~1 ~ ' GEORGIA ROOM BALDWIN'S ; ' -' ' ' ~ <-,:. T? Marietta GEORGIA City Directory MASTER EDITION VOLUME 3 ABCD No. 122 CONTAINING AN ALPHABETICAL DIRECTORY OF ALL RESIDENTS 16 YEARS OF AGE AND OVER, WITH DETAILED INFORMATION CONCERNING EACH; A NUMERICAL HOUSEHOLDERS' DIRECTORY AND STREET GUIDE; A CLASSIFIED BUSINESS DIRECTORY WITH SPECIAL. LISTINGS FOR NATIONALLY ADVERTISED BRANDS; A MISCELLANEOUS DIRECTORY, CONTAINING INTERESTING INFORMATION ABOUT LOCAL, STATE AND NATIONAL GOVERNMENTS AND A COMPLETE BUYERS' GUIDE, CIVIC SECTION A Numerical Telephone and Rural Route Directory Issued with a special supplement edition for presentation to a selected group of private homes, Chambers of Commerce, Boards of Trade, Merchants' Associations, Selling Agents, Buyers, Government Offi- cials and Newspapers throughout the United States. This directory remains the property of the Baldwin Directory Company, Inc., and is leased to subscriber for a period of two years or until the next edition of the directory is published. This directory is leased for use of only one subscriber unless different arrangements are made with publisher. Directory must be returned to publisher at the expiration of the lease. Compiled and Published By Baldwin Directory Company, Inc. Home Office 125 MEETING STREET, CHARLESTON, SOUTH CAROLINA Independent and Progressive Baldwin Directory Company, Inc., publishers of this city directory and the world's largest independent publishers of city directories, is in no way connected with any national association or directory "trust." Its policies are laid down with a view to serving the individual directory subscriber and the general public. It is a progressive company, constantly on the alert to improve its service. The ABCD type of city directory was originated by the Baldwin Directory Company, Inc. While many publishers have been content to rest on their laurels, issuing the same type of directory used 30 years ago the Baldwin organization has led the way to the production of a modern city directory to meet modern selling and credit conditions. Newspapers, chambers of commerce, merchants' associations and individual business concerns are invited to write for particulars concerning this type of directory service. In the future, as in the past, Baldwin directories will stand for the highest ideals in public service. BALDWIN DIRECTORY COMPANY, INC. 1943 POPULATION OF Marietta, a. 17,721 This population secured by an actual count of persons residing in the territory covered by a House-to-House Canvass under Baldwin's Modern ABCD plan GENERAL INDEX Abbreviations Advertiser's Index Advertising Section Alphabetical Section Business Directory Buyers Guide Civic Section * Classified Business Directory Criss-Cross Telephone Directory Explanation , , Federal Government Federal Judges Georgia Government History of Marietta Honor Roll : Householders' Directory Index to Display Advertisements Introduction , Miscellaneous Directory Nationally Advertised Brands Numerical Telephone Directory Officials United States Population of Marietta Resident Directory Resident Telephone Directory Rural Route Street Guide Street Telephone Guide Telephone Directory Numerical Title Page Trade Marked Merchandise Brands U. S. House of Representatives United States Cabinet United States Senate United States Supreme Court 102 4 41 101 445 41 41 445 333 ; 7 13 14 , 21 9 4 4 333 4 .. 5 and 6 13 445 479 14 2 and 8 101 333 495 333 333 479 1 445 15 14 14 14 HONOR ROLL Cobb County Chamber of Commerce Peerless Furniture Co. Victory Homes of Marietta, Inc. Carter Candy Co. John T. Dorsey Johnson's Pontiac Service Station Florence's, Inc. H. N. DuPre Marietta Credit Service Purity Dairy Russell S. Grove 5 .1 Office Sales & Service Barron Electric Co. Cobb County Fed. Savings & Loan Ass'n. Nu-Way Cleaners & Laundry Earl G. Medford Forest C|. Brooks M'einert Florist Colonial Cottage Gardens Model Dry Cleaners Marietta Federal Savings & Loan Ass'n. The McNeel Marble Co. Blair & Carmichael Cowan Auto Supply Strand Theatre, Inc. First Methodist Church Western Auto Associate Store Brumby Furniture Co. McPherson Tire Shop S. A. White Jones Pharmacy Marietta Lumber Co. Brumby Chair Co. Williams Drug Co. Hanley Co. J. Guy Roberts Cobb County Coal Co. McKinney Tire & Battery Service Mayes Ward & Co. American Laundry & Dry Cleaners City of Marietta The First National Bank Max C. Pittard J. W. Franklin & Sons Southland Ice Co. Cobb Exchange Bank Rice Furniture Co. Walter W. Hazel Hubert E. Kerley--O. Dr. Fred V. Legg--Gulf Oil Corp. Channell Furniture Co. Roy McCleskey Georgia Coal Co. Clackum's Transfer Field Hotel Field Furniture Co. F. P. & "Bob" Lindley Marietta Coca-Cola Bottling Co., Inc. U. S. Post Office F. E. A. Schilling, Inc. Albert M. Dobbins Funeral Service Home W. P. Stephens Lumber Co. SJoahuln'nsyDWepaalkrtemr,enInt cS. tore Sears, Roebuck & Co. Carl Smith Tire Co. MJamareiesttAa.RRaedeioceCEo.lectrical Appliance Co. First Baptist Church Style Shop (Garrison-Latimer) Marietta Transfer & Salvage Co. W. H. Beshers CArtehsecretonnt FDurrungitCuore. Co. Jas. J. Daniell Sheriff -- Cobb County John T. LcCroy Helen C. Griffin Department of Public Welfare DDrr.s.GFeoo.wFle.r H&agFooowdler MDra. rRieottbaerHt oLs.pLitaelster Monto Shaw & Son GWreesytheornunUdnBiouns TSetla.tiCoon. The Mercantile Agency--Dun & Bradstreet Inc. The Gas Co. Holeproof Hosiery Co. Rich's, Inc. Sterchi Bros. Stores, Inc. Southern Bell Tel. & Tel. Co. Five Point Service STew Marietta Hotel Fred Myers Gordon M. Combs Anderson Motor Co. J. M. Fowler Co. z Albert H. Bishop Kaplan's Department Store Marietta Hosiery Co. Dempsey B. Medford Harrison Beauty Parlor W. M. 'McCurdy Gogglns Shoe Store Refrigeration Exchange INTRODUCTION Baldwin Directory Company, Inc., publishers of your city directory, takes pleasure in presenting the 1948 edition to the general public. A large force of trained enumerators and solicitors worked diligently in the preparation of this volume and we are confident that the result is an authenic and useful city directory. We have faith in the continued growth of your city and we believe that our directory will take its place as one of the vital instruments for the advancement of your community. Subsequent editions will be issued promptly and regularly. This volume is an example of the ABCD type of city directory as originated and developed by the Baldwin Directory Company, Inc. In the modern business world with its greatly changed sales and credit systems, the old type of directory has become completely obsolete. In adapting the directory to modern conditions the Baldwin organization is the pioneer. The excellent city directory which your city now has is the result of the progressive spirit of this company and its accurate interpretation of modern business requirements. SEVEN DIVISIONS OF THE BOOK The pi incipal parts of the Baldwin Directory are as follows i 1. The Miscellaneous Directory, contains a great deal of useful information concerning the national, state and local governments. In it are listed the names of members of congress and the state legislature, city and county officials. 2. The Buyers' Guide and Civic Section is made up of the advertisements of the leading business firms of the city, announcements of churches, clubs, lodges, associations and schools, and professional cards of Pubhc-spirited lawyers, physicians and dentists. The display spaces have oeen carefully grouped and indexed under headings which are descriptive of the business engaged in by each firm. Th Buyers' Guide, when properly arranged and distributed, is of tremendous value in the building of business in the community. 3. The Resident Directory contains most of the data concerning the individual. The wife's name is given in parenthesis, and the number of dependents under 16 is shown as well as the ownership of homes. This is followed by position, place of employment and home address. 4. The Householders' Directory contains a complete directory of streets and avenues, properly located, gives the names of all householders arranged as they come upon the streets and avenues, indicates ownership of property. 5. The Business Directory and List of Nationally Advertised Brands contains the names of all business firms, professional people and nonprofit organizations, properly classified. In this division are also listed &ne names of nationally advertised brands of merchandise, with the name of the local agents or distributors. 6. The Numerical Telephone Directory contains telephone numbers arranged in numerical sequence. SPECIAL ABCD FEATURES The following valuable information which appears in the ABCD type of directory is not to be found in the old-style city directory: Number of dependents under sixteen; Designation of home ownership; Nationally Advertised Brands; Numerical Telephone Directory; Telephone Numbers on Street Guide. In addition to these valuable features, the ABCD type of directory is more conservatively styled, printed on better paper and more beautifully bound, arranged for more convenient use and contains a much more complete civic section. Directory stands are maintained in th> business district for the use of the general public. THE HOUSEHOLDERS' SUPPLEMENT After including every conceivable feature which would tend to make the directory as useful and attractive as possible, the originators of the ABCD type of directory made one more bold stroke--they established a guaranteed home circulation for advertising matter by issuing the Householders' Supplement and delivering it to the homes of the community. Every advertisement which appears in a Baldwin Directory also appears in the Householders' Supplement, making the Baldwin Directory "America's greatest dollar-for-dollar advertising medium" today. BALDWIN DIRECTORY CO., INC. EXPLANATION All people sixteen years or over are listed. Wives are listed with husbands, the wife being shown in parenthesis as follows: Smith Robt R (Mary L). The number of children under sixteen years is shown after the wife's name as follows: Smith Robt R (Mary L) 3. The both in the resident directory and the householders' directory designates ownership of the home. In case of a natural widow this fact is shown with the name of the deceased husband in parenthesis, whenever possible, as follows: Smith Mary L (wid Robt K). The occupation and place of employment are shown as follows: Smith Robert R (Mary L) elk Hub Clothing Co. The residence of each person is shown, "h" denoting a householder or head of the family, "r" denoting people in the home. Married women, engaged in some other occupation than housekeeping, are individually in addition to their regular listing with their husbands, as follows: Smith Mary (Mrs Robt R) bkpr Henry Jones & Co r 210 Main. Names in heavy type denote patrons of the directory and are usually the leading firms in each line of business. Persons living outside the city limits and receiving mail in the country are marked RD. The letters BD shown on some entries indicate Buyers' Directory. Colored is shown by a . The publishers are very careful in using this, but do not assume any responsibility in case of error. This directory contains all the regular departments of the modern city directory and many features used by no other publisher in the United States: A numerical telephone directory will be found in the back of the directory list*1 ing each telephone according to number. The Rural Route Directory will be found in back of this volume. The classified business directory lists each firm according to line of business. The numerical street directory lists each street alphabetically and each house according to number, with the street intersections as they appear. After each householder's name will be found his telephone number. In case he has no telephone the nearest telephone may be found. The (h) denotes householders who own the house in which they live. By using the street guide as a mailing list a thorough coverage of the city will be obtained without any duplication of names. The buyers' guide carries the printed messages of the city s leading business and professional firms arranged alphabetically according to classifications. This directory shows the exact population of the city and environs at the present time. BALDWIN DIRECTORY COMPANY, Inc, POPULATION OF MARIETTA, fiEOIfilA A _ B _ C _ D _ E _ F _ G _ H _ I J K L M N 0 __ P Q R __ S __ T __ U __ V __ w _ X __ Y z 622 1,960 1,575 933 321 559 1,027 1,667 48 495 369 638 1,795 315 141 887 18 815 1,487 533 38 94 1,258 78 28 TOTAL 17,721 Marietta GEORGIA Marietta, grown from a village founded in 1833 by a group of pioneers while the Cherokee Indians still inhabited this section, has increased in population to approximately 15,000. Situated in Cobb County at the foot of the famous Kennesaw Mountain, the city is named for Marietta Cobb, daughter of Thos. W. Cobb, famous Georgia statesman from whom the County gets its name. Marietta's early attractions were its pleasant climate, its charm as a residential center, its easy access to Atlanta, the prosperous business GLOVER PARK, IN CENTER OF PARK SQUARE 10 MARIETTA CLARKE LIBRARY ON CHURCH STREET establishments within its own bounds, and the hospitality of its own people. By the same hand of fate that, through the War Between the States caused many of the city's fine old landmarks to be destroyed, the present war has caused the city to grow from a population of 8,643 in 1940 to a present 17.721. The Bell Aircraft Corporation, located southeast of town, and begun in 1942, has attracted thousands to this community and is constantly increasing its number. Various real estate firms and builders have made remarkable strides, as shown by the attractive new subdivisions housing these defense workers and their families who have come here( for residence. Marietta has responded capably and willingly to the new responsibilities resulting from the sudden rise in population. Marietta's contribution to famous names includes the late Alexander Stephens Clay, United States Senator, and Joseph M. Brown, former governor of Georgia. GEORGIA 11 The industries include Brumby Chair Company, Holeproof Hosiery Company, McNeel Marble Company, Glover Machine Works, Stephens Lumber Company, ice manufacturing- plants and numerous smaller establishments. The schools and hospitals are modern and well equipped with new buildings planned and under construction, including a Health Center, and additional parks. There are numbers of churches of different denominations in and around the city as well as a splendid city library. Located on State Highway No. 41, with other thoroughfares being rapidly built, places the city in a most convenient center for commuters. Also accessible are the bus and trolley service. Among the places of a recreational nature offered to the residents are: Brumby Recreation Center, three moving picture theatres and a Country Club with swimming pool, tennis courts and golf course. Active civic organizations include Cobb County Chamber of Commerce, Rotary Club, Kiwanis Club, Woman's Club with clubhouse, Junior Welfare League, Lions Club, Elks Club, American Legion and American Legion Auxiliary. Also an American Red Cross branch with headquarters on Winters Street. Marietta extends a welcome hand to its new neighbors. WHITLOCK AVENUE, LOOKING WEST FROM PARK SQUARE 12 MARIETTA BRUMBY RECREATION CENTER THE STRAND THEATRE, Marietta, Georgia, considered the most modern and beautiful theatre in a town of this size in the entire South. Completely euipqped in every respect, it offers to the people of Marietta and environs the latest and best motion pictures obtainable. BALDWIN'S Marietta GEORGIA MISCELLANEOUS DIRECTORY 1943 Cgseoonvnteatratniivnmeinesgn;tscvoawuluniattyhblestehaientsfonraamnmdaetsiopnoopfucloUantnicoietnersndianngSdtaltooetcshael,rsesuntsaaettofeurslainnadfnodrnmartaeitopionrena-l. UNITED STATES GOVERNMENT FRANKLIN D. ROOSEVELT President HENRY A. WALLACE Vice-President 14 BALDWIN'S The Cabinet) mSn^nM FT TOHTMULlELN, THAU;Tr:-:::::: SecretarySeocfrettharey Tof State SSrwoA nx^1ETM R ;::::;i^v:::::::::::_postoasteyr General V Secretary of the Navy SDJO -CK: -=Z: ScerejaryofCommerce FRANCES PERKINS secretary The Supreme Court CHIEF JUSTICE HARI^^c^teHs.TMJaHcukgsoonL,. Black, Frank William Murphy, Orville Douglas, Felix Frankfurter, Stanley F. Reed, Owen J. Roberts Robert Government Officials WILIAM AuLrEvXiiAmNDmE?R JtUttLltIAan - PRESTON DELAJNU NELLIE TAYLOE ROSS TrCeoasmuprterrololefr thoef UthneiteCdurSrteantceys 'Dirpptor of the Mint B^iSer of the TreasuTv fEmsLW HALl"AN - - "-"---I--" Director of the Bureau of Engraving " ff & TM FtoRhfNhCbASSTM ^RR?F1irak^,l^RFERN QE mr :::: Chief of the Bureau of Animal Industry chief of the Bureau of Dairy Industry UNITED STATES SENATE (D)--Democrats, 57; (R)-Republicans, 38; (P)--Progressive, 1. Total 96 NAME Aiken, George D. (R) Andrew Charles O. (D) Austin, Warren R. (R) Bailey, Josiah W. (D) BBBaaalnrlb,kohJueoras,deW,phJ.oWHhn.ar(HrRe.)n(--D(R) ) Barkley, Alben W. (D) Bilbo, Theodore G. (D) BBorenwe,stHero,mRear lpTh. (OD.) (--R) Bridges, Styles (R) Brooks, C. Wayland (R) Buck, C. Douglass (R) Burton, Harold H. (R) Butler, Hugh A. (R) BCyaprdp,er,HAarrrtyhuFr . (R(D) ). Caraway, Hattie W. Mrs. (D) Chandler, Albert B. (D) Chavez, Dennis (D) Clark, Bennett C. (D) Clark, D. Worth (D) Connally, Tom (D) _ Dahaher, John A (R) DDaovwins,eyJ,amSheesriJd.an(R)(D) Eastland, James O. (D) Ellender, Allen J. (D) . Ferguson, Homer (R) -- George, Walter F. (D) Gerry, Peter G. (D) -- Gilette, Guy M. (D) Glass, Carter (D) Green, Theodore F. (D) Guffey, Joseph F. (D) . Gurney, Chandler (R) Hatch, Carl A. -- MMMaaadagsdn.eunsM,oneRl,vaWiyn aJJr.r.en((DR))G. (D) Mahon, George H. (D) Maloney, Paul H. (D) Manasco, Carter (D) Mansfield, Joseph J. (D) Mansfield. Mike (D) Marcantonlo, Vito (AL) Martin, Joseph W., Jr. (R) Martin. Thomas E. (R) -- Mason, Noah M. (R) May, Andrew J. (D) --r--Merritt, Matthew J. (D) -- MMeicrhroewne,r,CEheasrtlerC.E.tR()R) -- Miller, A. L. (R) Miller, Louis E. (R) Miller. Thomas Byron (R) . MMiillllesr.'WWiliblluiarmD.J.(D(R) ) Monkiewicz, B. J. (R) Monroney, A. S. Mike (D) . Morrison, Cameron (D) Morrison. James H. (D) -- Mott, James W. (R) Mruk, Joseph (R) MMuurnddot,ckK. aJrolhEn. R(.R)(D) Murphy, John W. (D) Murray, Reid F. (R) Murray, Tom (D) Myers, Francis J. (D) NNeicwhsoolsm, eJ, aJcokhn(DP), (D) Norman, Fred (R) NNoorrrtoelnl,. MWa. ryF.T(.D()D) O'Brien, George D. (D) O'Brien, Joseph J. (R) O'Brien. Thomas J. oxuurttnenvnnnneseswadrrddEidrengnosbfrltmswnmttratcgprprgtnrcsotcvrrspspcttsbyansntpemawsddbmndrywmghnnsh_lr.ovytptrsprcltrrr_r--n_mrr._-rrtk__-r_dnnhysr_n___r--.._n._-_-___-_._er_e___m__nr_--_________-c-__v-__m_____---._--_i___--_._a._-n_______i-_-__..._sc__-__f___-A_n__.t-_-_._-___-____-ueg_e_he____t__-____d__-__ln_-__rrri-e__-______e__-Rn___-_neoi-___-d_g-_r____-_oc_____-_mi____ci-nr-i_i__-_s_dst_r____-_innheB-_._-___adfr--t-ded_vho_r-____ro,i_eco_l.f_el.reic.ne,eeie___-edhieof__r..eusRedsnails,n,fddxl_fsm-eue_,hntroancfaprfsxd._egselfoehmstrfglisw,rcglopl_ireaufitehmrgstrmahdjtcd-ivcpiaietEjlaxearlnougrhnrsreedeanuhkhrobpgsarnanuaetjtreooeiavlcrgivrfuopheomsirhenwafuctrunatisoowaohnbeceruecnmgiiddmaemisnmtrVoiaaeplircrnotifsonvighawdktecyenviolotlhcdaoaochtliugaeirienootonantgeatapiuyddmteongeeahebeptrctaeeotanitnaieirrrstoseleaerhdnnroecunoroeosacepeoniorrdarrynreeeeyrenstetenslrtr,eydryrerdsseyrettsrerlArrrreelrsrrrrrmmmmmmMmmmmmmmmmmMmnNonon(oopPpppp.ppppppppppppppppppprgrRrTrRrrRrfreeo-fespdhedlhhiflkgkrlerelmknkrdluflnsejaerurreu)sttuureNcumtcdmcdgsporssnereirrrosaylsoptOnenstrrstptrb_sbttbrrithenherhnt_rvDRsrmldfrrosfrt_ct_gbtlb_rOrl_lodmr-r_m_g._rh___-_-rr__-_g__._-n__g_-__r_________m_______-_k-i_-__-__--______-___._-_____s_-r__--e.-._____-____-_-__.___-d_S_-__--_____-._._____._-___i_m-._p_._--_c__-__RH__-______m____-_---__h_._a---___arM-p__p._-m_uP__a-l._e-__--_n-_a_._,___h.a_-,,,_o._m_r_-r_p-__-eem_-nu_appmto-mm--_p_-_.r__ortt_-mper_ful_-.r-hmtom__re-epcup_e_mpseaapNecepoe_M puppooRirams_srpohrehltrRprhccsn_Dass-reeprg-mrbpruplneuctp-pramc-aceplapeyeOsostyamiteceradsuoipomaurrrlnombaOmnmmeehheatnusnvofpelisnasiiaupfsnoeatop,iumiaiallmnwlenldltsdsrpauaaicaunmrecidnerofoliitprasfroiupiiioipadtublacdsaacmherrestnefdieongtilvntcsksfsirkugdirirsebcnnabbtirthtonasuoknaaiiiithkipeidadesitsirnhaleaotiieeiloeeeeecanertnaaoiciereanaaintecnecaeteceeeagevennoneaeeehlsccerrmenrlrrhrrkrreertnelgrrlrngerrigdergdrrreyrstltdrerrerrltrsRsssssssRssssssssssssssssstttttttltttttteactU-heloliUUuuploqUvwwttvwwwwemcvwwyyteutmueuuoreyeytwrnrrrsssSsaecvhdrmcipnrlac-leuxhealkldkerbmppRpmrwh-dvpkihnnrktpestkhhdtnadlgvWSscrmStov_cr_MssrSSfctdg_ar_rn-_n_oit_sgp___tUwsh__rSelhUtert__d_i_e_slAs__rkr_rS_m_-l__s-__tm____cnr-tk_____w_M_Nn_ar_-_._____-_r_____hi_n_-_rt_i_n____--___at__-e_-_tn__._-__.e___.___ey_-_____-s_-__i_Ct_d___d__i-.-c._-___-r_--_.___..__s_______.