trust with coporate trustees, and

assertain what changes such trustees would m

make.

Book 3 J*age 71.

September 4 1928. Meeting of the Vestry.

Voted, that the receipt gor ^2.000.00

worth of marketable securities be signed to

the executors under the will of Mrs. H.D.

Alexander in lieu of costs, and that Mr.

Edward Panforth and .7.J.Cranston be appoin-

ted as a committee to meet with Mr.F.B.Gulley

and select securites after apprised by a

broker to their values.

Book 3 Page 76.

October 8 1928. Meeting of the Vestry. Report was made regarding endowment fund
of &s. Alexander to the effect t;iat the beQ,uest of ^2.000.00 in cash had been invested in Georgia Power Company Bonds, bought at v98.99 bearing 5^o interest,

The following is taken from the Church Bells of July 1916.

Mrs. Barrett*3 Legacy to St.Paul* s.

S;

received from Mr. '"">

i ijive ,and beq^ueath and devise to St.Paul's Episcopal Church in Augusta,the sum of One Thousand
(i?l000),to be used for the benefit of the Parish House either in paying off any existing debt,or,if no debt,in improving it " Under the law this legacy would be taxed five per cent,but my nephew.,,Clark Howell Jr and I who are the only ones affected in fv>A >
K^.OOO will be net to the Church."

GIFT OF MRS>1.0UISE POLLARD >
Through the generosity of Mrs.louls^ollard St* Paul's baoame the possessor of a lot situated near the Globe Mills* In order to enable the Church to realize upon this gift, Mr*J.C.F.CJlark ^ kindly puro^sed the lot at a generous price.
October 1931*
FROM TREASURER'S REPORT FOR 1901*
"Reoeired from Legacy of the.Est* of Vf.T. Davidson- - -- -- -- -- - -$150*00

3^^ A PAP3R BY llARY 5. CUiailNS CONCSRKING THE

I^ARLY days of AUGUSTA.

in the ''gooI^3hi^Ame"^on^w

Uraveaena

TOs with a Lree?fo^^

November 17,1732,it

colony of Georgia in Amerinn he was interestea in ^ovidiAir

establishing the Philanthropist,

unfortunates in the deh*X-=7^ ? This wo^d bfl oolonv

Sngland.

them, a new opport^itv^

f new world, and for

to strengthen the militayjr

^ aold.ier, he wanted

Anerioa by establishing the Carolinas anS

England in i\

AS a statesman and finanoi^ h ^ possessions,

were great possibiliii*an o?

thought there

orown by the cultivation of thtn^ wealth to the

land. As a practiole boi

fresh and fertile

woull secure m^e nubile

^^t he

last two grounds tLn^on thefi^t"^ support on the

he, and with him, his aLocLfr * A

idealist

le* with highest stlnS^ ??' the only one of the 13 colonies\n^whinh rum were absolutely prohibiting-o to settle in the oolLies wlre^Ann,"??

to be sett-
^^ry and wished

a ffertttln degree of charactor! ^'^tred to be up to

pinoutenrdes3fto'^r^ftoherP "naorlbi^^lnpitL^-aptLeon "Staining the p1u0b,l0i0c0

^^^oVlS

the"\%^uLTpfror?h^A

ffoorit^if y '^hitsfteployslietigonL^antrdiahyi Sf^tht^Srl and Indiands by building forts as possible for the settlers!^

to Spaniards

and Fred^io^'^the

Darien

a town Should be^,^rkerout of t^e ri^h't h""

^avannah river below the falls at tf

the

tion. In honor of a roval nnin/.^^

t>ead of neviga-

ta. This was the wife ^ Fnnf

earned it A^s-

in April 1736,was married to Afustff'^q of Vales whQo,

,

Oglethorpe himself vlsitedA^f\^ Sax-Gotha.

as in September, 1739.

Augusta only once. This

33

Georgia." it reads as follows:
Seven miles above Kew '.Tinsdor on the
Georgia side^ lies the town of Aiagusta. just below the falls. . , There are several warehouses thoroughly well furnished with goods for the Indian trade, and rive large boats, belonging to the different inhabitanoe of the town, which can carry about nine or ten thousand weight of deer sJcins each, making four or five voyages at least in a year to Charles-Town for exporation to England. . . neither all the English traders with their servants resort in the spring, and * tis computed that above two thousand horses come heither at this season. . This is a very advantageous trade to England since the furs are mostly paid for in v/oolen and Iron.

^

(Jones* History.)

Embedded in the sidewalk on the northwest

corner of Broad and Center Streets is a square

stone marker, placed there in 1929 by the Augusta

chapter of the Daughters of the American Revolu-

tion. Carved upon it are the words "01d town of

Augusta,stteled in 1735," and on each side of the

square are the names of the boundaries; N.Savan-

nah river; S. Greene Street; E. Elbert street;

7. '.Tashington street. The town as so indicated

was probably laid out as were all of Oglethorpe's

towns# "like military camps, with streets inter-

secting at right angles, and with open spaces,

into which the settlers could retreat in case

of attack." Broad street v/as, in the beginning

300 feet wide. It has been narrowed on two occa-

sions under special acts of the legislature.

At the northwest corner of the prospective

town and on a bluff overlooking the Savannah river

Oglethorpe erected Port Augusta,, 120 feet sq\iare,i

with quarters for a garrison of 20 men. There

I

were four bastions or towers, one at each corner,

connected by musket proof walls,and, on the

ramparts were mounted eight iron cannon,which

(

Oglethorpe brought with him on his return from

England in 1736. One of these cannon is still in

existance and lies at the base of the Celtec

Cross in St. Paul's church yard, having been pla--l

ced there by the Colonial Dames in 1901

i

Opposite one of the "curtains" of the fort anfl

grot|ote(i by -its guns was built in 1750 the fipsi 5fPaul's ohuroh. The effect of this Port so successfully

little town fj?om the Indians that,

traiding post, it v;as never attaok-

f Ive^ndian^nA??^ '

^ congress of the

Port n

nations were held here at the "Kings

ernorc

vf

0?

Indians oame to meet thegov2outh Carolina, and / oonferenoe they "

^ salute from the ^uns of Fort A^-

m -

hDTyT the late Rev. C.C.Wieildliiaomatsi:on of the Celtic Cross,

revolution the iron guns or the fort had looked out upon a scene of busy in-

dustry and peace. They had never fired to kill.

'*Indeed, after the war began and for several years, its peaceful record was unbroken. The Liberty

Boys took possession of it in 1775, hauled down the

British flag a:id held the fort for four years.

Colonel Campbell took possession <fcf it again in the name of the King in February 1779. After holding

it for two weeks, he evacuated it and the Americans

occupied it once more. After the fall of Charles-

ton in Jlay >780, the fort was abondoned by the Ameri-

cans and the British, under Oolonel Browne, immedi-

ately occupied it.

.7hen, on the 14th of Septem-

ber, 1780, the Americans made their famous attack

upon the "'.Vhite House"(Jolonel Browne took most of ^

his garrison and marched to its relief. In his ab-

sence, Colonel Clark quitely possessed himself of

the fort and the town. But,four days later when

Browne returned, the Americans yielded the post with-j

out offering any resistance.

j

"The Americans had but one piece of artillery, which;

Colonel Lee('.Yhite Horse Harry Lee, the father of

j

General Robert E. Lee.) brought with him. This six- |

pounder was hoisted to the floor of tfte tower, and, f:

from that eminence, it completely commanded the in-

terior of the Fort. The tower was a device of ilajor

l^aham, of South Carolina, and was erected hear

where the Cotton Exchange now stands. Bro'wne tried

to neutralize the effect of this movement by build-

ing a platform at the southwest corner of the fort

and mounting upon it two of his eight pound cannon.

But from the hour that Lee*s six-pounder opened fire

from the top of the Ihham tower, the fort was doomed., The first shot was fired from the tower on the

morning of June End. 1781. Before noon the two piee-

es of British ordiance were dismounted from the platform. The whole of the interior of the fort was ra-

ked except the the segment nearest the tower and a

few spots sheltered by traverses. So deadly was the

fire that the besieged were driven to dig holes in

the ground and literally bury themselves in the

35~
blackened ruin.The fort
powerless ti.o save itprfortoemcteddistirtuowtaison.at last
daer and blood and smoke. paTsshiengfoortutanind theunoharoh which had stood side by side for nearly naif a century went down in common ruin.
was never rebuilt, it vra.s never needed again. But the Church loomed up out
smoke-,' to go upon her way and pluck victory from the Jaws of seeming defeat. Her mission is never ended."
"Three times therefore had the Americans captured the fort and three times had the British ^^aken it, and yet nCt a gun had been fired,
old ^spell of peabceeenwlaos sst.tillItonseetm heedliatstlief fthoert. And now for nearly a year, from September 1780,
to June 6 1781. it was again the Kings Fort,and the gro\ind on which i.t stands was still Colonia'' ground.
"In the .fjnerioan army there v;as one man who would seem to have sworn a vow on the altar of American independence that Augusta should not renain under the flag of the king. That man was Col.Elijah Clark.Cato was not more insistant that Carthage must be destroyed than was Col. Clark that Augusta's fort must be taken. From the day that Browne took possession of it and hoisted the British flag, Clarke v/ent everyvhiere gathering recruits to drive him put. It is said that it was Clarke who planned the attack upon the '.Yhite House which deserved success, but failed at the moment of impending victory. It ,was he who gatherd the forces, vjhich under Pickensknd iilliamson and llcCall, came and set down here before the town for two months, resolved never to go av/ay until that flag cane down. At last Col. Lee was sent with his famous Legion to reinforce and take command of the investing army. He saw at once with the practiced eye of a soldier, that Bro^vne had built a fort which was impregnable to any assault that he could make upon it. He therefore
resorted to the ingenious device of building a tower thirty feet high, out of hewn logs,filling with stones and other material. Hear the top he built a platform,and the logs were sawed to let an embrasure for a cannon. The British had mounted in the fort the eight original cannon. They had a garrison of 400 men besides 200 negroes v/ho did duty in the fort. In addition to these there were a number of prisoners and others who had fled to the fort for protection. .^fter the Revolutionary V/ar, people oajne in large numbers to settle

in Georgia, and to Angusta came many from Virginia ^d middle Korth Carolina, a few from the New England States and some Roman Catholios from Ilaryland#
They were mostly English, Scotch and Irish," though some French came about 1798 at the time of the uprising in San Domingo# There were many jxeraans in Augusta later on and,as far as I can find?:
<yame to Ameruca to escape the compulsory military service in their own country. tI-o 1796. and before ctahpeitatulrnfoorf ththee sctaetneturfryomshe17h8a6d already developed into a very substantial little city. There were warehouses extending along the
as the present Riverside Kill. Boats between Au^justa and Savannah, with their
of freight brought in from the west up-oountry," The greater portion of this
Augusta'3"tobacco age."
Copied from the Augusta Chronical of Friday February 6, 1931.

PAPER ON THE COLONIAL DAYS OF AUOUSTA. BY MRS. JOSEPH R. LAMAR. 19S0.

history op colonial AUGUSTA,OEORGIA.

^ paper read by Mrs.

Lamar^f'th^^nitlfl'^q*

Associate Justice

P United S^tes Supreme Co\irt .formerly

read at the^un-

teria^i^

Placed on the east ex-

nof the Calo^ niaSl tD.Pamaeusl'sofcA humrcerhicabyonthA e pGreilor2g3ia1S93o0c.iety

hboeoeKn. slowsttoaterecsoogcniieztei"esanodf C toolroencioarldDtahmeesdheabvte thnaott
the early settlers owed to the friendly offices'of certain Indians during the Colohial period.
tossaohusetts has placed a tablet to the memory '^annalaneet; Virginia has her memorials to Poehahontas, and the Indiam Chanco.who saved a recant of the colony from extermatlon during the
1622; Lreorgia has a boulder to Tomochiohi.the Mioo of the Yamacraws,and Alabama-one to the Indian oheif.Tuscaloosa; while coming down

society in Minnessota had ^rked the site where a treaty was signed in 1805 between Lieut.Zebulon Pike ,U.S.A-and the Sioux
^-S.A. ao(iuired the etrritory on which Fort Snelling was subseqently built. ^
my pleasure a few years ago to attend a

^

^^3ylvania Society held at "Stenton"

home of James Lo" ganS,twehnotonwaas s thyeoupkrenosw id.w enast othfe thCeolonial

colony,as well as 'Yilliam Penn. He had many dealings with the Indians and it is a worthy remark that Penn in

Pensylvanla and Oglethorpe in Georgia were the mnc*f

successful Of any of the leaders if CoEal Umef

in their dealings with the aborigines^ and th

colonies which they foxmded sufford

f*T.nm 4.

by indiands tlmn did the other Colonies, ofthis^"

"^*J^<^aiament at Stenton we listened to an address by a talented yoxmg Indian who wa h..

*^ P".vlvania University Socle tv

greeted them, and as a memento of the occaqion

M?.?****

' "* `y th.

a?r

3^

The ground on which we ateind today is historic

as well as holy, for here it was that the events

oocured which gave birth to the city of Augusta,

and around this ancient church, and still more

ancient church yard cluster the oldest memories and records of the Knglish occupation and settle-

ment of this part of the state of Georgia.

A little more than 200 years ago this region

was an unbroken wilderness; the banks of the river,

tiien clothed with the original forest, and only

the leaves of the forest and the birch-bark canoes

of the Indians were born on its placid surface.

If we are to believe the tales that were told in

England of this favored cotintry, it was an earthly

paradise. About the time that Oglethorpe was pre-

paring to sail,a pamphlet appeared in London setting

forth the attractions of the proposed colony of

Georgia. It might well have been written as an

advertisementoof a new development in real-estate.

It closed with some verses by the poet 7aller,

describing the favored condition of the inhabitants

of an island off the cost of South Carolina.

It describes the inhabitants as enjoying all the

tropical fruits without the trouble of cultivation,

as drinking the fermented liq,uor which was found

on the tops of the palmettoes; as feattilig on the

"candied pleuitines," by which he probably meant

"candled" plantians, a tropical fruit; and the

"Juicy pine" meaning the pineapple not the pine

tree, and on the oranges which the orange trees

bore at the same time that the blossoms appeared

on the boughs. The author of the pamphlet, in

oroof of the longevity of the inhabitants, cites

the case of one of the Florida kings, mentioned

by Purchas, who, three hundred years old, had a

father living who was fifty older than himself.

I doubt not that even in the Atlanta Chamber of

commerce they could improve on that prospectus.

Even then there was a trading post on the left

bank of the river, not far below the town of

Hamburg, where the South Carolinians made their

way. bu land axuby water to exchnge their goods

with the Indians, who brought the pelts of the

deer which they had hunted and killed to exo^^e

for fire-arms, cloth and agricultural implements.

It was called Savannah Town, and known later as

Moore's Fort, and a regular schedule of prices was

in use for a given number of buckskins, or doeskins

which were valued at one-half the

,

buckskins. A gun, for exfimple, was worth 10 buckskins T^istflVfive. A white balHket brought five

buckskins and a blue one three, while a laced hat ms worth eight buckskins and a calicoe petticoat
twelve

efoSor:^ sMnlLa^o-^^

- t^Tooi'sMi 2^ ChBrleaton, with its firs*

brSt wiL set^nT.fh

Charter which he which was signed by King George 11

1st n-p fha

foundi^ of thfcoLnyf S' home and an opportunity for manv

or wj^t o^L^?r

^ho^Lroush LfforK.

? SJ? F

SS":

is LrsSr'V`

Sf`?S; iiii?,'jrisr LS

-SJ "

wTeScSananroBt ^toiS o ih'n ig^hSlvii;,* SL?g,isf;j

empire-

them. But there^have

that actuated

nen-from ,/arren Ilastinjs^own ?o

English-

were willing to take risks ?nT. ?h2 -^^ Rhodes-who mm

upbuilding of the R-ni

h

glory and the

his counoilores doubtless had^oth^^^

and when George 11.

^lw,

in the charter he wac,

Indians'^

attacks of the'Spaniards

thinking more o]l the

aiplomatic to sS sSn ilack title to the land owned by
oouth Carolina-out of whiuh^the be carved-was disputed by the Rr^anT

PoUtia: aSd For,the
was to

the Spanish governor of St

orown, and

tunity of ha^ssing and and interfering with the

opporCarolinians,

method was to^ntice the Sro

^

from the rice plantations to i?Wo

dom and to arm them, incitetheir free-

former masters. Another was to ?nn to attack the frontiers of tho

Indians

The Spaniards therefore, looked on the proposed new colony and
power to obstruct and

extreme disfavorr everything in their

s-r s2` H- -

ulation to the victoriois^e'nlral.

coilgrat-

^ *.u Twenty-nlna years ago, Aiagusta oommittee ' society of Colonial Dames erected
a Celtic Cross which stands on the river bank to
commemorate the founding of Augusta by order of Oglethorpe and the trustees- the establish -

TInd?i;ands^; tthraedibnugildpionsgt 6fof ra thfoe rdt efaolirngthsewpirthotethcetion of the settlers and the erection of a church, T^der a curtain of the fort, for the religious
newl^bade citizens of Georgia, To^y, on the walls of^the present church- the rourth to occupy this site-the same oommittee has placed, a tablet to commemorate a no less important eventfthe holding of a congress and the signing of a treaty between the representives of five
Nations and the governors of Virginia.and North and South Carolina. I say an event of no ^

I

said hebe.

5^ leading up to one idea-that as of ail E^lish speakinggepneiuosploef, ttohepAremfeerrioaan.

peaceful settlement of international differences,

hy treaty or by arbitration to an appeal to

*

senseless argument of cannon." They believe that

argument has all the force of and a more

f^{ot f^an the largest sannon, and that when she builds them, are intended

*^^ the hBi th

in fae end to pass out of^

^^

Augusta, leaving

Indians. It discharged the hi^chest

^

function of all forts anfl

office and

tary armaments whatsowver. it keut^^the^

"lli-

throj^hout the Whole coloAoa"perLd S tTlL

breaking out of the Revolution;"



*'^

tim': ^rth^hfltorfof Korir^r" "

effort is for the

L

^ onoerted

nations of the earth to ^reaoh^s^ by which treaties and oongrisses

and covenants shall take thi piacf ofhe

in the settlement of international differenfe^ ie were not surprised to learn fhof p renoes.
]Ioover and Kr, Ramsey llacDonald aulok-i i un agreement as to nLal disarmmef
wonder that in the parley th^ hef hi! on in London the American and the 2ngll3h"4leSftes
, have stood shoulder to shoulder in their efforts for disarmament. They have always done so and

they always will, it Is in the blooii; and

hK4is Militiary miEssnigolnishtmo apn roOtgelcetthothrpeecooalmone iewsith from the attacks of the IndLians, he followed
the same method; he built a chain of forts id is

true,from*Fort Frederick to Fort Aikgusta, but first no gun where a well directed argument or

4 well worded treaty woiad do the work. The Indians believed his promises, they trusted him, and they never attacked him or his colonies of their own volition, and when they were incited to do so by the Spanish, they were quickly won back to their

alliance with the English - won back by a treaty which Oglethorpe executed at his own risk and

peril, going pracjioally unarmed,and unattended save by two pack-horse loads of presents for the

Indians -i to a meeting of the Greeks,Cherokees and Chlckasaws at Coweta Town 400 miles from

Frederica. He went through the untrodden wilderness, through pestilential swamps,exposed to dangers seen and unseen,and at the mercy of prowling

Indians who knew only too well what the Spanish would give for his capture or his scalp, he won

their respect and their admiration, and he secured

a treaty which settled all points in dispute and saved the young colony from massacres that were so disastrous to Virginia and New England. I doubt if

any general ever did a braver thing. At this meet^* ing, he not only somked the"pipe of Peace" but u.

drank the "Sofkey" or "Fosky" which was a sacred

drink with the savages which only chiefs and war captains, prists and "beloved men" were allowed
to taste. It was made with great formality from

shoots and berries of the Cassena berry, which is

now so common on the Sand Hills. Oglethorpe bbserved all the ceremonies connected with the observance, and it is interesting to remember the history of the translucent red berry which covers the

limbs of the small llix trees, and which are now the chief diet of our native mooking^i^birds.
It was also after this visit to Coweta Town that Oglethorpe was attacked with fever and stoped at

Axigusta to recuperate. Here he was visited by some

of the Indian Chiefs, and from this place he wrote

a letter by his own hand dated"Augusta in Georgia." The place was a health resort, you see,even at that

distant day. By this treaty the Indians ceded most

of the land fiom the Savannah to the St.John's

river, "as high as the tide flows," and all the

iBldnds save St.Catherlne's Ossabaw and Sapelo

reserving only a small tract for their

*

own hunting grounds. They declaired that they would not suffer either the Spaniards nor any other people excepting the trustees of the colony of (ieorgia^bo settle their lands.
The treaty as I said, was executed in 1739,and used for practically twenty-four years, at least as far)i as Georgia was concerned,in spite of the efforts of the Spanish and the French,and of quarrels among themselves and the Carolinians. But by ' 1763 trouble arose between the Indians and the licensed traders who took adveuitage of their ignorane and defrauded them. To meet this difficulty it was ^ thought best to appoint an agent gor Indian affairs for the Southern as well as the Northern districts of America,and the man selected to fill this office
Capt. John Stewart,was in all respects well fited for the task. He knew the Indian character . He called a meeting of the Southern tribes at Mobile, where he made them a talk in true Indian fashon, but with Anglo-Saxon wisdom.He promised tA deal Justly by them if they,on their part,would observe the terms of the treaties they had signed.
The year 1763 was notable for both England and Georgia. It saw the end of the war between Great Britain and Spain by the treaty signed in Paris in February of that year. A tx-eaty by which valuable and extensive territory in Horth America was added to the British crown. Because of these accessions. His I'Ajesty George llj^, who had accepted the throne, issued a Royal Proclamation, dated from St.Jajnes palace in October 1763, annexing the colony of Geprgia valuable territory,Axtfehding^tC''the ^ Mississippi on the west, and including north and east Florida on the south. At the same time the Bari of Egremont, who was the chief secretary of state for the southern district of America, at the king's suggestion wrote a letter to the governors of Virginia, Georgia and North and South Carolina asking them to convene a congress at Augusta, in Georgia, with Captain Stewart, the agent for Indian | affairs, and the representives of the five Indian Nations-the Creeks, Chiokasawa.Cherokees and the Chocktaws. These were the leading tribes from what is now Alabama, Mississippi. Tennessee,North and South Carolina and G-eorgia. The four governors were Governor '^fright of Georgia, Governor Boone of South Carolina,Governor Dobbs of North Carolina, and Lieutenant Governor Farqhier of Virginia.
The head men of the chirfs, the war captains and Jhe "beloved men" of the five Indian Nations together with their followers, niuaberlng 700. Their names were all given, but were all unpronounceable bv an American tongue, save the great Chief, Red ShoAs, who appears again in American history.
Captain Stewart, the eigent for Indian affairs,

was present and was most useful, saoh tribe V" y

interpreter, sinoe the congress Georgia soil, Gov. Wright presided,and Opened the oongress with great fonnalitv on

all^dian

Toohevetredrmasll otfhethepotirnetas tyinwdeirse-

pute, and it was duly signed at the end by the

representatives of the red men and the white men. it provided for peace between them all. There should be no molestation between the Indians and the English settlers. It ppomised^eoue al justice on both aides. If a white man killed an Indian he should be tried and executed, if
found guilty. The terrltoral limits of the Indian hunting grounds were clearly defined, and

agreed to. The Catawbas, for example, limited

themselves to an area fifteen miles square,and it settled the boundaries of the colony of Georgia, including the territory recently added to the domain. Presents were given to the Indians who declared themselves satisfied with the treaty and promised to keep "the talk in their hearts as long as the sun shines on the waters run in the rivers."
At the conclusion of the oongress, Gov. 'bright had a salute fired in honor of the Indians from guns in the fort. This was a wise and tactful compliment and the Indians must have been impressed with the fact that the white men were able to defend their rights if the treaty was broken.
The signing of the treaty, together with the removal of certain restrictions under which the colonists had chafed, and the additions to their territory, inaugurated a period of great posperitory to the colony which had languished before.
The colony and the town of Augusta grew and flourished; so that when, twelve years later, Georgia was called upon to do her part in the struggle for American Independence she was able to acquit herself with credit and to render assistance to the great cause.
The little fort of A\igusta was captured by the British and converted into a formiable fortress, which iilght Horse Harry lee, when came to attack it declared it to be practically impregnable. It was captured and recaptured, changing its name with each change of masters, until, at the close of the war it remained Fort Augxista until the day it passed out of exlstance, having fulfilled its mission and kept peace, not with shot and shell and the booming of cannon, but with the aid of this

oongress and treaty which we commemorate todav with the unveiling of this gttfne

To Commemorate The Creat Congress
of Five Indian Nations Held here at Fort Augusta in 1763 7hen Seven Hundred Indians Game to
Meet the Governors of Georgia,Virginia and
North and South Carolina.
Erected by the Augusta Committee of the Georgia Society of the Colonial Dames of America. 1930.