__a_a_____t__t___-_u-_M_MsUe_--r_l-nv_.s__--_S__a_,_p_a.S__x_____t.ts___._____is_a__nla__rt-en-_e___csart.tefUasiuu_striayinue_srte-_tl_slesiet_vit_ww_l_.v-__s.we_eepcistu_.amatt-eop_nnneemss.rtwatRneeeeea_sua-scpkhlrprdh,sraitgeisodasmSscwtlo.lltedhtemtsatlratshaastsoatreeiuew-eesterscerseecowreeewkerle-tpteaoinpmncnotssvarsoqwlptuedSnsgrerihruadelaaAwbsrrsfseeCrshoavoschepectdilgawopNimhitmohuvptvrdiirnntcatmtreraaectiennluaiwtcoruiaiydtmtgiriioaaeomaoahdeeaiorapieliheicitdssksikaanttpvomaigkaacrructeatteokneoporzorararsoteecereaanoltcneyvheyeeeeeageneanneprsykdeesernyseeresnlnenrhsngrllwreroyerrtyrysrrrnrdnreesrrsrrttr PROPER NAMES Abr _ _ . _ _ Abraham Chas _____ Charles Kath Katherine Sami Samuel Alex _ _ _ Alexander Danl _____ Daniel Job - . - - _ Joseph Sol - _ - . - Solomon Alf ______ Alfred Edw . _ _ _ Edward Margt - - - Margaret Steph - - - - Stephen AArrcthh Aug Benj Oath ____ __ _. _ArcAhritbhauldr _____ August _ . _ - Benjamin _ _ _ Catherine Eliz _____ Elizabeth Eug _ _ _ - - Eugene FGreeodk. ___ _- _- F_reGdeeorircgke Jas _____ James Miehl .... Michael Nathl Nathaniel Patk ----- Patrick Riehd . . . - Riohwrd Theo Theodore ; _* J J William TO FIND A NAME YOB MUSI KNOW HOW TO SPEEL IT & P Food Store Jos F Wyatt br mgr gro 101-03 Church 'Abbott Carl W (Reta R) emp US PO h 204 Roswell Abbott Jas L (Bertie C) 3 baker Sunlite Bakery h Pearl RD 5 Abbott Julia M (wid Jos) 1 (Marietta Hotel Coffee Shop) h 504 Church Apt 4 'Abbott Katie C (wid W L) r 504 Church Apt 1 bbott Ulysess B (Sarah T) 2 electn Bell Aircraft Corp h 427 Brook cir Apt 1 bbott Wm J (Dixie N) 1 emp Bell Aircraft Corp h 504 Church Apt 3 bercrombie Barbara H bkpr Cobb Exchange Bk r 310 Washington av bercrombie Delia B (Mrs J Y) emp Bell Aircraft Corp r 205 Geo Hamil- ton ct Apt 7 bercrombie Floyd D (Elsie J) emp Bell Aircraft Corp h Atlanta rd bercrombie Jack B (Lora M) USN r 401 Lawrence bercrombie Joe Y (Pearl) (Marietta Glass & Cabinet Shop) h 501 Lawrence bercrombie Jos R (Beatrice W) constn wkr r 205 Geo Hamilton ct Apt 7 bercrombie Jos Y (Delia B) 2 emp W P Stephens Lbr Co h 205 George Hamilton ct Apt 7 ' bercrombie Mary E (wid YB) h Atlanta rd bercrombie Nellie opr S B T & T Co r 131 Fair Oaks av (FO) bercrombie Nolan (Ollie T) h Fair Oak av (FO) bercrombie P Eug USN r Fair Oaks av (FO) bercrombie T Everett (Alice J) 1 emp Bell Aircrft Corp h Oak av (FO) bercrombie Talmadge (Cecile) aud r 310 Washington av bercrombie Wm B (Flossie K) formn Bell Aircraft Corp h 311 Wa- terman bernathy Carl (Myrtle B) supt Glover Mach Wks h 1525 Roswell Abernathy Harvey E USN r 1525 Roswell 1 bernathy Jack W USN r 1525 Roswell bernathy Marie R (Mrs Willard) cash H N DuPre r 600 Cherokee bernathy Willard (Marie R) 1 USA r 600 Cherokee burn Josie Mrs r Cogburn Park (Eliz) dair Bartow C (Eunice W) 1 emp Holeproof Hosiery Co h 300 Lemon dair Eunice W (Mrs B C) inspr Holeproof Hosiery Co r 300 Lemon dair Geo B (Virginia G) USA r 622 Atlanta rd dair Geo E (Carrie B) 1 carp Bell Aircraft Corp h 622 Atlanta dair Howard J ptr r 308 Maple av dair Malcolm H USN r 622 Atlanta dair Talmadge USA r 622 Atlanta ARIETTA CITY DIRECTORY 103 Adair Virginia G (Mrs Geo B) ofc wkr r 622 Atlanta Adair Walter J (Zula R) carp Bell Aircraft Corp h 308 Maple av Adams Aaron USA h 809 Lawrence Adams Callie r 512 W Hansell Adams Clara cook 710 Church r 809 Lawrence Adams E Grace (Mrs Wm) ofc wkr Bell Aircraft Corp r 207 Holland Adams Earl C elk McLellan Stores Co r 315 Washington av Adams Elgin C (Helen) 2 emp Bell Aircraft Corp h 605 2d Apt 2 Adams Eliz maid 315 Park View av r 706 Fort Adams Frances ofc wkr r 204 Geo Hamilton ct Apt 8 Adams Fred (Alice W) 3 lab h 125 Franklin Adams Henry (Mary L) 6 elk A&P Food Stores h 204 George Hamilton ct Apt 7 Adams Henry (Mary B) 8 produce mgr A&P Food Stores 204 George Hamilton ct Apt 8 Adams Henry Jr USMC r 204 George Hamilton ct Apt 8 Adams Henry E (Ercelene T) 2 sander Brumby Chair Co h 608 Fort Adams Horace B (Mary L) (Dixie Cafe) h 114 W Dixie av Adams John (Jean B) USA r 207 Wayland Apt 5 Adams Lillie M (wid A F) h 207 Holland Adams Louise r 512 W Hansell Adams Louise E (Mrs R A) inspr Bell Aircraft Corp r 605 3d Apt 3 Adams Mary B (Mrs Henry) elk A&P Food Stores r 204 George Hamil- ton ct Apt 8 Adams Mary (wid J A) r 200 Stewart av Adams Mary r 605 3d Apt 3 Adams Mary L (Mrs Henry) elk A&P Food Stores r 204 George Hamil- ton ct Apt 7 Adams Mary S (Mrs Horace) cash Dixie Cafe r 114 W Dixie av Adams Mary S (Mrs W H) emp Brumby Chair Co r 618 Cherokee Adams Molly C r 605 3d Apt 3 Adams Morton porter h 706 Fort Adams Pauline (Mrs W T) inspr Bell Aircraft Corp r 606 2d Apt 2 Adams Roy A (Louise E) tool wkr Bell Aircraft Corp h 605 3d Apt 3 Adams S M Jr (Claudine) 1 formn Bell Aircraft Corp h 602 Morningside dr Apt 2 Adams Tibbie (wid T E) r 307 S' Waddell Apt 4 Adams Wm (E Grace) 1 carp Bell Aircraft Corp r 207 Holland Adams Wm H (Mary S ) 1 fnshr Brumby Chair Co h 618 Cherokee Adams Wm T (Pauline) 2 guard Bell Aircraft Corp h 606 2d Apt 2 Addison Fred J (Lemma P) 1 firemn City Fire Dept h 227 Winters Addison Frank W (Lulu C) jan Bell Aircraft Corp h 113 Holiday Addison Jewel emp Holeproof Hosiery Co r 500 Haynes Adkin Ludie h 408 Robeson ct Apt 6 Adkins Cleveland (Gladys P) USA r 113 Radium ioi BALDWIN'S 181 Adkins Ernest C USN r 210 Campbell Hill Atkins Geo E (Christine H) mgr City Curb Mkt r Tower rd (Eliz) Adkins Gladys P (Mrs Cleveland) emp Holeproof Hosiery Co r 113 Radium Adkins Minnie (wid Howard) r Tower rd (Eliz) Agan Chas A (Madeline PI) 1 emp Bell Aircraft Corp h 613 2d Apt 4 Aircraft Apartments Jos J Black mgr ofc Atlanta rd (FO) Apt 210 Akin Wm C (Dorothy P) 1 USN h 201 Waddell pi Apt 5 Akins J D (Imogene F) USA r Canton rd (Eliz) Akins Jackson S (Ennon) guard Bell Aircraft Corp h Marble Mill (Eliz) Akins Kenneth P (Ruth D) USA r 315 Waterman Akins Louise sten Bell Aircraft Corp r 307 Maple av Akins T R carp Bell Aircraft Corp h 307 Maple av Albee Richd L (Muriel) emp Bell Aircraft Corp h 309 Aviation dr Albers Harriett (Marietta Beauty Shop) r Atlanta Ga Alderson Harold C (Margt W) USA r 309 Kennesaw av [Alderson Margt W (Mrs H C) sten Bell Aircraft Corp r 309 Kennesaw av Alexander Evelyn R smstrs Walter W Hazel h 511 Lemon Apt 7 Alexander G M (Mary H) h Atlanta rd Alexander Hazel opr Louise Beauty Shoppe r RD 4 Alexander Ida M slswn Saul's Dept Store r 220 E Dixie av Alexander Idell H (Mrs Wm C) emp Bell Aircraft Corp r 208 Geo Hamil- ton ct Apt 7 Alexander Ivey B maid Field Hotel r 513 Fort ALEXANDER J MALVIN (N Beulah) (Purity Dairy) r RD 4 Tel Coun- ty 2004 Alexander Kella B elk L & N RR and N C & St L RR r Atlanta Ga Alexander Laura J r 208 Geo Hamilton ct Apt 7 Alexander Lewis emp Brumby Chair Co r 102 Elk Alexander Muriel (Mrs Frank) slswn Florence's Inc r RD 1 Alexander Nemon (Ivey B) 1 trk dr Field Furn Co h 513 Fort Alexander Ola M maid r 511 Lemon Apt 7 Alexander Tiny 2 maid 161 W Dixie av r 316 W Goss Alexander Wm C (Idell H) 2 meat ctr h 209 Geo Hamilton ct Apt 7 Aldridge Mary Mrs 1 sten Bell Aircraft Corp r 104 S Waddell ALDRIDGE WM L (Nettie P) (Model Dry Cleaners) r Atlanta Ga Alford Louise C (Mrs Neal) elk Hodges Drug Co r 405 Lawrence Alford Neal (Louise C) USA r 405 Lawrence Alford Thos inspr Brumby Chair Co r 615 Whitlock av AH Henrietta U (Mrs J H) ofc wkr Bell Aircraft Corp r 108 Colonial cir Apt 3 All John H (Henrietta U) 2 electn Bell Aircraft Corp h 108 Colonial cir Apt 3 XETTA CITY DIRECTORY 105 Allen Alice Indrs h 604 Fort Allen Alphonso (Inez M) sprayer Brumby Chair Co h 318 W Goss Allen Carl trk dr Southland Ice Co r 200 Montgomery Allen Claiborne (Geneva) 1 emp Sou B T & T Co h 411 Cherokee Allen Delos USA r 312 W Goss Allen Dock (Lena) hlpr Brumby Chair Co h 200 Montgomery Allen Drug Co Mrs Lucile Allen Dean mgr 65 S Park Square Allen Edna cook r 310 Reynolds Allen Effie emp Bell Aircraft Corp r 506 Church Allen Emanuel ydmn r 107 Mulberry Allen Geneva (Mrs Claborne) emp Bell Aircraft Corp r 411 Cherokee Allen Geo (Ora) USA h 206 Harold Allen Geo O (Loraine G) phys 64 S Park Square h 1005 Cherokee Allen H Eug (Harriett M) USA r Fair Oak av (FO) Allen Harriett M (Mrs HE) ofc wkr r Fair Oak av (FO) Allen Hubert B (Eloise C) mgr Greyhound Bus Sta h 804 Church Allen Inez maid 301 Gramling r 318 W Goss Allen J Eug (Arzebie C) mech Holeproof Hosiery Co h 108 Moon Allen Jack (Ada P) 1 lab h 507 Lemon Apt 6 Allen Jas USA r 312 W Goss Allen Julia 4 Indrs h 507 Wright Allen Lee F (Flarranelle P) 3 guard Bell Aircraft Corp h 209 Allgood rd Apt 1 Allen Lottie cook r 504 Lemon Apt 4 Allen Lyle O (Harriett G) 1 emp Bell Aircraft Corp h 117 Kings ct Apt B Allen Mabel S maid r 507 Wright Allen Martha J (wid J T) r 108 Moon Allen Melvin H (Virginia J) 1 mech Marietta Army Airport h Fair Oak av (FO) Allen Ora cook r 206 Harold Allen Orval tool mkr Bell Aircraft Corp r 513 Frasier Apt 1 Allen Ralph L (Vera H) 5 h 614 2d Apt 2 Allen Ruth (Mrs Addison) waitress r 304 Polk Allen Roy J (Maggie W) 2 carp h 507 Whitlock av Apt 13 Allen Thos (Lottie) 2 lab W P Stephens Lbr Co h 504 Lemon Apt 4 Allen Vera slswn Nu-Way Clnrs & Lndry r RD 2 Allen Vera H (Mrs R L) elk Bell Aircraft Corp r 614 2d Apt 2 Allen Wiley W (Carrie C) 1 (Delk's Garage) h Joyner av (FO) Allen Cafe (Dock Allen) 202 Montgomery Alley Irvin E (Maude W) 4 elk Bell Aircraft Corp h 124 Butler Apt A Allgood Addie W (wid A C) h 716 Roswell AUgood Cynthia I drsmkr 300 Roswell r same Allgood Edw J (Beulah O) County Tax Assessor h Atlanta rd RD 5 Allgood Jas L (Edith) inspr Bell Aircraft Corp h 615 Polk Allgood Mary E ofc wkr Bell Aircraft Corp r Atlanta rd (FO) lOti BALDWIN'S 1941 Allgood Ruby ofc wkr Bell Aircraft Corp r 228 E Dixie av Allgood Sarah L ofc wkr Bell Aircraft Corp r Atlanta rd (FO) Allison Clifton (Margt) 2 bkpr Earl G Medford h 105 Lemon Allison John M pharm Williams Drug Co r Atlanta Ga Allison Josephine r Atlanta rd (FO) Ambros Carrie maid 712 Church r 210 Montgomery AMERICAN LAUNDRY & DRY CLEANERS, Herman P Wilson Mgr, Alterations, Dyers, Fur Cleaning, Glazing and Storage, Hats Cleaned and Blocked, 229 Winters--Tel 159 (See Supplement Cover and Buyers' Guide) American Red Cross, Cobb County Chapter Mrs Mark Temple executive dir 220 Powder Springs Amorous Martin F (Leila Y) h 823 Whitlock av Anderson Antique Reproduction Cabinet Shop (Truman W Anderson) Atlanta rd nr Hill Anderson Buford H (Thelma C) 2 emp Brumby Chair Co h Garrison rd RD 5 Anderson Building 100*4 Whitlock av Anderson Chas (Georgia) lab h 107 Page Anderson Coatus E (Vernon C) 1 emp Brumby Chair Co h Garrison rd RD 5 Anderson Carrie cook r 311 Cole Anderson David gdnr 1031 Cherokee r 210 Montgomery Anderson Dudley R USA r 202 Sessions Anderson Emma C inspr Bell Aircraft Corp r 416 Whitlock av Anderson Emmiline student r Atlanta rd nr Hill Anderson Florence E (Mrs Frey E) emp Bell Aircraft Corp r Fair RD 5 Anderson Frank (Leola) 1 lab The McNeel Marble Co h 504 Lemon apt 8 Anderson Frey E (Florence E) 2 emp Holeproof Hosiery Co h Fair RD 5 Anderson Geo D (Lena S) lawyer 59 S Park Square h 314 Freyer dr Anderson Gertrude E typist Bell Aircraft Corp r 204 E Dixie av Anderson Gwendolyn bkpr McPherson Tire Shop r Holly Springs Ga Anderson Harold G (Vivian B) 3 millwright Bell Aircraft Corp h 204 E Dixie av Anderson Harold T (Kath N) 1 uphol Mitchell Furn Mfg Co h Garrison rd RD 5 Anderson Harrison L (Miriam B) 1 athletic coach Marietta High Sch h 201 Geo Hamliton ct Apt 3 ANDERSON HUGH D (Mary T) (J M Fowler Co) r Villa Rica Ga Anderson Ira O (Alice B) 2 welder Bell Aircraft Corp h 614 2d Apt 5 Anderson J Danl (Mary G) cotton buyer H N DuPre h 511 Whitlock av ANDERSON JAS T JR (Jennie T) Mgr Anderson Motor Co h RD 4 Anderson Jas T (Jessie M) h 416 Whitlock av Anderson Jas F (Emily B) del slsmn The Texas Co h 234 E Dixie av Anderson John r 300 Rose la Marietta city directory 107 Anderson John D (Mary L) elk H N DuPre r 511 Whitlock av Anderson Josephine r 204 Glover Anderson Junie r 204 Glover Anderson Kath N (Mrs Harold T) knitter Holeproof Hosiery Co r Garri- son rd RD 5 Anderson Leila h 203 Freyer dr Anderson Leola emp McLellan Stores Co r 504 Lemon Apt 8 Anderson Lemon uphol Mitchell Furn Mfg Co r 117 Clay Anderson Louise maid h 205 Fort Anderson Mack C (Stella M) 4 emp Glover Mach Wks h Marble Mill (Eliz) Anderson Mamie L (wid J F) h Rose la (Eliz) Anderson Mary J (wid Freeman J) cashier Big Star Food Store h Gar- rison rd Anderson Mary L tchr Lemon Street Sch r 106 Height ANDERSON MOTOR CO, Jas T Anderson Jr Manager, Chevrolet and Oldsmobile Sales and Service, 111 Powder Springs--Tels Day 33, Night 55 Anderson Nancy V typist Bell Aircraft Corp r 204 E Dixie av Anderson Paul W USMC r Rose la (Eliz) Anderson Roy C (Nell M) 4 inspr Bell Aircraft Corp h Fair Oak (FO) Anderson Ruth A emp Bell Aircraft Corp r 202 Sessions Anderson S T (Martha C) 1 accnt Bell Aircraft Corp h 202 Sessions Anderson Sarah (wid Wm) r Garrison rd RD 5 Anderson Stella R (wid D B) r 202 Sessions Anderson Truman W (Vera) (Anderson Antique Reproduction Cabinet Shop) h Atlanta rd nr Hill Anderson W' Geo (Myrtle C) 1 mech Bell Aircraft Corp r Campbell Hill (Eliz) Anderson W Montgomery USMC r 416 Whitlock av Anderson Walter W (Ruth B>, checker W P Stephens Lbr Co h Rose la (Eliz) Anderson Wm S USA r 314 Freyer dr Anderson Zeb h 300 Rose la Andre Albert L 1 emp Bell Aircraft Corp h 1613 Hillside dr Andress J A elk L & N RR and N C & St L RR r 116 Winters Apt 3 Andrews Chas (Clyde J) h 110 Pierce Andrews Dewey R emp Bell Aircraft Corp r 108 Moores av Andrews Dorsey (Dorothy L) 1 fire inspr City Fire Dept h 107 Moores av Andrews Evie r 107 Moores av Andrews Fred (Grace M) sander Brumby Chair Co h 108 Lakewood Andrews Mark r 408 W W Lee Court Apt 7 Andrews Richd shine boy Atlanta St Barber Shop r 406 S Waddell Andrews Virgil B (Eva P) carp h 108 Moores av Anglin Irene Mrs h Austell rd (FO) Anglin Jack W (Merle G) USA r Austell rd (FO) 108 BALDWIN'S 1944 Annandale Geraldine (Mrs Wm C) cashier Piggly-Wiggly Super Mkt r 900 Roswell Annandale Geraldine D (Mrs W C) checker Piggly-Wiggly Super Mkt r 900 Roswell Annandale T Clyde (Edna) emp Gulf Oil Corp h 502 Atlanta Anneberg Clara K supvr nurse County Health Dept r Canton rd RD 1 Anthony Geo (Effie) USA r 201 Roswell Anthony Glenn B (Allyne M) 2 inspr Bell Aircraft Corp h 603 3d Apt 2 Anthony John W (Marie D) 1 mach Bell Aircraft Corp h 116 Kings ct Apt B Anthony Phillip A (Frances H) 2 inspr Bell Aircraft Corp h Concord rd Apt 16-a (FO) Antley Schuler (Neva B) 2 supt City Slchools h 1004 Cherokee Appleby David farmer r 213 Greer av Appleby Laura 1 cook 505 W Atlanta h 213 Greer av Appleby Robt USA r 213 Greer av Appleby Salon (Jeannette M) 1 lab h 118 Johnson Armfield C Heath (Sarah H) 1 elk Bell Aircraft Corp h 112 Colonial cir Apt 1 Armstrong Burrel (Eleanor E) emp Bell Aircraft Corp h 311 Lakewood dr Apt A Arndell Russell waiter Chester's Cafe r Cherokee rd (Eliz) Arnett Eliz R (wid Wm J) slswn Kaplan's Dept Store h 206 Lawrence Arnold Clara L tchr Lemon Street Sch r 714 Lawrence Arnold Henry L (Mary S) 2 formn Bell Aircraft Corp h 606 Ramona Apt 1 Arnold Howard T USA r 302 Winn Arnold John T (Hester P) 1 carp h 302 Winn Arnold John T Jr knitter Holeproof Hosiery Co r 302 Winn Arnold Lena M maid r 102 Rigsby Arnold Nellie F emp Sunlite Bakery r 302 Winn Arnold Otis (Addie J) lab Bell Aircraft Corp h 408 Robeson ct Apt 5 Arnold Wm H (Hattie G) 2 h 103 Gober Arrendale Gaynell waitress Chester's Cafe r Gault Tourist Homes Chero- kee (Eliz) Arrendale Russell waiter Chester's Cafe r Gault Tourist Homes Cherokee (Eliz) Artistic Beauty Shop The (J Loy Carpenter) 44 W Park Square Ash John (Evelyn M) 1 eng Bell Aircraft Corp r 401 Cherokee Asherley Sallie Mrs r Fair Oak av (FO) Askew Katie K (Mrs T M) ofc wkr Bell Aircraft Corp r 230 Campbell Hill Askew T MJilton (Katie K) USA r 230 Campbell Hill marietta city directory 109 Atchison Richd F (Nettie F) emp Bell Aircraft Corp h 304 Cleburne av Av Atchison Richd F Jr USA r 304 Cleburne Av ATHERTON DRUG CO (Lucius H Atherton) 46 W Park Square--Tel 6 Ay Atherton Howard student r 1216 Cherokee Ay ATHERTON LUCIUS H (Mary D) (Atherton Drug Co) h 1216 Cherokee Ay Atkins Clarence C (Sallie) 2 emp Bell Aircraft Corp h 112 Colonial cir apt 4 Ay Atkins Emma R (wid T J) r 310 Maple av Atkins G E (Nora H) elk City Curb Mkt h Tower rd (Eliz) Atkins Henderson L hlpr r Tower rd (Eliz) Atkins Howard r Tower rd (Eliz) Atkins Jas E (Kath C) 2 slsmn h 109 Moores av Atkins Louise elk Allen Drug Co r Kennesaw Ga B 1 Atkins Luke E (Lula R) 2 emp Bell Aircraft Corp h Page Bat Atkins Mary G slswn Florence's Inc r 310 Maple av Atkins Marie (Mrs Wm) emp Bell Aircraft Corp r Hill RD 5 Bac Bac Atkins Sallie (Mrs C C) emp Bell Aircraft Corp r 112 Colonial cir Apt 4 Bac Atkins Sarah (wid Geo) h Tower rd (Eliz) Bac Atkins Wm E (Marie) emp The McNeel Marble Wks h Hill RD 5 Atkinson Geo J (Maurine B) 1 emp Bell Aircraft Corp r 108 Roswell Bae Bae Atkinson Harry L (Hazel B) 2 mech Bell Aircraft Corp h 800 4th Apt 3 Bag Atkinson John T checker r 108 Roswell Atkinson Mary h 108 Roswell Atlanta Constitution Bureau The Clara J Jones reporter 110 Atlanta ATLANTA GAS LIGHT CO, Fred E Cook Branch Mgr, 109 Church-- Tels 200 and 201 Atlanta Journal The J E Lowe distributor 47 W Park Square Atlanta Street Barber Shop (High E Mozeley) 113 Atlanta Atlanta Street Tire & Battery Service (Wm Morrison) 310 Atlanta Attaway Nannie M (wid W M) smstrs h 1303 Roswell Atwater Allen lab r 313 E Anderson Auer D K (Nadine W) 2 sales eng h 401 Campbell Hill Apt 3 Aunspaugh Arrie (wid Jos) r 509 Kennesaw av Bag Bag Bag Bag Bag Bag Bag Bag Bag Bail Bail Bail Austin Aaron M (Carol P) USA r 208 McCord Austin Avenue Baptist Church Rev Amos O Russell pastor 212 Austin a? Austin Carol P (Mrs A M) elk L & N RR and N C & St L RR r 208 McCord Austin Frank (Nellie C) elk H N DuPre h Garrison rd RD 5 Austin Geo (Eliz M) 1 USN r Concord rd (FO) Austin Herbert (Frances M) 1 cook City Cafe h 327 Page Autenrieth Roy W (Eliz G) emp Bell Aircraft Corp h 704 Cherokee Awtrey Hazel B (Mrs Orlando) asst ret store mgr Birdsey Flour Mills' Bail Bail Bail Bail Bail Bail BAI1 Acworth Ga Awtrey Kate H (wid Bernard) r 601 Whitlock av Awtrey May F Mrs 1 emp Bell Aircraft Corp r 104 S Waddell Awtrey Merrill E (Grace D) r 911 Whitlock av Awtrey Orlando (Hazel B) ret store mgr Birdsey Flour Mills r Acworth Gs no BALDWIN'S MARI ne av rel 6 jrokee apt 4 Awtrey Palmer ofc wkr r 601 Whitlock av Awtrey W Dodson USA r 601 Whitlock av Ayer Kathelene technician Marietta Hosp r same Ayers Cleo A (Ouida A) 1 mech Bell Aircraft Corp h 602 2d Apt 4 Ayers John K (Susie C) 1 mech Bell Aircraft Corp h 107 Hawkins Apt B Ayers Kenneth r 608 2d Apt 4 || TO FIND A NAME YOU MUST H KNOW HOW TO SPELT. IT \.pt4 II Apt 3 ta h-- a .stin av McCoJd ee Mills orth Gs [N'S M* B N Auto Parts Co (Robt H Northcutt) 201 Winters Babb Louie (Carolyn) emp Bell Aircraft Corp r 207 E Dobbs Bacon Norman G r 501 Kennesaw av Badger Erwin G (Lela M) 1 eng Bell Aircraft Corp h 309 Manget Apt B Badger L C (Louise) USA h 302(4 Forest av Badger Louise ofc wkr Bell Aircraft Corp r 302(4 Forest av Baert Alf (Jean) USA r 118 Forest av Baert Jean (Mrs Alfred) bkpr The Marietta Journal r 118 Forest av Bagwell Henry R (Donna E) (Bagwell Sign Service) h 131 Hazel Bagwell Horace F (Bessie W) carp r 315 Washington av Bagwell Howell (Ruth P) 1 guard Bell Aircraft Corp h 614 2d Apt 4 Bagwell Jack M (Mary C) 1 USA h 119 Wright Bagwell Jas M (Eva M) 3 h Pearl RD 5 Bagwell John (Eliz C) trk dr Clackum's Trans r 206 S Waddell Bagwell Robt D (Flora H) USA r 315 Washington av Bagwell Ruth P (Mrs Howell) elk Bell Aircraft Corp r 614 2d Apt 4 Bagwell Sign Service (Henry R Bagwell) sign pntrs 131 Hazel Bagwell Wm W (Martha B) carp h Cochran (FO) Bailey Cleveland (Frances C) USA r Atlanta rd (FO) Bailey Earl (Isabell S) 1 lab Bell Aircraft Corp h 507 Lemon Apt 15 Bailey Frances C (Mrs Cleveland) ofc wkr Bell Aircraft Corp r Atlanta rd (FO) Bailey Jack C USA r 305 Polk Bailey Jas C (Mildred M) 1 emp Bell Aircraft Corp h 813 4th Apt 5 Bailey Jas D (Virginia F) USA r 200 S Alexander Bailey Jas M (Beulah E) blksmith The McNeel Marble Co r 305 Polk Bailey Lee N (Lillian) 2 expeditor Bell Aircraft Corp h 207 Wayland apt 4 Bailey Lucy mus tchr h 716 Church BAILEY RAYMOND E (Anne P) (Office Sales & Service) r Acworth Ga --Tel 3481 Bailey Richd H emp Bell Aircraft Corp r 813 4th Apt 5 Baine Loyd F emp Bell Aircraft Corp r 804 4th Apt 5 Bame S A Douglas (Etta S) 1 mech Bell Aircraft Corp h 804 4th Apt 5 Baird Earl D (Mary E) 3 guard Bell Aircraft Corp h 903 Frasier MARIETTA CITY DIRECTORY 111 Baird Floyd E (Eliz S) 2 consulting eng h 400 Campbell Hill Baity Alice (wid F A) emp Bell Aircraft Corp r Atlanta rd (FO) Baker Cath R (Mrs P T) elk First Natl Bk r 204 Sessions Baker Claud r Church (Eliz) Baker Claude M (Agnes P) ofc wkr Bell Aircraft Corp h 1610 Hillside dr Baker H June student r 408 Whitlock av Baker Homer hlpr r Church (Eliz) Baker Imogene student r 504 Lemon Apt 1 Baker Iva L (Mrs W L) furn rms 408 Whitlock av r same Baker J W (Sallie) h Church (Eliz) Baker Jos F (Ruby L) 1 slsmn Nu Way Clnrs &j Lndry h 317 Washington avenue Baker Mattie D nurse r 511 Washington av Baker Paul T (Cath R) 1 emp Bell Aircraft Corp r 204 Sessions Baker R Margt ofc wkr r 408 Whitlock av Baker Sara (wid L C) asst mgr Cafe Bell Aircraft Corp r 619 Church Baker Warner L (Iva T) h 408 Whitlock av Baldwin B F emp Bell Aircraft Corp r 516 W Hansell BALDWIN DIRECTORY CO INC, L A R Nelson Pres, Jesse W Orvin V- Pres, Mrs L A R Nelson Sec-Treas, World's Largest Independent City Directory Publishers; Originators of the ABCD Type City Directory. Publisher Marietta 1943-44 Directory. Home Office 125 Meeting St., Charleston, S. C. Baldwin Henry E (Mary T) 1 opr N C & St L RR h 114 Trammell Baldwin Mary T (Mrs Henry E) tmkpr Bell Aircraft Corp r 114 Trammell Baldwin Nettie B (Mrs Walter L) emp Owenby Mfg Co r 605 Powder Spring Baldwin W E (Fletcher) tmkpr Bell Aircraft Corp h 610 2d Apt 1 Baldwin Walter L (Nettie B) 1 h 605 Powder Springs Ballard L C (Geneva) inspr Bell Aircraft Corp h 805 3d Apt 6 Ballard Lowel emp Bell Aircraft Corp r 801 Church Ballard Robt L (Etheline M) 2 USA h 406 W W Lee ct Apt 6 Ballard Thos (Annie H) 1 lab h 607 Fort Ballerud Dorothy E (Mrs John B) ofc wkr Bell Aircraft Corp r 603 Bimey Apt 2 Ballew Clyde W (Ruth B) 2 guard Bell Aircraft Corp h 106 Gober Ballinger Geo W (Dorris R) eng Bell Aircraft Corp h 405 Lakewood dr Banks Adelle h 510 Lemon Apt 8 Banks Edith emp Bell Aircraft Corp r 1031 Cherokee Banks Howard A (Homosel C) emp Federal Communication Comn Monitoring Sta r 404 Cherokee Banks John USA r 510 Lemon Apt 8 Banks Lenola cook r 510 Lemon Apt 8 Bankston Parker J (Ruby C) 1 mach Bell Aircraft Corp h 128 Butler apt A Banning Edw G elk McLellan Stores Co h 305 E Anderson 112 BALDWIN'S 1944 Bannister Edith tchr Elizabeth Sch r Marble Mill (Eliz) Bannister Rheba Mrs emp Bell Aircraft Corp h 208 George Hamilton ct Apt 6 Barbaree Emery J (Hattie S) 4 emp Bell Aircraft Corp h 601 3d Apt 5 Barber Danl W (Laurie V) 2 eng Bell Aircraft Corp h 309 Frasier Barber Durant C (Stella J) 1 h 303 N Forest av Barber Francis C (Jean E) 1 formn Bell Aircraft Corp h 102 Stokes av Apt A Barber Jas F (Lucy D) 1 h 1210 Washington av Barber Stella B student r 303 N Forest av Barbrey Alonzo const wkr r 410 Powder Springs Barclay Haddie S (wid R P) r 202 Wright Barfield Annie nurse h 302 Clay Barfield Avery A USA r Beaver av Barfield Berry M (Emma B) 2 ins agt h 211 Fairground Barfield Bettie C (Mrs J M) inspr Marietta Hosiery Co r 108 South av Barfield Chas F USN r Beaver av Barfield Clista Q (wid A A) 2 r Beaver av Barfield David D (Lennis M) elk H N DuPre h 113 South av Barfield Ethel D (Mrs H H) mach opr Holeproof Hosiery Co r1 107 Pierce Barfield Evelyn oprSBT&TCor 110 Fairground Barfield Grady S 2 ins slsmn r 113 South av Barfield Gladys W (Mrs W H) emp cafeteria Bell Aircraft Corp r 204 Geo Hamilton ct Apt 4 Barfield H Hilliard (Ruth M) 1 h 211 South av Barfield Harry C (Dorothy M) 1 emp Bell Aircraft Corp h 115 South av Barfield Herbert (Connie) linemn S B T & T Co r 208 Geo Hamilton ct Barfield Homer H (Ethel D) 5 h 107 Pierce Barfield John M (Bettie C) 5 tmpkr Bell Aircraft Corp h 108 South av Barfield Ralph P (Bertha C) USA r 205 Fairground Barfield Robt P (Cora S) r Beaver av Barfield Winston H (Gladys W) 4 emp Bell Aircraft Corp h 204 George Hamilton ct Apt 4 Barger Jas E r Cherokee Barger Jos J (Minnie W) fnshr Brumby Chair Co h Cherokee Barger Jos J Jr emp Brumby Chair Co r Cherokee Barkalow Fred S (Aurelia W) trav slsmn r 207 Washington av Barker Leonard h Cherokee rd (Eliz) Barmore Eug (Jessie K) 1 core mkr r 1908 Roswell Barmore Evelyn opr S! B T & T Co r 110 Fairground Barmore Florie P (Mrs W C) mender Holeproof Hosiery Co r 115 North av (Eliz) Barmore Fred C (Lola J) 4 cook Jack's Place h 110 Fairground Barmore Jas H (Flossie K) core mkr r 1908 Roswell Barmore Jas H elk A&P Food Stores r 110 Fairground marietta city directory 113 Barmore Oscar E (Mina C) 1 stationary firemn W P Stephens Lbr Co h 115 Park Barmore W C (Florie P) 3 pntr Bell Aircraft Corp h 115 North av (Eliz) Barnes Albert H (Corrie M) 1 supvr Bell Aircraft Corp h 236 Hill ct Barnes Blanche tchr Keith Seh r 351 Gramling BARNES CARL P, Asst Cashier The First National Bank h 351 Gram- ling--Tel 292-J Barnes Claude (Dorothy K) slsmn F E A Schilling Inc h 604 Cole Apt 1 Barnes Earline student r 208 Mulberry Barnes Elbert E (Ruby B) 2 mach r 829 Manget Barnes Delane toolmkr Bell Aircraft Corp r 616 Birney Apt 2 Barnes Dollie (wid J Lester) 1 h Rose la (Eliz) Barnes Floy B (Blanch C) 2 mach Bell Aircraft Corp h 820 1st Apt 5 Barnes Horace lab Brumby Chair Co r 902 N Cole Barnes Ida L h 212 Roswell Barnes Jas R student r 820 1st Apt 5 Barnes Jesse M (Niwana C) USA r Marble Mill (Eliz) Barnes John H Jr student r 209 Geo Hamilton ct Apt 7 Barnes John H (Martha W) 1 emp Bell Aircraft Corp h 209 George Ham- ilton ct Apt 7 Barnes Mary F knitter Holeproof Hosiery Co r Rose la (Eliz) Barnes Mollie r 228 E Dixie av Barnes Parnell knitter Holeproof Hosiery Co r Rose la (Eliz) Barnes Retta (wid H M) h 616 Birney Apt 2 Barnes Robt E emp Bell Aircraft Corp r 616 Birney Apt 2 Barnes Roy C chf elk Bell Aircraft Corp r 131 Trammell Barnett Coralie F (Mrs Jos C) elk W P Stephens Lbr Co r 122 McDonald Barnett Eliz U (Mrs L L) ofc wkr r 207 Sessions Barnett Jos C Jr student r 122 McDonald Barnett Jos C (Coralie) emp Railway Exp Agcy h 122 McDonald Barnes Jos C elk Bell Aircraft Corp r 100 Gramling Barnett Leon L (Eliz U) USA r 207 Sessions Barnwell Green (Buline W) 2 emp Bell Aircraft Corp r 208 Johnson Barr Jas H (Norma H) eng Bell Aircraft Corp h 106 Colonial cir Apt 4 Barr Jas W (Nina B) 1 emp Bell Aircraft Corp h 204 Frasier Barrett Danl W (Lillian B) 1 pntr Bell Aircraft Corp h 218 Campbell Hill Barrett Ernest (Jacqueline K) USA r Concord rd (FO) Barrett Frances H (Mrs L W) tmkpr Bell Aircraft Corp r 108 Summit av Barrett Geo W (Carrie B) h 111 McDonald Barrett Geo H USN r 111 McDonald Barrett Henry F (Nellie G) 3 emp Bell Aircraft Corp h 501 Alexander circle Barrett Jacqueline (Mrs Ernest) ofc wkr Bell Aircraft Corp r Concord rd (FO) 114 BALDWIN'S 1944 Barrett L P boarder Holeproof Hosiery Co r 619i/2 Cherokee Barrett Layton W (Frances H) USA r 108 Summit av Barrett Linton