VfILLIAtl LONGS

.

following is taken from The National Cyclopaedia of American Biography. Page 4ii4.

-'/illiam Longstreet, Inventor, was born in New Jersey, October 6th,1759. In childhood he removed
where he early disl)laydd a marked aptitude for mechanics. He invented and patented an improvement in the Cotton Gun. called a breast-roller, which was operated by horse power'
4t.hUe Steam eEanrlgyinaegaendhe ondePveobteindiahryis1asttt,en1t7i8o8n, aton act was passed by the General Assembly of Georgia securing to "Isaac Briggs and Jilliam Longstrert
fourteen years, the sole exclusive right of using a newly constructed Staam Engine invented by them. He applied this new power to his Cotton Gin with gratifying results but the appartus was shortly afterwards destroyed by fire.
The Augusta (Georgia) Herald, of December 23rd, 1801, printed an account of the fire, which broke out in the house containing Mr. "^ongstreet's Steam Engine and concludes, "This accident seems to have been particular unfortunate as the ingenious proprietor of the works had, we understand, the day before completed a new boiler which had, on trial, been found to equil his utermbst expectations and enabled him with a single gin and a very trifling expense of fuel to gin from 800 to 1.000 weight clean cotton per day.
He also constructed a portable Staam Saw Mill, which he patented. A number of Saw Mills were erected throught this State and an account Isxxt given the destruction of one of them near St.Mary's, Georgia, by the British in 1812.
Longstreet also directed his attention to the application of staam power to the propulsion of boats; and in the Archives of the State of Georgia is preserved a letter dated September 26th, 1790, addressed by Longstreet to Governor Telfair in which he solicits the Governor's assistance ' and patronage, beginning; "I make no doubt but you have often heard of my Steam Boat and as of-"ten heard it laughed at,"which indiaa^es that at that time he had made considerable pTogropo progress with his experiments.
There is no record preserved, however of his method of propulsion, whether by oars, as oontrijed by Rumsey or by paddle wheel, whiefh was the
distinctive feature of Pitch's invention.

It l3 Stated that he finally obtained suffl-
oient mohey to oonstruot a Steam Boat according to his idea and to Operate it on the Savannah River in 1806 but this cannot be verified.
The Augusta Herald of November 10th, 1808,
however, has an editorial on Longstreet successful attempts "with his new invention the Steam Boat", and refers to "the different essays he has made previously.
His son was Aiagustus B. Longstreet, Author, and President of the University of KAssisaippi and South Carolina College.
.Tilliam Longstreet died in Augusta, Georgia, September 1st ,1814 and was buried in St.Paul's Church Yard there.

The following is taken from an editorial in the Augusta Chronical of February 23 1931*

I

"In an article in the Atlanta Journal by John

I

T. Boifeuillet, we find comment upon the list

of Georgians as compiled by the Carnegie library and in this article is a most interesting letter

written in 1790 from .Yillaim Longstreet to Governor Telfair as follov/s:"

Augusta, Sept* 26 1790. bir- I make no doubtbut you have often heard of my steamboat, and as* of ten laughed at it. But in this I have only shared the fate of all
projectors, for it iias uniformly been the Bustom Of eve^ country to ridicule even the greatest
inventions until use had proved their utility.

scheme to praotice has been a little unfortunate for me, I confess.and

lately I

general; but until very not think that either artists or

material could be had in the place sufficient.

However, necessity, that grand science ihf inven-

tion, has furnished me with an idea of perfectig

my plan almost entirely with wooden materials ^

wortoen as may be got here, and from a thoro^h confidence of its success, I have
pressed to ask your assistance and patronage. Should it succeed agreeable to my expecta-

I sfahvaollrs daislwcoayvsermtehraitt; saonudrceshoouf ld

"For me to mention to you all th^ arisijig from such a machine, would be tediou^ ^ ahd indeed quite unnecessary therftfn-nA taken the liberty to atetf t^rSfL
ble manner my wish and opinion, which J

SSoKoI'

^

'^itho^t

"v^M. LONGSTREHT."

*milarn Longstreet was an inventor other than boats, as the following historical and

encyclopaedic record shows: Cotton had been

^

ously ginned by two rollers, not quite one in<^^^'

o

in iiameteTj whioh oaiight the fibers, pressed
out the seed and deliverd the clean cotton on the other side, where it was taken by the gin-
ners hand, and deposited in a bag attached to
I*ongstreet invehted and patented roller," mived by horse power,whioh entirely superseded the old method.
Longstreet according to history, also set up two gins in Augusta, which were proppelled by steam, worked admirably and promised him a fortune. They were, both destroyed by fire in a week.
He next erected a set of steam mills near
St. tory's Georgia, whioh wete destroyed by the British in the war of 1812. "These disasters exhausted his resources and discouraged his enterprise, though he was confident that steam would soon supersede all other motive powers."
But few people knew of the other inventions of longsti*eet, for Eli '.Thitney has been given

g^

credit for the invention of the cotton

Those that have dared to dream, to pioneer can fully sympathize with Longstreet in that para-

graph of his letter to Governor Telfair in whioh

states that it had been uniformly the custom to ridic^e every invention until it had proven its practicability. There are those who dare to

terms of greater communities, with increas

culture and wealth, and who are ridiculed for a time.

In Historloal Book Ho. 1 page 77 there is a further account of the famons inventor.

LONSS!TRSET.

The first steamboat over built, ran on ttie

SavMnah River^and the first steamship ever built,

left the mouth of the Savann^, and crossed the

Atlantic carrying a cargo.

The legislature of Georgia passed an act, Febrji-

ary 1788, granting a patent for 14 years to Isaac

Briggs and William iJongstreet for the use of a steam engine, which-in a letter to Governor Telfair

from William i^ongstreet explains what was being used

in a steamboat. This letter is still on file in the

Statehouse in Atlanta.

Mention of the fact that

the opperation of Longstreet's steamboat, was made

by the Augusta's Newspapers from 1806 to 1808. and

the additional fact recorded by the Augusta Herald

of those times, that his steam Gin, and ttaohine Shop

caught fire and was burned makes the inference clear

that he used the steamboat in connection with the

sawmill in hauling logs to it. or hauling lumber

fro* it. Fulton's "Clermont" is recorded to have

made her first trip on the Hudson on August 7th,

1807:but even then the account describes the steam-

boat as in the experimental stage. William liong-

street's boat was built and operated in 1806, its

name, tonnage and fate is unknown.

William -^ongstreet is buried in St. Paul's grave-

yawd|the epitath reading,

Sacred to the memory of

William Longstreet,who departed

this life September 1st ,1814

Aged 54 years,10 months,26 days.

All the days of the afflicted

are evil but he that Is of a

mvrry heart hath a continual

feast.

^

Captian John D. Twiggs,in the Augusta Chronical of **uly 13 1933.

PRESIDENT GEORGE iTASHIHGTOK'S 7ISIT TO
AHGUSTA MAY 18-El 1791.

PRESIDCTr GEORGE '-7ASHINGTOH*S VISIT TO AUGUSTA MAY 18-El 1791,

in

A^fatsehr ina^ttteonndimnagdemaortnoiniigr soefrvGiecoersgiian

ItltTt

On Monday the 16th. he stopped at Mulberry

Grove. He spent the night of the 17th. at .Tayns-

borough, and arrived in Augusta about one o*clock

Wednesday May 18th.

Accompanied by a n\imerous retinue, he rode ttoou^ lines of cheering spectators down Broad Street. Captain Howells artillary all the while

firing salutes. Governor Telfair's residence, "The Grove," near Augusta was the scene of a large

brilliant dinner to the President at 4 o'clocl: in the afternoon, at which one of the toasts proposed

by '.Tashington was"to the state of Georgia."

It is said that later the President drank tea with "many well-dressed ladies." That evening Mrs.

Telfair gave a ball "to the ladies," and the Pres-

ident was in attendance for a short while.

Next morning, Thursday, the citizens presented Vashington a formal address of welcome, to which he

replied, "Gentlemen, I receive your congratulations

on my arrival in Augusta with great pleasure.I am

much obliged by your assurance of regard,and thank you with unfeigned sincerity for the favorable sen-

timents you are pleased to express towards me. About 3 o'clock the Augusta Volunteer Light

Horse paraded to receive the illustrious President

of the United States... ;?hen the President passed theVffloors saluted; and as soon as he was seated

and'the firing over, they sat down to an"elegant

dinner". Among the fifteen toasts drunk on this

occasion was one"to the governor of Georgia."and

another"to the fair sex of Georgia." The newspaper

account of this dinner does not explainwhy on this

occasion only fifteen, instead of the ciistomary

sixteen, toasts were drunk.

At half-past four

that same afternoon the President partook of another

"elegant dinner" provided by popular subscription,

which was attended by Governor Telfair and a large

number of citizens. In the evening the President

went to an assembly at the Academy, there being

present "60 and. 70 well-dressed ladies," the"lar-

gest number of ladies," according to the Augusta

Ohroniole, ever assembled at this place.

The next morning according to hid diary,.Yash-

ington "viewed the ruins, or rather the small re-

mains, of the work which had been erected by the

British during the war and taken by the Amer-

icans. (Fort Augusta.) Also the falls, which are

about two miles above the town; and the town itself."

At the state house on ilay 20th. was presented

to the President the address of the executive of

the state of Georgia. He replied in part:"I shall

always retain the most pleasing remembrance of the

polite and hospitable attentions, which I have re-

ceived in my tour through Georgia, and during my

stay at the residence of your government."

On Saturday morning. Hay 21st, about 6 o*clock,

.Tashington made his departure from Augusta, and as

he crossed the Savannah River by the bridge he re-

ceived the fsalute of Hajor Gordan's Horse and Cap-

tain Howell's artillery."

In addition.to his us-

ual retinue he was accompanied by a oommettee of four prominent citizens of Columbia, S.C.(including Gen-

eral V/ade Hampton, to escort him to that city on

his return Journey to Philadelphia, at that time the national capital.

RIGHT REV. LEONIDAS POLKJ

-- i-

OCCASION OF HIS.DEATH .AND ACCOUNT OF HIS FUNERAL SERVICES.



On Tuesday mornibg June 14tb. (1864)

General Johnson, Lieutant-Generals Polk and

Hardee, and Brigadier General .V.H.Jaokson,

aooompanied by members of their respective

staffs, visited Pine mountain, an elevated position laying ijeyond the Confederate lines,

and some six miles fromphe town of Larietta, ^

for the purpose of making a military reoonnoiss-

ance. Leaving their escorts and horses behind

the hill, they proceeded to the top on foot. Their observations having been completed, they were about to return, when a shot from a.Federal

battery, striking the ground a short distance in

front of their position, warned them that their presence had been discoverd by the enemy.
The group at once separated. Generals

Johnson and Polk passing along the brow of the

hill, still farther to the left, while the other officers withdrew toward the right and rear.

After finishing their survey in that direction the two parted- the former moving around the

hill to rejoin his escort, and the latter leisurely retracing his steps across the summit.

Upon reaching a commanding point he paused for

a moment, either to make a final examination of i the scens before him, or, as is more proable,

to spend a short interval in silent communion

,

with his God.

^

^

aS he stood thus occupied, his arms folded

upon his breast, and his face wearing the com-

posed and reverent look of an humble and trust-

ini; worshipper, ^^shot was heard, and the cry

arose that General Polk had fallen. Colonels

Jack and Gale, members of his staff, at once retiirned to the spot, but life was already ex-

tinct. His body, badly torn, was laying on-the

ground at full length, with the face upturned,

and retaining its last expression of prayerful

faith `and the arms, though broken, still cross-

ed upon his breast.

The enemy*s battery w^s

shelling the hill with great rapidity and pre-

cision, eind the remains were borne to a place

of safety in the rear under a heavy fire.

In the left pocket of his coat was found his

Book of Common-Prayer, and in the right four

copies of a little manual entitled "Balm for the

v/eary and 'bounded." Upon tha fly-leaf of three

of these had been written the names respestive-

.

I

"lieutenant-Gen-'

the compliments^of

Hood," "with ,

Polk X* ipfh ^,,^f^tenant-Beneral Leonidas

TOs

the fourth w

with hs,r.r.f^^mu^^r,'*" name. a11 were saturated^

knol

^^ <^e"eral-ln-Chlef at once made

ned -Ph^

sustalmilitary staff not feel

h?f

liberty to determaln upon the place of

ilv

without consultation with his fam-

son' , then teinlegLroanptghoicmedreya, pAatlcah. easnd to Bishop aillott, at Savannah, to meet the'body

w witihthit^rtot^tth^aft ^poT inft. On reacinhtlm engtiA ontlatnotaproseed the body was received by a committee for thdX
p^pose by the Layor of the city,and taken dlrect-
oontinued laying in state for severil hoxirs, and then, after appropriate religious services and an impressive eulogy pronounced by the Rev. Dr. Q,uintard, Rector of the Church and Chaplin attached to the staff of General Polk, was conveyed to the depot under a proper military escort, attended by a large concourse of sympathizing citizens. A car having been provided expressly for their use, the immediate attendamts proceeded with it to Augusta,and upon arrival, early the following morning, were met by the Rectors, hardens, and Vestrymen of St.Paul's Church and the Church of the Attenement, the remains were reverently conveyed to St,Paul's Church, where a guard of honor had been stationed to receive them by the Commandant of the Post.
Upon consultation at Augusta with such members of General Polk's family as could be Gathered at the spot, and with Bishop Elliott, it was decided to be most appropriate to commit his remains to the keeping of the Diocese of Georgia, whose Bishop had now come the Senior Bishop of the Church in the Confederate States , until the Church of Louisiana should claim them as her rightful inheritance. The following invitation was issuei^!
'^The Bishop, Clergy, euid Laity of the Prot- ' estant Episcopal Church in the Confederate States, the officers of the Army and Navy of the Confederate States, and the citizens generally, are invited to attehl-the funeral services of the Rt.Rev. Leonidas Polfc D.D. , from the City Hall of Augusta, Georgia, on .Vednesday, the 29th of June. The procession will move from the City Hall to St. Paul's Church.
His remains will be deposited in the ChurchYard of ^t.Paul's until the war closes. "
"Stephen Elliott,

n Senior Bp, of Prot.Epis. Ch. in C.3.A, ^ ^
the*bDooddyv^T byHtuh"e^ dlreotion of CSotl.,PaGuelo'.s 7C. hR uracihn,s co^nding the Post, was enclosed in a'leaden *
placed in an appartment of the City .rail tenderd for the purpose by the City author-
left under a proper guard until the morning of June E9th (1864)
FUUERAL SOLMITias.
Upon the day appointed the local military force of Augusta, consisting of one full regiment of infantry, a battery of light artillery, and a company of calvary, was drawn up on Telfair Street, in the rear of the City Hall, at halfpast nine o*clock A.M. The case that enclosed the remains was brought and placed within the hearse by soldiers detailed for that purpose. The hearse was draped in the flag of the Confederate States, with its broad folds of white and its starry cross of Trust and Truth upon a field of blood, and sourmounted with wreaths of bay and laurel, and a cross of evergreen and snow-white flowers.
The military escort, under Llajor I.P.Girardey, headed by the Palmetto Band, began its solemn inarch, the Colonel commanding the Post.and His Honor the Maydr of the city on horseback, immediately preceding the hearse, ,/ardens and Vestrymen, representing St.Paul*s Church, Augusta, Ga.St,John's Savannah, and the Church of the At tenement .Augusta/' accompanied the remains on either side as pallbearers. After them, under the direction of Cap. C.A,Platt, the remainder of the funeral cortege was arranged in the following order;
The Military Family of General Polk,with the Clergy and Citizens of Louisiana. The Reverend Clergy. Officers of the Army and Havy. Members of the City Council.
Civil Officers of the Confederate Government. Members of the Medical and Legal Profession.
Other Citizens,
(Thile the procession was passing along the principal streets of the city, houses and balconies and walks were thronged with multitudes who had come to pay the respects of loving homage to the departed Christian soldier. All places of business i were closed. The band played appropriate dirges, and the bell of St.Paul's Church was tolled at intervals. As it came down Reynolds Street,

d' Y
ohuroh, the Bishops of Georsia, LlsslsBlppi, ana Arkansas, in their robes, attendoa Dy a company of aurplioed Priests, moved from
the vestry-room, and took their station in front Of the oh^oh near the entrance-gate, while the
company of Silver Greys was detached from the regiment and drawn up on either side of the aven-
a special guard of honor, The Bishops and oiergy having met the corpse, went before into the oh^oh, the Senior Bishop repeating the wo^s
I am the Resurrection and the Life,saith the
three Bishops, with the Rector or ^t.^auls, enterd the chancel, while the attend ing Prists occupied places assigned them on either side without the rail. The anthem^Lord let me ^ow my end," was chanted by the choir,with a sole^ ^d effective accompaniment upon the organ. The Bishop Of Arkansas read the Lesson;after which the choir euid congregation united in singing the first three stanzas of the familiar hymn
alway." The Senior Bishop ^jiiiiiott) then deliverd, in the presence of a
vast assemblage gatherd within and around the church, the funeral address, closing as follows.
"And now, ye Christians of the North, and especially ye priests and bishops of the Church who have lent your-selves to the fanning of the fury of this \mjust and cruel war, do this day, in the presence of the body of this my murderd brother, summon you to meet us at the judgmentseat of Christ-- that awful bar where your brute force shall avail you nothing; where the multitudes whom you have followed to do evil shall not shield you from an angry God;where the vain excuses whihh,^ou have varnished your sin shall be scatterd before the bright beams of etermal truth and righteousness. I summon you to that bar in the name of sacred liberty which you have trampled under foot; in the name of the glorious constitution which you have destroyed; in the name of our holy religion which you have profaned; in the name of the temples of God which you liave desecrated; in the name of a thousand martyred saints whose blood you have wantonly spilled; in the name of our Christian wQfflen
whom you liave violated; in the name of our slaves whom you have seduced and then cohsigned to misery; and there I leave justice and vengance tq God. The blood of your bretheren crieth unto God from the earth, and it will not cry in vain. It has enterd into the ears of the Lord God of Sabaoth, and will be returned upon you in blood a thousand-fold, llay God have mercy upon you in*^ that day of solemn justice and fearful retribution

At the close ot the address, the ooffin,under the escort of the Silver Greys, preceded by the Bishops and Blergy, was carried to the grave prepared for it in the rear of the church, immediateljr behind the chanoei window,the family and near friends of the departed accompanying it. .Vhile it was made ready to be laid in the grave, the Senior bishop pronounced the sentences "llan that is born of a woman," etc.,and the form of committing the body to the ground, and the sentence, "I heard a voice from heaven." As he utterd the words "Earth to earth, ashes to ashes,^ dust to dust,"earth was fest upon the body by the Bishops of iilisslssippi a:id Arkansas, and Lieut. General Longstreet, of the Army of Vlglnia; and the last military honers were paid by a salvo from the battery of light artillery, stationed for the purpose at the foot of .'/ashington Street.
The Bishop Of i^ississippi concluded the solemn services by offering the "Lord*s Prayer;"the first prayer in the order for the burial of the dead, the prayer,"0 God,whose days are without end;" the prayer for persons in affliction, and the apostolic benediction.
In the rebuilding of St.Paul's Church,after the destruction of the third church by fire in 1916, there was built a crypt under the altar. The remains of Bishop Polk was removed from their burial place out side of the church, to this crypt.

6
DESTRUCTION OP THE THIRD S-t.PAUL'S CHURCH.
APRIL SHnd, 1916

THE BURNIHG of THE HISTORIS St.PAUL'S CHURCH BY an EYE <7ITNESS. IIARCH EE 1916.

Miller.

Senior //adden Mr. iflT.K*

My dear Doctor;

Augusta, Ga. March E.8 1916.

the S^of^the^oW^Jh^h

<=

down for the first tim^?h^^^

^

^at

tioally Since thffi"ri thou^hf"T"'^'^^

you.

ire,x thoiaght I would write

you oi^^oSy'*^as^^T^L"

Of Dore's l^aKwon

^

night of the fire relization

to ofcVSrrLn V.ll,,Ton`, "*';' *"* >'

o" frEC*v- F

towf rf -^o^nooday afternLn! buf tJ stav in in the af^moon^ we'^hear^Le^fire^^l

Chrfni\5lCil^?^:^i,^ S

^3^irthr""

bXf;n'ifSrLifirbSM!i^S/?r'

S borafaotoclhisehist^oaSdo^^sto^obm ut ei^tnfce^^''? ^tdh"ejm S*,-tiw t omay

cajition in taking care of nJL

act of pre-^

I went down an^ver to yhitea^irof^^^ property."

hand satchels and nnm ''nites.got a couple of

there were fully twentv-five'^h

that time

the corner watchi^ Se fire

around

18, .ioh... t,.,,.,,,,

V

%

been taken 4ovm the fip=sape;

v/hen I got baok upstairs I put the contents

of my safe in those two satchells. There were some other papers on my desk that I thought I

might as well take care of. Father's old green

bag, which I'have ali/mys kept in the vault,so

I took it out and filled it with a lot of papers.

About that time Hamilton came up with a friend,

eind he and I closed the door, thinking everything

was perfectly all right, and started down with

the papers. '.Vhen we got to the elevator ,we found

it had stoped running for some reason - I think

to get some hose up the stairs - anyhow we met

some parties with hose, who said they were going

to throw water on the buildings in the rear,

which by that time was on fire.

-7e got down, took these papers home, and I sat

down quietly and had supper, after which I went

around to the church,.and never went back to the

office at all, because I tliought it ^s perfectly

safe.

I staid at the church from abodt seven

to eleven, and only after the church had been

burned down did I know that the Chlronicle Build-

ing had also been burned.

'.Then I arrived at the church there were a num-

ber of people there, and the fire had reached

the comer where Cecil Cochran's officers were,

behind the old Davidson building.

A graat deal of cotton was stored in the

streets and the hose was playing in this.

I said to Hr. '.Thitney that it was a'matter of

precaution to, gather the valuables, plate,church

silver, etc.. This was done, and they were carri-

ed to a place of safety.

The wind all this time was blowing fifty miles

an hour, and a great many sparks began to drop

"in the church yard, so r^suggested -that we be-

gin to move the furniture out. I'started-wi-th

the Bishop's Chair-, many others assisting.

In the course of time everything was taken out

and removed to a place of safety except the

altar, which was left for the last, because

had an idea that the church would be saved.

There was such a high wind as is rarely seen

in Augusta, and it was just one red hot volume.

The Vason warehouse next door caught fire,

and then realized that we were in for a very

serious condition.

In a little while the

steeple caught on fire.

One paltry hose

appeared on the scene, with which nothing could

be done - it was not long eno\igh - There were

men up in the tower, and on the roof, and time

and again they put out the fire.

After awhile one of the compartments in the

Vason warehouse expiboded, and the volume of

flame was sent

in the air. and blowing

directly toward the ohuffch* I was out at, the

time in thepear watching, and ^Hconcluded^'o^

.

building was sure to'go. \/rt.went into the church,

wiiioh was full of smoke, and with the assistance o of two or three^men whom'I .had never seen before,

got out the altar and carried it out to the east

{J side

of the church, 7ith the altar

safely

out,

near

the

back

gate,

and turnedj updide down so as to protect it as far

as posslb^le, we waited for the conclusion-

It,wa^ not.long before the church steeple was one maSs^xf flames. The Beams of the building

seemed to stand very well, but after a while some

sparks ;>odged in an angle of the cornice at the'

back of the chancel on the down town side, and

ther^Ws no way to reach it. It burned very

rapidly, and in a little while the tower fell in.

Jeff, the sexton tolled the bell as long as

the rope held out, and it was with difficulty

that we got out of the building.

I could not get to my house on Telfair St.,

going out Reynolds ot. v/ashington streets, but

had to walk up the levee as far as Campbell (9th,

street) then through to Greene/^to my house. I then took my automobile and went down to see

about Bertha and Tom, for all the buildings onc/_

the other side of Washington street, and-en-dowa

looked as though they were doomed to be burned.