P boarder Holeproof Hosiery Co h 619 Cherokee Barrett Margt W (Mrs It L) matcher Holeproof Hosiery Co r 222 Bose la Ban ett Mattie L slswn Murray's r 500 Atlanta Barron Myrtice B (Mrs Henry T) emp Holeproof Hosiery Co r 206 E An- derson Barrett Raymond L emp Bell Aircraft Corp r 212 Campbell Hill Barrett Robin M (Betty W) 2 druggist Jones Drug Co h 701 Church Barrett Roy L (Margt W) 1 emp Bell Aircraft Corp h 222 Rose la Barrett Thos E (Daisy M) h Gray (Eliz) Barrett Thos E (Eudora) slsmn Kaplan's Dept Store r Church (Eliz) BARRON ELECTRIC CO, (Jos B Barron) Electrical Contractors, House Wiring, Electric Fixtures and Supplies, 203 Mill--Tel 113 (See Buyers' Guide) Barron Emma F ofc wkr r Henry RD 5 Barron Florine student r Henry RD 5 Barron Henry T (Myrtice B) 5 emp Holeproof Hosiery Co h 206 E Anderson BARRON JAS B (Chessie McC) (Barron Electric Co) h Henry RD 5-- Tel 560-W Barron Lenward H (Louise) C 2 emp Anderson Mtr Co h 702 Roswell Barron Pauline cook h 405 Cole Barron Ralph M elk H N DuPre r 206 E Anderson Barron W F (Evelyn W) photog Bell Aircraft Corp h 105 Lacy Barron Wm H shop mech B & N Auto Parts Co r Austell Ga RD 1 Bartlett Lena maid 115 Vance cir r 107 Fort Apt 3 Bartlett Loyd (Hazel B) brklyr h Concord rd (FO) Bartlett Pearl (Mrs T E) emp Owenby Mfg Co r 606 Cole Bartlett T E (Pearl) brklyr h 606 Cole Bartlett Willie (Osie J) 5 lab h 107 Fort Apt 3 Bartley Robt H (Nell) br mgr Piggly Wiggly Super Mkt h 131 Garrison dr Barton Glen H (Barbara G) 1 loftsmn Bell Aircraft Corp h 401 Grover Barton Johnny (Lena P) 1 lab Southland Ice Co h 504 Lemon Apt 2 Barton Lena P maid r 504 Lemon Apt 2 Barton Robt J (Eva T) 2 electn Bell Aircraft Corp h 132 Hedges Apt 2 Barton Sara J emp Bell Aircraft Corp r 308 Washington av Baskm O Eliz student r 108 Margaret av Baskin T Edw (Bess M) 1 mech Marietta Housing Authority h 108 Margaret av Bass Hardie C Jr (Julia H) constn wkr Bell Aircraft Corp h 416 Park View av Bass Neil (Sara K) emp Holeproof Hosiery Co h 404 Wright Bass Sara K (Mrs Neil) ofc Brumby Chair Co r 404 Wright pass Virgil (Caroline) emp Bell Aircraft Corp r 412 Maple av Baswell L Veston (Lillie P) 1 del slsmn Sinclair Refining Co h Atlanta rd Bates Clarence (Elizabeth H) 5 lab The McNeel Marble Co h 10B Fort Apt 7 Bates Claude (Pauline) emp Model Dry Clnrs h 507 Lemon Apt 1 Bates Coleman (Annie M) 1 lab Brumby Chair Fac r 909 Lawrence Bates Eliz H maid r 103 Fort Apt 7 Bates Emmett (Clara) 1 hlpr Brumby Chair co h 113 Mulberry Bates Hazel M (Mrs F C) 1 r 111 Covington Bates Henry (Ida) lab Brumby Chair Co h 406 W W Lee ct Apt 1 Bates Jas (Zelma R) 1 lab Brumby Chair Co h 511 Lemon Apt 6 Bates Lewis J (Jeanette D) 4 trk dr The McNeel Marble Co h 509 Hunt Bates Ruby B maid Atlanta Gas Light Co r RD 1 Bates Susie h 606 Fort Battles Harold L (Alma H) formn Bell Aircraft Corp h 424 Aviation rd Baum Jos L (Kath F) 3 chf airplane inspr USA Southeastern Div h 421 Brook cir Apt 1 Baxley Oscar B (Wilier H) 1 mach Bell Aircraft Corp h 714 4th Apt 4 Baxter Chas emp Nu-Way Clnrs & Lndry r Atlanta rd Baxter Cora M (wid C W) 1 h Atlanta rd Baxter Eliz R (wid J E) h 514 Church Baxter Mary R Mrs usher Strand Theatre r 19 N Park Square Baxter Wm E (Lucille C) 1 inspr Bell Aircraft Corp h 121 W Dixie av Bayliss Alf W (Eliz F) 1 pilot Delta Air Lines h 209 Forest av BAYLESS ELIZ MRS (J M Fowler Co) 121 Forest av--Tel 445 Beaman Opal B (Mrs J Otis) slswn The Mill End Store r 300 Roswell Beaman Otis (Opal B) 1 constn wkr r 300 Roswell Bean R Luther (Bertha T) 2 emp Bell Aircraft Corp h Fair RD 5 Bean Robt L (Kath A) 2 accnt h 124 McDonald Bearden Bertha opr Marietta Beauty Shop r RD 1 Bearden Hubert H uphol Bell Aircraft Corp r Atlanta rd (FO) Bearden Ozelle emp Bell Aircraft Corp r Henry RD 5 Bearden T Gordon (Ora B) dairy Henry RD 5 h same Beasley Edna Mrs 1 emp Bell Aircraft Corp r Atlanta rd RD 5 Beasley Fredk W (Mae B) constn wkr r Cherokee Beasley Jas (Blanche G) 1 Lawrence Street Cafe h 118 Lawrence Beasley John W Jr (Mildred S) 1 supvr Bell Aircraft Corp h Concord rd Apt 13'-a (FO) Beasley Starling S (Maude M) 4 emp Brumby Chair Co h Joyner av (FO) BEASLEY WM L (Sadie H) 1 Asst Cash The First National Bank h 317 Atlanta Apt 2--Tel 907-R Beavers Albert A USN r 415 Polk Beavers Buford S (Stella W) 3 trk dr Monroe Mtr Exp h 302 Sessions Beavers Claudia 1 lndrs r 307 Harold Beavers Earl J (Leacy C) emp Federal Communication Comn Monitoring Sta h 415 Polk 116 BALDWIN'S 1944 Beavers Edw G (Ira L) 1 emp Bell Aircraft Corp r 602 Cherokee Beavers Ernest P (Lozia) pntr r 215 Waterman Beavers Fredk emp Bell Aircraft Corp r 602 Cherokee Beavers Geo lab r 213 MulberryBeavers H Alvin r 602 Cherokee Beavers Jas E (Ruby M) 1 USA h 408 Robeson ct Apt 3 Beavers Leacy C (Mrs Earl J) waitress Model Cafe r 415 Polk Beavers Lozia (Mrs E P) elk Bell Aircraft Corp r 215 Waterman Beavers Nellie M (wid M J) h Page Beavers Oeilla r 302 Sessions Beavers Plina h 213 Mulberry Beavers Waldo W USA r 302 Sessions Beavers Wiley H (Minnie P) 4 emp Bell Aircraft Corp h 602 Cherokee Beck Chas C (Juanita G) inspr Bell Aircraft Corp h 703 3d Apt 6 Beck Fred L (Drucilla) 3 (Marietta Marble & Stone Wks) h 611 Atlanta Beck J Sami (Lunie) (Marietta Marble & Stone Wks) h 208 Goss Bedford Andy (Bertha) lab h 310 Rigsby Bedford Bertha maid r 310 Rigsby Bedford Edw W (Irene J) lab Brumby Chair Co h 410 W W Lee ct Apt 9 Bedford Georgia cook YWCA h 111 Johnson Bedford Irene maid r 410 W W Lee ct Apt 9 Bedford Jos Jr lab Brumby Press r 300 Rigsby Bedford Jos M (Sarah H) 4 jan H N DuPre h 300 Rigsby Bedford Lillie M student r 300 Rigsby Bedford Sarah H lndrs r 300 Rigsby Bedford Viola h 117 Maple Beetle Jesse porter Cash & Carry Gro No 3 r Atlanta Ga Beitman Carol student r 809 Cherokee Beitman Carroll E (Katherine C) 1 elk h 809 Cherokee Beitman Howard student r 809 Cherokee Beitman Kath U S WAVES r 809 Cherokee Bell Clarence E (Jeanette) 1 trk dr Marietta Trans h 507 Montgomery Bell Clyde N (Mrs W B) looper Holeproof Hosiery Co r 302 Radium Bell Effie 1 maid h 106 Rigsby Bell Geo H (Minnitte W) 1 emp Bell Aircraft Corp h 104 Allgood rd Apt 2 Bell Jean student r 104 Allgood rd Apt 2 Bell John H (Kate C) salesmn h 411 Campbell Hill Bell Jos T (Lillie S) wtchmn The McNeel Marble Co r 415 Maple av Bell Lula h 211 Sessions Bell Marian C (Mrs W H) mach opr Florence's Inc r Dallas rd Bell Marietta E Mrs r 602 Cherokee Bell Parks M (Mary E) 3 elk Bell Aircraft Corp h 603 2d Apt 2 Bell Robt L lab r 202 Harold Bell T Lamar (Dorothy H) 3 mech McKinney Tire & Battery Service h 206 Locust MARIETTA CITY DIRECTORY 117 Bell W B (Clyde N) h 203 Radium Bell Aircraft Corp Butler south of City Limit Bell Aircraft Local No 10 (UAW-C10) 102% Washington av Belle Isle Vivian elk r New Marietta Hotel Belk Clyde S linemn Cobb County Rural Elec Membership Corp r 600 Cole Bellcour Frank H (Dorothy J) 1 tool mkr Bell Aircraft Corp h Lake- wood av RD 5 Benfield E J emp Bell Aircraft Corp r 411 Church Benjamin Jessie cook r 204 Montgomery Benjamin Louis (Mary B) lab Bell Aircraft Corp h 702 Pine Benjamin Mamie cook 208 Kennesaw av r 209 Montgomery Bennett Clara student r 409-a Lemon Bennett Dilmus T (Ervie B) 2 pntr Bell Aircraft Corp h 604 1st Apt 3 Bennett Eva (Mrs W L) emp Bell Aircraft Corp r 411 Campbell Hill Bennett Jas trk dr Ga Coal Co r 906 N Cole Bennett Lawrence (Ruthell) insptr Bell Aircraft Corp h 811 4th Apt 6 Bennett Mattie M r 201 Lawrence Bennett Ruthell (Mrs Lawrence) emp Bell Aircraft Corp r 811 4th Apt 6 Bennett W H (Charlotte E) 1 crane opr Bell Aircraft Corp h 403 N Wad- dell Bennett W L (Eva) inspr Bell Aircraft Corp h 411 Campbell Hill Bennett Willie M student r 409-a Lemon Benning Clement J (Mabel C) 2 emp Bell Aircraft Corp h 604-b E Wa- terman Benson Albert A (Nellie E) ticket agt N C & St L RR and L & N RR h 230 Whitlock av Benson Arth E (Mary B) r 200 Butler Benson Caroline B (Mrs Harold) ofc wkr The McNeel Marble Co r 403 Kennesaw av Benson Earl B student r 629 Kennesaw av Benson Ella N (wid O) h 500 Haynes Benson Harold (Caroline B) 1 ofc wkr Bell Aircraft Corp h 403 Ken- nesaw av Benson Hoke S (Jennie L) 3 crane opr Bell Aircraft Corp h Garrison rd RD 5 Benson Jewell (Mrs T Cliff) slswn The Grand Shop r 104 S Waddell Benson Katie (Mrs Troy C) slswn The Grand Shop r 104 S Waddell Benson Laura T (wid Geo) slswn Style Shop r 121 Wright Benson Lora G (wid T M) h 300 S Alexander Benson Marcellus R student r 406 Whitlock av Benson Mildred L ofc wkr Sou R R Co r 300 S Alexander Benson Milton Y USA r 121 Wright Benson Ralph E (Helen W) 2 bkpr h 108 Francis av Benson Regina A ofc wkr Am Tel & Teleg Co r 406 Whitlock av BENSON REGINA RAMBO (wid W E) Manager Marietta Credit Service, Agent Equitable Life Assurance Society of the United States, h 406 Whitlock av--Tel 784-W Benson Robt L (Lizzie A) const wkr h 613 Church Benson Roy P (Margt P) 2 mach h 200 Butler Benson T Cliff (Jewell) slsran Gulf Service Sta r 104 S Waddell Benson Troy C (Katie) h 104 S Waddell Benson & Ward (Wm H Benson, Judson C Ward) gros 105 Church Benson Warren (Jewell A) 1 dept mgr H N DuPre h 300 Frasier Benson Warren E welder r 406 Whitlock av Benson Wm H (Claire B) (Benson & Ward) h 629 Kennesaw av Benson Wm H Jr intern r 629 Kennesaw av Benson Wm L (Hellen B) USA h 401 Atlanta Bentley Almeta r 107 Coryell Bentley Cleve (Beulah) ab h 101 Mulberry Bentley Frances elk Jones Pharmacy r RD 1 Bentley Howard B (Pearl T) emp Bell Aircraft Corp r 809 E Waterman Bentley Ima P (Mrs O A) elk Brumby Press r 401 Washington Bentley Jas W (Ruby H) (Bentley's Lunch Rm) r RD 2 Bentley's Lunch Room (John T Brand, Jas W Bentley) 106 Washington av Bentley Oscar A (Ima P) 2 elk F E A Schilling Inc h 401 Washington av Bentley Thos P (Sarah W) 4 emp Bell Aircraft Corp h 1110 Roswell Benton Alma (wid C H) r 111 Radium Benton Chas H USA r 111 Radium Benton Clara M looper Holeproof Hosiery Co r 111 Radium Benton Geo (Rosie J) 7 h 114 Maple Berry Boy lab r 212 Greer av Berry Clara elk Bell Aircraft Corp r 203 Clay Berry Gladys elk J S Frey Gro r Marble Mill (Eliz) Berry Hesta msngr Bell Aircraft Corp r 203 Clay Berry J I (Hattie G) formn L & N RR h Marble Mill (Eliz) Berry Jas E (Beckey D) 1 tool grinder h Gray (Eliz) Berry John E (Willie M) 4 h 203 Clay Berry John E Jr USA r 203 Clay Berry Martin M (Cath W) 2 emp Bell Aircraft h Cranfill (FO) Berry Maud emp Bell Aircraft Corp r Marble Mill (Eliz) Berry Morris E (Lou N S) USA r 208 Campbell Hill Berry Sarah M maid h 107 Height Berts Scott (Mary) 1 lab Brumby Chair Co h 403-a Lemon BESHERS W HAROLD (Nina R) Accountants and Auditors, Tax Consult- ants, Income Tax Service, Blair Bldg--Tel 328, r 211 Atlanta, Smyrna Ga--Tel Smyrna 106-W (See Supplements Covers) Beshers Nina R (Mrs W Harold) cir dept Brumby Press r 211 Atlanta, Smyrna Ga Bettis Ada M student r 517 Page MARIETTA CITY DIRECTORY 119 Bettis Ada W (Mrs C F) slswn Kaplan's Dept Store r 517 Page Bettis C Felton (Ada W) 1 carp r 517 Page Bettis Chas J r 1126 Powder Springs Bettis Esther B mender Holeproof Hosiery Co r 1126 Powder Springs Bettis Geo T (Myrtie C) 1 foremn Bell Aircraft Corp h 1126 Powder Springs Bettis Herschel R (Josephine S) USN h Church (Eliz) Bettis John A carp Lewis Cabinet Shop r RD 1 Bettis Josephine (Mrs H R) (Church Street Service Sta) r Church (Eliz) Bettis Lola teller Cobb Exchange Bk r 517 Page Bettis Myrtie L usher Cobb Theatre r 1126 Powder Springs Bettis R C (Reba C) 1 carp Bell Aircraft Corp h 527 Page Bettis Ruby E r 1126 Powder Springs Bettis Willis R (Eva M) 1 mach opr Bell Aircraft Corp h 215 Waterman Beverly Gray N (Viola E) 3 carp h Garrison rd RD 5 BEVERS FRANK C (Lillian W) 2 (Five Point Service) h 122 Frasier-- Tel 902-M Bickers Harry M (Braska H) plmbr F E A Schilling Inc h 411 Maple av Bickers Wm C USN r 411 Maple av Biddlecomb Robt 1 emp Bell Aircraft Corp h 1515 Hillside dr Biddy John W (Zelma B) 2 mach Glover Mach Wks r Glover nr Fairground Big Star Food Stores Alf F Thomason mgr 201 Cherokee Biggers F M (Lorna M) oil inspr r 301 Kennesaw av Biggers Lorna (Mrs F M) ofc wkr r 301 Kennesaw av Biggers W H ofc wkr Bell Aircraft Corp r 409 Cherokee Biles Lois tchr Waterman Street Sch r 420 Atlanta Billington Jas lab r 518 Lawrence Billstone Ralph A (Margie J) 2 ofc wkr Bell Aircraft Corp h 170 W Dixie avenue Bingma Wm Earl emp Bell Aircraft Corp r 306 Washington av Bird Opal Mrs pkr Carter Candy Co r 116 McDonald Bird Walter R (Opal) USA r 116 McDonald Birdsey Flour Mills Orlando Awtrey Jr mgr ret store 207 Church Birt Aleese nurse County Health Dept h 304 Cherokee Apt 4 BISHOP ALBERT H (Nellie G) 2 City Recreation Director, h 212 Sessions --Tel 816-J Bishop Claudia student r 330 Austin av Bishop Claude G (Etta H) 2 mech City Board of Light & Water Wks h 330 Austin av Bishop E Dorothy sch tchr r 104 W Dixie av Bishop Grover S (Amilee B) 2 mach Bell Aircraft Corp h 606 1st Apt 3 Bishop Ina L (wid W A) h 323 Lawrence Bishop John A (Jonnie M) del slsmn Std Oil Co of Ky h 101 W Dixie av Bishop Lacy G USN r 104 W Dixie av Bishop Nellie (Mrs A H) dept mgr Florence's Inc r 212 Sessions rzo BALDWIN'S 1944 Bishop Patterson H (Lucy V) 1 meat mgr H N DuPre h 203-b Washington Bishop Reynolds G( Mamie T) 1 elk USPO h Fair Oak av (FO) Bishop Robt (Stella M) 5 h Tower rd (Eliz) Bishop Robt H (Essie D) 2 slsmn Std Oil Co h 126 Griggs Bishop Stella M (Mrs Robt) looper Holeproof Hosiery Co r Tower rd (Eliz) Bishop Wm student r 330 Austin av Bishop Wm J (Annie A) h 208 E Dixie av Bisnow Jean R (Mrs Oscar L) ofc wkr Bell Aircraft Corp r 613 2d Apt 6 Bisnow Oscar L (Jean R) eng Bell Aircraft Corp h 613 2d Apt 6 Bittinger Bert C (June D) tool wkr Bell Aircraft Corp h 408 Victory dr Blahlock Milton lab L & N RR r 205 Fort Black Alice home service supvr Ga Power Co r 839 Church Black Andrew C (Darkes) butler 900 Church h 329 Page Black Austin (Nell C) 1 electn h 221 Rose.la Black Beauty Salon Mrs Gladys Sexton 206 Depot Black Bertha 2 maid 324 Lawrence r 406 Robeson ct Apt 6 Black Daisy W (wid JR) cashier-bkpr Marietta Housing Authority h 310 Kennesaw Black Doris r 601 3d Apt 2 Black Gilbert T r 330 Atlanta Black Hamilton student r 406 Robeson ct Apt 6 Black J Walter (Nora) tmpkr Sou RR Co h 113 Freyer dr Black John A (Leila H) h 112 Delk Black John A jan r 406 Robeson ct Apt 6 Black John H (Dorothy N) 1 traffic dept Bell Aircraft Corp h 201 Radium Black Jos J (Florrie C) mgr Aircraft Apts h Atlanta rd (FO) Black Jos J III USA r Atlanta rd (FO) Black Julia B (wid J D) h 708 Church Black Lester G (Thelma E) 1 emp Bell Aircraft Corp h 400 Grover Black Linda M (wid R O) slswn Office Sales & Service h 613 Church Black Mildred student 200 George Hamilton ct Apt 8 Black Nell (Mrs Austin) knitter Holeproof Hosiery Co r 221 Rose la Black Telula r 112 Roswell Black Verneta r 602 Hunt Black Wm W (Muriel M) 4 emp Bell Aircraft Corp h 521 Frasier Apt 2 Blackmon Bertie L (Pearl) 1 lab h 401 Montgomery Blackmon Ora student r 401 Montgomery Blackmon Wm M (Molligene W) emp Bell Aircraft Corp h 305 Park View avenue Blackstock J D roofer W P Stephens Lbr Co r Rose la (Eliz) Blackstock W L (Leila C) 2 ctr h Rose la (Eliz) Blackwell Alf (Ethel H) 3 emp Hanley Co h 322 Lemon Blackwell Cath student r Atlanta rd (FO) Blackwell Ethel H maid 102 Francis av r 322 Lemon Blackwell Herbert D (Merzie C) slsmn h Atlanta rd (FO) MAltlETTA CITY DIRECTORY 121 I' Blackwell John S Jr mech Anderson Mtr Co r RD 1 Blackwell Isabel sten First Natl Bk r RD 1 Blackwell J T (Willie C) I emp Bell Aircraft Corp h 1408 Cherokee Blackwell Leo D (Evelyn G) 1 ptrlmn City Police Dept h 607 Atlanta apt 2 Blackwell Morris J (Geneva C) 1 dispr Southeastern Greyhound Lines h 109 Austin av Baine Louise tchr Lemon Street Sch Cole BLAIR AND CARMICHAEL, (Leon M Blair, Jas V Carmichael) Law- yers Blair Bldg 59 S Park Square--Tel 1340 Blair Apartments 317 Atlanta Blair Amanda (wid W C) h Pearl RD 5 Blair Building 59 S Park Square Blair D Jerome USA r Pearl RD 5 Blair Daisy T (Mrs Waddell) 1 safety eng r 307 Cleveland av Blair Daniel M student r 1020 Cherokee Blair Doris M ofc wkr Bell Aircraft Corp r Concord rd (FO) Blair Eliz A (wid Leslie) 2 h 504 Whitlock av Blair Homer D (Corrie J) h Concord rd (FO) Blair Irene M (wid D W) r 1030 Cherokee Blair June student r 1020 Cherokee BLAIR LEON M Hon (June W) (Blair and Carmichael) Mayor of Ma- rietta, h 1020 Cherokee--Tel 686 Blake Charity D maid r 124 Holiday Blake Geise L (Frances M) 2 ofc wkr h Concord rd (FO) Blake Wm (Charity D) trk dr h 124 Holiday Blakey Susie F h 312 Reynolds Blalock Alton (Annie P) emp W P Stephens Lbr Co h 212 Maple Blalock Cleola maid 318 Lawrence r 408 Lee ct Apt 5 Blalock John (Cleola Y) lab W P Stephens Lbr Co h 408 W W Lee ct apt 5 Blanchard Mary S Mrs r 911 Whitlock av Blanchard Scott D (Marie V) slsmn h 127 Vance cir Blancher Ella P maid r Rose la (Eliz) Blancher Griffin (Orabelle) emp Economy Ice Cream Co r Rose la (Eliz) Blancher LB (Ella P) lab h Rose la (Eliz) Blancher Orobelle maid r Rose la (Eliz) Blasingame Claude hlpr Bell Aircraft Corp r 709 Lawrence Blevins Clyde USN r Henry RD 5 Blevins Grady USA r Henry RD 5 Blevins J Pair (Lillie F) h Henry RD 5 Blevins Oscar (Maurine C) 1 trk dr Railway Exp Agcy h Henry RD 5 Blevins Willie USA r Henry RD 5 Biitch Carolyn home service sec American Red Cross Cobb County Chapter r 302 Lawrence Blitch Hazel drsmkr r 716 Church Bloodworth Imogene (Mrs J L) elk The Hosiery Shop r 200 Holland 122 BALDWIN'S 1944 Bloodworth Jas L (Imogene P) TJSA r 200 Holland Blount Robt (Louise P) 3 atndt Hartsfield Service Sta h 702 Fort Boalch Ruby D Mrs emp Holeproof Hosiery Co h 208 George Hamilton ct Apt 8 Boatner Adrain K (Hazel J) 1 ofc wkr Ga Power Co h 205 McCord Boatner Benj F (Eliz N) 1 genl mgr Cobb County Marble Co r 306 Depot Boatner Eliz (Mrs B F) elk War Housing Center r 306 Depot Boatner Florence B (wid W O) h 505 Page Boatner Lessie L (wid W M) h 306 Depot Boatner Ruby r 505 Page Boatner W Glenn (Ilah P) emp Cobb County Marble Co h 310 McDonald Boatright Cecil A student r 126 Trammell Boens Nancy 3 maid r 215 Mulberry Bogan Leslie E (Margarita C) 3 ofc wkr Bell Aircraft Corp h 611 2d Apt 5 Boggett Mildred artist Loudermilk Studio r 20 N Park Square Bogle C K (Melissa E) 1 emp Bell Aircraft Corp h 806 Cherokee Bogle Kelly Jr USA r 806 Cherokee Bogner Howard D (Lollie) tool designer Bell Aircraft Corp h 106 Colonial cir Apt 2 Boger Ada cook r 104 Harold Bohanon Albert M (Mattie P) emp Brumby Chair Co h 207 Wayland Apt 6 Bohanon C Eug emp L C Landers Mattress Shop r 207 Wayland Apt 6 Bohanon Chas J (Sarah D) emp Brumby Chair Co r 207 Wayland Apt 6 Boland Arth C (Mary R) 1 emp Bell Aircraft Corp h 517 Vista cir Apt 1 Boland Edgar (Mary R) 1 firemn Bell Aircraft Corp h Atlanta rd Apt 302 (FO) Bolden Addie H ins agt H 503 Lemon Apt 6 Bolden Mildred student r 503 Lemon Apt 6 Bollerut John B (Dorothy E) 1 USN h 603 Birney Apt 2 Boling Emory E (Eva J) 2 emp Bell Aircraft Corp h 123 Moon Boling Emory M (Allie B) 1 emp Bell Aircraft Corp h 801 1st Apt 4 Boling Gordon B r 614 2d Apt 5 Bolte Henry P (Eliz E) 1 emp Bell Aircraft Corp h 524 Frasier Apt 4 Bond Lucile elk J S Frey Gro r 200 Radium Bonner Francis Mrs tchr h 104 Forest av BOOK STORE THE (Dempsey B Medford) 54 S Park Square--Tel 449 Booker Hattie nurse 416 Whitlock av r same Booker J H (Hattie) 1 lab r 537 Washington av Booker Jas C (Gertrude) emp Brumby Chair Co h 210^ Black Booker Wm (Bessie B) 3 emp Brumby Chair Co h 326 Lemon Apt 2 Booth Christine tchr Marietta High Sch r 104 Forest av Booth Donald C (Nowata L) slsmn Cowan Auto Supply h 201 George Hamilton ct Apt 9 Booth Joel B (Margt B) mach opr Brumby Chair Co r 201 Glover Booth John J (Dorothy B) dept mgr Bell Aircraft Corp h 524 Frasier Apt 1 marietta city directory 123 Booth Thos H (Mary S) 1 math h 829 Manget Boozer Jas C (Maude R) 4 plmbr Bell Aircraft Corp h Oak av Boring Geo W r 109 Reynolds Boring Herman W (Idelle P) 1 mech h 106 South av Boring Lemon I fnshr Brumby Chair Co r 207 Goss Boring Oscar L fnshr Brumby Chair Co h 109 Reynolds Boring Ruth Mrs 3 r 109 Reynolds Boston Nancy S (wid John) h 420 Atlanta Boswell Danl D (Louise II) 1 mach opr Bell Aircraft Corp h 523 Vista cir Apt 2 Boswell John C (Agnes M) 1 mach Bell Aircraft Corp h 226 Clay Bothwell Riggins (Eva N) 3 carp h 213 Clay Bottley Anna maid r 215i/2 Johnson Bough Frank emp Bell Aircraft Corp r 214 Powder Springs Bowden Letha r 110 Lake Bowden Robt h 407 Cole Bowen Artie M r 201 N Alexander Bowen Carrie cook City Cafe r 201 N Alexander Bowen Chas P Jr (Hope L) eng Bell Aircraft Corp h 110 Phillips dr Bowen John W (Carrie) 3 lab h 201 N Alexander Bowen Maude W (wid I T) smstrs r 112 Delk Bowling R E (Eva B) 3 emp Bell Aircraft Corp h 707 Page Bowman Danl J Jr plmbr Charlie M Mayes r Austell rd RD 4 Bowman W C (Ola H) 2 emp Bell Aircraft Corp h 232 Campbell Hill Boyce Cora Mrs r Concord rd Apt 15-B (FO) Boyce Ivan (Grace) 4 emp Bell Aircraft Corp h Concord rd Apt 15-b (FO) Boyd C Fort Mrs r 804 3d Apt 3 Boyd Jas E (Grace P) 1 barber Rich & Powell Barber Shop h 213 Aus- tin av Boyd Nannie h 112 Black Boyd Sami D (Ida P) constn wkr h 106 Ayers av Boyington Lola Mrs 2 emp Bell Aircraft Corp r 302 Sessions Boyton Lola Mrs 2 emp Bell Aircraft Corp r 302 Sessions Boyton Patrick lab h 121 Fort Boyton Wm (Alice W) 1 lab Bell Aircraft Corp r 121 Fort Bozeman Eleanor (Mrs T W) nurse Marietta Hosp r 509 Kennesaw av Bozeman T W (Eleanor A) 1 asst mgr Sears Roebuck & Co h 509 Kenne- saw av Brackett E V (Annie L S) 3 oiler Bell Aircraft Corp h 107 Campbell Hill Brackett J Newel (Banche O) 6 drftsmn h 100 Campbell Hill Brackett Jean elk Nu-Way Clnrs & Lndry r Page BRACKETT MONNIE, Sec Carter Candy Co r RD 2 Brackett Ruby N (Mrs Wade A) emp Holeproof Hosiery Co r 603 Powder Springs Brackett Wade A (Ruby N) USA r 603 Powder Springs 124 BALDWIN'S 1944 Brackett Willie (wid R L) h Page Bradberry Hubert F (Bernice S) 1 inspr Bell Aircraft Corp h 807 4th Apt 4 Bradberry Josie M Mrs h 208 Locust Bradford Harry E (Nellie B) emp Bell Aircraft Corp h 100 Colonial cir Apt 3 Bradford Thos (Belle) emp Brumby Chair Co r 100 Roswell Bradwell Oscar emp Bell Aircraft Corp r 409 Cherokee Brady Lonnie M (Eula M) barber Reece's Barber Shop r RD 4 Bramblett G Weldon firemn Bell Aircraft Corp r 303 Seminole dr Bramblett W Frank inspr Bell Aircraft Corp r 303 Seminole dr Bramlett Clyde USA r Atlanta rd (FO) Bramlett John B (Minnie B) rd supvr L & N RR h Atlanta rd (FO) Bramlett Virginia opr S B T & T Co r Fair Oaks av (FO) Brand H Marshall (Rheba B) 1 USA h 209 George Hamilton ct Apt 9 Brand Jos F USA r 319 Washington av Brand Jos R (Giula R) mach Bell Aircraft Corp h 319 Washington av Brand John T (Lennie B) (Bentley's Lunch Rm) h 102 Fairground Brand Rheba B (Mrs H M) opr Artistic Beauty Shop r 209 George Ham- ilton ct Apt 9 Branson Concrete Products Co (T C Branson Jr) 135 Butler Branson Thos C (Gladys J) (Branson Concrete Products Co) h 124 Vance cir Brantley C Fields r Powder Springs RD 4 Brantley Chas W USA r Powder Springs RD 4 Brantley Eliz B (wid John S) h Powder Springs RD 4 BRANTLEY J L (Lizzie G) (Style Shop) h 215 E Dixie av--Tel 410-W Brantley John E USA r Powder Springs RD 4 Brantley Lewis R pharm Allen Drug Co r Powder Springs RD 4 BRANTLEY LIZZIE G (Mrs J L) (Style Shop) r 215 E Dixie av--Tel 410-W Brantley Luther A farmer r Powder Springs RD 4 Brash Bonnie P (Mrs Raymond E) emp Bell Aircraft Corp r 714 Atlanta Brash Raymond E (Bonnie J) USA r 714 Atlanta Brasfield C Mae r 310 Merritt Brasill Albert C (Arlintia) carp Victory Homes of Marietta Inc r Smyrna, Georgia Brasill Mary (Mrs Albert) opr S B T & T Co r Smyrna, Ga Braswell John R (Suedell T) 1 dispr Bell Aircraft Corp h 200 Allgood rd Apt 2 Bratcher Wm M (Dorothy H) 1 mach Bell Aircraft Corp h 204 Campbell Hill Bray Fannie r 706 Fort Bray Ida elk Rich's r 409 Atlanta Bray J T (Nora A) 5 farmer h Austell rd (FO) MARIETTA city directory 125 Bray Jennie G (wid C L) h 409 Atlanta Bray Oscar USA r 706 Fort Bray Sami lab Brumby Chair Co r 706 Fort Bray Willard D (Agnes M) 4 lab Brumby Chair Fac r 909 Lawrence Brazel H Grady (Frances R) emp Bell Aircraft Corp r 1112 Frasier Apt A Breedlove Carl emp Bell Aircraft Corp 214 Powder Springs Breedlove