Then I reached the 400 block of greene street,

I found every thing below there on fire.From 6th,

street to Sast boundray, and from ^ast Boundray to

Reynolds Street was one mass of flames. From the point where the fire started at the

north west corner of Broad and 8th, streets to

Sast Boundray was cpmpletely destrojred, except the

Planters Loan and Savings Bankthe Citizens and

Southern Bank, and the - buildings on the north side

olt Broad street, extending from 7th, to 6th,^ streets,were not bui*nedr.

All the warehouses, dwellings and the church,

on both sides of Reynolds from 7tn, street to^East

Boundray went down with nothing left stand^ug but

the chimneys.

Many people took all their be-

loru?ings into the middle of the street where they

were just licked up by the flames. The effort

of people to help others, was very noted. The question now beilore 3t.Paml*s is as to

its future.X x x Under Jhe old acts-creating the parish, the property is vested in the Episcopal Corporation for Church purposes, with reversion

to the state in case the Church Corporation should

fail to keep the old buying ground,and use the place for permeinent worship.

itaelf is directed to m

and tih?ere pCerhpuerotuhabteuiildtsineglf obny ECaostreprorlaiotendealye,c-

tion,

under such circumstances, I advise that

we could not with safety consider removingftne

property, because if we did, we might lose^%^

property. '.yhile,of course the state could take

that position, yet against any action taken by

j

the state,we would have no defence.

^

I believe it would disintegrate St. Paul's ^ parish, to attempt to moveC^^lie original location, t,

xxxxxxxxxxxxxzxxxxxxxxxx It would wring your heart to see the remnantaV
that are left. - the vastness of the ruins. To start with, every tree is killed, ex-
cept the few in the back. The vast majority are gone.

The fact of the matter is, Augusta looks like a town, - particularly in the lower part of the city. - that has been long dead. The vast amount of chimneys Just giire you the idea of a cemetery, particularly at night as it has a weird appearance.

The people as a whole are bearing up as iw

bravely as any community could. I have not heard
anybody complain, they Just accept the situation. I of course lost my law library,--mv lett-

er files, etc*, except the few papers 1 carried

down stairs^ x x x x .

Your telegram ttas duly

received by Mr. V/hitney, and was read to the con-

gregation at the service in the Sunday school

room of the Christian Church last Friday after-

noon, where we gatherd to consider the situation..

,7e had services in the Confederate Memorial

Hall at the court house on Sunday, and will

proaUly be there for some time to come.

1<3 ^ P '

With assurance of continued esteem and vener-

7 ation, I am

VerjF truly your friend,,

W.K.M.

(ol DISTRUCTIOK 0? TH3 THIRD St.PAUL'S
CHURCH.
The followlBg was writen by the Rev. G.S' 7/hitney,Rector of St.Paul's Church 1907-19E4, for publication in the April nnmber of the Church Bells.
At about 6:30 o * clock on the evenin^j of ^Tednesday.llarch aSnd 1916, a fire broke out in the Dyer Building on the corner of 8th and Broad Streets. Under ordinary conditions it would have been readily subdued by the Fire Department; but a strong gale of wind was blowing at the time, and in a very few moments it was seen that a greaf Conflagration was imminent. Leaping across 8th street, it attacked the Union Savings Bank^at the same time to the cotton warehouses on Reynolds street. It is impossible for us to attempt a discription of what was \indoubtedly the greatest calamity in the history of Augusta, but in brief a general conflagration followed wiping out 35 * blocks of the business and residence sections and rendering more than 700 families homeless.
The eeene was beyond discription but those who witnessed it from the stirroxinding hills will never forget it. So rapidly did it spread that the people who were up-town watching the Dyer Build* ing, turned to discover all the lower part of the city in flames and rushing to their own houses, hardly in time to save more than a handful of clothing or valuables.
;/hen it was seen that the fire was coming down Reynolds Street, the Rector gather! a little group of our people in the Church and we all knelt there for a brief service of intercession that our beloved Church might be saned. ;7e are sure our prayers were not unheard, but that Cod iias answered them in a way that will in His own good time bring some great blessing.
V/e then begah to remove all the most valathings which could be moved. The Rector ooened the safe and took out all the silver and record fipt, and took them to the Rectory, and altogether made four trips in his oar carrying brasses memorlkls and other things to the Rectory and to llr. V/*K.Miller's house. There were many willing hands both among our own people and strangers. It would be impossible to name them all, for there several whose names we have never learned Some of the Ladles of the Altar Guild'looked

after the linen and furnlshln^^a of the Altar.

ilr. John Twiggs took a load of things in his

oar to his own home. Kr. Platt worked until his own place across the streetwas in flames and

from which he saved almost nothing except his

records. Dr. Fargo took out the Chancel rail

^d with the help of some unknown yo\mg women

buried it in the yard. Mr, Miller with the

help of severil men got out the Altar and some

of the Chancel;^ furniture and it was found the n

next morning near the Southern Railway bridge.

Of course we might have saved much more,but no one would believe till the last moment that the

Church would really burn. Meanwhile Jeff, the

Sexton, aided by several unknown white men were

carrying water in pails and pane up to the tower

to put out the sparks.

No fireman came near us

tho we are told that the Chief did drive up

and look at the Church an hour before it caught*

The Rector ran to Broad Street and tri^ to divert an engine, but no one would listen.

lo!tuh Street and g^ ot it up ina thloenetow fierermbaunt othnere TOs not enough pressure to carry the water up there. Soon t;he blazing cotton from the adjoining warehouse^egan to stick to the wooden oupalo

in great masses. The aeh in the tower tolled the

^ws to thousands that the old chjirch was burning. Many wept when they heard U, for it rang the knell of a^laoe saoeed and dear to all of Augusta for more than a century.

The story Is told. The tower burst into flames

whioh stood out in the gale like a great flag.

About the same time a oornioe of the Churoh caught

and a few minutes later the wall of the adjoin!^

cotton warehoiisetell or blew up and a mass of flame=

enveloped the Patish House.

riame.

The Rector seeing that nothing more could be done and ttet the exits ffom Reynolds Street were* being rapidly out off left the Church and v/ent to
the Rectory, which now contained most of the

Church's valuables eind which in the event of a

slight change in the wind might have gone also. Mr. MillerDr. ^argo and a few others

remained a while longer and went out by the wav the Lewee to Campbell (9th Street) Street.
The old Churoh was gone and the dawn of another day revealed only the melancholy ruins which brings a ache to many a heart and tears to many eyes t^May our Heavenly Father give us grace to see'^His hahd laid upon us in loving ohastisment.and vouchsafe us a vision of a future full of opport\mities for greater things for His Kilngdom.

(p3

In the midst of our sorrow for the loss of

Parish house we are not unmindful that has come to almost one-third
or the families of our congregation. Fully eighty

families belonging to St.Pail's were victims of the fire fiend. They were families of every degree of wordly wealth from those who can bear the loss and still maintain their usual standard of living to those who are left practically penniless. But even though one may have some means* it is an awful blow to have everything, house, furniture, clothing, silver, books, pictures and keepsakes, the aocumalation of years, swept away in a few hours. Only in a few rare instances was anything considable saved. Itany removed their things to the center of the street only to have them burned up or stolen. Kverybody had things which no amount of money could replace. And also mansrhad no insurance whatever.
But in spite of such stupendous losses, the spirit of the losers has been simply wonderful. Not one word of murmuring or complaint have we heard from anyone, but all have accepted this visitation with cheerful resignation and set about the work of rehabilitation with faith and courage. On the other hand those that did not lose, have displayed the most remarkable generosity and eagerness to be helpful, and in most oases their aift has been accepted in the same spirit as given and with no false pride. It takes more grace to receive than to give and we are very ^roud of the true Christian spirit shown by all our people both fortunate and the unfortunate.
Nothing has more deeply touched us than the prompt and generous sympathy and offers of help which came to us from our brethren of the ot>er churches* Sither by personal visit or by letter, the Pastors cx and Boards of Officers expressed their sympathy and offerd us freely the use of their churches and Sunday School buildings. Such offers came from St.John's Methodist, the First Presbyterian, First Baptist. First Christian. Holy Trinity-Lutheran^ and the Jewish Synagogue. And it goes without saying that the Rectors of the G-ood Shepherd and the Atonement tender! their assistance at once. But to all we extend our sincere thanks for their sympathetic and generous good will. But after careful consideration|i

we felt it was best to accept the offer of the

United Daughters of the Confederacy of their hall

at the Court House and this we used for several

Sundays and week days during Lent, and to them we

extend our many thanks.

also accepted the kind

offer of Dr.Cree of the Sunday School room of the

First Christian Church on the second day after the fire. These are but a few of the expressions of sympathy that has come to us.

The morning after the fire, the Altar and other furniture that load been saved v/as moved to the Rectory (7^3 Greene St,)
The Altar v/as placed in the bay-window in the parlor and properly vested with the han^'ings and brasses. This made a very attractive little ctiapeL, and here \ms held the early celebrations of the Holy Communion on Sundays and the some of the lenton services.
1
I I

SERVICES OF St.PAUL'S AFTER THE BURNING OF THE CHURCH ON UARCH 22 1916.
There is no record of services from the burning of the Church to Llay 7th.
From that date to Eay 21st all services were held in a tent in the Church Yard. After that date the morning services were held in the Richmond County Court House, all other services were held in the tent \intil August 27th when all of the services were held at the Court House.
On April 8th 1917 toaster Sunday) the first service was held in the new Parish House. The i*arish House was used for all services up to September 1918. On that date the first service was held in the new Church.
The Church was Consecrated on ISay 7 1919. Also on that date the opening of tfte Annual Convention of the Bioaese of Georgia was held in the Church*

(li^
CONFimiTION SERVICES HELD IN THE REAR OP THE RUINS OF THE 3rd, St.PAUL'S CHURCH APRIL 3nd, 1916

CONFIRMATIOH SERVICES HELD IN THE REMl OP THE RUINS OP THE 3rcL St.PAUl'S CHURCH APRIL 2nd 1916.
On the 4 th Sxinday In Lent April Z 1916 eleven days after the destruction of the 3rd St.Pauls Church,there was held Confirmation services in the rear of the ruins.
The following account of the services is taken from the Church Bells of April and May 1916.

April End 1916 was the day appointed for the visitstion of the Bishop for Confirmation.

class that had been prepared felt that they wished to be confirmed nowhere but on the

ground sacred to us all from its many dear associations. The Celtic Cross of granite which marks the site of old Augusta was chosen as the most

appropriate spot. Willing hsuids labored to make i it all as beautlftil as possible. The fire fiend

had mercifully spared this section of the Church

yard, and beneath our feet was a carpet of fresh green grass,while above towered a group of grace-

ful elms Just putting forth their tender leaves.

The red clay of the Levee (then being built) was

concealed with the waving plumes of yoxing pines

against which were banked great masses of pure

white dog-wood blossoms.

The stone cross was

the altar,and a spacious chancel was formed by a

wide railing wrapped in White,ih front of which were placed all the benches and seats that could

be found.

At the appointed hour,a great congregation had gatherd,far more than the seats would accom-

odate. Assembling back of the ruined Parish House,the Choir and Clergy proceeded by the Cross

marched through the trees and down the aisle into the Chancel,singing "Onward,Christian Sol-

diers

^hort form of morning prayer was

said, followed by the confirmation services.

A class of twenty-six, about half adults and half children knelt at the rail to receive the Apostolic Laying on of Hands. It was one of the

most impressive sights it has been our privilege

to witness and will never br forgoten by those

present. The Bishop addressed the class with appropriate and earnest words,and later preached

an earnest and helpful sermon full of encourage-

ment and cheer. Urged all to stand bravely togeth-

er and look only toward the future.

ULYina (IF OHS COHinSR STOHE OF THE-FOURTH CHURCH. SEPTEMBER 29 th 1916.

(e^ ACCOUNT OF THE LAYIHG OF THE CORNER STONE
OF THE FOURTH St.PAUL'S CHURCH,TAKEN FROM
THE CHURCH BELLS OF OCTOBER 1916.

On the Festival of St.Michael and All

Angels, September 29th, at 4 p.m.,History re-

peated itself, in the laying of the corner stone

of the fourth St.i^aul's Church upon the samS site.

In the presence of a "notable assembly", the

ceremony was performed which marked the beginning

of a new epoch in the history of our venerable

parish.

(Yhen the corner stone ^f the old Church was

laid in 1819, so far as the records show, there

was no Church ceremony, only that of the ilasonic

fraternity. This we felt should not be the case

and arrangements was made for the Church ahd the

fraternity to have theitT proper share in the

rite.

Shortly after 4-o'clock, om the most

ideal afternoon one could wish for, the choir pro-

ceeds by the Cross,borne by Master J^ohn Kershaw,

enterd the front gate, sixiging "The Church's One

Foundation

Seats were provided for Choir, Clergy and

Grand Lodge on a platform. The ifesons in- full

regalia enterd the East gate and followed the

Choir. The Bishop then used the Service prescribed

service, the Rector reading the Lesson from Ezra

111-10-11.

Following the responsive reading the Bishop

bid the congregation to prayer and laying his hands

upon the stone said:

"0 Lord Jesus Christ, Son of the Livihg God, who art the brightnes of the Father's Glory, and the

express image of His Person, the one Foundation,

and the chief Cornerstone; Bless what we do now in

laying this Stone in Thy name, and be Thou, we

beseech Thee, the biginning, the increase, and the

consummation of this our work, which is undertaken

to the gloru of Thy Name, who with the Father and

the Holy Spirit livest and reigenst, one God, world

without end. Amen."

Then striken the stone three times, the Bishop

said:

"In the faith of Jesus Christ let this

foundation be placed. In the name of God the Fa the]?

and of God the Son, and of God the Holy Ghost. Amen'

Then the Bishop invoked the blessing of God.

After the singixig of the hymn.

The strength by which our toTl is blest.

Upon this consecrated ground

Now bid Thy cloud of ^ory r<

>1

CONSECRATION OF THE FOURTH 8t.PAUL'S. MY 7th, 1919

COHSECRAO?ION OP THE FOURTH St.RAUl'S.
'ra)HESDAY MAY 7 th 1919.

On Wednesday May 7th 1919 the fourth

St.Paul's Chxiroh was consecrated with the solemn and impressive ceremony of the Book of Com-

mon Prayer, thtis setting it apart from all

xinhallowed and wordly uses uid devoted it to the worship of Almighty Cod.

Promptly at 10:30 a.m. the choir led by the cross left the Parish House and marched down the^ walk and circling on the front,approached the main door of the church. The Clergy followed the choir, then tha Bishopf; the Rt Rev.E.G.Weed Bishop of Florida:the Rt.Rev. Arthur S. Lloyd, President of the Board of Missions;the Rt.Rev. Edmard A. Osborne,retired Bishop of Springfield;

then came Rt.Rev. P.P,Reese Bishop of Georgia, preceded by the Rector of the Parish as the Bishop's Chaplain* As the procession reached the front door it opened order and Bishop Reese and p and the Rector passed between the ranks. The

Bishop knocked thrice on the door,the Senior Warden who stood with the Vestry Just within asked, "Who comes hero?" The Bishop replied,

"I, Frederick Focke Reese, Bishop of Georgia, who demands admission that he may consecrate this Church to the worship of Almighty God." The doors were then thrown open and the procession advanced up the aisle, the Vestry follow-

ing the choir. As the procession moved the twenty-fourth Psalm was recited by the Bishop*

and Clergy repeating the alternate verses. The consedration service than proceeded; The Senior and Junior ?/ardens,presented to the Bishop

the "Instrument of Donation," declaring the

church free of debt. At the proper place in the

service the sentence of consecration was road

)y the Rector.

^

.

Morning Prayer was then read,the first

jart by the Rev. D. Watson Winn, the priest ildes* in point offeervlce in the Diocese and

the creed and prayers by the Kev. John Moore falker. The lessons were read by the Rev. S.B. tIoGlohon and the Rev. W.B*3ama. The

Bunlon was celebrated by Bishop Reese;The ^Istle

:>eto read by Bishop Osborne and the Gospel bv iiSoD Seed. Bishop Lloyd preached an inspiring
sermon, from the text Gen.28.EE--" *

a allS"" ''fTM' *" " *; U\f r

" "kloh ^ {.

New York

Polk of

Ss!'polk!^* Saacutary was also a gift of

&

THE CHOIR STALLS are the gift of the oholT* Each member made a personal eontrlbutlon this *

wo^t was added to by a concert given by the

choir, and a number of sales conducted bv the

members. The_oost

the Stalls was about #360.00

Sift

memorials

n-f fha

^^22 at the celebration

mlmStl d

dedloated two n

First the*gommunion Rail, which was given by Miss lad Coodrich in memory of her father

and mother,Mr. A Mrs. William J, ioodrich.

Mr. & Mrs. Goodrich were among the most devoted

Members of St.Pauls of a generation ago,both pass-

ed away within the past few years.

Other memoriUl dedicated was a Credence Shelf,the gift of the Bishop Elliott Society in loving memory of Mrs. Hollingsworth, some fifteen years ^o suggested the organization or rather the revival of a Society bearing the name of the first* Bishop of Georgia (1841).
There had once been a Bishop Elliott Society but had long since been disbanded.

THE SEAT ON THE WEST SIDE OF THE CHANCEL in the Chapel is made from the console of the

7^
second organ in St.Paul's Chuxoh. This organ was built by Geo. JardAn & Sin of New York, and placed in the church In 1861.
The first mention of an organ in the Minutes of the Vestry Ileetings Yra.s,in 1860 when the Vestry voted to p\zrchase an organ.

On the first iiunday in June 1919 the Rector dedicated a new memorial in the shape of ah Alms Box for the offering for the poor.
This was the gift of I'jcs. iistell Turpin in memory of her husband Vllliam S.Turpin who died July 26 1916.
The box is placed just inside the middle door into the church.

On Sunday October 5 1919 immediately after the Processional Hymn, the Rector dedicated a memorial to the memory of Lester Palmer,a member of the boy choir who didd July 21 1918 aged 15 years. The memorial is a standard for holdi^ the Processional Cross, and was presented by his parents.

The following is taken from the Church Bells
of November 1920. _ OLD SILVSH JANTliB).

"St.Paul's possesses three beautiful silver

basons in which the collections are taken each

Sundav. For convenience sake we need four,one

for each aisle. These Alms Basons were given by

?Se congregation

^

ofiglo

Tt is now proposed tnat in this year oi

we give ^otLr! To this end we ask that anyJL having old silver that they have laid away

will mak^a donajtion for a new Alms Bason.

Please look It up and on Sunday

12th it

will be received with our morni^ offering, Sufficient silver was received tp make the

fourth bason.

From the Churoh Bells of ttaroh 1921.
OUR BUHBING debt paid.
"On Palm Sunday morning Just after the Offertory thr Rector had the great Joy of announcing to the congregation that he held in his hand a paper stating that the last cent of debt upon the church's property had been paid and the mortgage upon the Rectory cancelled. The Doxology was sung, the general thanksgiring said by the whole congregation and special prayers and the benediction by the Rector."
"Thus the loyalty and devotion of a united an4 faithful people has met its rewardvand the fifth anniversary of the fire will find vta entirely free of debt. Laus Deo;"

At the service on All Saints Day 1916 the

Rector received and blessed a beautiful memorial

gift to the church. A private Communion Service,

the gift of Llrs.Mary del'fligle of New York.

The set is designed for the use of the Rector

in administering the Holy Communion to the sick.

It consists of the chalice, paten, pyx and a

pair of cruets, and a small spoon for the admonis-

tration to the very ill. All the vesels are soli

silwer, plated with gold.

The set in enclosed

in an oak case of which one side can be let down

to form the top of a small Altar.

This set is kept in the safe in the Secretary's

office. (1930)

A BML HERO.

We were all thrilled to read In the morn-

ing paper of the 29th of the return of one of our

St*Pau^8 hoys as a real hero of the war.

Lyirood Pelot is the hoy and we are more than p

proud at him. The tale of his heroism is told

in detail in the paper.

His ship,"Polar sea",was struoh hy a tor-

pedo in the Bay of Biscay and Lynwood and another

hoy named Cassidy were thrown into the water.

Though his own leg was hrolcen in two places he

saw his companion was in a graver plight.

Taking off his own life perserver he put it on

Cassidy and then managed to make a tourniq,uet to

stop the hlood frpm Cassidy's wounds. He then lapsed into unconsciousness and later both were

picked up and taken to a French Hospital and

both reooverd. Lynwood was decorated with the

Croix de (juerre hy ILFrench Admiral and also re-

ceived the Ceurnegie Hero Medal.

Lynwood Pelot was confirmed in St.Paul's

servll years ago (March 22 1914) and has been a

faithful communicant , and a regular member of

the Sunday School until he enlisted in the

Navy .

We are very proud of him and offer our

heartiest congratulations to his mother, Hrs.Ann

Pelot.

7?
ROBBERY.
On the night of October 13 1920 burglars broice into St.Paul's Church by some means undis-- coverd and suoessfully broke into the concrete fireproof Vault. Both inner and outer doors were made of the best steal by the York Safe and Lock Co., with heavy combination look on the outer door,and a strong ''Yale" look on the inner door. The burgalers used a heavy Steel bar which they left behind, to batter the oombinatiihn knob out of shape - and then apparently sawed of the handels. Once inside they found all the old Communion Set,the Silver Alms Basins,and a quanity of Communion '.Vine. They did not take any of these,but gave their attention to a small trunk containing most of the Rector 's silver, which they did not take,but in this trunk they found a package of papers,and took fhom them three Liberty Bonds belonging to the Rector's wifw, and were valued to $700.00. The parties were never caught,or the bonds recoverd.
From the Church Bells.
The above is the second time that St.Paxil's has been robbed. Several years previous to the burning of the 3rd St.Paul's the Chxirch was broken into . At that time the 1820 Communion Service and the Alms Basins were kept in a closet that was kept looked. This closet was broken ; into and all the silver was carried away. The thiefs were soon apprehended. They proved to be tvfo young men in their teens. They confesed , the robbery,and told where they had buried the silver on the South Carolina side of the Savannah River. The silver was recoverd and is now kept in the safe in the office in the Parish House.
1

CANTENIAIi CONVENTION OF THE DIOCESEOP GEORGIA. 19ZZ

lior?00 nf 1823-1923

&t. Paula ffll|urrlf, Auguata. (georgia RT REV FREDERICK F. REESE. D.D., Bisbop REV. G. SHERWOOD WHITNEY. M.A., KeUor.
SljirJi uniiau aftrr EaHtjr. April tnirntg-Brrnna
(Eijf Sifroirr at rUnm-fiftren n'tlntk

Unrning Pragrr aui i^nlg (Hommunum

Organ Prelude. Finlandia

Sibelius

Processional Hymn 493 q i fewas a ^lQyf*n1

Venite. Exultemus Domino.

Saitoh

Jubilate Deo.

Introit, "God So Loved the World."

Kvrie Eleison.

Gloria Tibi.

Hymn. 4a0

hall the pQwfty nf

Sevin Stainer Barnhy
Tolin Holden 0^.

Sermon. Rt. Rev. F. F. Reese, D.D.,

Bishop of Georgia

Offertory Anthem. Send Out Thy Light. Doxology. Sanctus. Agnus Dei.

Gounod Old Hundred
Garrett Gounod

Gloria in Excelsis.

Old Chant

Sevenfold Amen.

Stainer

Nunc Dimittis.

Harris

Recessional Hvmn 397. glory muat b< Organ Postlude. Great P'uge in G Minor.

J. S. Back

V

7-r

(Flfp Enptting Smiup at rtgljt-ftftMn o*rlxirk

Organ Prelude. Suitef^othique.

Boellman

Processional. Hymn 311.days>

Hymn 253.

bannft-p;Tfit It float

Hymn, 249. Q Slon,haste thy mi.^inn

*0cHovyA^._

Presentation of Alms. Hvmn 478.

Headliaid

Sevenfold Amen.

Stainer

\

Recessional Hvmn 582.

^

^taua up.stand up f<^r`'je3ua

Organ Postlude. Fantr.sie in G Minor.

Fricker ^

The oonjrregation is invited to join In slnjflng the 1st, 3rd and last ^ verses of the Offertory Anthem. The last verse to be sung In unison.

Geo. L. Johnson, Organist.

E. S. Bothwcll, Choir Director.

CSHTENLAl COHVEKTIOH OF THE DIOCESE OP GEORGIA.
April ZZ - 23 - 24th 1923.