Jas B (Virgie T) 2 h 606 2d Apt 5 Breedlove Virgie T (Mrs J B) elk Bell Aircraft Corp r 606 2d Apt 5 Breese Bettie (Mrs E Y Jr) emp Bell Aircraft Corp r 308 Washington av Breese Edw Y Jr (Bettie) emp Bell Aircraft Corp r 308 Washington av Brewer Frank N USA r Fair Oak av (FO) Brewer Hugh A USA r Fair Oak av (FO) Brewer Ida Indrs h 108 Page Brewer J B USA r Fair Oak av (FO) Brewer J Herbert (Orlean P) 1 foremn r Fair Oak av (FO) Brewer Lilia R Indrs h 202 Black Brewer Lillie (wid A S) 2 h Fair Oak av (FO) Brewer Marie maid r 801 Lawrence Brewer Martha B r Fair Oak av (FO) Brewer Mary F elk r Fair Oak av (FO) Brewer N Linton (Bert P) 2 mgr Marietta Cafe h 207 Locust Brwer Walter D USA r Fair Oak av (FO) Brewster Jos S (Helen A) 1 emp Bell Aircraft Corp h 600 Page Brewster Sibbie r 203 Montgomery Bridges Albert A (Mary N) 2 emp Swift & Co h 211 Glover Bridges Arth (Claire) emp Bell Aircraft Corp r 116 Forest av Bridges Elree elk Bell Aircraft Corp r 400-a W Hansell Bridges Robt A (Tiller C) 2 USA h 604 1st Apt 4 Bridges Tillie C (Mrs R A) inspr Bell Aircraft Corp r 604 1st Apt 4 Bright John D (Patricia) tool wkr Bell Aircraft Corp h 507 Whitlock av Apt 7 Brimer Cecil emp Holeproof Hosiery Co r 220 Campbell Hill Brimer L Dewey (Lucille D) 1 guard Bell Aircraft Corp h 103 North av (Eliz) Brimer Mary emp Holeproof Hosiery Co r 500 Haynes Brinkley Herman J (Ida H) 3 electn h 213 McDonald Brisendine Roxie P (wid J E) nurse 309 Roswell h same Britt A R (Sadie H) route mn American Lndry & Dry Clnr h 121 Delk Britt Alf R (Sadie H) 1 dr American Lndry h 121 Delk Britt Cora H Mrs h 203 N Alexander Brittain Jas (Jennie M) h 306 Washington av Brittain Jenny L sten County Clerk of Court r 306 Washington av Britton Carrie r 808 N Cole Broaden Carrie nurse r 204 Fort Broaden Clarence (Mary) h 204 Fort 123 BALDWIN'S 1944 Broadnax Hezekiah K (Faith W) emp Bell Aircraft Corp h 211 Reynolds Broadnax Jessie r 909 N Cole Broadnax Lucile cook 101 Oakmont dr r 106 Height Broadway Jesse emp Bell Aircraft Corp r 108 Fort Broadwell Dorothy sten r 705 Powder Springs Broadwell Dorothy H ofc sec r 705 Powder Springs Broadwell Midford B student r 705 Powder Springs BROADWELL MIDDLETON B (Frances) (Marietta Transfer and Sal- vage Co, Marietta Storage Co) h 705 Powder Springs--Tel 1565-W Brock C Theo (Eva S) 1 mech h 307 S Waddell Apt 7 Brock John mgr City Disposal Plant r 619 Lawrence Brock R H (Margt M) 2 supt Marietta Army Air Port h 616 Morningside dr Apt 2 Brock Willie nurse State Dept of Public Health r 515 Whitlock av Brodnax Wilbur chauf r 307 Fort Bronson Jas porter McPherson Tire Shop h 306 Reynolds Bronson Marie maid r 204 Rigsby Bronson Minnie (wid B) r 707 Page Brook Geo r 309 Fort Brook Ruth drfswn Bell Aircraft Corp r 113 Gober Brooks Aliie nurse Marietta Hosp r same Brooks Chas O (Alma B) (Brooks Service Sta) h 305 Wright Brooks Clifford G (Hattie L) supt County Home h 410 Fairground Brooks Clyde C (Irma C) elk H N DuPre h 109 McDonald Brooks Earl B (Vivian D) 1 slsmn h 307 Wright Brooks Efford USN r 215 S Waddell Brooks Esther r 232 E Dixie av Brooks Evelyn slswn Williams Drug Co r Woodstock Ga BROOKS FORREST C (Eva P) 2 Agent Shell Oil Co, h 103 W Dixie av --Tel 759-W Brooks Grover (Beatrice K) h 411 Atlanta Brooks Gus A (Annie B) mach Bell Aircraft Corp h Lakewood av RD 5 Brooks Hollis F (Iowa D) 2 inspr Sears Roebuck & Co h 313 Lemon Brooks J E (Ruby L) 2 mach Brumby Chair Co r 616 Cherokee Brooks John R USN r 411 Atlanta Brooks Jos W (Arminda C) roofer W P Stephens Lbr Co h 215 S Waddell Brooks Kath bkpr Cobb County Federal Sav & Loan Assn r 109 McDonald Brooks Lillian D (Mrs Russell) emp Bell Aircraft Corp r 706 Church Brooks M Eliz ofc wkr Marietta Hosp r 219 Campbell Hill ~~ Brooks Martha L mender Holeproof Hosiery Co r 219 Campbell Hill Brooks Mollie R (wid L L) h 219 Campbell Hill *Brooks Nina B knitter Holeproof Hosiery Co r 313 Lemon Brooks Otis W (Annie S) 3 formn Bell Aircraft Corp h Glover pi RD 5 Brooks Russell (Lillian D) mech h 706 Church Brooks Service Station (Chas O Brooks) 315 Whitlock av Marietta city directory 127 Brookshire Horace F (Verna C) 2 emp Bell Aircraft Corp h Austell rd (FO) Brookshire Maude opr S B T & T Co r RD 3 Broom Jas L (Marian S) 1 mech Bell Aircraft Corp h 602 Morningside dr Apt 1 Broughton Ada maid r 215 Rigsby Broughton Larry trk dr Clackum's Trans r 106 Hunt Broughton Mary (wid Marshall) r Pearl RD 5 Browden Harry (Ruby) 2 presser Nu Way Clnrs & Lndry h 106 Hunt Brown Allen (Jane W) 2 autos 118 Washington av h 312 Freyer dr Brown Alice G r 400 Washington av Brown Annie M cook 606 Whitlock av r 405 Cole Brown Annie W (Mrs Clyde L) elk Bell Aircraft Corp r 809 4th Apt 2 Brown Austin L (Charlie C) 1 ofc wkr h 507 Kennesaw av Brown Bunch lab Bell Aircraft Corp r 704 Wright Brown Cecil USA r 1208 E Washington av Brown Chas A (Lucille C) 3 mech h 114 South av Brown Chas H (Annie C) 1 carp h 800 Washington av BROWN CHAS M (Helen B) 1 V-Pres Cobb Exchange Bk, Lawyer 20 N Park Square h 103 Oakmont dr--Tel 600 Brown Chas M Jr student r 103 Oakmont dr Brown Charlie C (Mrs A L) ofc wkr Bell Aircraft Corp r 507 Kennesaw av Brown Claude H (Blanch B) 4 stone ctr The McNeel Marble Co h 118 Delk Brown Clyde L (Annie W) 1 USN r 809 4th Apt 2 Brown Coryell r 111 Campbell Hill Brown D Asbury 5 (Cherokee Cash Gro) h 610 Cherokee Brown Danl C (Rebecca B) 1 emp Noah S Frey h 205 Polk Brown E T r 514 Lawrence Brown Earl E (Pearl I) emp Bell Aircraft Corp h 802 Washington av Brown Ed (Fannie J) 5 emp City Board Lights & Water Wks h 210 Johnson Brown Eddie L USA r 210 Johnson Brown Edw E carp r 405 Maple av Brown Ellender (wid G F) h Ward (Eliz) Brown Eloise M (Mrs I E) emp Marietta Hosiery Co r Joyner av (FO) Brown Ernest student r Atlanta rd Brown Ernest E (Barney S) 4 agt Industrial Life & Health Ins Co h Atlanta rd RD 5 Brown Ernest L emp Bell Aircraft Corp r 412 Atlanta Brown Ernest W (Geraldine L) 1 trk dr Model Dry Clnrs h 104 Green Brown Ervin A (Irene R) 2 carp Bell Aircraft Corp h 106 S Alexander Brown Fred J (Mary B) USA r 216 Rose la Brown Fredk (Mary) emp Bell Aircraft Corp r 116 E Anderson 128 BALDWIN'S 1941 Brown Floyd E (Florence T) frt handler N C & St L RR h 209 George Hamilton ct Apt 10 Brown Geo F Rev (Amy L) pastor First Baptist Ch h 107 N Forest av Brown Geo M (Alta B) hlpr h 301 Lemon Brown Grace M emp Holeproof Hosiery Co r 109 Covington Brown Harriman (Elsie) 1 USA r 211 Montgomery Brown Henry F (Callie) 1 barber Hunter's Barber Shop h Carnes rd RD 4 Brown Herbert W (Opal M) 5 emp Bell Aircraft Corp h 1000 Roswell Brown Herman (Fannie S) USA h 101 Gober Brown Hilliard (Anna B) lab City Disposal Plant h 204 Denmeade Brown Hoke S (Jessie B) 1 roofer W P Stephens Lbr Co h 803 Wash- ington av Brown Horace W (Lucille) 2 mech Holeproof Hosiery Co h 204 Radium Brown Hugh E r Ward (Eliz) Brown Ina r Ward (Eliz) Brown Ira E (Eloise M) USA r Joyner av (FO) Brown Irene R (Mrs E A) emp Bell Aircraft Corp r 106 S Alexander Brown J Broadus (Carrie W) sec-treas National Farm Loan Association h Canton rd Brown J D (Maud P) 8 cond N C & St L RR h 617 Kennesaw av Brown J P Grocery (John P Brown) Church (Eliz) Brown J D Jr USA r 617 Kennesaw av Brown J W (Ruby E) 1 linemn Georgia Power Co h 509 Page Brown J Homer (Ada H) mach Brumby Chair Co h 111 Campbell Hill Brown Jas USA r 103 Campbell Hill Brown Jas (Lillie M) 3 shoe repr Tritt Shoe Repair Shop r 211 Grerr av Brown Jas A (Irene M) 7 emp Brumby Chair Co h 109 Covington Brown Jas F r 1402 Roswell Brown Jas H (Leila M) electn h 216 Rose la Brown Jas H (Theo M) 1 emp Bell Aircraft Corp h 303 Stewart av Brown Jas R (Ruby B) 3 emp Bell Aircraft Corp h 1402 Roswell Brown Janie M (Mrs T N) looper Holeproof Hosiery Co r Rose la (Eliz) Brown Jesse M r Cherokee rd (Eliz) Brown John E (Viola S) 4 carp r 400 W Goss Brown John P (Lillie P) 1 (J P Brown Gro) h Gray (Eliz) Brown John P Jr r Gray (Eliz) Brown John R (Kay C) inspr Bell Aircraft Corp h 804 3d Apt 3 Brown John W h Cherokee rd (Eliz) Brown Jos E (Delores G) 1 USA h 314 Chickopee dr Brown Kittie r Cherokee rd (Eliz) Brown L L (Vada W) 2 emp Bell Aircraft Corp h Cogburn Park (Eliz) Brown Laverne r 204 Radium Brown Lee L (Nancy R) 2 foremn Holeproof Hosiery Co h 408 Kennesaw avenue Marietta city directory 129 Brown Leila M (Mrs J H) looper Holeproof Hosiery Co r 216 Rose la Brown Lena L Mrs r 514 Lawrence Brown Leotis (Laura) 1 lab Bell Aircraft Corp r 801 Lawrence Brown Lettie r Ward (Eliz) Brown Lillie cook r 910 N Cole Brown McClure USA r 111 Campbell Hill Brown Mildred r 514 Lawrence Brown Manning (Maude S) 5 tex wkr h 1208 Washington av Brown Martha J slswn McLellan Stores Co r RD 2 Brown Mary knitter Holeproof Hosiery Co r Ward (Eliz) Brown Mary F r 301 Lemon Brown Mary Lee (Mrs F J) knitter Holeproof Hosiery Co r 216 Rose la Brown Mosey jan h 317 Lemon Brown 0 L mech Bell Aircraft Corp r 207 Lawrence Brown Odell welder r Cogburn Park (Eliz) Brown Pauline (Mrs R M) emp Marietta Hosiery Co r 501 Church Apt 9 Brown Pearl I (Mrs Earl E) looper Holeproof Hosiery Co r 802 Washing- ton av Brown R R (Nellie M) gro Atlanta rd h same Brown Reid W (Lynne R) cash Railway Exp Agcy r Cartersville Ga Brown Robt M (Pauline P) USA h 501 Church Apt 9 Brown Rosa L r 210 Johnson Brown Sara elk US PO r 617 Kennesaw av Brown Sylvester USA r 204 Denmeade Brown T N (Janie M) 1 trk dr Holeproof Hosiery Co h Rose la (Eliz) Brown Thos J (Annie A) 1 stone ctr The McNeel Marble Co h 114 Delk Brown Viola knitter Holeproof Hosiery Co r Ward (Eliz) Brown Walter A (Mollie F) USN h 113 Campbell Hill Brown Wm E stockmn H N DuPre r 1208 Washington av Brown Wm E USA r Carnes rd RD 4 Brown Wm H student r Gray (Eliz) Brown Wm I (Iowa L) 3 hlph h Cogburn Park (Eliz) Browne Ella D r 309 Kennesaw av Browne Horace L (Celia) 2 emp Bell Aircraft Corp h 231 Hill ct BROWNFIELD LE ROY H (Marie B) executive sec Cobb County Cham- ber of Commerce h 306 Kennesaw av--Tel 519-J Browning Julia D gro 201 Glover h same Brownlee Mamie maid r 204 Page Bruce Nada (wid H H) r 409 Lakewood dr Apt B Bruce Sami H (Mary B) h Glover nr Fairground Bruce Wm E (Margt L) firemn Marietta Army Air Port h 311 Glover Brumby Anne F (wid Wm M) h 1019 Cherokee Brumby Annette ofc sec Brumby Chair Co r 1019 Cherokee Brumby Bolan G (Ida H) emp Cherokee Hosiery Mill h 133 Gober iso BALDWIN'S 1941 BRUMBY CHAIR CO THE, Robt E Brumby Pres, Otis A Brumby V-Pres, Thos M. Brumby III Sec, J Remley Brumby Treas, Manufacturers of "Brumby" Chairs and Rockers, 106 Kennesaw av--Tels 376 and 377 (See Buyers' Guide) BRUMBY FURNITURE CO, Mrs Marie M Brumby Pres, Roland S Lindsey V-Pres-Genl Mgr, Mrs Marie B Fowler Sec-Treas, 12-14 E Park Square--Tel 198 Brumby Gretchun D h 1015 Cherokee Brumby Ida L US WAVES r 138 Gober BRUMBY J REMLEY (Marjorie J) 1 USA r 112 McDonald Brumby Jack B USN r 1019 Cherokee Brumby John T student r 1000 Cherokee Brumby Marjorie (J Remley) sten First Natl Bk r 112 McDonald BRUMBY MARIE M (wid JR) Pres Brumby Furniture Co h 1000 Cher- okee--Tel 215 BRUMBY OTIS A (Eliz D) Pres Brumby Press Inc, V-Pres The Brumby Chair Co r Smyrna Ga Brumby Press Inc, Otis A Brumby Pres, Publishers Cobb County Times, 109 Whitlock av Brumby R E (Eliz W) supvr Brumby Chair Co h 121 Vance cir BRUMBY RECREATION CENTER Albert H Bishop Director Polk nr Winn--Tel 9115 Brumby Richd G (Virginia T) 3 USA h 111 Francis av BRUMBY ROBT E (Myrtle P) Pres The Brumby Chair Co h 101 Oak- mont dr--Tel 975 Brumby Robt M r 133 Gober Brumby Roberta E student r 101 Oakmont dr BRUMBY THOS M III USN r Atlanta Ga Brumby Wm E student r 1000 Cherokee Brunson Bethenia maid r 714 Fort Brunson Jas (Lillie L) 1 emp McPherson Tire Shop h 306 Reynolds Brunson Lillie L emp Victory Beauty Shop r 306 Reynolds Brunson Pink (Almenthia G) 1 jan Holeproof Hosiery Co h 714 Fort Brunson Trudie r 714 Fort Brunson Wm (Mamie M) hlpr The McNeel Marble Co h 321 W Goss Bryan Carl W (Edna) carp h 539 Page Bryan Geo F (Pauline K) 1 diesel opr r 202 Fairground Bryan Ida (Mrs Irving) elk Irving's Ten-cent Store r 1000 Church Bryan Irving (Ida) 2 Irving's Ten-cent Store h 1000 Church Bryan P H emp Bell Aircraft Corp r 309 Kennesaw av Bryant Albert (Marie W) 4 welder h 410 Robeson ct Apt 5 Bryant Cleo r 303 Page Bryant Edw W (Sadie) 2 lab W P Stephens Lbr Co h 102 Hunt Bryant Evelyn maid Florence's Inc r 324 Lemon Bryant Fredk (Ruby) 3 lab r 605 Washington av marietta cut* directory 131 Bryant Georgia student r 102 Hunt Bryant Gladys r Joyner av (FO) Bryant H Jackson (Lula B) h Marble Mill (Eliz) Bryant Henry (Lena) 1 lab Bell Aircraft Corp r 607 Fort Bryant Homer emp Brumby Chair Co r 102 Hunt Bryant John T emp DuPre Cotton Gin r RD 2 Bryant L M (Lula W) 1 emp r 107 North av (Eliz) Bryant L M Jr USN r 107 North av (Eliz) Bryant Lena maid r 607 Fort Bryant Maggie student r 102 Hunt Bryant Pauline r Glover pi RD 5 Bryant Ruby cook 304 Freyer dr r 605 Washington av Bryant Sadie clnr r 102 Hunt Bryant Susie 1 maid h 410 W W Lee ct Apt 5 Bryant Winnona clipper Holeproof Hosiery Co r Marble Mill (Eliz) Bryson F H r 539 Page Bryson Hoyt welding Bell Aircraft Corp r Hill RD 5 Bryson Lem (Maude) brklyr h 310 Reynolds Buchanan Manon D (Emma S) mach Bell Aircraft Corp h 602 Victory dr Apt 1 Buchanan Syble r Henry RD 5 Budd Robt M (Grace D) 2 mech Bell Aircraft Corp h 400 Alexander cir Bufkin Aline (wid Wyatt H) ofc wkr Bell Aircraft Corp r 111 McDonald Bullard Edw G (Lillie W) 1 elk Gulf Oil Corp h 112 Freyer dr Bullen Winnie emp Bell Aircraft Corp 207 Frasier Bulloch Roy W (Ethel M) 2 mech Bell Aircraft Corp h 819 1st Apt 3 Bullock Georgia cook 520 Stewart av r Rose la (Eliz) Bullock john W (Vallie L) 1 inspr Bell Aircraft Corp h 604 1st Apt 1 Bullock Thos (Georgia N) emp Brumby Chair Co h Rose la (Eliz) Burch Nathan H (Margt L) loftsmn Bell Aircraft Corp h 323 Aviation rd Burckhautter Wm T (Marian S) 1 inspr Bell Aircraft Corp h 102 McIntosh av Apt A Burford Louise cook r 400 Reynolds Burford Raymond (Louise) 1 lab r 400 Reynolds Burgarry Lucy 1 opr Artistic Beauty Shop h 704 Cherokee Burgen John (Frances) USA r 103 W Dixie av Burger Chas E (Josephine P) 2 mech Bell Aircraft Corp h 612 Birney Apt 2 Burger Clarence (Mary) welder Bell Aircraft Corp h 510 Victory dr Apt 1 Burgess Bertha E slswn Florence's Inc r 312 Campbell Hill Burgess Chas emp Sears Roebuck & Co h 617 Cherokee Burgess Eug USA r 700 Roswell Burgess Howard USN r 700 Roswell Burgess Hoyt C (Ruth C) 2 patrolmn County Police Dept h Concord rd (FO) 132 BALDWIN'S 1944 Burgess Jas L USA r Concord rd (FO) Burgess John USA r 700 Roswell Burgess Lilia (wid Sami) 1 r 700 Roswell Burgess John A (Opal F) 1 emp W P Stephens Lbr Co h Cochran Burgess Mae B (wid J H) h Concord rd (FO) Burgess Romie L (Dorothy K) 1 h 312 Campbell Hill Burgess Ruth C (Mae C H) elk Bell Aircraft Corp r Concord rd (FO) Burgess Wm C USA r 104 3d ct Apt 4 Burgess Wm E farmer r Concord rd (FO) Burke Arth J (Elaine B) 1 eng Bell Aircraft Corp h 1508 Hillside dr Burke Dorothy M elk Atherton Drug Co r 306 Roswell Burke Louisa cook h 105 Rigsby Burnell A Ford (Helen S) 2 emp Bell Aircraft Corp h Garrison rd RD 5 Burnes J B (Ethel G) 4 fixer Holeproof Hosiery Co h Marble Mill (Eliz) Burnette Robt H USA r Rose la (Eliz) Burnette Wm L (Mary M) h Rose la (Eliz) Burns Eliz H (Mrs L L) riveter Bell Aircraft Corp r 612 2d Apt 5 Burns L L (Eliz H) 4 h 612 2d Apt 5 Burns Margt L (wid E W) r 209 Seminole dr Burrell Jackson emp Bell Aircraft Corp r 505 W Atlanta Burrett Chas H (Ruth G) millwright Bell Aircraft Corp h 209 Aviation rd Burse Fannie h 208 Maple Burse Jas L (Minnie D) 1 lab h 103 Fort Apt 6 Burse Scott (Mary C) lab Brumby Chair Co r 403 Lemon Burson C B (Bertie M) 2 mech Bell Aircraft Corp h 413 Brook cir Apt 2 Burson Jas W (Lucy T) 1 emp Bell Aircraft Corp h 504 Haynes Apt 2 Burson Lou A student r 605 2d Apt 3 Burt Byron T (Willie C) USA h 405 Seminole dr Burt C T (Mary) 1 emp Bell Aircraft Corp h 162 Hedges Apt 2 Burt H M (Lucy M) 2 supvr Bell Aircraft Corp h Austell rd (FO) Burtchfield W D (Mabel) 2 emp Bell Aircraft Corp h 611 2d Apt 4 Burton Agnes (wid F T) genl sec YWCA r 212 E Anderson Burton Alma (wid W H) h Tower rd (Eliz) Burton Bernice knitter Holeproof Hosiery Co r Tower rd (Eliz) Burton Glover (Eunice) 2 emp Glover Mack Wkrs h 206 Wayland Apt 1 Burton H Monroe (Sarah B) USA r 303 N Forrest av Burton Helen knitter Holeproof Hosiery Co r Tower rd (Eliz) Btirton Howard (Irene) 1 USA h 801 Frasier Burton Jack (Cath S) 3 lab Brumby Chair Co h 121 Johnson Burton John P (Christine) 1 elk Bell Aircraft Corp h 701 3d Apt 2 Burton L P Coal Co (Luther P Burton) 616 Kennesaw av Burton L Lee (Mozelle N) uphol Brumby Chair Co r 603 Cherokee Burton Luther P (Virginia S) (Burton Coal Co) h 322 Austin av Burton M Jackson (Mary N) USA r 603 Powder Springs MARIETTA CITY DIRECTORY 138 Burton Mary N (Mrs M Jackson) emp Bell Aircraft Corp r 603 Powder Springs Burton Monroe C emp Brumby Chair Co h 204 Polk Burton Mozelle N (Mrs L L) inspr Holeproof Hosiery Co r 603 Cherokee Burton Sarah B (Mrs H M) ofc wkr Bell Aircraft Corp r 303 N Forest av Burton ffm H (Leila S) 4 mech h Atlanta rd Burtz Leo tchr r 104 Forest av Bushong Carroll V (Hettie H) mgr Miller's Inc h 702 Church Bushong Mary A (wid F M) r 702 Church Business Girls Club Evelyn Kay sec meets Friday night 31 N Park Square Butler Estell maid h 714 Lawrence Butler Evelyn D (Mrs J E) (Evelyn's Beauty Shop) 200 McDonald Butler Hugh L (Louise L) 1 emp Bell Aircraft Corp h 508 Lakewood dr Apt B Butler Jos E (Evelyn D) 1 USA h 200 McDonald Butler Lawrence elk Southland Ice Co r Smyrna Ga Butler Lucy hlpr Brumby Chair Fac r 715 Lawrence Butler Margt W (wid D P) h 803 Church Butler Merrill J (Myra D) 2 inspr Bell Aircraft Corp h 305 Waterman Butler Willie D USA r 714 Lawrence Butler Warren (Ella) lab h 300 Harold Butterworth Charlotte (Mrs W H) looper Holeproof Hosiery Co r 218 Rose lane Buttersworth Evelyn C (Mrs Howell) knitter Holeproof Hosiery Co r 225 Rose la Buttersworth Howell (Evelyn C) 2 fixer Holeproof Hosiery Co h 225 Rose la Butterworth Jack E (Gertrude N) draftsmn McNeel Marble Co h 123 Vance cir Butterworth W H (Charlotte H) 1 h 218 Rose la Buttram J T (Mildred M) 5 emp Bell Aircraft Corp h 612 Birney Apt 1 Butts Allie 1 lab Bell Aircraft Corp r 102 Denmeade Byers Cora J (wid Edgar) 1 asst librarian Clarke Library h 207 Wayland Apt 5 Byers Richd. E (Edna) 2 emp Bell Aircraft Corp h 201 Waddell pi Apt 1 Byers Thos J USA r 207 Wayland Apt 5 Byrd Guy J (Hemietta G) 2 elk Colonial Food Stores h Tower rd (Sliz) Byrd R M elk Scoggins Gro r 205 George Hamilton ct Apt 7 Byrd Robt M r 205 George Hamilton ct Apt 7 | TO FIND A NAME YOU MUST f KNOW HOW TO SPELT, IT Cabe Floyd C (Ophie S) 5 emp Bell Aircraft Corp h Washington av 134 BALDWIN'S 1944 Cabe Geo R r Beaver av Cabe Robt M (Viola W) emp Fox Mfg Co h Beaver av Cabrera F Homer (Lucille T) 3 trk dr h Nelson favle Sherman C Jr USN r 212 Clay - Cagle Sherman C (Grace B) 2 emp Bell Aircraft Corp h 212 Clay Cagle Wm H USN r 212 Clay Cain Anna (Mrs Homer W) slswn Coggins Shoe Store r 801 Cherokee Cain Beatrice (wid C F) smstrs r Fair Oak av (FO) Cain Guyeula emp Bell Aircraft Corp r 904 3d Apt 5 Cain Homer (Anna C) 2 ofcs wkr h 801 Cherokee Cain Remer J (Mrs W E) elk Bell Aircraft Corp r 609 2d Apt 3 Cain Wm E (Remer J) 1 electn h 609 2nd Apt 3 Cairnes Allen E student r 111 Freyer dr Cairnes T Harold r 111 Freyer dr _ Cairnes Wade W (Zelma) 1 supt Colonial Food Store h 111 Freyer dr Caldwell A Jack (Katie L) 1 accnt Economy Ice Cream Co h 211 Sessions Caldwell Biddie R (wid W A) h 130 South av Caldwell Cordelia (wid D M) (Caldwell & Ravan) Marble Hill (Eliz) Caldwell Cordelia E (wid D M) h Marble Mill (Eliz) Caldwell Earl D inspr Bell Aircraft Corp r Marble Mill (Eliz) Caldwell Geo V (Venia L) 1 fdr wkr h 112 Rogers Caldwell Jos W (Wilma M) 2 h 206 Wayland Apt. 3 Caldwell & Ravan (Mrs Cordelia Caldwell, J Willis Ravan) gro Church Caldwell Wilma M (Mrs J W) boarder Holeproof Hosiery Co r 206 Wayland Apt 3 Calhoun C M (Marg M) 1 asst executive Boy Scouts of America h 112 Hillside av Calhoun Wm B eng Bell Aircraft Corp r 504 Cherokee Callahan D Grady (Wylene D) 1 emp Glover Mach Wks h Marble Mill (Eliz) Callahan John (Mattie N) 3 carder h 201 Clay Callison Frances R Mrs tchr Marietta High Sch r 302 Lawrence Calloway Carl V (Nellie) 1 ticket agt L & N RR and N C & St L RR h 419 Atlanta Calloway Sami E student r 419 Atlanta Calquitt Alfred O Jr USA r 126 McDonald ,, , Cameron R R (Essie) mgr Marietta City Housing Authority r Acworth rd Camp Albert R (Louise C) 3 (Gulf Service Sta) h Atlanta rd (FO) Camp Alf H (Ruth M) 1 ofc wkr Bell Aircraft Corp r 640 At.anta Camp Annelle sten Bell Aircraft Corp r 307 S Waddell Apt S' Camp Eva B (wid B N) 1 h 307 S Waddell Apu 3 Camp Geo W inspr Bell Aircraft Corp h 807 3d Apt 1 Camp Harvey L (Jeanette W) 4 formn Brumby Chair Co h 117 Delk Camp Horace M (Myrtie D) 3 carp h 303 Roswell MARIETTA CITY DIRECTORY 135 Camp Jas F r 807 3d Apt 1 Camp Jas L USN r 113 Pierce CampierceT ^ emp City Board of Li^hts & Water Wks h 113 Camp Jewell Mrs 2 emp Bell Aircraft Corp h 209 Geo Hamilton ct Apt 6 Camp Leslie M (Monah W) 3 emp Bell Aircraft Corp h Joyner av (FO) Camp Mary E elk r 209 Geo Hamilton ct Apt 6 1 Camp Mary J ofc wkr Holeproof Hosiery Co r 307 S Waddell Apt 3 Camberrd ^FO)6^ E) instr Rickenbacker Aircraft Training Sch h Bar Camp Ruth M (Mrs Alf H) ofc wkr Bell Aircraft Corp r 640 Atlanta Apt B0^ W (Virginia J) 3 emp Bel1 Aircraft CS h 602 Roosevelt cir Camp Virginia S slswn Irving's r 303 Roswell Camp Walter E USA r 307 S Waddell Apt 3 Campbell Betty opr S B T & T Co r Pearl Campbell G B emp Holeproof Hosiery Co h 124 Lacy Campbell G B Jr (Louise W) 2 supt Marietta Housing Authority h 201 George Hamilton ct Apt 4 * Campbell Ida r 408 Robeson ct Apt 6 Campbell Jesse W (Jessie B) 1 emp Bell Aircraft Corp h 606 2d Apt 4 Campbell Lewis (Cath) 2 lab r 638 Pine P Campbell Rachel opr S B T & T Co r Pearl Campbell W Porter (Martha C) 1 mech h Atlanta rd (FO) Campbell wm G (Virginia B) 1 emp Georgia Power Co h 410 Maple av Cannon Buren (Mrs R L) tmkpr Bell Aircraft Corp r 511 Lawrence Cannon Gerald B (Alice V) 1 mach h 605 Haynes CANNON SAML A (Anna H) 1 (Crescent Furniture Co) h 212 McCord A cl 41^ Canova Henry L (Ida M) 1 instr Bell Aircraft Corp h 307 Park View av Cantrell Chas N (Zora C) h 203 E Dixie av SV Cantrell Charlotte Mrs waitress Marietta Cafe r 317 E Dixie av Cantrell Clarence P (Lela G) 5 mech Ga Power Co h 118 South av Cantrell Earl USA h Atlanta rd (FO) Cantrell Evelyn S (wid M A) r Bells Ferry (Eliz) Cantrell Hiram J (Emma H) slsmn Dunlop Tire & Rubber Corp r Acworth v*a KD 1 Cantrell Hubert (Jennie C) 1 USA r Garrison rd RD 5 Cantrell Lela G (Mrs C P) nurse Bell Aircraft Corp r 118 South av Cantrell Ralph G Rev (Annie H) 6 pastor Lindale Church of God h Rose la (Eliz) Cantrell Ruby emp Bell Aircraft Corp r 309 Roswell Cantrell Walter lab r 113 Page Canty Willie gro 409 Cole h same Cantrell Jos E (Minnie H) USA r 126 Trammell 136 BALDWIN'S 1944 Canup C Grafton C trk dr Marietta Lbr Co r Garrison rd RD 5 Canup Geo D (Clarice H) 1 carp h 204 George Hamilton ct Apt 2 Canup J C (Mignonette J) fnshr Anderson Antique Reproduction Cabinet Shop h Garrison rd RD 5 Canup J Ollie (Lizzie N) 1 carp Marietta Lbr Co h Garrison rd RD 5 Capeheart Lela M r Garrison rd RD 5 Carden Carl J (Jewel V) 1 mech Bell Aircraft Corp h Darnell rd (FO) Carden Marian (Mrs Robert M) opr S B T & T Co 202 Polk Carden Marron S (Mrs Robert) opr S B T & T Co r 202 Polk Carden Robt (Marron S) USA r 202 Polk Carder Louise 0 (Mrs A C) emp Owenby Mfg Co r 614 Cole Carlile D C (Louise A) 1 r 622 Atlanta Carlile Louise A (Mrs D C) ofc wkr r 622 Atlanta Carlile Sue (Mrs M H) elk Ga Produce Co RD 2 Carlisle Hazel (Mrs R C) elk A & P Food Stores r Roswell Ga RD 1 Carlisle W Howard (Lou S) trk dr W P Stephens Lbr Co h Oak av (FO) Carmichael Donald E (Ruby C) 2 USA h 604 Birney Apt 2 CARMICHAEL JAS V (Frances M D) (Blair and Carmichael), County Attorney Blair Bldg--Tel 1340, Marietta-Atlanta Highway Carney Ethel P (Mrs W F) emp Bell Aircraft Corp r Darnell rd Carney Fredda F (Mrs Geo) riveter Bell Aircraft Corp r 906 3d Apt 6 Carney Geo (Fredda