S-unday April 22nd. the Holy Communion was celebrated, at 7:30 a.m. with the Rt. Rev. Dr.

I'ikell, Bishop of Atlanta as celebrant.

At 11:15 a.m. came the official opening services. The Church was filled to overflowing

A large delegation of colored filled the galle-

ry.

The procession which enterd the front

door was led by the crucifer and choir,augent-

ed by the choir of the Church of the Atonement

were followed by the Rectors of Christ- Church

of Savvannah, and St. Paul's Church Augusta,

lav members of the standing committee. Then came the clergy of the Diocese ^d the visit-

ing Bishops, Bishop Knight, Bishop tiikell, B^hop Finlay, and lastly Bishop Heeae,pro-

ceeded by the Rector of St.Saul's,acting as

the Bishop's Chaplain. Shortened Morning Prayer was said by Rev.

D.'.Y.-.Tinn, and the lesson read by Archdeacon

Lawrence. Bishop Reese celebrated the Holy

Co^Smunlon assisted by the visiting Bishops.

The historical sermon was dellyerd

Bishop of the Diocese. The music was digini

fied. and beautiful*

At 8:15 p.m. the Church was again filled 4.^ fhP floors. The Bishop of Atlanta made a

stiring address. Dr. Wm. ASturges Eduoaltion-

al s^etary of the Department of Missions

made an address*

c4- dqi-iTiq

Tn addition to the services in St. Paul s

o mppi-iru: was held at the Church of the Good

Shephe^under the auspices of the Discisan

social service Department. The address ms made iy the Rev. George Croft 'Williams of

Auguste,V^d an authority on Social

the day ms occupied from t^ to one ^nd^from three to four in the regular
business of the convention; the
ry, the C.S.S.L. and the Y-P.S.l. aiso heia services*

At 1:20 o'clock there \vas served to the delegates a limchoen in picnic style by the

ladies of St.Paul's,

At 5:00 o'clock the Historical Pa^ant ms

held on the lawn in the rear of the church.

In the evening there was held at the Par-

tridge Inn a dinner at which there were seated

at the tables 248.

The rector of St.Pau's

acted as toastmaster. Talks were made by Bishop

Reese, Bishop llikell and Bishop Guerry.

After the addresses those that had been con-

firmed by Bishop Blliott (1841-1866) were asked

to stand. This req.uest was responded to by

three persons. Then twelve arose that had

been confirmed by Bishop Beckwith (1868-1890),

and some thirty confirmed by Bishop Nelson

(1892-190t)and forty five by Bishop Reese.(1907-)

An orchestra at intervals furnished music.

HISTORIC PAGHANT HBLD IN StPAUl'S CHURCH YARD ON
APRU. 23 1923.

The setting of the Pageant could not have

held in a more appropriate place thaV on the

very spot where some of the epsiodes occured

in 1751.

In 1923 there were gatherd over

one thousand people who watched with interest

the apperance of every character.

The levee with its covering of honeysuckle,

and its shrubbery along the wall made a beauti-

ful background for the stretch of green lawn

vrtiioh marked off the stage.

The program was ambitious in its scope,cover-

ing from the days of the Apostles down to the present time.

The fourth eposode was perhaps the most inter

esting to St.Paul's congregation on account of

its portraying scenes in the history of the par-

ish, which actually occured on the very spot

where it ms now being enacted.

The first scene of this eposode occured when

in 1750 the citizens met and resolved to ask

the Trustees in London to allow them to build a

chiirjoh on the Kings land,^jmder thr protection or rne fort, and to send them a minister of the

gospel.

The group of aotors.were men, women and children

with a number of red-coat British Officers. They were well cd^stumed and the dialogue well given.

The Trustees turned the matter of sending over

a minister to the "Incorporated Society for the propagation of the G-ospel in Foreign Patts."

In responce to this request the Rev.Jonathan

Copp was sent. He was in the pageant coming down

the river bank with his Indian guide, and vras

welcomed by the inhabitants.

^

4.

The sedond scene was the surrender of the lort

by Col.Brown to ''Light Horse" Harr^ Lee. The third scene was the Gonfirmationbf a odass

of fifty by Bishop Dehon in savannah in 18^. The fourth was the Convention of 18<iS.the cen-

tennial of which was being celebrated, gates to the Conventioned signed the Constitution organizing the '^Ddocese of Georgia. , .. . ^ 4

^The last scene showed Bishop Beckwith Joining

the hands of the Soldiers of the North and the

Epsiode was followed by tbe final tableau

in which 111 the

"

"Soiret of the Church and the Splret of the Stat

Then all Joined in singing the Boxology.

Shere iere over 300 persons taking part in the

pageant.

St. PAUL'S GROUP OF THE PAGEANT APRIL 23rd 1923.

EPISODE 1.

Scene 1 - The petition of the Citizens of An^sta. Dramatis Personae:

Capt. CadgOEUi (British)

Mr. S. C. B. Danforth Jr.

Capt. Kent (British) - - - llr. W. P Cordon.

Hr. James Fraser

-- Er. F. B.

.

llr. John Rae

Glover R. Bailie.

Llr. David Diiglass - - - - Hr. Don Gulley.

Citizens of Au^sta.

^

rrs Irvin. Hrs. '.Vheeless, Mrs. V/hite, Hrs.Sheile,

vliss .<hlttend.ale, Miss 3ara.Biggar, Hiss i-ary Green, I'iss Betty Biggar, Hiss ll.Pressly. Kesaers Geo. Schley, Chaa. Cooper, Taylor Hutt, Geo. Balk, Paul Sledge, B. Palmer.

Scene 2.- The Coming of Jonathan Copp the firat Illsslonary

Rev. Jonathan Copp Two Indian guides.

Rev. G.S.vmitney

EPISODE 2. surrender of Port Cornwallis to the Americana,
1781 Place;, The actual apot oAf \Jtihgeu3Ptaa. geant,the aite

Lt Col. Bro'jm, Brltlah Comman^nt.- Ur. E.Probyn, TAree Britlah Soldera.
GGeenUii "Light Horae Hcaorrlyo"niIa*l*So"lder,,a. " *
EPISODE 3
First visit of a Bishop to Georgia. April 15 1815,at Savannah.
Bishop Theodore Dehon - - - " -Bishop Finlay. Bishop's Chaplain ------ -Rev.J.B.Lawrence
C'.ass of fift;

SPISODS 4.
Organization of the Diocese.
Scene 1st -.First Convention Feb. 24, 182S, in St.Paul*3 Church, Angus ta

Rev. Abiel Carter Rector Christ Church Savannah#- Rev. S .B .llcGlohon.

Rev. Sdnrundl Matthews Rector of Christ Church Frederica. Rev. P.'.Y.V/inn.

Rev. Hugh Smith, Rector of St.Paul*s Augusta. - Rev. u.s. Vhitney.

Dr. ;Y.IT.Parker of Christ Church Savannah. - Hr. B.b.Russell Jr.

Hr. J.B.Read of Christ Church, Savannah. - lir. J..i.d. Platt.

i:r. Peter Guirard of Christ Church, Savannah. 2-r. J. H. i?lythe.

Hr. John Course of St. Paul*s

^

.

Angnsta.- Hr. HT. J.To'.vnsend.

Dr. Thomas I. 'Vray, of St.Paul's Augusta, Mr. Chester Clark.

Scene 2. ^ The Rev. Lot Jones Sent to i-acon.

H6v. lot Jones

ReV.R.S.Shannenhouse

KPIS0D2 5.
Georgia's First Bishop; Bishop Stephen Blliott.
Bishop Stephen Blliott - - - -Rev. J.J.Cornish.

SPI30DS 6.

TI^3 Blue and the Gray keunited under Bishop Beckwith.

Bishop Beclr.Tith - - Confederate Officer -

Albert Twi^jtJ

Union Officer

- - -Hr. 0. Schley.

Tablea^t of entire cast.

ST. TTLLSHlSTOHyOf

mi
Growth of Church in Georgia Is Traced by the Rev.

The

the^Jjplsco-

pal church ih Georgia and St. PauU

church in Augusta was

along with the history o th state

yesterday by the Rev.

Wright. St. Paul's rector, at the

morning church services.

His sermon follows:

-On November 17. 1732. the 'Anne, aSrgl.aell.e.nryd owf i2th00 thtoensflrseett esmaillKfrrao^m to the Colony of Georgia. On iry 13, 1733. they first and on the 20th they landed at Beaufort. S. C. Here they were hospitably entertained until when the embarked on a loop of 70 tons and five Place where General James Ogle j thorpe had chosen a site for the ^ colony. Thus, on February 12. 17M. 200 years ago this ,^**57
landed at Yamacraw Bluff Savannah river, and tlheawnSksaevlvolynaggetoanGdosdaffeorartrhiveairl, ptrhoesy

?iset naobwoutonteheswltyorkofofSbavuialndninagh,wahnadt the Colony of Georgia was founded.
Thus would begin the account of almost any hlsto^ of Georgia. Bui it also is the beginning of the Epis copal Church in Georgia. For t^se ort^nal settlers were Englishmen 5^hmTftio&ritv coff \tghelmanwdereamndem^ bers

I they determined, through chantable ' and phllanthropls *no"ves. to estab

llsh a new state, they made sure

that their religion would accompany

them.

,

By the charur of Georgia .t was

that all such persons, except Papists, shall have a free exercise of reu lRioonm.' aTnihsets,dishcorwimeivneart,ionwaasganinostt tthhe

omnalyttegrosvoefrnrmeleignitoaln IinnteGrfeeorregnicaes ea^ ly days. For while the charter ashed religious liberty for all others, yemetmbeonthts tlheentCthoeloinrial and

ocfestshaetioCnhuorfchthoef England. Upon the

ment and the erection of prov

See into a King's government, one

of the first ats of the Colonial As

J'aeTMmbjlTv owvai"s

to divide it into parishes for th, upp'

copal worship therein. In 17M e orovlnce was laid off fishes What had been the district of Augusta, foPraiunls.taFnocre,thbeecmamaneagthee-

1 ment of the parish many regulations Se?e maJe it being the avowed pur-

SurcS^rEngUnd as"the govern-

instituting and dividing the several

districts and divisions > Ince into parishes, and f< lishing religious worship

cording to the rites am. of the Church of Englan for empowering the Chu and vestrymen of the re ishes to assess rates fo of churches, the relief and other parochial sc trymen and wardens w lected and sworn to the fcrmance of their dut purpose of keeping th>

fice In repair, for the cemetery, sacred utens ments, to provide bread

the Holy Eucharist, to arles of minister am to assist the poor an< the parish, the rector, en and vestrymen we

to levy a lax on the e personal of all the inh in the parish sufficien nuaily the sum of 30

rector was to be one

and the churchward' structed to procure

paper or parchment

the vestry clerk was i ister of the births, marriages and burials

within the parish, un> of five pounds sterl thereof.' Such recor< accepted in all court

the province as furni. proof of the Informal' any party was convl< to be made wilfully

therein, he was to be

ty of a felony and

with death without b

W"hBiluet,

to the

quote Colo patronag*

and the favor of tl

sembly were extende< manner in aid of chu the Episcopal faith, purpose of this act

by exclusive recognlt

have involved a viola cipie orginally pron charter. The idea

to accord to that Ch limits of Georgia, a

to that which the Ck enjoys within the F certain offices for th

of that religious pei extension of the gos' with Us form of w> of government anc method by which t

of births, marriages and deaths might b petuated. Numeroi senters then in the

were reprasented Lutherans, Congreg

odists. Anabaptists brews. To ail sed

wwhasereferveeer atoldeirsastelon orgamized and appli

land whereon to bi petition did not pas

can be no doubt, 1

it was the lntentl< ment, both Royal engraft the ChurcF

the Province and ^ Its. to advance its

sure Us permanen

`On the good shi

the Rev. Henry H with the single pu the spiritual need aanccdomwpitahnoieudt fteheent

He remained but t colony, when, on

he set sail for En the return voyage in Its watery gra

le pro le esta rein, a remonl and ai warde live pt le rep> he poi ;a.' V. to be ^ hful pi For t arch e e of t nd on wine 1
the B xton a potent irchwa. npowei real a .nts wi yield ( inds. 1 le vest were ell bot ; wher ep a `r rlstenin 11 perai le pens m fail' ere to record csourfdfeicdi, af caua alse en dgpeudnigsl'
of cler . C. Jon tlhoeniaClre his spe profesf is not ^tain tl This w< )f the p ed in ircd to within Tence i of Eng mtroagcerr on and accord
and r descrlt j1 regi 'hrlstet le and re the ince. 'rsbytei ilists, I a few ve Bap corded. 2ongreg r a gra churcl eeded. ' er. but the gt Colonl Ingland ' certal' lerlty a

ne, thei

. D. D.

of carl the col



of r

their vo. t

months in

mt of lllr

. He died

nla body res

1 that great

day when the earth and the aea eball give up their dead.
"In Savannah a site was appoint* ed for a church and sufficient glebe for the minister. Of the many mis* slonaries who gave their services, only one remained any considerable length of time. Of the others, two did work -vhosa influence lasts to this day-
"John Wesley becsune rector of Christ Church Savannah in fsbra*

** `After the war between the states this church was given the services of the Rev. Anson G. P. Dodge, Jr. This devoted priest and fervent missionary gave his services for the upbuilding of the work until 1898, when he closed his earthly career. He generously left an endowment for the continuation of the parish and also a fund, the Income of which has been largely Instrumental in founding and maintaining fully two-thirds of the missions In the diocese of Georgia.

ary. 1756 and remained until Decern- j ber, 1737. It was during this time that a Sunday School was organized under the superintendence of Mr. Delemotte. which -- still in opera-

" `While Augusta laid out in 1735. it was not until 1750 that the church was organized. About that time a number of the principal inhabitants forwarded a memorial to the Society

tion -- is the oldest Sunday school In the world.
"In December. 1728, the Rev. George Whitefleld came to Georgia, the church in Savannah being the only

for the Propagation of the Gospel in Foreign Parts, setting forth their spiritual needs and asking assistance. I* appears that as an earnest of their disposition they built a

parish he ever had. He devoted most crf'iils time and eloquence to build-

church near the fort on the Savannah river, and agreed to build a rec-

ing a home for orphans, which he tory, set apart a glebe, and raise tbe

named 'Bethesda' and placed in salary of 20 pounds per annum if a

charge of James Habersham. This clergyman was sent there. The glebe

orphanage, too. Is still in operation land was the territory which now

and Is the oldest in America. On lies between Centre and Jackson

March 25, 1740, Whltefield laid the streets., the river and Gwinnett

first brick o' the main building. This streets.

work absorbed him. He made 13

" `The Rev. Jonathan Copp, a na-

voyages across the Atlantic when tive of Connecticut and graduate of

voyages were dangerous, and 10 dis- Tale, who bad been ordained by the

tinct visits to Georgia, chiefly In the interest of Bethesda. Of a sermon preached in behalf of the home Benjamin Franklin says:
" `1 happened soon after to attend one of his sermons, in the course of which I perceived he intended to finish with a collection, and I silently resolved he should get nothing

Bishop of London, was selected to KO as missionary to Augusta, then the furthest point in Georgia to which thw Church of nenetrated. He arrived in 1751. bilnging. with him the window glass church furniture, ind a deed to the glebe land of acres.

from me. I had In my pocket a hand-

"He found the church almost com-

ful of copper money, three or four pleted. The rectory measured M by

sliver dollars, and five pistoles of 18 feet, two stories high with a

gold. As he proceeded I began to kitchen in the rear 18 by 16 feet

soften, and concluded to give the containing three fire places and an

copper. Another stroke of oratory oven. He states that his congrega-

made me ashamed of that, and de- tion was about 80 or 100 persons,,

termined me to give the stiver; and but the regular communicants were

be finished so admirably that I emp- only 12. The rectory was a pretty

tied my pocket wholly into the col- go(^ one were there any glass

lector's dish, gold and all."

windows in it; but for want of them

" `But the man who In those day* it is uncomfortaWe in the winter

devoted the influence of his life to season. He continued to la^r in

the Church In Savannah, was the this isolated field with indifferent

Rev. Bartholomew Zouberbuhler. success and in extreme poverty for

Born In St. Gall, Switzerland, edu- some five years; when, utterly dis-

cated In Qiarleston, ordained deacon appointed and disheartened. h ac-

and priest by the Bishop of Liondon, cepted the rectorship of &t. Johns

he arrived in Savannah in Jan, 1746, Parish in South Carolina where he

and remained In charge of the died in 1762.

church until bis death In Dec., 1766. It was during thl* time that the first Christ Church was built. In 1746 President Stevens wrote:--`The roof of It Is covered with shingles, but as to the sides and ends of it, it remains a skeleton.' Finally, on July 7. 1760. the building - `large beautiful and commodious' was dedicated to the worship of Almighty God. This building was enlarged In 1766, burned in 1796, rebuilt in th* years 1801-06, and replaced In 1838 by the one which now stands, a memorial to the sacred history of the state.
" `When In 1738, George Oglethorpe began to build the town and fort of Frederica, on St. Simon's Island, as a protection against Spanish Aggression. he was accompanied by his secretary and chaplain, the Rev. Charles Wesley, who until hts departure the next year supplied the regiment and inhabitants with the services of the Church. A tabby building with basement, lower and upper stories was built, and in the upper story the services were held. Thus was the second church In the 'Colony founded, and it has eonas a parish and mission throughout the history of the state.

"Some eight years after Mr. Copp's removal, the Rev. Samuel Prink was sent out by the Society. He reported the population of Augusta at that i time as 540 whites, 501 slaves and [ 90 Chickasaw Indians. He labored. until 1787 when he was succeeded) by the Rev. Edward Ellington. .
"In 1768 this zealous and faithful | rector reported that St. Paul's | church was the only place of wor- ; ship within 100 miles of Augusta. He , generally left home on Monday. ^ traveled 30 or 40 miles and preached at three different places about 10 miles apart during the week and returned on Friday for the next Sunday's services. During his three years' service he traveled over 3,000 miles to minister to his scattered flock, baptised 428 persons, married 62 couples and raised the number of communicants to 40.
"The laat Colonial rector was the' Rev. Mr. Seymour, who left an Interesting account of hts sufferings during the Revolutionary War, when he was outlawed as a Tory. The building was destroyed during the war with the battery located where i the Cotton Exchange now stands.

church remained in the ha`nhidss soefcothned t secular authorities and was used by all denominations. The PresbyterU

for five year`sh.e building from 1804 '^'as built in

destroyed 1? " "

""

"From 1832 until Mr. Schaad'*

resignation in 1931, a period of 100 years, there were five different rec-

endTehdutsheinirCroeplcaotrnoiisrahslh, dipmayobssytthdeoesfaethwthhroeme

cChhurricsht esc--huCrchhri,st Fcrheudrecrhic.a,Saavnadnna&ht-!

Paul's Augusta--were founded. But It was not until February, 1823. that

the Primary Convention of the ^ergy and laity of Georgia met in

' St. Paul's, Augusta, for orgamzation. Three clergymen were present and five lay delegates. Rules of order and a constitution and canons adopted, and the convention acceded to the constitution and canons of the church in the United States. The Rev. Hugh Smith, of Augusta, was sent as delegate to the General Convention, at which the church In Georgia was received into union with the General Church.

"Although the diocese was now organized, there were to be many years before It was to have its own bishop. From 1798 until 1838 the bishops of South Carolina made episcopal visitation -- confirming many classes.

"At last, the convention which met < at Grace church. Clarksville, in
1840, elected the Rev. Stephen Elliott and he was consecrated the first Bishop of Georgia. He was not quite 36 years old at the time. With the enthusiasm of youth, with splendid poise of mind and body, full of God's grace, and with a heart of oak, he began at once to devote himself to the difficult task before him. With a list of eight clergy, five churches and two missions, and 323 communicants, he undertook to build up the church in the state largest in area east of the Misclsslppi. Bishop Elliott, with Bishop Otey and . Bishop Polk, formed that great triumvirate which founded the University of the South at Sewannee. He was careful for the instruction of slaves, and St. Stephen's church. Savannah, was one of the first parishes for colored people In the country.
"At the time of his death In 1866. ' the clergy list showed 26 clergy resl` dent in the diocese ministering to
228 parishes and missions, whose communicants numbered more than

2,000.

,, ^

"When the War between the States

came to an end. there came to an

end with it the old ideas, institutions

and civilization.

"There now dawned upon the

South new things, new Ideas, a

changed conditions of things. It has

been seen with what courage Bishop

Elliott began his episcopate. It re-

quired no less courage for Bishop

Beckwith, coiwecrattd second B^lshop

in 1868, to face the new conditions

which confronted him. His task was

to put new faith and courage Into

men and women who were undergo-

ing hard times and being traliwd m

the school of adversity. He cominu-

ed the work of pushing the church

into the smaller towns and villages.

I parishes grew and new ones were formed, so that when he died In 1890 the number of communicants in the diocese had more than doubled.
"The third Bishop, the Rt. Rev. C. K. Nelson, was consecrated in 1892. He developed an eplsocate whose chief characteristic was in its missionary activity. The work in a few years grew to such an extent that it was too much for one bishop. Accordingly, in 1907 Georgia was divided. Bishop Nelso elected to-administer the new diocese, the northern part of the state, and became the flrah Bishop of Atlanta.
"In May, 1908, the Rt. Rev. F. F. ijReese, D. D.. was consecrated fourth 1 bishop of Georgia. Under his wise * administration the great work goes i on. In the diocese of Georgia 31
clergymen administer to 73 parishes and missions; in the diocese of Atlanta, 32 clergymen minister to 60 parishes and missions. Thus, from unstable and slow beginnings, has our Church in Georgia advanced with the State, until It is now a strong and flourishing branch of the One Holy Catholic and Apostolic Church.
"The Anglican Communion has always prided itself upon Its past. Central in Its thoughts has been the realization of its continuity with the ancient Church, its participation in apostolic succession. At the time of the reformation we avoided the mistakes some of the Protestant bodies made in rejecting much that was not only good but vital in its institutions.
"So also the Episcopal Church in the state of Georgia is proud of its history. It was the first church In the state and for many years its missionary labored valiantly in this rather rough field. For over fifty years St. Paul's was tne only Xn church in the city of Augusta.
"Such pride is good. A continuity vwainthtagtehe--pwaset inisheraint gilmormioeunssetraaddi-tions from our forefathers.
"But vainglory is a different matter. No use to glory In the past unless we are willing and eager to carry on In the same way In our generation. At the present moment K per cent of the white people of this city belong to no body. Augusta is fifth, I believe among the cities of the country In the number of murders per capita committed each year. We do right to be proud of our history. We must be thankful for all those saints who from their labors rest. But I call upon you to
Rise up, O men of God; Have done with lesser things. Give heart and soul and mind and
strength To serve the King of Kings.
Rise up, O men of God. His kingdom tarries long. Bring In the day of brotherhood And end the night of wrong.
Lift high the cross of Christ. Tread where His feet have trod. As brothers of the Son of Man, Rise up, O men of God."
i^rraisfArtswsT-'6K

9s* V

AVSRAGE ATTENDANCE AT THE 11:15 a.m. SERVICES.

1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930

254 206 193 173 166 150 167 179 180 157 179
169 166 178 172 162 178 199 184 183 151 134 142

In 19|8 many of the services have no record of the number in attendance.

>>j ^

1?^-

STATE CAPITOL

DEPARTMENT OF STATE
BEN W. FDRTSDN, JR. aCCRCTARY or aTATC
ATLANTA 3* OEDRaiA

DCPARTHENT OF ARCHIVES AND HISTORY 1ia rCACHTREE STREETt N.W.
ATLANTA 9 OEOROIA

CERTIFICATE OF AUTHENTICITY

This is to certify that the microphotographs appearing on this reel are the accurate, complete and official reproductions of:

Churches, Episcopal

Reel No, 327

St, Paul's Episcopal Church (of Augusta) Positive

Richmond County

filed in

Church History (two voliines) 1750-1933

In possession of: St. Paul's ^^iscopal Chi rch Augusta, Ga.

Date microxilmed: Feb. 9, I960

As reproduced by the Microfilm Division of the Georgia Department of Archives and History, under the jurisdiction of the Georgia Department of State, Ben V, Fortson, Jr., Secretary of State,
It is further certified tlat the microphotographic processes were accomplished in a manner and on a film which meets with the requirements of the National Bureau of Standards for permanent microphotographic copy.
'/X/tA tJL. era operator