T) 2 mach Bell Aircraft Corp h 906 3d Apt 5 Carney J W (Nannie P) fixer Holeproof Hosiery Co h 234 Campbell Hill Carney Louise M (wid W W) 2 r Beaver av Carney Nannie P (Mrs J W) emp Bell Aircraft Corp r 234 Campbell Hill Carney Raymond F (Octavia C) h Burnap RD 1 Carney W Fred (Ethel P) 1 guard Bell Aircraft Corp h Darnell rd (FO) Carpenter J Loy (Mary U) 2 dentist 44 W Park Square h 408 Camp- bell Hill Carpenter Jas emp Bell Aircraft Corp r 839 Church Carpenter Lillie R (wid HP) h 619 Church. CARPENTER MARGT L (Office Sales & Service) r 619 Church--I el 3bb-J Carpenter Nina (wid H) r 405 Cherokee Carriker W Clayton (Lillian S) h 403 W Atlanta Carroll Lawton P mach Bell Aircraft Corp h 408 Alexander eir Apt 1 Carroll Minnie J (wid A A) r 408 Alexander cir Apt 1 Carrouth Harbyn O (Maude M) 1 barber Lee's Barber Shop h 200 Wayland Carruth Carl R (Jennie F) 4 prod mgr H N DuPre h 207 S Alexander Carruth Henry L (Eliz B) 2 carp h 208 Geo Hamilton ct Apt 3 Carruth R J Good & Bad Lumber (R Jackson Carruth) Atlanta rd RD a Carruth R Jackson (Ruby B) (R J Carruth Good & Bad Lumber) At- lanta rd RD Carsley Norman W (Hazel B) 1 meter reader Ga Power Co h 206 Wayland Apt 10 MARIETTA CITY DIRECTORY 13 Carsley Wm C (Crissie J) h Atlanta rd (FO) Carson Geo (Helen) emp Bell Aircraft Corp h 426 Maple av Carter Anna L (wid A V) 3 Bell Aircraft Corp r 613 Church Carter Calvin slsmn Kaplan's Dept Store Tower rd (Eliz) Carter Calvin W slsmn Kaplan's r Tower rd (Eliz) CARTER CANDY CO, Lonnie E Carter Pres, Monnie Brackett Sec, Manu- facturers of Staple Candies Wholesale, 301 Husk--Tel 1041 (See left bottom' lines) Carter Carlton L (Delia R) h Atlanta rd (FO) Carter Claire R sten County Agent r 413 Polk Carter Clanton emp Geo W Whorton Gro & Mkt r 103 Fort Ant 6 Carter Clara M (wid J W) 1 h Tower rd (Eliz) Carter Clarence G (Hylas D) 2 ofc wkr h 413 Polk Carter Emma Indrs r 518 Lawrence Carter Ernest (Florene R) lab Meinert Florist r 518 Lawrence Carter Ethel B Mrs emp Bell Aircraft Corp r 209 Geo Hamilton ct Apt 4 Carter Florene 2 maid h 204 Rigsby 1 Carter Fred hlpr Brumby Chair Co r 518 Lawrence Carter Glenn J (Helen H) supt Bell Aircraft Corp h 508 Lakewood dr Apt A Carter Harry emp Bell Aircraft Corp r 113 E Anderson Carter Harry lab r 408 Robeson ct Apt 7 Carter Harold G (Geneva W) 3 USA h 110 Shepard Carter J H USA r 103 Fort Carter Jas C (Frances L) 1 rigger Bell Aircraft Corp h 309 Lemon Carter Jos (Mable H) 1 r Miller av (FO) Carter John M USA r 408 Robeson ct Apt 7 CARTER LONNIE E (Grace N) Pres Carter Candy Co Victory Trailer Parks Atlanta rd Carter Louise (Louise Beauty Shoppe) r Atlanta rd (FO) Carter Lula h 211 Greer av Carter Lulla M 1 cook 601 Haynes h 409-a Lemon Carter Lydia ofc wkr h Atlanta rd (FO) Carer M Inez knitter Holeproof Hosiery Co r Tower rd (Eliz) Carter M Kate waitress City Cafe r Tower rd (Eliz) Carthers Mack A (Helen P) 1 USA r 106 Pierce Carter Marion K mldr r 1912 Roswell Carter Mildred tmkpr Bell Aircraft Corp r 607 3d Apt 5 Carter Octave 4 emp Bell Aircraft Corp h 408 Robeson ct Apt 7 Carter Oscar (Sarah C) 4 hlpr Bell Aircraft Corp h 411 Cole Carter Ossie (wid J W) h Atlanta rd (FO) Carter Regina maid McLellan Stores Co r 104 Elk Carter Russell emp Bell Aircraft Corp r 622 Atlanta Carter Seaburn P (Nettie H) 1 millwright h Garrison rd RD 5 Carter Ths (Annie R) 1 lab h 537 Washington av BALDWIN'S 1041 Carter Wm (Clara M) 3 lab h 630 Pine Carter Wm Jr USA r 630 Pine Carter Wm L (Florence C) mldr h 1912 Roswell Carver Millard K (Grace) 1 hlpr L & N RR h Rose la (Eliz) Carver Wm (Olive L) tex wkr r 108 Green Casey Chas R (Mildred S) 1 electn Bell Aircraft Corp h Marble Mill (Eliz) Casey E Charlotte ofc wkr Bell Aircraft Corp r Powder Springs RD 4 Casey Ellison G (Alma M) r 510 Cherokee Casey Hubert P (Estelle S) 2 trk dr Standard Oil Co h Powder Springs RD 4 Casey Jas H (Willie B) pntr h 232 Moores av Casey Julia B (wid Ernest T) gro Powder Springs RD 4 h same Casey Wm T (Vera F) formn W P Stephens Lbr Co r RD 4 Cash Beatrice slswmn MeLellan Stores Co r 200 N Waddell Cash & Carry Grocery No 3 John A Dyar mgr whse 304 Atlanta Cash Lawrence W (Lillie B) 2 jan County Court House h 200 S Waddell Cash R Pauline emp Bell Aircraft Corp r 200 N Waddell Cash Ralph M (Lonette N) 1 guard Bell Aircraft Corp h 413 Maple av Cash Sandy D (Jewel D) 2 emp Bell Aircraft Corp h 806 3d Apt 4 Cason Cora r 102 Gober Cason Louise pairer Holeproof Hosiery Co r Atlanta rd Cason Melinda (wid C E) r 102 Gober Cason Richd H (Lucille H) 2 service eng Int Business Mach Corp h 613 Polk ttt ,, . Casper Geo (Flora) tool mkr Bell Aircraft Corp r 111 W Dixie av Cassel Buren W r 610 1st Apt 3 Cassel Henry V (Bessie S) mach Bell Aircraft Corp h 610 1st Apt 3 Cassel Willis M student r 610 1st Apt 3 Cassidy I V ofc wkr h Austell rd (FO) Cassidy Martha F (wid S E) h Austell rd (FO) Cassidy Ostella r Austell rd (FO) Cassidy Phylia r Austell rd (FO) Cassin Geo E (Edna W) 1 tool wkr Bell Aircraft Corp h 213 Phillips dr Apt A Casteel Bessie (Mrs Frank) r 101 3d ct Apt 4 Casteel Frank (Bessie) 1 emp Bell Aircraft Corp h 101 3d ct Apt 4 Casteel G Felton (Louise N) 2 trk dr Dunn Co h 207 E Hansell Casteel Gordon L (Sara B) 2 dispr Bell Aircraft Corp h 708 4th Apt 4 Casteel J Sanford (Osie G) emp Monto Shaw & Son r 303 S Waddell Casteel Jewell O (Mrs Oscar) emp Bell Aircraft Corp r 238 Club dr Casteel Oscar (Jewell O) 2 guard h 238 Club dr Castile Green B r 114 Moores av Castile Henry E (Amanda S) emp W P Stephens Lbr Co h 732 Kennesaw av MARIETTA CITY DIRECTORY 139 Castile Henry L (Bertie B) sander The McNeel Marble Co r 107 W Dixie av Castile Lillian L ofc sec h 303 E Anderson Castile Mollie R (wid T M) r 303 E Anderson Castile Ray (Lucile G) 1 emp Bell Aircraft Corp r 732 Kennesaw av Castile Thos W (Effie C) 2 mach Bell Aircraft Corp r 303 E Anderson Casto Miriam K (Mrs T J) mach opr Bell Aircraft Corp r 101 3d ct Apt 2 Casto Theodore J (Mirian K) grinder Bell Aircraft Corp h 101 3d ct Apt 2 Caswell Hulett M (Willie C) 3 emp Bell Aircraft Corp h 809 4th Apt 3 Cates Walter F (Sara C) 1 firemn City Fire Dept r 120 Moores av Cates Wm E (Allene C) 2 USN h 142 Hedges Apt 1 Cauitt Marshall W (Ruth R) 2 mach Bell Aircraft Corp h Cogburn av (Eliz) Caylor O Ray (Mabel W) 3 mech Bell Aircraft Corp h Church (Eliz) CENTRAL FIRE STATION Howard Schaeffer, Fire Marshal 210-12 Winters--Tels 1162 and 1163 Ceibles Elmer (Ruby) USA r 1009 Roswell Chadwick Carrie L waitress Stonewell Cafe r Garrison rd RD 5 Chadwick Ernest B (Eliz) 1 uphol J E Wilber h 115 Glover Chaffin Clyde C (Minnes T) 2 guard Bell Aircraft Corp h 813 4th Apt 2 Chaffin Tommie (wid Newton) cook Keith Sch r 305 N Waddell Chalker Amos R Rev (Laura C) h 301 Austin av Chalker Hattie (wid C) h 102 Gober Chalker Jas R ofc wkr r 301 Austin av Chalker Laura M emp Holeproof Hosiery Co r 301 Austin av Chalker Lula (wid J H) h 705 Cherokee Chalker Orlando J (Stella) 1 gro 103 Lemon h same Chalker S C (Faye B) emp Brumby Chair Co h 406 N Waddell Chalker Steph A (Emma P) 1 emp Bell Aircraft Corp h 120 Moores av Chalker Virginia L usher Cobb Theatre r 23 N Park Square Chamberlain Rodrick L phys 120% Lawrence r Atlanta Ga Chambers Barlow A (Maude P) emp Holeproof Hosiery Co h Church (Eliz) Chambers Bartow J USA r Church (Eliz) Chambers Chas A USA r Church (Eliz) Chambers Edna J student r Atlanta rd Apt 104 (FO) Chambers Fain USA r Oak av (FO) Chambers Green (Evelyn S) 2 emp Bell Aircraft Corp h 502 Alexander cir Chambers Henry L (Sallie D) 1 plstr h Oak av (FO) Chambers Hubert J (Cora D) USA r Church (Eliz) Chambers Jas L (Lucile P) 3 emp Bell Aircraft Corp h 206 George Hamilton ct Apt 5 Chambers Lon mgr Morrison Taxi r 215 Powder Springs 140 BALDWINS 1044 Chambers Maude P (Mrs Bartow A) boarder Holeproof Hosiery Co r Church (Eliz) Chambers Pearson del slsmn Wofford Oil Co h Bells Ferry rd (Eliz) Chambers W D (Don Ola S) 1 emp Bell Aircraft Corp r 212 Campbell Hill Chambers Wm Ford (Eliz W) 2 foremn Bell Aircraft Corp h Atlanta rd Apt 104 (FO) Chamblee Lewis E (Estell M) USN r Atlanta rd RD 5 Champion Geo W (Jewell M) emp Brumby Chair Co r 600 Roswell Champion Jewell M (Mrs G W) mgr Marietta Credit Service r 600 Roswell Champion Lewis L (Hettie D) 2 guard Bell Aircraft Corp h Pearl RD 5 Chance Randall L (Willie D) steel wkr r 1916 Roswell Chandler Addie L (wid Berry) r Austell rd (FO) Chandler Alice S (wid T C) r 203 Stewart av Chandler Alvin W USA r 500 Church Apt 1 Chandler Dorrace S ofc wkr Bell Aircraft Corp r 500 Church Apt 1 Chandler Esther lndrs h Canton rd (Eliz) Chandler Fred J (Virginia P) accnt Bell Aircraft Corp h 1418 Victory dr Apt 1 Chandler J B emp Bell Aircraft Corp h 601 Alexander cir Chandler J Raymond (Nina R) eng h 407 Church Apt 2 Chandler Joel W student r 407 Church Chandler L Dean (Edna P) 1 USA h 205 Waddell pi Apt 5 Chandler Lem (Clara M) mgr DuPre Cotton Gin r RD 4 Chandler Loyd B student r 500 Church Apt 1 Chandler Oliver M (Sara T) emp Bell Aircraft Corp h 403' Powder Springs Chandler S Alvin (Wallace I) trav slsmn h 500 Church Apt 1 Chandler Wallace (Mrs S A) slsmn Florence's Inc r 500 Church Apt 1 Chandler Wm D (Ruby) barber Washington Avenue Barber Shop r Ken- nesaw Ga Channell Annie M: (Mrs E G) emp Bell Aircraft Corp r Lindley CHANNELL EDWIN G (Annie M) (Channell Furniture Co) h Lindley RD 4 CHANNELL FURNITURE CO (Edwin G Channell) Furniture, Floor Covering, Stoves, Ranges, 201-203 Powder Springs (See Buyers' Guide) Channell Geo W (Ruth M) dairymn h Whitlock av RD 4 Channell H G (Myrtie A) (Cherokee Certified Service Sta, Channell Ra- diator Shop) r 716 Roswell Channel's Radiator Shop (H G Channell) 400 Cherokee Chapman Birdela (Mrs J H) inspr Holeproof Hosiery Co r Campbell Hill (Eliz) Chapman Buck (Myrtle M) carp h 107 Reynolds Chapman Chesley J (Mattie J) 1 carp r 329 Atlanta Chapman David emp Eason Shoe Shop r 107 Reynolds Chapman Elaine sten r 644 Atlanta Chapman Elliott L (Flora L) civ eng h 1514 Hillside dr MARIETTA CITY DIRECTORY 141 Chapman J C (Grace I) carrier US PO h 644 Atlanta Chapman J Harry (Birdela G) USA h Campbell Hill (Eliz) Chapman Jas (Pearl) 2 h 205 N Alexander Chapman John B emp Bell Aircraft Corp r 1514 Hillside dr Chapman Johnnie (Grace) 1 r 644 Atlanta Chapman Pearl (Mrs Jas) emp Brumby Chair Co r 205 N Alexander Chapman Susan (wid Frank) smstrs r 135 Trammell Chappell Elmo L (Ophelia S) USA r 100 W Dixie av Chappell J C mech Bell Aircraft Corp r 409 Cherokee Charles Myrtle Mrs 2 r Church (Eliz) Chase Rita ofc wkr W P Stephens Lbr Co h 215 Cherokee CHASE THOS L (Eola B) Field Supt Baldwin Directory Co Inc r Hunts- ville, Ala Chastain Arth J (Laura D) emp Brumby Chair Co h Washington av Chastain Clara T (Mrs Clyde) ofc sec Blair & Carmichael r 215 Victory dr Chastain Clyde J (Clara) 2 instr h 215 Victory dr Chastain Jas H (Ivey S) 2 plstr r rear 1120 Powder Springs Chastian John (Agnes T) 2 emp Brumby Chair Co h 108 Park Chatfield Robt E (Myrtle J) 2 emp Bell Aircraft Corp r 501 Washing- ton av Chatman Carl C (Willow V) lab h 518 Lawrence Cheek Danl C USA r 130 Griggs Cheek Ed G (Leila B) formn Brumby Chair Co h 130 Griggs Cheek Ellis M (Lydia) 3 emp Brumby Chair Co h 509 W Hansell Cheek Jas L (Frances R) 1 atndt Hardage Service Sta h 209 Holland Cheek Jas F r 208 Roswell Cheek John USA r 509 W Hansell Cheek Mary J student r 130 Griggs Cheek Wm USA r 509 W Hansell Cheney John P (Maud S) lawyer 102 Atlanta h 1225 Whitlock av Cheney John P Jr USA r 1225 Whitlock av Cherokee Cash Grocery (D Asbury Brown) r 610 Cherokee Cherokee Certified Service Station (H G Channell) 400 Cherokee Cherokee Chapter No. 13 RAM E L Moore sec Meets second Friday 3d fir 209 Atlanta Cherokee Street Lunch (Wm D Marlar) 104 Cherokee Cherry C H (Claudia) 1 emp Bell Aircraft Corp h 610 2d Apt 3 Cherry Jessie E emp Bell Aircraft Corp r 104 Gramling Chester's Cafe (Chester E Cranmer) restr 119 Church Chester Jesse S (Emaline R) r 1912 Roswell Childers Carlo (Hazel) emp Bell Aircraft Corp h Hill RD 5 Childers Delbert O (Cleo F) 1 tool mkr Bell Aircraft Corp h 616 Birney Apt 1 Childress J H Jr (Annie D) 2 ofc wkr h 507 Kennesaw av Childress Susannah E (wid J H) h 507 Kennesaw av 142 BALDWIN'S J 944 Childress Wesley E sten r 507 Kennesaw av Childress Wm E USA r 507 Kennesaw av Chiles Z T Rev (Josephine K) h 228 Johnson Chisholm Eloise (Mrs H A) emp Bell Aircraft Corp r 200 W Lemon Chisholm H Alfred (Eloise) 2 emp Bell Aircraft Corp h 200 W Lemon Chisolm Marilyn ofc wkr r 200 W Lemon Chilton W R (Ila C) 7 welder h Atlanta rd Apt 112 (FO) Chitwood Betty (Mrs R C) slswn Sunlite Bakery r 108 Poplar Chitwood Ernest W (Louise) 3 mech Southland Ice Co h 108 Poplar Chitwood Obra (Mrs R C ) slswn Sunlite Bakery r 108 Poplar Christler Bessie maid r 510 Lemon Apt 6 Christler Bessie cook 207 Freyer dr 510 Lemon Apt 6 Christian Ernest (Pauline) cook 309 Kennesaw av r 112 Montgomery Christian Ernest butler rear 309 Kennesaw av Christian Henry (Patty) 3 lab h 212 Rigsby Christler Serlimer maid 713 Church h 510 Lemon Apt 6 Church of Christ Rev J B Rasbury pastor 405 Roswell Church of God The Rev Henry A Powell pastor 114 Austin av Church of God The Rev Spence pastor North av (Eliz) Church of God in Christ The Rev Geo Braily pastor 210 Mulberry. Church Street Service Station (Mrs Josephine S Bettis) Church (Eliz) Cinderella Shop Mrs Barbara McCollum, Mrs Agnes Walker women's clo 49 W Park Square Cinnimon Chas emp Bell Aircraft Corp r Hill RD 5 City Cafe (Clarence W Pitner) 43 W Park Square City Curb Market (Arvel W Stover) 219 Atlanta Clackum Anna S (Mrs R A) looper Holeproof Hosiery Co r 332 Sessions Clackum Bernice S (Mrs N H) knitter Holeproof Hosiery Co r Nelson Clackum Chas L (Florence C) 1 steel wkr h 124 Moores av Clackum Charlie Jr r Atlanta rd (FO) Clackum D (Mary S) 5 wtchmn h Page Clackum Ernest (Mattie B) 2 h Page Clackum Ernest Jr (Willie B) 1 USN r 215 S Waddell Clackum Esther opr S B T & T Co r Page Clackum Eug E (Ethel S) 2 uphol Mitchell Mfg Co h 133 Durham Clackum Homer (Mary S) pntr h 114 North av (Eliz) Clackum Irene G (Mrs S C) emp Holeproof Hosiery Co r 508 W Hansell Clackum J W (Eunice L) (Marietta Pottery Sales) r RD 4 Clackum Jas W (Eunice L) h Whitlock av extd RD 4 Clackum Jamie trk dr Marietta Coca-Cola Btlg Co Inc r Atlanta rd (FO) Clackum Julia (wid Charlie) riveter Bell Aircraft Corp h Atlanta rd (FO) Clackum L (Maggie C) h Nelson Clackum Nolan H (Bernice S) 3 fixer Holeproof Hosiery Co h Nelson Clackum Nona R (Mrs Wm C) emp Bell Aircraft Corp r 133 Durham MARIETTA CITY DIRECTORY 143 Clackum Richd C (Dora G) emp W P Stephens Lbr Co h Bells Ferry rd (Eliz) Clackum Rosa M (wid W H) 2 h 206 S Waddell Clackum Roy A (Anna S) 2 mech h 332 Sessions Clackum Roy S (Bennie D) emp Clackum's Trans h 500 Powder Springs Clackum Sibley C (Irene G) 3 carp Bell Aircraft Corp h 508 W Hansell Clackum Thos W (Nellie L) 1 emp Clackum's Trans h 800 Roswell CLACKUM W AMOS (Clackum's Transfer) r 206 S Waddell--Tel 79-W Clackum W Clarence (Johnnie H) 1 USN r Atlanta rd (FO) Clackum Wm C (Nona R) r 133 Durham CLACKUM'S TRANSFER (W Amos Clackum) Local and Long Distance Moving, Sand and Gravel Dealers, Packing, Crating and Excavating Contractors, 107 S Waddell--Tels Day 781, Night 79-W (See left bottom lines) Claiborne T Sterling (Dorothy) 2 USA h 204 Seminole dr Clark Alleze emp Nu Way Clnrs & Lndry r Atlanta Ga Clark Beatrice emp Mpnto Shaw & Son r 506 Reynolds Clark C Maynor (Louise) USA h 115 Freyer dr Clark Edw lab Brumby Chair Co h 506 W Goss Clark Edw H (Ruby S) 1 formn Bell Aircraft Corp h 406 Grover Clark Ernest M (Mary P) 2 mech h Rose la (Eliz) Clark Forrest L Jr (Evelyn T) 2 ofc wkr h 205 Waterman Clark Grace M (wid FL) 2 emp Bell Aircraft Corp h 207 Waterman Clark Haywood Jr hlpr Brumby Chair Co h 125 Holiday Clark Ida M maid 1000 Church r RD 2 Clark Louise maid 1224 Whitlock r 506 Reynolds Clark Lucinda lndrs r 506 W Goss Clark Maria r 506 W Goss Clark Marian pkr Carter Candy Co r RD Clark Martha J r Burnap RD 1 Clark Mary lndrs h 210 Montgomery Clark Mattie cook h 910 N Cole Clark Ossie maid 500 Campbell Hill r 108 Holiday Clark Paul B (Easter W) emp Bell Aircraft Corp h Atlanta rd (FO) Clark Paul W (Dorothy M) 1 USA h Atlanta rd (FO) Clark Rebecca emp Nu Way Clnrs & Lndry r 108 Holiday Clark Rebecca emp Nu Way Clnrs & Lndry r 902 N Cole Clark Robt L lab W P Stephens Lbr Co r 609 Fort Clark Ruby M student r 609 Fort Clark Ruth maid r 606 Lawrence Clark Truman B (Joan B) eng Bell Aircraft Corp h 1605 Hillside dr Clark Walter (Lillie P) 1 lab W P Stephens Lbr Co h 609 Fort Clark Warren H official Bell Aircraft Corp h 202 Wright Clark Willie F (Mattie H) 1 emp Bell Aircraft Corp h Allgood rd Clarke Chas E (Natalie M) 2 formn Bell Aircraft Corp h 808 3d Apt 1 144 BALDWIN'S 1944 Clarke Connie (Daisy C) 4 emp Bell Aircraft Corp h Marble Mill (Eliz) Clarke Fay M elk r Marble Mill (Eliz) CLARKE FRED W (Kath) (Marietta Hosiery Co) h 111 Hillside av Clarke J B r Marble Mill (Eliz) Clarke Library Florence W Sibley librarian 400 Church Clay Benj S (Grace T) 2 tool grinder h Atlanta rd (FO) Clay Fannie L Mrs h Hill RD 5 Clay H W (Thelma R) 3 brklyr h Concord rd (FO) Clay Henry D r Hill RD 5 Clay Homer Administration Building cash-bkpr Mrs Daisy Black 204 Way- land Clay Horace B r 505 Lawrence Clay J T farmer r Richardson rd Clay Jesse (Lena) jan Marietta High Sch h 118 Fort Clay Lena lndrs r 118 Fort Clay Ourtress L proofreader Brumby Press Inc r Hill RD 5 Clay Thos USA r Richardson rd (FO) Clay Warner H (Starlena S) h Atlanta rd (FO) Clay Wayman E (Laura M) 1 (Marietta Bargain House) h 301 Butler Clayton Clarence M (Ollie F) 1 emp L & N> RR h Marble Mill (Eliz) Clayton Clarence W emp Holeproof Hosiery Co r Marble Mill (Eliz) Clayton Donald F student r Marble Mill (Eliz) Clayton Emma (wi dF M) looper Holeproof Hosiery Co h 315 Glover Clayton Ernest L (Clyde B) 5 sch tchr h 200 Wayland Apt 6 Clayton Ollie F (Mrs C M) boarder Holeproof Hosiery Co r Marble Mill (Eliz) Clayton Pauline nurse Marietta Hosp r same Cleckler De Forrest (Mary S) 1 mach opr Bell Aircraft Corp h 804 4th Apt 4 Clements Eliz (Mrs Phillip) emp Bell Aircraft Corp r 603 3d Apt 1 Clements Emanuel (Lemma B) USA r 714 Fort Clements Ida 4 lndrs h 221 Johnson Clements Jas J emp Brumby Chair Co h 214 Mulberry Clements Jessie T (Dew Drop Inn) r 106 Montgomery Clements Olivia r 214 Mulberry Clements Paul (Jessie) hlpr Brumby Chair Co h 106 Mulberry Clements Phillip (Eliz) emp Bell Aircraft Corp h 603 3d Apt 1 Clements Virgil (Bonnie) r 310 Harold Cleveland Agnes emp Bell Aircraft Corp r 708 Atlanta Cleveland Frank B (Cleora S) 1 mech r 708 Atlanta Cleveland Mary cook h 321 Lemon Clevenger Clarence (Helen) 1 formn Bell Aircraft Corp h 108 Colonial cir Apt 1 Clevenger Helen (Mrs Clarence) ofc wkr Bell Aircraft Corp r 108 Colonial cir Apt 1 MARIETTA CITY DIRECTORY 145 Clinton Lowell A guard Bell Aircraft Corp r 100 Gramling Clotfelter Chas N (Mary L) sales mgr W P Stephens Lbr Co r 401 Polk Clotfelter Max E (Ida R) 1 elk W P Stephens Lbr Co h 1005 Church Clowdis Alonzo (Rose W) 1 emp Bell Aircraft Corp h 201 Denmeade Clowdis Zetta L student r 201 Denmeade COBB COUNTY CHAMBER OF COMMERCE, LeRoy Brownfield execu- tive sec, 202 Lawrence--Tel 1194 COBB COUNTY COAL CO (Mrs Joe P Legg) Kentucky Coals, "L L" (For- merly sold by Legg Coal Co) and Red Heart, 109 Cleveland av--Tel 529 (See inside margin front Supplement Cover) COBB COUNTY FEDERAL SAVINGS & LOAN ASSN OF MARIETTA, Jas J Daniell Pres, Wm N Stephens V-Pres, P Grover Smith SecTreas, Home Financing, Investments and Mortgage Loans, 100 Cherokee--Tel 83 (See right top lines) Cobb County Marble Co Benj F Boatner genl mgr W Glenn Boatner supt 300 Depot COBB--COUNTY OF COURT HOUSE 7 E Park Square Advisory Board Jas J Daniell, John T LeCroy, Geo H. McMillan, Mem- bers, 1st fir Court House Agent John H Henderson 202 Lawrence Attorney Jas V Carmichael, Blair Bld-g Board of Education T Theo Wills supt 117 Atlanta Board of Health Dr John E Lester dir 117 Washington av CLERK OF COURT, John T LeCroy 1st fir Court House--Tel 91 Commissioner Geo H McMillan 1st fir Court House Coroner John R Williams 1st fir Court House DEPARTMENT OF PUBLIC WELFARE Polly Wellons Director 202 Lawrence--Tel 959 Farm Frank D Hopkins supt Fairground nr Clay Home G Cliff Brooks supt Fairground near Clay Home Demonstration Agent Eliz Wicker 202 Lawrence Jail Hubert L Strickland jailer 119 Washington av ORDINARY Jas J Daniell 1st fir Court House--Tel 126 Police Dept Esmer C Ward chf 1st fir Court House Prison Camp John Hood Fairground nr Clay SHERIFF Jonah F Hicks 1st fir Court House--Tel 92' fax Assessor Edw J Allgood, Wm H Tanner, Augustus P Jones, 1st fir Court House Tax Collector John D Collins 1st fir Court House TAX RECEIVER Helen G Griffin 1st fir Court House--Tel 1017 Treasurer Horace Groover 1st fir Court House Cobb County Rural Electric Membership Corp Carl E Hamby project supt 113-15 Winters Cobb County Selective Service Board IGOVs Whitlock av 146 BALDWIN'S 1944 Cobb County Times J S Harris Editor and Manager 109 Whitiock av Cobb Ernest (Janie K) 1 r 123 Griggs COBB EXCHANGE BANK, Harold 0 Schilling chairman of The Board, Ceph B Galsan Pres, Chas M Brown V-Pres, Wm C Patterson Cash, Olin D Kemp Asst Cash 22 N Park Square--Tels 1100 and 1101 (See inside front supplement cover) Cobb Fannie M (Mrs M V) elk County Board of Education Smyrna, Ga Cobb Janie K (Mrs Ernest) waitress Atherton Drug Co r 123 Griggs Cobb Ovoline S Mrs 1 ofc wkr Bell Aircraft Corp r 307 Powder Springs COBB THEATRE, John L Hooper Mgr, 23/z N Park Sq Coble Freda L (Mrs G M) emp Bell Aircraft Corp r 209 Merritt Apt A Coble Gus M (Freda L) 1 emp Bell Aircraft Corp h 209 Merritt Apt A Cochran Bennie A (Nora A) h Cochran (FO) Cochran Clifton (Edna) 2 emp Bell Aircraft Corp h 206 Wayland Apt 7 Cochran Edna (Mrs Clifton) mach opr Simmons Mattress Co r 206 Wayland Apt 7 Cochran Hoyte J (Jewell J) 1 trk dr h Cherokee rd (Eliz) Cochran Idessa (wid D W) r 204 Maple av Cochran Ivaree emp Bell Aircraft Corp r 308 Washington av Cochran Jennie (Mrs W P) slswn Williams Drug Co r Smyrna Ga Cochran Lee r 109 Forest av Codding Garnett H (Mrs J S) ofc wkr Bell Aircraft Corp r Canton rd (Eliz) Codding John S (Garnett H) ofc wkr Bell Aircraft Corp h Canton rd (Eliz) Coffey G Monroe (Pauline W) 1 guard Bell Aircraft Corp h Rose la (Eliz) Coffey Geo W (Gertrude Z) h 201 Waddell plr Apt 4 Cofer Jas V (Cora H) 3 barber h Atlanta rd (FO) Cogburn E J (Lillie MU) h 401 Cherokee Cogburn Eug D Jessie L) 1 USA r 317 Atlanta Apt 3 Cogburn Minnie D (wid J M) furn rms 308 Washington av h same Cogburn Velma (Mrs J W) tchr Elizabeth Sch r RD 1 Coggins Knox W (Madge C) 3 repr Eason Shoe Shop h 125 Garrison dr Coggins Robt P USN r 106 Vance cir COGGINS ROBT L (Felice B) (Coggins Shoe Store) h 106 Vance Cir Tel 351 COGGINS SHOE STORE (Robt L Coggins) Men's, Women's, and Children's Shoes, 52 S Park Square--Tel 96 (See front supplement cover) Coile Turner F (Helen) pharm Hodges Drug Co h 115 Forest av Coker Thelma ofc sec Bell Aircraft Corp r 408 Lawrence Cole Apartments 501 Church Cole Bayard (Mary S) emp Bell Aircraft Corp h 504 Page Cole Building 44 W Park Square Cofe Constance ofc wkr. Bell Aircraft Corp h 504 Page Cole DeWitt C Jr (Margt B) 2 civ eng Bell Aircraft Corp h 304 Forest av Cole Galia E bkpr Hodges Drug Co r 403 Powder Springs MARIETTA CITY DIRECTORY 147 Cole Ida H (wid H T) h 501 Church Apt 2 Cole John L (Jewell C) 1 emp Federal Communication Comn h 312 Man- get Apt A Cole L Fletcher USA h 511 Washington av Cole Mary S (Mrs Bayard) ofc wkr Bell Aircraft Corp r 504 Page Cole Street Baptist Church Rev M J Jackson pastor 417 Cole Cole Webster D (Carolyn F) h 408 Washington av Coleman Alzia tchr Keith Sch r Marietta Hotel Coleman Carrie M (wid E W) r New Marietta Hotel Coleman Chas (Geraldine) 1 emp Bell Aircraft Corp h 208 Greer av Coleman Claudie M lndrs h Rose la (Eliz) Coleman Clifford (Rushie M) 3 lab h 113 Shepard Coleman Clifford Jr (Willie B) r 113 Shepard Coleman Edw (Irene S) lab r Rose la (Eliz) Coleman Eilene ofc wkr r New Marietta Hotel Coleman Irene S maid r Rose la (Eliz) Coleman Jas Jr porter Strand Theatre r Rose la (Eliz) Coleman Katie r 116 Lakewood av Coleman Marvin H (Jessye) 1 trav slsmn h 808 Church Coleman Nellie cook 203 Seminole dr r rear same Coleman Rushie lndrs r 113 Shepard Coleman Toy L porter Rich & Powell Barber Shop r 113 Shepard Coleman Willie (Evelyn) 3 atndt Hardage Service Sta r 205 Mulberry Coleman Willie B maid r 113 Shepard Colford Pauline waitress Economy Ice Cream Co r Atlanta rd RD 5 Collier Harry O (Mildred B) 3 const wkr h 313 Walthall Collier Wesley cement fnshr Bell Aircraft Corp r 704 Wright Collier Willie C (Joan Y) emp Hanley Funeral Home h 406 W W Lee ct Apt 9 Collins Arth (Louella) plmbr h 638 Pine Collins Carlyss W (Mary L) 1 emp Bell Aircraft Corp h Rose la (Eliz) Collins Dorothy 1 maid r 413 Cole Collins Ellen M (wid J F) 2 tchr Waterman Street Sch h 521 Page Collins Elma T (Mrs LeRoy) mgr War Housing Center r 114 McDonald Collins F Paul (Barbara N) asst mgr Big Star Food Stores h 201 George Hamilton ct Apt 1 Collins Florrie G r 617 Church Collins Hildred H (Mrs W G) riveter Bell Aircraft Corp r 506 Alexander circle Collins Jas R (Agnes B) trav slsmn h 201 Gramling Collins John D (Gypsy L) County Tax Collector h 614 Church COLLINS LEE ROY (Elma T) Cashier The First National Bank h 114 McDonald--Tel 914 Collins Lula h 413 Cole Collins Madge emp Bell Aircraft Corp r 209 Gramling 148 BALDWIN'S 1944 Collins Mary L (Mrs C W) knitter Holeproof Hosiery Co r Rose la (Eliz) Collins Norman H (Jeannette B) 1 slsmn The McNeel Marble Co h 617 Church Apt A Collins Paul (Barbara N) 1 asst supt Big Star Food Stores h 201 George Hamilton ct Apt 1 Collins Ruby emp Bell Aircraft Corp r 221 Powder Springs Collins Wm G (Hildred H) 1 emp Bell Aircraft Corp h 506 Alexander circle Collum Clarence J Rev (Ida P) h 301 E Dixie av Colonial Apartments 504 Church COLONIAL COTTAGE GARDENS (Mrs Howell Trezevant), Florists-- TDS Members, Funeral Designs, Wedding Decorations, Corsages, Cut Flowers, Potted Plants, Greenhouses, 811 Powder Springs--Tel 484 (See Classified Business Card) Colquitt Alfred 0 (Eliz S) brk Sou Ice Sup Co h 126 McDonald Colquitt Hilda ofc wkr r 126 McDonald Colquitt Hugh S USA r 126 McDonald Colquitt Patricia A nurse r 126 McDonald Colquette N E guard Bell Aircraft Corp r 801 Church Colston John F (Martha M) 2 mach r 311 Lawrence Colvir Henry M (Tommie S) 1 emp Bell Aircraft Corp h 316 Aviation rd COMBS GORDON M (Rachel G) lawyer 106 Atlanta--Tel 356 h 511 Church--Tel 690 Combs Gordon M (Rachael G) 1 lawyer r 511 Church Comer G W (Leola H) 1 mach Brumby Chair Co h 133 Lacy Confederate Cemetery Goss cor W Atlanta Conley David K (Barbara A) 1 firemn Bell Aircraft Corp h 603 2d Apt 6 Conley Laraine emp Bell Aircraft Corp r 301 Manget Apt B Conley Porter emp Bell Aircraft Corp r 124 Henderson Connolly D H (Grace B) USA r 514 Church Connolly D H Jr USA r 514 Church Connally Emmett L (Eva E) 3 (Connally Shoe Shop) h 329 Atlanta Connally John M (Nell R) 5 mach Bell Aircraft Corp h 604 2d Apt 2 Connally Shoe Shop (Emmett L Connally) reprs 201 Church Connally Thos W USA r 514 Church Conner Bertie M r 114 Griggs Conner Fuller F (Anna B) 1 civ eng r 201 Waterman Conner Geo W (Louise G) 3 fnshr Brumby Chair Co h Tower rd (Eliz) Conner Harrison (Nellie J) mech Conner's Auto Parts h Atlanta rd Conner Irene elk Bell Aircraft Corp r 806 1st Apt 3 Conner Irene E Mrs 2 h 806 1st Apt 3 Conner J M (Zelphia B) 1 (Conner's Auto Parts) h Atlanta rd Conner Lester E emp Brumby Chair Co h 114 Griggs Conner Margt J (wid Wm H) r 114 Griggs Conner Mattie emp Bell Aircraft Corp r 806 1st Apt 3 marietta city directory 149 Conner Roy G USA r 806 1st Apt 3 Conner's Auto Parts (Jas M Conner) Atlanta rd Connor Kath A (wid T J) h 403 Whitlock av Connon Nellie B (wid G F) r 200 Wayland Apt 8 Conroy John W (Allie) dr NuWay Clnrs & Lndry h 204 Stewart Conroy Virgie L ofc sec r 204 Stewart av Constantine Com gandery No 26 K T E L Moore, Recorder meets every 4th Friday 3d fir 209 Atlanta CONWAY ODENE F MRS 1 Sec-Treas-Mgr Florence's Inc, r 612 Atlanta --Tel 514 Conyers Lorena W sten Cobb County Rural Elec Membership Corp r 321 Lawrence Conyers Mamie G (wid A L) h 321 Lawrence Cook Claude L elk O D Mitchell Gro r RD 2 COOK FRED E (Mary G) Branch Manager Atlanta Gasi Light Co and The Gas Co, h 101 Seminole dr--Tel 721 Cook Horace emp W P Stephens Lbr Co r Church (Eliz) Cook Jas E trkr L & N RR and N C & St L RR h 119 Henderson Cook Lula M cook 513 Kennesaw av r 119 Henderson Cook Minnie maid 310 Roswell r 539 Washington av Cook Moses trkr L & N RR and N C & St L RR r Powder Springs Ga RD 2 Cook Natl (Minnie T) h 539 Washington av Cook Nathl Jr USMC r 539 Washington av Cook O W (Frances C) emp Bell Aircraft Corp r 310 Kennesaw av Cook Robt C (Savannah S) emp Bell Aircraft Corp r 206 Maple Cook Roy (Ruby M) (Pylant & Cook) Dollas rd RD 4 Cook W Paul (Nettie B) 1 USA h 310 Maple av Cooke Kath emp Bell Aircraft Corp h 112 Colonial cir Apt 2 Cooper Glenn (Louise) 2 rigger Bell Aircraft Corp h Hill RD 5 Cooper Jesse C (Bonnie C) 2 patrolmn City Police Dept r 402 Washing- ton av Cooper Lonnie S (Delia R) (Cooper's Gro) h 110 Black Copelan Chas P ofc wkr Bell Aircraft Corp r 401 Atlanta Copelan Edgar P USA r 425 Brook cir Apt 2 Copelan Hettie B (Mrs J D) emp Bell Aircraft Corp r 312 Frasier Copelan John D (Hettie B) formn Bell Aircraft Corp h 312 Frasier Copelan Louis B r 425 Brook cir Apt 2 Cooper's Grocery (Lonnie S. Cooper) 110 Black Copeland Betty J student r 213 Sessions Copeland C D (Clara C) USA r 801 Cherokee Copeland Clara 2 lndrs h 109 Mulberry Copeland Clara C (Mrs C D) opr r 801 Cherokee Copeland Columbus D (Clara C) USA r 801 Cherokee Copeland Downing USA r 213 Sessions --~ " 15b BALDWIN'S 1944 Copeland H A emp Bell Aircraft Corp h 114 Colonial cir Apt 4 Copeland Nannie (wid Wm) r 401 N Waddell Copeland Paul C (Daisy H) 3 projectionist Strand Theatre h 213 Ses- sions Copeland Paul C Jr USA r 213 Sessions Copeland Sara cash Strand Theatre r 213 Sessions Copeland Willie (Bertha M) 7 lab h Allgood rd Coper Cora PI (Mrs J V) cash r Atlanta rd (FO) Coppock Virginia Mrs (Virginia Coppock Studio) r Atlanta Ga Corbin Alice maid 806 1st Apt 5 r same Cordell Blanche T (Mrs Donald E) emp Bell Aircraft Corp r 309(4 Wash- ington av Cordell Christine cook The Liberty Bell Cafe r 108 Lemon Cordell Donald E (Blanche T) r 309(4 Washington av Cordell W Henry (Mary W) 3 watchmn L & N RR h 206 George Hamil- ton ct Apt 7 Cordell John E (Maude T) emp Bell Aircraft Corp h 310 Forest av Cordell Ramond H r 206 George Hamilton ct Apt 7 Cordell Thedus D student r 310 Forest av Corder Alexander (Louise) 2 installer S B T & T Co h 614 Cole Cordle Andrew E (Frances C) emp Bell Aircraft Corp h 607 2d_Apt 6 Corley Annie R (Mrs Aubie) slswn Saul's Dept Store r Hill RD 5 Corley Aubie (Annie Mae R) meat ctr h Hill RD 5 Corley Jas W (Rowena H) tex wkr h 1003 Powder Springs Corley Jas W Jr student r 1003 Powder Springs Corley Thos A student r 1003 Powder Springs Corley Wm H USA r 1003 Powder Springs Corn Ezra (Sarah P) 1 trkr h Joyner av (FO) Corn Hazel B ofc wkr r Joyner av (FO) Corn M Denver USA r Joyner av (FO) Corn M Ruth student r Joyner av (FO) Corn Thos B (Carloine M) h Poplar (FO) Cornett J T (Frances L) 1 dr Safety Cab r 107 Gober Cornette Jas E (Belle) 3 mach Holeproof Hosiery Co h 517 Stewart av CORTELYOU ADRIAN V (Sarah P) 1 V-Pres The First National Bank, h 510 Church--Tel 580 Coryell H G (Ruth W) 1 ins adjuster h 102 Francis av Coryell Ruth (Mrs Howard) sten American Red Cross Cobb County Chapter r 102 Francis av Coryell Ruth W (Mrs H G) ofc wkr Red Cross Chapter r 102 Francis av Cosby Morris F emp Bell Aircraft Corp r 412 Atlanta Cosden Howard F (Johnnie L) USA r 607 2d Apt 4 Cosden Johnnie L (Mrs Howard F) riveter Bell Aircraft Corp i. 607 2d Apt 4 MARIETTA CITY DIRECTORY 151 Cottrell Steve C (Ruby M) 2 pntr h 109 Campbell Hill Cotton Eddie lab Bell Aircraft Corp r 124 Henderson Couch J H (Fannie F) patrolmn City Police Dept h 120 Vance av Couch Malissa maid r 700 Lawrence Couey Malcolm D (Edith G) 1 mech Bell Aircraft Corp h 207 McIntosh av Apt B Courtneay Carlile Jr (Nellie B) 3 inspr Bell Aircraft Corp h 604 2d Apt 5 Covington Aubrey L (May S) constn formn h Atlanta rd Covington Bertha B (wid H M) h 205 Fairground Covington Edw D (Evelyn R) 1 prin Marietta High Sch h 119 Vance cir COWAN AUTO SUPPLY, Rolla N Soper Manager, Goodrich Tires and Batteries, Radios, Bicycles, Rich-Coat Paints and Automobile Parts, 29 N Park Square--Tel 45 (See Buyers' Guide) Cowan Jas R (Virginia L) h 904 Church Cowan Otis A (Willie W) guard Bell Aircraft Corp h 501 Church Apt 10 Cowan Willie G (Mrs O A) slswn Florence's Inc r 501 Church Apt 10 Cowart Carl J (Mary R) millwright Bell Aircraft Corp h 302 South av Cowger Nelson W (Margt L) 1 welder Bell Aircraft Corp h 825 Manget Cox Betty ofc wkr r Marble Mill (Eliz) Cox Buna (Mrs Chas) sten r 113 Forest av Cox Chas (Buna H) dispr N C & St L RR r 113 Forest av Cox Cleveland M (wid W O) (Cox Printing Co) h 405,Washington av Cox Frank (Berta S) electn Bell Aircraft Corp r 105 Forest av Cox Geo E (Lassie S) r 501 Atlanta Cox Geraldine ofc sec W P Stephens Lbr Co r 312 Maple av Cox H Cecil (Gertrude B) 1 ofc wkr Bell Aircraft Corp h 813 1st Apt 1 Cox Herbert A (Alma B) repr Diamond Jewelry Co h 201 E Dixie a' Cox Jerry ofc sec W P Stephens Lbr Co 312 Maple av Cox Jos E USA r 312 Maple av Cox Jos T (Winnie) 1 welder Bell Aircraft Corp r 301 Mill Cox Manley A (Juanita H) 1 emp Atherton Drug Co h 106 Maxwell Cox Martha sten Bell Aircraft Corp r 102 Maple av Cox Printing Co (Mrs Cleveland M and Wm M Cox) 108 Atlanta Cox Raymond H (Emma S) (Cox's Mkt) h 312 Mlaple av Cox Robt B (Margt) 1 elk US PO h 209 Lemon Cox Robt D (Jessie R) opr N C & St L RR h 102 Maple av Cox Ruth bkpr Brumby Chair Co r 312 Maple av Cox Walter N (Ada F) 2 opr N C & St L RR h Marble Mill (Eliz) Cox Walter N Jr USA r Marble Mill (Eliz) Cox Wm M (Lucille E) 3 (Cox Prntg Co) h 204 McDonald Cox Willis R USA r 312 Maple av Cox's Market (Raymond H Cox) gro 109 Powder Springs Coy Jas T Jr (Vida B) 2 emp Bell Aircraft Corp h 237 Hill ct Coyle Clara M (wid C C) h 500 Atlanta 152 BALDWIN'S 1944 Coyle Ernest H (Ethel F) 2 welder Bell Aircraft Corp h 80B 3d Apt 5 Coyle Ralph C (Martha P) USA h 303 Waterman Crabtree Floyd N (Bessie H) 2 formn Bell Aircraft Corp h 801 3d Apt 2 Crabtree John formn Bell Aircraft Corp r 801 3d Apt 2 Craig Jas P (Evelyn B) 2 mech Bell Aircraft Corp h 409 Lakewood dr Apt A Craig Richd N (Gene R) 1 loftsmn Bell Aircraft Corp h 1615 Hillside dr Crain R Spencer (Beatrice H) 2 (Crain's Garage) h Garrison rd RD 5 Crain's Garage (Robt S Crain) 214 Winters Cramer Martha R (Mrs Robt) tchr r 509 Page Cramer Robt (Martha R) 1 USA r 509 Page Cranfill Jesse F (Annie S) 1 carp Bell Aircraft Corp h Cranfill (FO) Cranfill Jesse F Jr student r Cranfill (FO) Cranfill Willie C (Lucille D) 1 mldr h Cochran (FO) Cranmer Chester E (Mary T) 5 (Chester's Cafe) h 535 Page Cranmer Robt C USA r 535 Page Cranmer Wesley E USA r 535 Page Cravin Addie instr Bell Aircraft Corp r 605 Roosevelt cir Apt B Crawford Geo D USA r 107 Fort Apt 5 Crawford Geo W r 311 Fort Crawford Hattie L waitress cafe Perkinson High Sch h 107 Fort Apt 5 Crawford Jas lab Brumby Chair Co r 107 Fort Apt 5 Crawford Josephine h 709 Lawrence Crawford Pauline Mrs sheetmetal wkr Bell Aircraft Corp h 412 Aviation rd Crawford Robt B (Ruth D) 1 elk Standard Oil Co of Ky h 307 S Waddell Apt 8 Crawford Ruby sheetmetal Bell Aircraft Corp r 412 Aviation rd Crawford Ruth D (Mrs Robt B) nurse r 307 S Waddell Apt 8 Crawford Wm (Mary R) 1 jan Brumby Press Inc h 303 Page Creasman Jos doorboy Strand Theatre 204 Geo Hamilton ct Apt Creasman Jos E (Bertha M) 2 guard h 204 Geo Hamilton ct Apt 5 Creasman Jos I student r 204 Geo Hamilton ct Apt 5 CRESCENT FURNITURE CO (Sami A Cannon) 100 Whitlock av--Tel 499 Crider Arry R (Willa K) 2 bus dr County Schools h Barber rd (FO) Crissey Clinton E (Myrtie B) 3 carrier US PO h 505 Washington av Crissey Geraldine r 505 Washington av Crissey Martha D student r 505 Washington av Crist Vernon W (Venella C) 1 mach Bell Aircraft Corp h 1415 Victory dr Apt 2 Cristopher Ida maid r 805 Lawrence Crittenden Cath emp Pilgrim Life & Health Ins Co r 216 Johnson Crittenden Fred recapper McKinney Tire & Battery Service r Campbell Hill (Eliz) Croft Amos (Ila G) hlpr r Jordan RD 1 Croft E S Mrs emp NuJWay Lndry r 506 Powder Springs MARIETTA CITY DIRECTORY 153 Croft Emma emp Holeproof Hosiery Co r Jordan RD 1 Croft Henry 1 pntr h Jordan RD 1 Croft Hubert (Pauline C) 1 pntr r 115 Glover Croft Lina knitter Holeproof Hosiery Co r Burnap RD 1 Croft Liza maid r 303 Montgomery Croft Sarah r 506 Powder Springs Cromer Bel emp Bell Aircraft Corp r 214 Powder Springs Croop R W (Audrey D) 3 emp Bell Aircraft Corp h 603 Page Crosby Virginia V h 507 Cherokee Apt 1 Cross Sherman S (Marian G) 2 eng Bell Aircraft Corp h 309 Walthall Crow Blynn D emp Bell Aircraft Corp r Concord rd Apt 18-a (FO) Crow Robt L (Oba H) r Concord rd Apt 18-a (FO) Crow Trudie C (wid J J) h 220 E Dixie av Crowder Geo T (Rachel H) 2 emp Bell Aircraft Corp h 705 Page Crowder Harry S (Kath G) eng Bell Aircraft Corp h 206 McIntosh av Apt B Crowder Herbert T USA r 303 E Dixie av Crowder Jas H (Elsie) slsmn Stokes & Co r Kennesaw Ga Crowder Judson F (Delie P) carp h 303 E Dixie av Crowe Audrey L (Mrs C F) ofs wkr Bell Aircraft Corp r 210 Campbell Hill Crowe Cecil D trk dr M A Griggs r 106 Covington Crowe Clinton F (Audrey L) 2 guard Bell Aircraft Corp r 210 Campbell Hill Crowe Emma H (Mrs W E) knitter Holeproof Hosiery Co r 200 Merritt Crowe Frank (Josephine) emp The Brumby Chair Co h 408 W Anderson Crowe Jas L (Mary K) h 210 Campbell Hill Crowe Jeanelle student r 200 Merritt Crowe Josephine cook r 408 W Ajiderson Crowe Mattilea N Mrs emp Holeproof Hosiery Co r 500 Powder Springs Crowe Olin ydmn r 210 Campbell Hill Crowe Robt D eng L & N RR r 103 Moon Crowe Wm E (Emma H) 1 emp Bell Aircraft Corp h 200 Merritt Crown Treadwell R Jr (Angela G) 2 supvr Bell Aircraft Corp h 213 Vic- tory dr Crumbley Wm D (Mattie K) foremn Brumby Chair Co h 105 Kennesaw Crumbley Wm D Jr USN r 105 Kennesaw av Crumrine Betty J student r 208 Forest av Crumrine Irving J r 309 Maple av Crumrine John A (Marie) mgr McLellan Stores Co h 208 Forest av Crumrine Marie (Mrs John A) home supvr Federal Security Admn r 208 Forest av Cruse Clyde (Lucile L) formn Bell Aircraft Corp r 330 Atlanta Cruse Lucile L (Mrs Clyde) tchr Waterman Street Sch r 330 Atlanta Culbertson Chas M (Annis R) 2 electn h 508 Lawrence 154 BALDWIN'S 1944 Culley Thos M (Jean M) inspr Bell Aircraft Corp h 515 Vista cir Apt 2 Culver Lewis H (Susie S) 3 guard Bell Aircraft Corp h 714 4th Apt 5 Cumby Grace (Mrs Robt) emp Bell Aircraft Corp r 104 3d ct Apt 3 Cumby Robt (Grace H) 2 emp Bell Aircraft Corp h 104 3d ct Apt 3 Cunningham Lurton H (Alice W) 2 emp Bell Aircraft Corp h 307 S Wad- dell Apt 2 Cunningham Maggie r 208 Kennesaw av Cunningham Mary W r 619 Lawrence Cureton Wm C Jr (Lillian I) 2 eng Bell Aircraft Corp h 203 S Alexander Curney Bessie maid 116 Hillside av r 507 Montgomery Curry Elise maid r Austell rd (FO) Curry Ethel (wid C C) tchr Keith Sch r 113 Forest av Curry John lab h 801 Lawrence Curry Jos (Maggie) 2 ydmn h 112 Curry al Curry Jos H r 112 Curry al Currier Jos W emp Bell Aircraft Corp r 412 Whitlock av Curtis Hannah (Mrs J M) binder Bell Aircraft Corp r 103 3d ct Apt 6 Curtis J M (Hannah) binder Bell Aircraft Corp h 103 3d ct Apt 6 Curtis Richd T (Frances L )2 emp Bell Aircraft Corp h 607 Birney Apt 2 Curtis Wilber (Emma C) 1 emp Bell Aircraft Corp h 305 Frasier Custer Benj L (Marian) 2 designer Holeproof Hosiery Co h Allgood rd Cuthbert Benj (Callie Y) 3 porter Anderson Mtr Co h 326 Lemon Apt 4 Curtis Lamprine (wid M N) 3 (Marietta Cafe; Marietta Liquor Store) h 501 W Atlanta g| XU FIND A NAME YOU MUST II KNOW HOW TO SPELL IT Baffin Edith S Mrs bkpr Stokes & Co r 507 Church Dallas Sami L fnshr Brumby Chair Co h 613 Wright Daniel Addie maid r 228 Johnson Daniel Chas hlpr W P Stephens Lbr Co r 112 Mulberry Daniel Cleveland USN r 112 Coryell Daniel Geo F (Ruth P) 1 emp Bell Aircraft Corp h 103 3d ct Apt 3 Daniel Gussie cook 617 Whitlock av h 410 Reynolds Daniel Homer (Leola J) lab Sou RR Co h 112 Coryell Daniel Jack (Mildred B) 2 hlpr Metallic Casket Co r 513 Lawrence Daniel M Edmond (Clelie K) farmer h Barber rd (FO) Daniel Oscar T (Wilda B) 3 sheet-metal wkr Bell Aircraft Corp h 102 3d ct Apt 2 Daniel Robt ydmn 513 Kennesaw av r 114 Goss Daniel Ruth P (Mrs Geo F) emp Bell Aircraft Corp r 103 3d ct Apt 3 Daniel Wm O (Beulah S) 2 carp h Jordan RD 1 Daniel Willie A (Mrs Wm Q) opr S B T & T Co r Joiner Lake rd MARIETTA CITY DIRECTORY 155 Daniel Willie M 1 h 112 Mulberry Daniell Archer E (Huldah F) farmer h Pearl RD 5 Daniell Barbara student r Joyner Lake rd (FO) Daniell Coree J tool grinder Bell r 125 Hedges Apt 2 Daniell E C (Susie G) 1 mech Bell Aircraft Corp h Pearl RD 5 Daniell Geo E (Lila G) (Daniell Jewelry Store) h 113 Forest av Daniell Hermice student r Joyner Lake rd (FO) DANIELL JAS J (OLIVIA B) County Ordinary Pres Cobb County Fed- eral Savings & Loan Assn of Marietta and member County Advisory Board--h 501 Kennesaw av--Tel 448 Daniell John W (Helen C) 1 mech Bell Aircraft Corp h 125 Hedges Apt 2 Daniell Lila G (Mrs Geo E) music tchr 113 Forest av r same Daniell M Edmond (Clelie K) (Little Rock House) h Barber rd (FO) Daniell Mary E emp Bell Aircraft Corp r 125 Hedges Apt 2 Daniell Mary J ofc wkr r 501 Kennesaw av Daniell Silas N (Louise D) supt Cobb County Water System h Joyner Lake rd (FO) Daniell W Zackrias (Willie D) (W Z Daniell Gro) h Joyner Lake rd (FO) Daniell W Z Grocery (W Z Daniell) Austell rd (FO) Daniell Willie D (Mrs W Z) opr S B T & T Co r Joyner Lake rd (FO) Daniell's Jewelry Store (Geo E Daniell) 48 W Park Square Daniels Albert G (Mary R) 2 .inspr Bell Aircraft Corp h 605 Alexander cir Apt A Daniels Clarence G emp Bell Aircraft Corp r 228 Atlanta Daniels Herbert J (Beatrice P) 1 porter Lee's Barber Shop h 401 W Goss Daniels Hubert H (Wilhelma G) 3 supvr h 405 Park View av Daniels Willie (Beatrice W) lab City Sanitary Dept h 408 W W Lee ct Apt 4 Dansley Mary tchr Perkinson High Sch r 104 Height Dansby Mary tchr r 701 Lawrence Danson Gladys C (Mrs F C) pastor's asst First Presbyterian Ch r Atl lanta rd t Darby Hazel nurse Marietta Hosp r same Darby I A & Co soft drinks 109 Winters Darby I Harold (Sara E) 1 prsmn Brumby Press Inc r 611 Powder Springs Darby Irving J (Hattie S) 1 emp Bell Aircraft Corp h 301 Wright Darby Isaac A (Annie G) (I A Darby Co) h 611 Powder Springs Darby Sara E (Mrs I Harold) bkpr Holeproof Hosiery Co r 611 Powder Springs Darden John W (Mona G) 1 inspr Bell Aircraft Corp h 600 Morningside dr Apt 1 Darnell Florine (Mrs Hardy) ofc wkr Sinclair Refining Co r 602 Atlanta Darnell Geo H (Annie S) 3 formn Bell Aircraft Corp r 215 Clay Darnell H Holbert (Bertha R) 3 inspr h Barber rd (FO) Darnell H Holbert Jr elk Colonial Food Store r Barber rd (FO) 156 BALDWIN'S 1944 Darnell Hardy (Florine W) elk Colonial Food Stores r 602 Atlanta Darnell Isabell C (wid Cicro) r Barber rd (FO) Darnell Jackson L student r Barber rd (FO) Daughtry Geo C (Myrtle D) 1 USA r 611 Lawrence Davenport Arth L (Nell H) 2 plmbr F E A Schilling Inc h 204 Locust Davenport Bernice inspr Bell Aircraft Corp r 511 Lawrence Davenport Clarence E (Alice E) 3 slsmn Marietta Coca-Cola Btlg Co h 115 Moon Davenport Helen M emp Holeproof Hosiery Co r 204 Locust Davenport Hugh E USA r 204 Locust Davenport John meat ctr 0 D Mitchell Gro r RD 1 Davenport John W (Ruth P) 1 plmbr h 210 Glover Davenport Johnie L Mrs 2 emp Bell Aircraft Corp r Marble Mill (Eliz) Davenport Jos (Clotee) farmer h 507 Hunt Davenport Lillian M (wid Clyde) ofc mgr Cobb County Rural Elec Membership Corp h 109 Husk Davenport Louise 7 cafeteria Bell Aircraft Corp h 408 W W Lee ct Apt 6 Davenport Mary (wid A E) r 110 Forest av Davenport Sarah lndrs h 313 E Anderson David Edgar H constn supt r 622 Atlanta David Wm lab r 109 Shepard Davidson Abram W (Kath H) 2 mldr Bell Aircraft Corp h 409 Grover Davidson Dorothy I student r Joyner Lake rd (FO) Davidson Ernest (Willouise W) 3 rnech Bell Aircraft Corp h 623 Birney Apt 1 Davidson Frank K (Gladys N) 4 emp Bell Aircraft Corp h Joyner Lake rd (FO) Davidson Fredk (Gladys C) ins agt r Atlanta rd (FO) Davidson Jas K USN r Joyner Lake rd (FO) DAVIDSON LA Sec-Treas Hanley Co r Atlanta Ga. Davies Evelyn Mrs 1 ofc wkr Bell Aircraft Corp r 300 Manget Apt A Davies Robt (Ann R) USAR r Concord rd Apt 16-b (FO) Davis Albert A elk Railway Exp Agcy r 200 McDonald Davis Alberta C (Mrs H A) emp Bell Aircraft Corp r 802 E Waterman Davis Allen lab h 209 Rigsby Davis Allie B (Mrs M M) looper Holeproof Hosiery Co r Jordan RD 1 Davis Annie P r 215 Reynolds Davis Bertha waitress Skinner's Cafe r 106 E Dixie av Davis Body Shop (Thos L Davis Jr) Powder Springs RD 4 Davis Bonnie M (wid Jas H) r 200 McDonald Davis Chas C (Lillian R) contr h Austell rd (FO) Davis Chas C Jr (Louise H) USA r Austell rd (FO) Davis Clyde W (Mildred J) tool mkr Bell Aircraft Corp h 404 Lakewood dr Apt B Davis Elbert W (Julia J) 1 mech Bell Aircraft Corp h 425 Brook cir Apt 1 MARIETTA CITY DIRECTORY 15 J Davis Ethel r Church (Eliz) Davis Eug lab h 310 E Anderson Davis Eug H bkbndr Superior Prntg Co r 200 McDonald Davis Eunice D Mrs 2 r 202 E Anderson Davis Gay N (Mrs G J) emp Bell Aircraft Corp r 804 4th Apt 1 Davis Gladys M (Mrs H A) emp Bell Aircraft Corp r 202 Camp Davis Gordon J (Gay N) USA h 804 4th Apt 1 Davis Helen (Mrs Wm J) emp Bell Aircraft Corp r 132 Trammell Davis Henry A r 313 Lemon Davis Herman A (Gladys G) USA r 202 Camp Davis Houston (Viola R) 6 mech Bell Aircraft Corp h 212 Glover Davis Hoyle H (Frances A) 3 slsmn r Rose la (Eliz) Davis John r 310 E Anderson Davis'failie J (Mamie H) 1 mech Bell Aircraft Corp h 600 Roosevelt cir Apt A Davis Lola Mrs 1 ofc wkr Holeproof Hosiery Co r 710 Church Davis Lottie emp Bell Aircraft Corp r 112 Colonial cir Apt 3 Davis Lowry W (Frances C) 1 eng Bell Aircraft Corp h 160 W Dixie av Davis Lucille ofc mgr Earl G Medford h 200 McDonald Davis Marjorie cook 415 Gramling r RD 4 Davis Martha (wid J H) r Jordan RD 1 Davis Merdia M (Allie B) 1 emp Bell Aircraft Corp r Jordan RD 1 Davis Rayford G (Ruth T) 1 ofc wkr Bell Aircraft Corp h 118 W Dixie avenue Davis Sami R (Mary M) mech Bell Aircraft Corp h Concord rd Apt 16-b (FO) Davis Thelbert M (Della R) 3 electn h 125 S Alexander Davis Theo emp Bell Aircraft Corp r 215 Reynolds Davis Thos L (Annie) ydmn r 601 Whitlock av Davis Thos L Jr (Lucy B) (Davis Body Shop) h Power Springs RD 4 Davis W H emp Bell Aircraft Corp r 317 E Dixie av Davis Will (Lula S) lab h 507 Lemon Apt 13 Dawson Emma J ofc wkr Bell Aircraft Corp r 210 Sessions Dawson Guy (Kate G) 2 emp Bell Aircraft Corp h 517 Frasier Apt 1 Dawson Ida A (wid J E) h 210 Sessions Dawson Ida R (wid J E) mgr Keith School Lunch Rm h 210 Sessions Dawson Jas P USA r 210 Sessions Dawson Robt L USA r 210 Sessions Day Daisy opr S B T & T Co r Powers Ferry rd Day Jas T (Virginia) slsmn Marietta Hatchery r RD 3 Day K A (Minnie W) 2 guard Bell Aircraft Corp h 801 3d Apt 3 Deal A Boyd (Lois R) 1 cash h Bingham (FO) Deal Edmond (Willie K) 1 elec eng Bell Aircraft Corp r 300 E Dixie av Deal Jewel E student r Cochran (FO) Dean Alice W (Mrs L A) wkh County Dept Public Welfare r Woodstock Ga 158 BALDWIN'S 1944 Dean Lola tchr Keith Sch r Woodstock Ga Dean Lucile Allen (Mrs N C) mgr Allen Drug Co r 1005 Cherokee Dean Wm H (Berta D) ofc wkr Bell Aircraft Corp h 501 Church Apt 4 Dean Wm H Jr USA r 501 Church Apt 4 Dearman Myrtle Mrs r 200 N Waddell Deas Caroline tchr Keith School r 109 Forest av Deaton Forest L millwright Bell Aircraft Corp r 408 Whitlock av De Foe Susie r 115 Maple de Jarnette R Henry (Mary G) 1 USA r 207 N Forest av Deichmann Chas W (Mary M) 3 civ eng Bell Aircraft Corp h 616 E Water- man Apt B DE JARNETTE WM L (Mary L) Sec-Treas Marietta Federal Savings & Loan Association h 207 N Forest av--Tel 612-J Delepree Anderson (Annie W) const wkr r 615 Lawrence Delk Alice lndrs r 509 Hunt Delk Annie cook 818 Church r 227 Montgomery Delk Clarence T (Edna A) barber Atlanta Street Barber Shop h 300 E Dixie av Delk Danl (Margt) 2 r 227 Montgomery Delk Danl r 204 Jones Delk David (Viola J) cook h 110 Johnson Delk Geo cook 918 Church h 227 Montgomery Delk Jas E emp Economy Ice Cream Co r RD 4 Delk Lena R cook r 108 Page Delk Maggie r 300 E Dixie av Delk Robt (Lena B) 9 lab r 108 Page DELK WM S (Dollie H) 3 (Marietta Radio Co) h 205! Waddell pi Apt 10 Delk's Garage (Wiley W Allen) 208 Waverly Way Dembik Danl D (Marie B) formn Bell Aircraft Corp h 418 Aviation rd Denney Iverson (Alma S) 2 mech Bell Aircraft Corp h 610 1st Apt 1 Denney Walton (Mary L) USA r 124 South av Dennis Geo R (Mollie L) inspr Bell Aircraft Corp h 701 3d Apt 5 Dennis Jas (Rose) 1 lab h Canton rd (Eliz) Dennis Rosa maid 208 Session r RD 1 Denson John I (Nancy S) 3 emp Bell Aircraft Corp h 617 Polk Densmore Chester emp Bell Aircraft Corp r 308 Washington av Densmore Darnell (Lizzie) lab h 913 N Cole Depot Susie h 102 Denmeade Derrick Curtis T (Gertrude M) 2 emp Bell Aircraft Corp h 541 McArthur dr Apt B Derick G Robt (Jane R) 1 plant eng Bell Aircraft Corp h 810 4th Apt 4 Devaughn Buford (Lottie M) USA h 504 Lemon Apt 9 Dew Drop Inn (Jessie T Clements) 115 Mulberry Dews Robt P Marion S) 2 emp Bell Aircraft Corp h 606 1st Apt 6 Dial Ellen lndrs h 109 Franklin MARIETTA CITY DIRECTORY 159 Diamond Jewelry Co Alvin B Dodd mgr 23 N Park Square Dice Lester (Rosilee T) 1 USA r 707 N Cole Dickerson Chas B (Voncie C) 1 USA r 303 S Waddell Dickerson Gladston W (Louise P) 2 ofc wkr Bell Aircraft Corp h 108 All- good rd Apt 1 Dickerson Jos E farmer r 1611 Roswell Dickerson Mack (Maggie B) mgr Economy Ice Cream Co h 315 Water- man Dickerson Maggie F (Mrs M C) emp Economy Ice Cream Co r 315 Water- man Dickerson Theodosia D (wid W M) 1 h 1611 Roswell Dickerson Wm I (Tiny G) jan Rickenbacker Aircraft Training Sch h 208 Wayland Apt 7 Dickie Roy N (Eva S) civ eng Bell Aircraft Corp h 209 Victory dr Dickson Chas B (Lillie J) dep County Clerk of Court h Canton rd Dickson Ford (Geneva I) USN h 107 E Hansell Dickson Geneva (Mrs Ford) ofc wkr Big Star Food Stores r 107 E Hansell Dickson Inez slswn Cinderella Shop r 204 Roswell Dickson Jos S (Mary K) 1 slsmn Sears Roebuck & Co h 115 Vance cir Dietrick Beatrice edu dir First Methodist Ch r 302 Lawrence Dietrich Elton A (Nellie M) USA r 316 Washington av Dielschler Edwin (Rosemarie F) 1 formn Bell Aircraft Corp h 1622 Hill- side dr Digby Walter (Alma) 1 emp Bell Aircraft Corp h 401 Lakewood dr Apt A D'igby Will G (Willie) emp Victory Homes of Marietta Inc 307 Fort Digby Wm (Willie) lab h 307 Fort Diggs T Mary r 705 3d Apt 2 Dillard Minnie h 103 Mulberry Dimsdale Ceborn O (Edna C) 2 inspr Bell Aircraft Corp h 700 6th Apt 2 Dingle Alvin A (Sally A) 2 mech Bell Aircraft Corp h 403 Fairground Dinsmore Dorothy V student r 104 Fort Dinsmore Earl (Essie) 1 r 104 Fort Dinsmore Marion L student r 104 Fort Dirper Willie emp Bell Aircraft Corp r 214 Powder Springs Distin Robt G (Jeanie M) 1 asst eng Bell Aircraft Corp h 1607 N Park dr Divine L R (Mary) eng Bell Aircraft Corp h 100 Colonial cir Apt 1 Divine Mary (Mrs L R) nurse Bell Aircraft Corp r 100 Colonial cir Apt 1 Dixie Cafe (Horace B Adams) 30 N Park Square Dixon Eug E (Della M) 1 trk dr Mitchell Furn Co h 201 Waddell pi Apt 3 Dobbins A H Mrs tchr r 104 Forest av DOBBINS ALBERT M (Hattie A) (Albert M Dobbins Funeral Service Home) h 306 Cherokee--Tel 437 DOBBINS ALBERT M FUNERAL SERVICE HOME (Albert M Dobbins) Funeral Directors, Embalmers, Ambulance Service, 306 Cherokee-- Tel 437 (See Back Supplement Cover & Buyers' Guide) 160 BALDWIN'S 1914 Dobbins Albert M Jr (Eliz W) 1 ambulance dr Albert Mi Dobbins Funeral Service Home h 304 Cherokee Apt 2 Dobbins Chas L (Virginia R) USN r 204 Maple av Dobbins Clyde M (Louella R) 1 guard Bell Aircraft Corp h 103 Pomeroy Dobbins Danl (Myrtle D) inspr Bell Aircraft Corp h 118 Frasier Dobbins Eliz S (Mrs Hubert C) knitter Holeproof Hosiery Co r 201 Locust Dobbins Ethel M emp Bell r New Marietta Hotel Dobbins Geo J USA r Rose la (Eliz) Dobbins Geo W (Ephie D) 1 pntr h Rose la (Eliz) Dobbins Harold msng Western Union Teleg Co r 305 Austin av Dobbins Hubert C (Eliz S) fixer Holeproof Hosiery Co h 201 Locust Dobbins J Stanley (Martha O) 1 mech Anderson Motor Co h 1214 Cher- okee Dobbins Jos M (Annie C) atndt Hardage Service Sta r 222 E Dixie av Dobbins Jos M (Mary J) USN h 212 E Dixie av Apt 3 Dobbins Junior (Lucile) 2 emp B A Corp h 208 Wayland Apt 8 Dobbins Lonus C (Emmie W) 3 r 201 Locust Dobbins Louella (Mrs Clyde) opr S B T & T Co r 103 Pomeroy av Dobbins Louise G (wid J S) h 803 Cherokee Dobbins Martha O (Mrs J S) tchr Waterman Street Sch r 1214 Cherokee Dobbins Ruth W (wid H F) 2 sch tchr h 115 Hillside av Dobbins Virginia r Rose la (Eliz) Dobbins Wm M (Myrtle A) h 306 Fairground Dobbins Willie G (Ethel C) h 305 Austin av Dobbins Willie G Jr USN r 305 Austin av Dobbs Allen H USA r Joyner av (FO) Dobbs Bertha G (Mrs Ernest) pairer Holeproof Hosiery Co r Church (Eliz) Dobbs Betty J pairer Holeproof Hosiery Co r Marble Mill (Eliz) Dobbs C M (Henrietta B) lawyer 64 S Park Sq h 824 Church Dobbs Carrie r Joyner av (FO) Dobbs Claude L (Mary M) 3 slsmn h Joyner av (FO) Dobbs Cliff (Odene L) boarder Holeproof Hosiery Co r Marble Mill (Eliz) Dobbs Edw (Estelle B) 2 emp Bell Aircraft Corp h 604 Cole Apt 2 Dobbs Ernest (Bertha G) 2 pntr Bell Aircraft Corp h Church (Eliz) Dobbs Ethel maid h 309 Rigsby Dobbs Evan P (Margt H) h 125 McDonald Dobbs Georgia (wid J R) 1 r 110 North av (Eliz) Dobbs Hal pntr r 209 Roswwell Dobbs Hal D (Junior W) 3 emp The McNeel Marble Co h 207 Roswell Dobbs Hal D Jr int dec r 207 Roswell Dobbs Hattie lndrs h 204 Greer av Dobbs Helen opr S B T & T Co r Joyner av (FO) Dobbs Henry (Beatrice F) 1 cook h 601 Lawrence Dobbs Hoke S (Alma I) 3 emp Brumby Chair Co h 302 Lemon Dobbs Howard r 209 Roswell MARIETTA CITY DIRECTORY 161 Dobbs Hubert r 110 North (Eliz) Dobbs Jas plmbr r 110 North av (Eliz) Dobbs John R h 110 North av (Eliz) Dobbs John W USN r Marble Mill (Eliz) Dobbs Johnnie A (wid W L) h Marble Mill (Eliz) Dobbs Jos S emp Bell Aircraft Corp r 417 Atlanta Dobbs Lelia emp Holeproof Hosiery Co h Rose la (Eliz) Dobbs Lena (wid W P) r 205 Campbell Hill Dobbs Lula r 112 Poplar Dobbs Mary E milliner r Joyner av (FO) Dobbs Mary L nurse r 202 Greer av Dobbs Mattie P uphol Brumby Chair Co r 112 Poplar Dobbs Missouri S (wid Shrim) h Joyner av (FO) Dobbs Olin r 101 Francis av Dobbs Rosmond opr S B T & T Co r Joyner av (FO) Dobbs Robt L Jr USN r 105 Poplar Dobbs Robt L (Cindie R) h 112 Poplar Dobbs Rosamond opr S B T & T Co r Joyner av (FO) Dobbs Ruth W uphol Brumby Chair Co r 112 Poplar Dobbs W Ishmel (Pauline D) 2 emp Bell Aircraft Corp r Barber rd (FO) Dobbs Wade A (Eula A) 4 pntr h 105 Poplar Dobbs Willard P (Bonnie C) 2 emp Bell Aircraft Corp h 205 Radium Dobbs Wm (Dorothy C) USA r 305 N Waddell Dobbs Wm M (Maude J) 2 formn Bell Aircraft Corp h 210 Cold Dobson Ellamae A (Mrs Preston D) looper Holeproof Hosiery Co r Rose la (Eliz) Dobson Geo W (Ruth F) USA r Church (Eliz) Dobson Helen L opr Artistic Beauty Shop r 141 Trammell Dobson J C (Dolly D) mach The McNeel Marble Co h 505 Campbell Hill Dobson Lucille Mrs 1 elk Cherokee Cash Gro r 610 Cherokee Dobson M Inez slswn Marietta Hatchery r 505 Campbell Hill Dobson Margt I bkpr Marietta Hatchery Co r 505 Campbell Hill Dobson Mac W (Mrs Terrell J) tchr Keith Sch r 1321 Trammell Dobson Prestone D (Ellamae A) 3 section hd L & N RR h Rose la (Eliz) Dobson Terrell J (Mae W) carrier US PO r 132 Trammell Dodd Alvin B (Josephine) mgr Diamond Jewelry Co h 117 Hillside av DODD FORMAN B (Margt) 1 Mgr Southern Bell Telephone & Telegraph Co h 116 McDonald--Tel 9080 Dodd Jas C (Mary E) 4 emp Bell Aircraft Corp h 311 Fort Dodd Jewell T sch tchr r 911 Whitlock av Dodd Josephine H (Mrs Alvin B) slswn Diamond Jewelry Co r 117 Hillside av Dodd Lillie B (wid W M) h 911 Whitlock av Dodd Monroe J (Lucinda) h 405 Montgomery 162 BALDWIN'S 1944 Dodgen Irene sch tchr r 209 Freyer dr Dodgen Lucile ofc sec r 209 Freyer dr Donald D F (Clara S) farmer h Joyner av (FO) Donald D G USA r Joyner av (FO) Donald Emmett N USA r Joyner av (FO) Donald Mary J r Joyner av (FO) Donald Wayne student r Joyner av (FO) Donehoo Betty J student r 209 S Waddell Donehoo Clarence A (Pearl B) phys 64 S Park Sq h 209 S Waddell Donehoo Jas A USA r 209 S Waddell Donehue W Clarence (Margt W) 1 del slsmn Gulf Oil Corp r 200 Locust Dooley Grace waitress Dixie Cafe r 405 Haynes Dooley Inman T (Annie S) 1 bkpr Bell Aircraft Corp r 309 Waterman Dore Frances h 604 Lawrence Dorman Sarah E (wid H W) r 1015 Cherokee Dorman Thos P (Dorothea Y) 2 fnshr Bell Aircraft Corp h 809 1st Apt 1 Dorris Clarence porter Sears Roebuck & Co r 911 Lawrence Dorris Helen maid r 215 Rigsby Dorris Idella maid r 911 Lawrence Dorris Jasper porter Sunlite Bakery r 911 Lawrence Dorris Odene maid Holeproof Hosiery Mill r 123 Fort Dorris Rufus atndt Benson Service Sta r 9.11 Lawrence Dorris Wm (Marcella) 1 lab h 214 Greer av Dorris Willie (Idella K) 2 lab Bell Aircraft Corp h 911 Lawrence Dorsey Arline emp Bell Aircraft Corp r 309 Roswell DORSEY JOHN T (Annie C) State Representative, Lawyer, 107 Atan- ta--Tel 532 h 607 Polk--Tel 1118-J Dorsey Vera N (Mrs Ernest H) 2 r 610 2d Apt 5 Doss Arthur W (Morine S) 1 r Ward (Eliz) Doss Carl lab r 905 Lawrence Doss Dovey 1 r 905 Lawrence Doss Guy Jr r Rose la (Eliz) Doss Leroy (Mabel M) 3 emp Bell Aircraft Corp h Rose la (Eliz) Doss Lillie P (wid G E) 2 boarder Holeproof Hosiery Co h Rose la (Eliz) Doss Morine S (Mrs A W) knitter Holeproof Hosiery Co r Ward (Eliz) Doss Octavia r 905 Lawrence Doss Robt D lab r 905 Lawrence Doss Steve lab r 905 Lawrence Doss Walter (Jeannette Q) 1 roofer W P Stephens Lbr Co h Ward (Eliz) Dosser David A USA r 412 Whitlock av Dosser Eliz C sch tchr r 412 Whitlock av Dosser Frank A USN r 412 Whitlock av Dosser Jas H (Eliz) slsmn Holeproof Hosiery Co h 412f W/hitlock av Douthit Geo E (Bernadine A) 2 emp Bell Aircraft Corp h 104 3d ct Apt 2 Douthit R S r 104 3d ct Apt 2 MARIETTA CITY DIRECTORY 163 Dover Andrew A (Brazilia) brkmn N C & St L RR h 421 Atlanta Dover Elsie r 421 Atlanta Dover Gorden L (Eva R) 2 bklyr h Tower rd (Eliz) Dover Mary W (wid T C) r Tower rd (Eliz) Dowda J Wm carp rll9 Gober Dowdy Thos I (Vernie J) 1 const formn r 309 Lemon Dowell Artie r 105 Mulberry Downen David E (Elene F) 2 supvr Bell Aircraft Corp h 327 Aviation rd Downey Lynn C (Winnie R) 1 eng Bell Aircraft Corp h 703 Page Downs Cecelia asst county jhome demonstration agt r 506 Church Dozier Geo L (Annette) 1 slsmn h 100 Wright Drake Evelyn V emp Bell Aircraft Corp r 104 Gramling Drew Minnie maid 317 E Dixie r 121 Grogan Drew Sami D (Minnie) blksmith County Prison Farm h 121 Grogan Driver Wm P (Elsie P) USA h 107 Hedges Driver Elsie P (Mrs W P) ofc sec Marietta Army Air Port r 107 Hedges Drummond Margt M knitter Holeproof Hosiery Co r Rose la (Eliz) Drummond Mary boarder Holeproof Hosiery Co r Rose la (Eliz) Drummond W C (Sallie B) 3 carp h Rose la (Eliz) Dryden Raymond P eng Bell Aircraft Corp r 714 Atlanta Du Berry Inez 4 cafeteria Bell Aircraft Corp h 103 Fort Duble Mary (Mrs Warren C) emp Bell Aircraft Corp r 701 3d Apt 7 Duble Warren C (Mary) formn Bell Aircraft Corp h 701 3d Apt 7 Du Busk Bradford S (Phyllis C) 2 eng Bell Aircraft Corp h 108 Phillips dr Duckett Edna emp Bell Aircraft Corp r 308 Washington av Duckett Frank M (Mae D) wtchmn N C & St L RR r 202 E Anderson Duckett Lorene B ofc sec Glover Mach Wks h 107 Lacy Duckworth Robt K (Ruby P) 1 inspr Bell Aircraft Corp h 101 McIntosh av Apt A Dudley Francis L r 534 Page Dudley Gertrude (wid J B) tchr Keith Sch h 501 Church Apt 3 Dudley John B (Betty S) 1 USN r 301 Lawrence Dudley John I Jr mgr Red & White Service Sta No 4 r Atlanta rd Dudley Marvin mgr Red & White Service Sta No 3 r Atlanta rd Duffey Benj H (Betty P) 1 inspr r 210 Locust Duffey Frank emp Bell Aircraft Corp r 313 Frasier Duggins H E emp Bell Aircraft Corp r 200 Seminole dr Duke Dorothy student r 102 Gober Duke Errol W (Zulu J) 4 trimmer Marietta Glass & Cabinet Co h 608 Cherokee Duke Laura W student r 608 Cherokee Duke Wm G (Norma R) 2 drftsmn Bell Aircraft Corp h 321 Washington av Dukes Jas emp Bell Aircraft Corp r 412 Whitlock av Dulin Harry H (Elvira L) 2 emp Bell Aircraft Corp h 106 Phillips dr Dunaway Wm H (Lenore B) 2 (Hodges Drug Co) h 209 Seminole dr 164 BALDWIN'S 1944 Duncan Earl G (Helen C) 1 emp Bell Aircraft Corp h 407 Haynes DUNCAN HUGH L (Annabell B) Mgr Peerless Furniture Co r Atlanta Ga Duncan Jack USA r 401 Kennesaw av Duncan Jack R emp Cox's Mkr r 213 Locust Duncan Jas (Mary) emp Bell Aircraft Corp r 209 E Dobbs Duncan Lula J (wid G A) I slslady Florence's', Inc h 401 Kennesaw av Duncan Walter G (Lula M) whsemn The Texas Co r RD 4 Duncan Wm M carp r Fair RD 5 Dunlop Tire & Rubber Corp Jos L Strozier mgr 203 Church Dunn Austin (Cora B) lab Brumby Chair Co r 308 Montgomery Dunn Carl (Vella) 1 elk A & P Food Stores h 205 Geo Hamilton! ct Apt 10 Dunn D Albert (Lucille L) 2 constn supvr State Hwy Dept h 219 Gramling Dunn Elmer T (Pauline W) 2 emp Bell Aircraft Corp h 515 W Hansell Dunn Feed & Grocery Co (Fred M Dunn) 203 Cherokee Dunn Fred M (Leila G) (Dunn Feed & Gro Co) h 839 Church Dunn Gladys opr S B T & T Co r 634 Atlanta * Dunn Glen C (Lucile W) 2 emp Bell Aircraft Corp h 521 W Hansell Dunn Howard M USN r 140 Trammell Dunn Howard W (Evalon T) 1 emp Bell Aircraft Corp h 809 4th Apt 6 Dunn Jewell emp Bell Aircraft Corp r 109 Freyer dr Dunn John D USN r 140 Trammell Dunn Lois E elk Bell Aircraft Corp r 140 Trammell Dunn M P r 103 North av (Eliz) Dunn Pauline W (Mrs Elmer T) emp Bell Aircraft Corp r 515 W Hansell Dunn Robt H (Dorothy) 1 bkpr h 305 N Forest av Dunn Virginia looper Holeproof Hosiery Co r 103 North av (Eliz) Dunn W Earl frame hand r Richardson rd (FO) Dunn W M Grocery (W M Dunn) Atlanta rd (FO) Dunn Wm H (Mae B) 2 const wkr h 140 Trammell Dunn Wm M (Cora N) (W M Dunn Gro) h Richardson rd (FO) Dunphey Henry B (Eleanor M) emp Federal Communication Comn h 1236 Whitlock av - Dunson Albert (Emma T) 4 lab Brumby Chair Co h 510 Lemon Apt 4 Dunson Mary L maid r 510 Lemon Dunstan Albert E (Mary O) 6 elec Bell Aircraft Corp h Austell rd (FO) DuPre Cotton Gin Lem Chandler mgr 201 Cleveland av DU PRE H N (Annie M) (DuPre Cotton Gin) Wholesale and Retail Gro- ceries, Feeds, Fertilizer, Work Clothing, Shoes, Agricultural Imple- ments & Supplies, Bicycles, Tire Dealers, Paints, Roofing, Cotton Buy- ers, 110-12 Whitlock av--Tels 700 and 701, h 804 Cherokee--Tel 369 (See right bottom lines) DuPre Harry N Jr (Ruth H) 1 store mgr H N DuPre h 842 Church _ DuPre Lelia B (wid W A) h 415 Whitlock av DuPre Marvin S (Agnes K) carp h 115 Griggs MARIETTA CITY DIRECTORY 165 DuPre R Banks (Mildred S) formn Bell Aircraft Corp h 415 Whitlock av J)uBre T Eug (Johnnie) 1 crane opr Bell Aircraft Corp h 141 Trammell DuPree Lula C (wid V J) 4 h 125 South av DuPree Odene emp Bell Aircraft Corp r 125 South av Durden Roy (Anne); (Sunlite Bakery) r Atlanta Ga Durham Annie: ,1 (wid Max) r 1611 Roswell Durham Bessie maid 4Q0 Campbell Hill h Rose la Durham Chester (Eva M) lab h 208 Rigsby Durham Claudie L US WAVES r 307 Stewart av Durham Doris, ofc wkr r 224 Powder Springs Durham Elmer W (Margt T) pipeftr N C & St L RR h 309 Stewart av Durham Emma ;M maid r 535 Washington av Durham Eva M, maid r 208 Rigsby Durham Fred (Flora A) 2 supt Ga Power Co h Atlanta rd (FO) Durham Glover B (Myrtle G) 2 elk Bell Aircraft Corp h 224 Powder Springs-;:;;:;-;.;;, - Durham Helen student r Atlanta rd (FO) Durham .loon student r 224 Powder Springs Durham Lucile opr S B T & T Co r Woodstock, Ga Durham Mary F see r Atlanta rd (FO) Durham Nancy J student r 1611 Roswell Durham Nathan J (Annie B) farmer h 307 Stewart av Dupham Paul mech Bell Aircraft Corp r Atlanta rd (FO) Dyar Clifford H elk L & N RR and N C St L RR r Atlanta Ga Dyar John A mgr; Cash & Carry Gro No 3 r Atlanta Ga Dyar J Travis (Robbie G) 1 lino Brumby Press Inc h Concord rd Apt 18-a OFO) tevM C. v . ; Dye Arch J (Iowa E) lab h 116 Glover Dye Lloyd M lab r 116 Gloyef Dye V Ruth waitress Bell Aircraft Corp r 116 Glover Dyer Amanda maid 413 Park View av r 515 Fort Dyer Edna R 2 (Edna's Beauty Shop) h 103 Fort Dyer Manda L nurse r 515 Fort Dyer Wallace lab: Brumby Chair Go r 515 Fort Dyson C Gober emp Kennesaw Mountain Natl Park r Powder Springs RD 4 Dyson Clyde M emp Channell Radiator Shop r Powder Springs Dyson Jas L (Lolitella B) USA r 314 Chickopee dr Dyson Lolitella B (Mrs J E) ofc wkr Bell Aircraft Corp r 314 Chickopee dr Dyson Marveen S (Mrs Randolph) designer Meinert Florist r Powder Springs RD 4 Dyson Mary L (wid J C) r 406 Whitlock av Dyson Myrtle C (Mrs V Roy) emp Bell Aircraft Corp r Powder Springs RD 4 Dyson V Randolph (Marveen S) USA r Powder Springs RD 4 Dyson V Roy (Myrtle C) 2 h Powder Springs RD 5 168 BALDWIN'S 1944 E TO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Earle Anna J maid 212 Aviation rd r same Early Annie Kate cook 201 Seminole dr r 206 Etowah dr Eargle Burke E r 123 Trammell Eargle Haskell G student r 123 Trammell Eargle Jos I (Ruth E) 3 h 123 Trammell Eargle Jos I Jr USA r 123 Trammell Eargle Margt R emp Holeproof Hosiery Co r 123 Trammell Earwood Ennis S (Corine R) 2 emp Bell Aircraft Corp h Austell rd (FO) Earwood Harold J (Charlotte M) 1 emp Bell Aircraft Corp h 212 E Dixie av Apt 4 Easley John R (Nealy W) mech Brumby Chair Co/h 110 Lake EASON A HERMAN (Mary D) (Eason Shoe Shop) h 112 Garrison dr-- Tel 911-W Eason Henry (Lillie E) emp H N DuPre h 117 Barnes EASON SHOE SHOP (A Herman Eason) Expert Shoe Repairing, 108 Cherokee (See back supplement cover) Eason Lillie C maid r 117 Barnes East Side Gro (Homer G Mauldin) 305 Cole Eaton Edna ofc wkr r 403 Seminole Eaton Harold (Plassie J) USA r Marble Mill (Eliz) Eaton Jas E USA r 403 Seminole dr Eaton Plassie J (Mrs Harold) elk Marble Inn r Marble Mill (Eliz) Eaton Sarah (wid Julius) r 403 Seminole dr Eaton Wm A (Pearl P) carrier US PO h 403 Seminole dr Eaton Wm A Jr (Evelyn L) 1 USA r 403 Seminole dr Eaton Wm O Jr (Emaline B) USN h Austell rd (FO) Ebener Lewis E (Helen) inspr Marietta Army Air Port h 220 Clay Echols Louise emp Bell Aircraft Corp r 815 E Waterman Echols Mooring J (Ruby W) inspr Bell Aircraft Corp h 413 Atlanta Economy Ice Cream Co No 1 Mack C Dickerson mgr 36 W Park Square Economy Ice Cream Co No 2 Mrs Ruth Fricks mgr 123 Church Economy Ice Cream Co (Buren G Hunt) Atlanta rd Edmundson Bertha Mrs r 118 Henderson Edmondson Charlie tchr Lemon Street Sch r 403 Cole Edmondson Docia (wid Roland B) r 1118 Powder Springs Edmondson Geo E (Lorene K) 1 pipe ftr Bell Aircraft Corp h 504 Manget Apt 1 Edwards Archie B emp Bell Aircraft Corp r 1110 Roswell Edwards C Frank (Lodia B) 1 emp Bell Aircraft Corp h 107 Covington Edwards Callie (wid Frank) boarder Holeproof Hosiery Co r Rose la (Eliz) marietta city directory 167 Edwards Claude C (Josephine L) USA r 142 Trammell Edwards E Eug (Anna Q) mach Bell Aircraft Corp h 526 W Hansell Edwards Ella elk h 404 Cherokee Edwards F Clifton mach opr Bell Aircraft Corp r Rose la (Eliz) Edwards Fuller h Rose la (Eliz) Edwards Jas B (Louise B) 2 emp Bell Aircraft Corp h 158 Hedges Apt 1 Edwards Josephine L (Mrs Claude C) sec U S Selective Service System r 142 Trammell Edwards L R Rev (Bessie W) pastor gioni Baptist Ch h 207 Lemon Edwards Larking B (Era S) emp Bell Aircraft Corp h 804 3d Apt 2 Edwards Robt L (Gladys R) 1 USA h Osborne (FO) Edwards Sarah S Mirs 1 emp Bell Aircraft Corp h 200 Wayland Apt 3 Edwards Thos H (Jeannette V) emp Bell Aircraft Corp r 205 S Waddell Eich Harris W (Mary T) 2 inspr Bell Aircraft Corp h 809 1st Apt 2 Elder Hazel M (wid CD) slswn Earl G Medford h 509 Kennesaw av Elder John H (Carroll) 2 slsmn h 1004 Whitlock av Elder John H Jr USN r 1004 Whitlock av Eldridge Sam M (Pauline B) 1 inspr Bell Aircraft Corp h Concord rd Apt 6-a (FO) Elizabeth Baptist Church Rev H C Moon pastor Church (Eliz) Elizabeth Methodist Church Rev D B Shelnutt pastor Church (Eliz) Elizabeth School C H King prin Canton rd (Eliz) Elliott Ethel maid 622 Atlanta r 619 Lawrence Elliott J Olin emp Bell Aircraft Corp r 105 Moon Elliott John (Sarah) 4 emp Bell Aircraft Corp h 206 Black Elliott Nell inspr Bell Aircraft Corp r 111 Poplar Elliott Paralee F maid Richardson r Richardson rd (FO) Elliott Viola G maid h 122 Holiday Elliott Wm B (Willie H) 1 emp Bell Aircraft Corp h 607 2d Apt 3 Elliott Willie H (Mrs Wm B) elk Bell Aircraft Corp r 607 2d! Apt 3 Ellis Benj (Doris B) USA r 204 Polk Ellis Doris B (Mrs Benj) ofc wkr r 204 Polk Ellis Haughton D (Jewel B) 1 h 515 Stewart av Ellis John B (Vivian G) emp City Disposal Plant h 619 Lawrence Ellis John B Jr lab r 619 Lawrence Ellison Charlotte elk Allen Drug Co r 111 North av (Eliz) Ellison Ella (wid JT) h 500 Kennesaw av Ellison Fannie r 500 Kennesaw av Ellison Jas M (Ruby F) 1 guard Bell Aircraft Corp h 206 Austin av Ellison John S (Sarah B) h 704 Atlanta Ellison Lee elk US PO r 704 Atlanta Ellison Minnie E topper Holeproof Hosiery Co r 704 Atlanta Ellison Walter E (Edna R) 1 granite ctr The McNeel Marble Co h 111 North av (Eliz) Elrod Clifford H (Mary M) 1 hlpr Clackum's Trans r 700 Roswell 16S BALDWIN'S 1944 Elrod J C (Nona) emp DuPre Cotton Gin r RD 4 Elrod J Guy (Emma G) 3 emp Bell Aircraft Corp h 504 W Hansell Elrod Jas R (Mattie P) firmn h Rose la (Eliz) Elrod Mary M (Mrs C H) emp Bell Aircraft Corp r 700 Roswell Elrod Roy L (Edna I) emp The McNeel Marble Co h 115 Moores av Elrod Walter (Martha M) 1 h Bingham (FO) Embry Hallie J (Sara W) 1 formn Bell Aircraft Corp h Church (Eliz) Emerick Jas F emp Bell Aircraft Corp r 411 Church Emery Herbert H (Mary B) 1 firemn Bell Aircraft Corp r Glover nr Fairground Emory Oscar emp Don Ree r RD 4 Emory Oscar T elk r Fair RD 5 English Geo E (Maurene K) 3 loftsmn Bell Aircraft Corp h 512 Lakewood dr Apt B English Murray hlpr Sunlite Bakery r RD 2 (FO) English Thos (Easter M) lab h 205 Rigsby Enslen A F r 808 4th Apt 4 Enslen F T (Hilda) 1 checker Bell Aircraft Corp h 808 4th Apt 4 Ensley Carl emp Bell Aircraft Corp r 608 Cherokee Ensley Opal J student r 410 Powder Springs Entwistle Jas W (Wilson) 4 emp Bell Aircraft Corp h 108 Colonial cir Apt 2 Ephrum Jas dr Safety Cab r Rose la (Eliz) Eppinger Addie h 901 N Cole Erquitt Jas E (Mary L) 1 emp Bell Aircraft Corp h 616 E Waterman Apt A Erwin Dennis L (Jeannette C) 2 emp Bell Aircraft Corp h 802 4th Apt 4 Erwin Jeffie maid r Tower rd (Eliz) Erwin S Ottis (Charlie N) 2 guard Bell Aircraft Corp h 806 3d Apt 3 Eskew Ann E sten Bell Aircraft Corp r 603 Alexander cir Eskew Bryant P (Evelyn L) ofc wkr Bell Aircraft Corp h 604 1st Apt 6 Eskew Walter R (Evelyn C) 2 emp Bell Aircraft Corp h 603 Alexander circle Esmiol Julius M (Edith B) 1 supvr Bell Aircraft Corp1 h 149 W Dixie av Etchison Brooker T (Marian J) 2 emp Brumby Chair Co h 210 Maple Etchison Jas carp r 901 N Cole Etchison Marian maid 403 Kennesaw av r 210 Maple Etheridge Frank (Roxie M) emp Bell Aircraft Corp h Marble Mill (Eliz) Etheridge M Dorris elk W W Mac Co r Marble Mill (Eliz) Etheridge Q Thos emp Model Dry Clnrs r Marble Mill (Eliz) Eubanks Claxton P (Mae E) 2 electn Bell Aircraft Corp h! 710 4th Apt 2 Eubanks Florida C (wid T J) h 125 W Dixie av Eubanks Herbert L r 308 Sessions Eubanks Marion (Irma D) 4 h 308 Sessions Eustace John F (Mary H) 1 inspr Bell Aircraft Corp h 407 Park View av Marietta city directory 163 Evans Annie L maid r 107 Lake Evans Bell (Ethel T) 2 r Rose la (Eliz) Evans Betty S student r Kirkpatrick rd Evans Beulah S (wid I W) r 302 Stewart av Evans Chas emp Brumby Chair Co r 609 Cherokee Evans DC (Carrie) trk dr Ga Coal Co r 311 E Anderson Evans Harold R (Bessie M) 1 emp Brumby Chair Co h 605 Cherokee Evans Harris USA r 107 Radium Evans Hugh T (Dorothy W) 2 emp Bell Aircraft Corp h Darnell rd (FO) Evans Jas H (Rosa M) 4 lab Natl Paper Co h 107 Lake Evans Jas H Jr r 107 Lake Evans John (Jula M) 4 emp Brumby Chair Co h Tower rd (Eliz) Evans Lillie B waitress City Cafe r 204 Roswell Evans Ola Mrs r rear 1120 Powder Springs Evans Robt W (Pollie C) pntr h 205 Waddell pi Apt 6 Evans Rosa M cook Stonewall Cafe r 107 Lake Evans Viola cook r rear 316 Washington av Evans W J (Eva) 2 emp Bell Aircraft Corp h 608 1st Apt 3 Evans W L (Byrdie H) mech Holeproof Hosiery Co h 107 Radium Evans W L Jr emp Marietta Army Air Port r 107 Radium Evans Wm (Viola E) lab h rear 316 Washington av Evans Wm H (Fay D) 3 mach Bell Aircraft Corp h 420 Lakewood dr Apt B Evanston Bradley (Mabel R) 4 lab h 104 Rigsby Evelyn's Beauty Shop (Mrs Evelyn Butler) 55 S Park Square Everett Wm inspr Bell Aircraft Corp r 409 Cherokee Everett Kath (wid Wm) h Hill RD 5 Evergin Dora M r 107 Fort Apt 2 Evergin Grace maid r 406 Robeson ct Apt 3 Evergin Jas F (Grace G) 4 lab Holeproof Hosiery Co h 406 Robeson ct Apt 3 Everhardt Annie K r 109 Elk Everhart Clyde (Irene) emp Bell Aircraft Corp h 811 4th Apt 3 Everhart Irene (Mrs Clyde) emp Bell Aircraft Corp r 811 4th Apt 3 Excelsior Laundry Milo C Jackson mgr 217 Church Ezzell Hugh (Virginia M) 1 eng Bell Aircraft Corp h 411 Fairground FXO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Fagala Sarah (Mrs Eug) sten Southland Ice Co r Calhoun Ga Faidell Blanche D (Mrs J H) slswn American Lndry & Dry Clnrs r 406 Powder Springs Fain Arra M (wwid John) r 409 Powder Springs 170 BALDWIN'S 1944 Fain Frank (Ovelene F) opr L & N RR h 409 Powder Springs Fain Jean student r 409 Powder Springs ; J':. ' Fair Oaks Dairy (J Edw White) Austell rd (FO) Fair Oaks Service Station L Wise Foster mgr Atlanta rd (FO)' Fallis Cecil E (Margt D) asst supt Bell Aircraft Corp h 1603 N Park dr ` Fallis Edw W student r 1603 N Park dr Fambrough Willard D (Wylene G) 1 yd foreran W P Stephens Lbr Co h 205 Waddell pi Apt 9 Farmer Daisy Mrs h 206 Wayland Apt 9 Farmer L Emory USA r Canton rd (Eliz) Farmer Martin C (Johnnie C) 1 drftsmn Bell Aircraft Corp h 102 3d ct Apt 1 Farmer Millard A (Laura K) 3 mach opr Bell Aircraft Corp h Canton rd (Eliz) Farmer T J (Ira G) mech Bell Aircraft Corp h 820 Rose la Farmer Venita emp Marietta Hosiery Co r 206 Wayland Apt 9 Farmer Wm F (Jeannette F) h 400 Maple av Farr Hoyt G Rev (Cath) 1 pastor Roswell Street Baptist Church 2 1504 Roswell Faucett B Irene emp Holeproof Hosiery Co r 607 Atlanta Apt 1 Faucett Chas H (Florence H) 2 mach NC&StLRRh 206 Geo Hamilton ct Apt 3 Faucett Omra L (Eliz H) 1 meat ctr h 607 Atlanta Apt 1 Faudel Dorothy elk U S Selective Service System Local Board No 1 r 306 Cleburne av Faudel Edw C (Willie A) Faudel Lbr Sales 306 Cleburne av h same Faudel Georgette bkpr Atlanta Gas Light Co r 306 Cleburne av Faulkner Harold (Jo) USA r 116 Forest av r , 1 =T Faver Chas M r Richardson rd (FO) Faver Jas D r Richardson rd Favors Andrew h 113 Maple ; Fay Walter D (Gertrude C) 2 accnt h 203 N Forest av I Federal Communication Commission Monitoring Station Powder Springs RD 5 Felder Idus D (Lida L) 1 emp Bell Aircraft Corp h 511 Lakewood dr Apt B Felts Clay H (Eleanor W) 1 eng Bell Aircraft Corp h 309 Grogan Apt A Fennell Grover C (Deborah M) printer Brumby Press Inc h 105-b N Forest avenue Ferguson Herbert (Willie L) 1 asst Hanley Co h 323 Lemon Ferguson J C (Lauris B) USA r 203 Radium Ferguson John (Lemma D) h 315 Page Ferguson John E (Esther D) 1 emp Bell Aircraft Corp h 400 Polk Ferguson Lucy B (wid V W) nurse h 204 Lawrence Ferguson Marie emp Holeproof Hosiery Co r 303 Lemon Ferguson Sarah A ofc sec Bell Aircraft Corp r 204 Lawrence marietta city directory 171 Ferguson Willie cook r 323 Lemon Ferrell Alf (Emma L) 1 USA r 111 Clay Ferrell Fred E (Violet R) 1 formn Bell Aircraft Corp h 404 Alexander cir Apt 1 Ferrell Mitchell (Hattie F) lab Brumby Chair Co h 410 Robeson ct Apt 1 Ferrell Willie H USA r 410 Robeson ct Apt 1 Fid ell Chas E (Evelyn B) USA r 501 Atlanta Field Alice tchr r 302 Lawrence Field Bertha M (wid HA) h 516 Church FIELD D BASSFORD (Isabell D) (Field Furniture Co) h Belk Ferry rd --Tel 1096-R-2 FIELD FURNITURE CO (D Bassford Field) Pabco Floor Coverings and Pabco Rugs, Zenith and Philco Radios, Simmons Springs and Mattresses, Stoves and Ranges, 202 Church--Tel 1010 (See Front Supplement Cover) FIELD HOTEL Jas R Stowe Mgr 200 Church--Tel 9116 Field Mabell Mrs 1 r 1312 Cherokee Ext Fields Annie maid h 120 Holiday Fields Danl E USA r 120 Delk Fields Edw S student r 120 Delk Fields Everette S ofc wkr Bell Aircraft Corp r 317 E Dixie Fields Francis P (Alva F) h 117 Clay Fields Helen maid 1508 Hillside dr r 162 Rigsby Fields Jasper B (Eliz H) 1 pntr h 120 Delk Fields Jasper B Jr emp Bell Aircraft Corp r 120 Delk Fields Jennie C r 616 Atlanta Fields Richd USN r 120 Delk Fields Wm H (Helen M) 2 USA r 108 Black Fincher Lillian emp Holeproof Hosiery Co r 203 Stewart av Fincher Lula M emp Holeproof Hosiery Co h 203 Stewart av Fine Raymond A (Pauline) h 323 Atlanta Finnell Velee emp Bell Aircraft Corp r 308 Washington av FIRST BAPTIST CHURCH, Rev Geo F Brown pastor, Sunday Service 11 a.m. and 8 p. m., 300J Church--Tell 957 (See Buyers' Guide) First Congregational Christian Church Rev J J Hicks pastor 310 Whitlock av FIRST METHODIST CHURCH, Rev Beverly C Gamble Pastor, Sunday Services 11 a. m. and 8 p.m., 200 Atlanta--Tell 503 (See Buyers' Guide) FIRST NATIONAL BANK THE, J Edw Massey Pres, Adrian V Cortelyou V-Pres, Lee Roy Collins Cash, Carl P Barnes, Wm L Beasley and B Bruce Overcash Asst Cash, 50 S Park Square--Tel 210 and 211 (See front Supplement Cover and Buyers' Guide) First Presbyterian Church Rev Alton H Glasure pastor 503 Church nz BALDWIN'S 1944 Fitts John USA r Church (Elwd Fitto Luke W (Myrtle L) 2 repr Eason Shoe Shop h 402 Cherokee Fitts Mark W emp Bell Aircraft Corp r Church (Eliz) Fitts Miles W (Jennie D) h Church (Eliz) Fitts Paul (Myrtle H) emp Railway Exp Agcy r Rose la (Eliz) Fitts Quenton E USA r Church (Eliz) Fitts Seth M (Odelle E) stone ctr The McNeel Marble Co h 320 Powder Springs FitzSimons J Middleton (Howard P) USN r 819 Church FIVE POINT SERVICE, (Frank C Bevers) 111 Roswell--Tel 708 Flanagin Geo W (Ila F) carp h 219 Clay Fleming Audry (Mrs Chas) ofc wkr Holeproof Hosiery Co r 224 Camp- bell Hill Fleming Chas (Audrey) r 224 Campbell Hill Fletcher E Truman (Louise W) 1 (Fletcher Studio & Gift Shop) h 100 Oakmont dr Fletcher Studio & Gift Shop (Truman Fletcher) 107 W Anderson Flood Jas B (Joan B) loftsmn Bell Aircraft Corp h 150 W Dixie av FLORENCE MARY A (wid W A) Pres Florence's Inc h 612 Atlanta --Tel 514 Florence Minnie J (wid T W) h 116 Henderson Florence Wm S (Martha J) 2 mach Bell Aircraft Corp h Henry RD 5 FLORENCE INC, Mrs Mary A Florence Pres, Dan T Manget (Newnan Ga) V-Pres, Mrs Odene F Conway Sec-Treas-Mgr, Ladies' and Children's Apparel and Accessories, Glassware and Gifts, 21 N Park Sq Tels 1012 and 1013 (See back supplement cover and Buyers' Guide) Flowers Eug (Lillian B) 1 USA r Atlanta rd Flowers Lillian B (Mrs Eug) emp Nu-Way Clnrs & Lndry r Atlanta rd Floyd Beni F (Eliz S) 2 (Floyd's Barber Shop) h Concord rd (FO) Floyd Lawrence (Lilar) ydmn h 504 Reynolds Floyd Otis (Emma) 2 tailor Saul's Dept Store h 200 Harold Floyd's Barber Shop (Benj F Floyd) Atlanta rd (FO) Flynn Ada F (wid H C) forwn Holeproof Hosiery Co h 206 Camp Flynn Elsie knitter Holeproof Hosiery Co r Atlanta rd Flynn Mary B (wid J M) emp Holeproof Hosiery Co h 309 Austin av Flynt Jas R (Marjorie L) 2 checker Bell Aircraft Corp h 209 Etowah dr Foley Mattie (wid J D) r 115 Campbell Hill Foley Otis USA r 115 Campbell Hill Folsom Connie C (Lillie M) USA r 102 Henderson Folsom Homer R (Mattie W) emp Chandler Whse h 102 Henderson Folsom Lillie M (Mrs C C) clipper Holeproof Hosiery Co r 102 Henderson Fonda Allan A (Louise) 1 loftsmn Bell Aircraft Corp h 1624 Hillside dr Ford Arnold (Doris K) 3 elk Bell Aircraft Corp h 708 4th Apt 2 Ford Laurie A prin Keith Sch h 109 Forest av MARIETTA CITY DIRECTORY 178 Forehand Gary C (Eunice C) 1 mech Bell Aircraft Corp h 51.4 Roosevelt cir Apt A Forrest Jas (Mina P) emp Bell Aircraft Corp h Hill RD 5 Forrester Jessie (Mrs Ralph) emp Bell Aircraft Corp r 200 Roswell Forrester Ralph (Jessie P) 1 emp Bell Aircraft Corp r 200 .Roswell Forry Wm A (Emma R) 3 mech eng Bell Aircraft Corp h 417 Lakewood dr Apt B Fort Hill Homes Eloise M Wright mgr aid rental ofc 507 Lemon Fortner Earl H (Daisy B) 4 core wkr h 313' Glover Fortner Ellen (wid E L) r Glover nr Fairground Fortner Howard L (Pairlee B) 2 lab h 1920 Roswell Fortner J Frank ofc wkr Bell Aircraft Corp r Atlanta rd (FO) Fortner Jas L (Flora M) h Atlanta rd (FO) Fortson Homer B (Wilma B) 1 mech Bell Aircraft Corp h 400-a W Hansell Foster Barbara L student r 118 Griggs Foster Dallas B (Lucille L) 3 printer Bell Aircraft Corp h 808 1st Apt 2 Foster Ernest O USN r 124 Lacy Foster Irene J (wid Paul) 1 h 115 Reynolds Foster Jas C (Muriel M) 2 welder Bell Aircraft Corp h 309 Park View av Foster Jas C r 504 Powder Springs Foster John H (Arlie M) emp City Water & Light Dept h 216 Maple Foster John LI USA r 124 Lacy Foster L Montgomery (Mae W) firemn Bell Aircraft Corp h Henry RD 5 Foster L Wise (Lettie R) mgr Fair Oaks Service Sta h Joyner Lake ' rd (FO) Foster Mae W (Mrs L M) nurse r Henry RD 5 Foster Marie ofc wkr Bell Aircraft Corp r 115 Reynolds Foster Ralph O Jr r Joyner av (FO) Foster Ralph O (Florence S) h Joyner av (FO) Foster Nancy D (wid J Z) h 208 Kennesaw av Foster Robt F (Lula N) emp Holeproof Hosiery Co r 124 Lacy Foster Wm K (Comerdele S) 4 tractor opr W L Florence Const Co h 118 Griggs Fountain Essie S (Mrs C R) ofc sec W P Stephens Lbr Co 206 Seminole dr Foust Lewis B (Barbara S) 3 mach Bell Aircraft Corp h 609 2d Apt 4 FOWLER A HERBERT (F Luvie) 3 Physician Marietta Hospital Bldg-- 206-210 Cherokee--Tel 217 h 1110 Cherokee--Tel 644 Fowler A Sylvester (Fowler's Place) h 121 Holiday Fowler Arth W elk Channell Furniture Co r Canton Ga Fowler Bert USA r Bells Ferry rd (Eliz) Fowler Beulah M r 121 Holiday Fowler Dallas E (Rubye T) 1 USA r Nelson Fowler Gladys (Mrs Porter E) slswn Kaplan's Dept Store r 213 Holland 174 BALDWIN'S 1944 FOWLER J M CO (Jas M Fowler, J M Fowler Jr, Paul F Meeks, Wm W Watkins III, J G Smith, Hugh D Anderson, Mrs Eliz Bayless and Ray Hill Cotton Brokers 108 Powder Springs--Tel 93 FOWLER JAS M (Fay L) (J M Fowler Co) h 12:1' Forest av--Tel 445 FOWLER J M JR (Ellen D) 3 (J M Fowler Co) h 500 Campbell Hill Tel 718 Fowler J Robt Jr (Marie B) emp Bell Aircraft Corp h Church (Eliz) Fowler Jesse L (Eula B) h 612 Church Fowler John R (Emma L) pres Peoples Loan & Finance Corp h Church (Eliz) Fowler Luvie B (Mrs A H) ofc wkr Marietta Hosp r 1110 Cherokee Fowler Mamie H (wid L W) r 202 Gramling FOWLER MARIE B (Mrs J R Jr) Sec-Treas Brumby Furniture Co r Church (Eliz)--Tel 386-J Fowler Marjorie L student r 121 Holiday Fowler Porter E (Gladys) 1 formn Brumby Chair Co h 213 Holland FOWLER RALPH W (Irma D) Physician Marietta Hospital Bldg, 206-210 Cherokee--Tel 246 h 303 McDonald--Tel 429 Fowler Ralph W Jr student r 303 McDonald Fowler Rubye T (Mrs D E) emp Bell Aircraft Corp h Nelson Fowler W H (Helen C) 1 emp Bell Aircraft Corp h 811 4th Apt 1 Fowler's Place (A Sylvester Fowler) restr 110 Lawrence Fox Jeanne expediter Bell Aircraft Corp h 705 3d Apt 2 Fox Vernon C (Agnes) accnt Bell Aircraft Corp h 1605 N Park dr Fraidy Weldon (Thelma) 1 emp Bell Aircraft Corp h Atlanta rd (FO) Franklin Azlee (wid Alonzo) r 208 Locust FRANKLIN B HAROLD (Hazel C) J W Franklin & Sons) h RD 3 FRANKLIN BARNEY E (Effie B) (J W Franklin & Sons) h RD 3 Franklin Clara r 613 2d Apt 2 Franklin Elridge H (Avis S) 1 mach Bell Aircraft Corp h 806 4th Apt 4 FRANKLIN LAMAR H (LeVert W) 1 (H) (J W Franklin & Sons) h RD 3 FRANKLIN J W & SONS (B Harold, Barney E, Lamar H and Mrs W J Franklin) Brick and Pottery Manufacturers, Wholesale and Retail Dealers, 1 Mile off New Atlanta hwy, RD 3--Tel 43 (See Buyers' Guide) Franklin Lee F (Dorothy H) sch tchr h 507 Whitlock av Apt 10 Franklin Thos lab r 224 Johnson FRANKLIN W J MRS (J W Franklin & Sons) h RD 3 Fraps Edw P (Nettie E) chem Bell Aircraft Corp h 322 Park View av Fraser Benj H (Mattie D) 3 h Burnap RD 1 Fraser Benson (Grace B) dr Safety Cab Inc h 118 North av (Eliz) Fraser Grace B (Mrs B) boarder Holeproof Hosiery Co r 118 North av (Eliz) Frasier John B (Linda C) 1 emp Bell Aircraft Corp h 301 Manget Apt 3 Fraser J Hubert (Lillie N) 2 electn h 504 Powder Springs marietta city directory 175 Frasier Oscar (Elsie) helpr Bell Aircraft Corp r 619 Mulberry Frasier Wilce W (Mazie) 1 (Happy's Service Sta) h 209 E Goss Frasure Cliff (Mamie M) atndt Marble Inn h Marble Mill (Eliz) Frasure Dorothy student r Campbell Hill (Eliz) Frasure Hunter (Minnie L) USA h 304 Stewart av Frasure J D USA r Campbell Hill (Eliz) Frasure J H (Lillie E) 5 formn h Campbell Hill (Eliz) Frasure John L (Pearl W) 2 h 223 Rose la Frasure Pearl W (Mrs John L) pairer Holeproof Hosiery Co r 223 Rose la Frasure Sarah opr S B T & T Co r Campbell Hill (Eliz) Frasure Sue emp Bell Aircraft Corp r 206 Camp Frazier Chas Jr (Jessie H) 3 mech h 107 Holiday Frazier Eliz maid r 507 Lemon Apt 11 Frazier Forest B (Evelyn M) electn City Board of Lights & Water Wks r 400 Whitlock av Frazier Jessie H smstrs r 107 Holiday Frazier Ruth maid 319 Campbell Hill 410 Lee ct Apt 6 Frederick Walter G (Emma H) 2 mech Holeproof Hosiery Co h 525 Stewart av Free Eva E (wid G H) pairer Marietta Hosiery Co r 400-b W Hansell Free Governor r 100 Roswell Free L Paul stone etr Marietta Marble & Stone Wks r 208 Goss Free Wm G elk Miller's Inc h 400-b W Hansell Freeland Jos B mech Bell Aircraft Corp r Cherokee rd (Eliz) Freeman Annie cook r 206 Montgomery Freeman Benj F (Bonnie) cond Ga Power Co r 320 Powder Springs Freeman Cicero (Laura M) 3 knitter Holeproof Hosiery Co h 1124 Powder Springs Freeman Corine emp Bell Aircraft Corp r 113 Forest av Freeman Flora M knitter Holeproof Hosiery Co r Powder Springs RD 4 Freeman Forrest (Nettie S) tex wkr r Rose la (Eliz) Freeman G R (Frances) 2 welder Bell Aircraft Corp h 608 2d Apt 2 Freeman Garfield (Annie) lab Brumby Chair Co r 206 Montgomery Freeman Geo emp Bell Aircraft Corp r 214 Powder Springs Freeman Geo W (Mildred H) 2 gauge grinder Bell Aircraft Corp h 603 2d Apt 1 Freeman Guy H (Flora C) 1 emp Bell Aircraft Corp h Jordan RD 1 Freeman Henry (Effie R) lab Brumby Chair Co h 111 Elk Freeman J Edwin (Martha) 2 ofc wkr Bell Aircraft Corp h 401 Park View av Freeman Jas guard Bell Aircraft Corp r Atlanta rd (FO) Freeman John (Minnie T) 2 h Powder Springs RD 4 Freeman John (Ida N) 1 h Burnap RD 1 Freeman Lucile maid 417 Whitlock av r same 176 BALDWIN'S 1911 Freeman Margaret S maid r 702 Lawrence Freeman Noah T (Inez S) 2 tractor dr Bell Aircraft Corp r Burnap RD 1 Freeman Oscar (Lillian J) 4 tr dr Glover Machine Wks h 410 W An- derson Freeman Ralph Rev (Emmajean M) 1 h 504 Lemon Apt 3 Fremming Geo J (Marian L) 1 emp Bell Aircraft Corp h 324 Aviation rd Frey Jas M USN r 200 S Anderson Frey John S (Lena L) 2 (J S Frey Gro) h 1311 Roswell Frey J S Grocery (J S Frey) 32 N Park Square Frey Josie B (wid B T) h 506 Lawrence Frey Marvin (Hettie C) 1 elk Sears Roebuck & Co h Canton rd (Eliz) Frey Meyes C (Nobia R) ofc wkr Bell Aircraft Corp h 200 S Alexander Frey Nellie emp Excelsior Lndry r 120 South av Frey Noah S (Edna C) 1 restr 200) Mills h 120 South av Frey Nobia R (Mrs Mayes C) wkr County Dept Public Welfare 200 S Alexander Frey Paul USA r Canton rd (Eliz) Frey Raymond r Canton rd (Eliz) Frey Ruth lndry wkr r 120 South av Frey Venia (wid J D) r Canton rd (Eliz) Fricks Hoyt (Ruth C) 2 guard Bell Aircraft Corp h 616 Cherokee Fricks John H (Margt) 4 emp Bell Aircraft Corp h 408 Aviation rd Fricks Ruth C (Mrs H W) br mgr Economy Ice Cream Co r 616 Cherokee Fridell Blanche (Mrs Jesse) emp American Lndry r 406 Powder Springs Fridell Evelyn B (Mrs Chas E) emp Sears Roebuck & Co r 501 Atlanta Fridell Jesse (Blanche) mech Atlanta Gas Light Co h 406 Powder Springs Fridell John W Jr USA r 501 Atlanta Fridell Mary (wid John W) r 501 Atlanta Frier Clyde E (Josephine H) 1 emp Bell Aircraft Corp h 131 Moores av Fulcher Diana student r 601 Polk Fulcher Eliz M Mrs nurse State Dept Pub Health r 601 Polk Fuller Alma (Mrs C) r 116 Henderson Fuller Bessie M maid r 715 Lawrence Fuller C Watson (Gladys T) 1 eng Bell Aircraft Corp h 407 Church Apt 3 Fuller Chas (Alma R) 1 r 116 Henderson Fuller Cora B (wid Fred S) h 304 Kennesaw av Fuller Fletcher ^Bessie M) mech Bell Aircraft Corp h 715 Lawrence Fuller Goldie C (wid F B) slswn r 304 Kennesaw av Fuller Pauline cook 602 Atlanta r rear same Fuller Robt (Pauline) porter Sinclair Refining Co r rear 602 Atlanta Furbinger Victor (Mildred H) 2 emp Bell Aircraft Corp h 313 Frasier Furr Effie L (wid Lou) r 313 Lemon Furr J Roy (Carrie L) 1 firemn City Fire Dept h 122 Griggs"^ Fuss Hampton E (Evelyn D) 2 eng Bell Aircraft Corp h 410 Grover MARIETTA CITY DIRECTORY 117 Fuster Edgar (Leila S) emp Bell Aircraft Corp h 200 Black Fuster Hubert USA r 511 Lemon Fuster Willie M 1 h 511 Lemon Apt 8 Futch Wm A (Thelma) 2 emp Bell Aircrapt Corp h 239 Hill ct Gto find a name you must KNOW HOW TO SPELL IT Gable Carolyn S (Mrs Dewey) nurse Bell Aircraft Corp r 202 S Alexander Gable Dewey Jr student r 202 S Alexander Gable Laura C (Mrs W D) slswn Florence's Inc r 310 Powder Springs Gable M Dewey (Carolyn S) 2 dep County Sheriff h 202 S Alexander Gable Walter D (Laura C) elk Rich's Inc h 310 Powder Springs Gabriel Dorothy L emp Bell Aircraft Corp r 1611 Park dr Gabriel Frank M (Nannie M) 1 formn Bell Aircraft Corp h 1611 N Park dr Gabriel Frank Jr student r 1611 N Park dr Gaines Helen H (Mrs J A) tchr Waterman Sch r 411 Cherokee Gaines Jas W (Mattie D) farmer h 1607 Roswell Gaines Joe A (Celia C) 6 lab h 115 Covington av Gaines Jos A (Helen) elk Dunn Feed & Gro Co r 411 Cherokee Gaines Justin N (Jessie B) 3 mach r 1607 Roswell Gaines Mattie D (Mrs J W) nurse r 1607 Roswell Gaines Sami A (Sara S) emp Bell Aircraft Corp h 707 3d Apt 6 Gallagher Robt C emp Bell Aircraft Corp r 620 Bimey Apt 1 Gallant Augustus A (Eliz L) 3 emp Holeproof Hosiery Co h 208 George Hamilton ct Apt 4 Gallant Annie B (Mrs Smith) emp Holeproof Hosiery Co r 200 George Hamilton ct Apt 7 Gallant Eliz L (Mrs A A) emp Holeproof Hosiery Co r 208| Geo Hamilton ct Apt 4 Gallant Eston L projectionist Strand Theatre 200 Geo Hamilton ct Apt 7 Gallant Smith (Annie B) emp Holeproof Hosiery Co h 200 George Ham- ilton ct Apt 7 Gallaway Doyle emp Bell Aircraft Corp r 417 Atlanta Galley Nannie M (wid T J) furn rms 511 Church h same Galoway Doyl H (Delma P) 1 emp Bell Aircraft Corp h 617 Momingside dr Apt 1 Galt Georgia L cash Cobb Theatre r 300 Cherokee Galt Gertrude (wid J H) h 309 Washington av Galt Lou (wid J E) h 300 Cherokee Galyon Paul G (Mildred M) 2 emp Bell Aircraft Corp h 124 Garrison dr Gambert Jos L (Kath M) emp Bell Aircraft Corp h 809f Frasier GAMBLE BEVERLY C REV (Jessica A) Pastor First Methodist Church h 210 Atlanta--Tel 207 178 BALDWIN'S 1944 Gamble Jean M student r 210 Atlanta Gamble Mary E student r 210 Atlanta Gamble Wm W USA r 210 Atlanta Gann Gordon B (Lillian W) lawyer 10814 Washington av h 813 Church Gann Lillian W (Mrs G B) hostess Mayes Ward & Co r 813 Church: Gantt Carl E (Bertha B) 3 store mgr h Austell rd (FO) Gantt Geo W (Edith S) 1 ofc wkr Bell Aircraft Corp h 100 Chickasaw dr Gantt Jesse N (Mary L) h 401 Maple av Gantt Mary A (wid Geo) r 205 Lawrence - Gantt Stanley N USA r 401 Maple av Gantt Steven E USN r Austell rd (FO) Gantt Walter C (Nellie A) 3 welder Bell Aircraft Corp h 405 Frasier Apt 1 Garber C Leighton (Eleanor L) USA h 523 Vista cir Apt 1 Gardner Eve portrait pntr 507 Cherokee r same Gardner Walter B (Emma B) emp Bell Aircraft Corp h 407 Church Apt 4 Garland Darrell asst mgr Spur Distributing Corp r RD 3 A 1 . . Garner Appliance Co (Lee Garner) 114 Cherokee Garner Harry E (Norma M) 2 mach Glover Mach Wks h 117 Garrison dr Garner Hattie W cook 120 Wright r 316 McDonald Garner Henry (Hattie W) h 316 McDonald Garner Hugh R emp American Lndry r 119 Moon Garner J John (Mae A) 3 plmbr h 119 Moon Garner John E USN r 119 Moon Garner J Sam (Alma S) wtchmn Brumby Chair Co h 226 Brumby; ; . Garner Lee (Ruth) 2 (Garner Appliance Co) h 301 Gramling Garner Sarah r 301 Gramling Garner Wm N lab h 502 W Goss Garret Artie h 105 Mulberry Garrett Artie D cook 200 Birney Apt 4 105 Mulberry Garrett Betty opr S B T & T Co, r 412 Atlanta Garrett Cap (Bessie) farmer r rear 1214 Whitlock Garrett Geo (Eva B) 3 emp Brumby Chair Co h 108 Elk Garrett Hoyt H (Gladys S) 1 emp Bell Aircraft Corp h 105 Stewart av Garrett Jas L USN r 313 Maple av Garrett Lacy M (Kath I) slsmn Kaplan's Dept Store h 405 Haynes Garrett Marjorie opr SBT&TCorlll Glover Garrett Paul USA r 105 Mulberry Garrett Sarah P Mrs 1 r 313 Maple av Garrett Will (Sovilla M) lab Meinert Florist r 313 Fort Garrett Willie (Edith) 7 trk dr Southland Ice Co h 130 Mulberry Garrett Will M (Sovilla) emp Meinert Florist h 313 Fort Garris Eliz emp S B T & T Co r 412 Atlanta Garris Geo W (Waveney W) 2 emp Bell Aircraft Corp r 412 Atlanta Garris John D (Eliz W) h 412 Atlanta Garrison Ruth V opr Western Union Teleg Co r 215 E Dixie av marietta city directory 179 / Garrison Sami J (Evelyn N) 2 h 219 E Dixie av Garrison W Ewell (Ellen L) 1 formn h Austell rd (FO) Garrison Wade J (Sallie L) r Austell rd (FO) Gary Claude W (Edith B) safety eng Bell Aircraft Corp h 317 Aviation rd Gary Maude L ofc wkr Bell Aircraft Corp r 515 Whitlock av GAS CO THE, Fred E Cook Branch Mgr, 109 Church--Tels 200 and 201 Gasaway Edna checker A & P Food Stores r RD 3 Gasaway Louise elk A & P Food Stores r RD 3 Gatewood Peyton C (Alberta W) elk W P Stephens Lbr Co h 102 Locust Gatlin Herman L (Louise G) 2 mech r 212 Sessions Gatlin Julian L pumper N C & St L RR r 104 Mooni Gatlin Lorene ofc wkr Ga State Hwy Dept r 1110 Church Gatlin Louise G (Mrs H L) emp Bell Aircraft Corp r 212 Sessions Gatlin Otie K (wid MR) smstrs h 1110 Church Gattie Wm J (Grace J) mech Bell Aircraft Corp r 610 Birney Apt 1 Gattis Geo A (Mary I) mgr B N Auto Parts Co r RD 2 Gaughan Thos C (Leah C) 1 USA h 610 Morningside dr Apt 2 Gault Claude (Lena D) 1 (Gault Tourist Homes & Dormitory) r Cherokee rd (Eliz) Gault Claude A USN r Cherokee rd (Eliz) Gault Tourist Homes & Dormitory (Claude and Lena Gault) Cherokee rd (Eliz) Gaultney Harley H (Mary M) 4 inspr Bell Aircraft Corp h 806 1st Apt 5 Gautz N F emp Bell Aircraft Corp r 411 Church Gavin Edw M (Mary B) 1 USA h 801 Rose la Gay Rich B (Lonnie C) lab Bell Aircraft Corp h 507 Lemon Apt 11 Gay Robt C (Sylena) 2 lab Bell Aircraft Corp h 504 Montgomery Gazaway Clifford B (Violet M) 1 mach Bell Aircraft Corp h 809 4th Apt 1 Gentry G Howard USA r 413 Roswell Gentry Geo H USA r 413 Roswell Gentry Geo M (Lucy C) (Mitchell & Gentry) h 413 Roswell Gentry Harry L emp Bell Aircraft Corp r 306 Washington av Gentry Jane L US WAVES r 413 Roswell Gentry Jas A (Flonnie S) 3 h 111 Pierce Gentry Kenneth (Angie) mech Bell Aircraft Corp h 804 3d Apt 1 Gentry Leone S slswn Miller's Inc r 413 Roswell Gentry Louise slswn Miller's Inc r 413 Roswell Gentry Mamie V r 413 Roswell Gentry Mary L student r 413 Roswell Gentry Wm W (Mary W) eng Bell Aircraft Corp h 603 2d Apt 4 George Hill B route mn American Lndry & Dry Clnrs r 216 Winters George Tyler 4 dr Safety Cab Inc r Jordan RD 1 George W Elmer (Ella G) 1 dist repre Atlanta Gas Light Co h 706 Church GEORGIA COAL CO (Luther L Groover) Retail Coal Dealers, Jellico Coal, 119 Butler--Tel 8 (See Buyers' Guide) 180 BALDWIN'S 1041 Georgia Produce Company (Kingsley E Miller) 114 Washington av GEORGIA--STATE OF Highway Department W W Phillips resident eng llO1/-* Washington av Department of Public Welfare District No 7 Mrs Jeannette P Gregory supvr 202 Lawrence Home Guard Armory 210 Winters Home Guard Office, Capt S' A Chandler, 202 Lawrence German Chas emp Bell Aircraft Corp r Atlanta rd German Poley J (Millanse T) 4 welder Bell Aircraft Corp h 803 4th Apt 5 Gestford Dee J (Jessie M) USA r 131 Durham Gholston Sami (Thenie W) lab Bell Aircraft Corp h 104 Shepard Gibson Carl J (Myrtle V) 2 eng Bell Aircraft Corp h 500 Stokes av Apt A Gibson Clarence E (Irma C) 2 emp Bell Aircraft Corp h 612 2d Apt 6 Gibson Fred W (Dorothy L) emp Bell Aircraft Corp r Campbell Hill (Eliz) Gibson Grocery (Mrs Mary L Gibson) h 212 Sessions Gibson Henry S (Leslie H) emp Bell Aircraft Corp r 612 Cherokee Gibson Irma C (Mrs C E) emp Bell Aircraft Corp r 612 2d Apt 6 Gibson K P (Thelma P) 1 constn wkr r 300 Roswell Gibson Leslie H( Mrs H S) emp Bell Aircraft1 Corp r 612 Cherokee : Gibson Mary cook r 912 N Cole * Gibson Mary L (wid GW) (Gibson Gro) h 212 Sessions Gibson Morris emp Bell Aircraft Corp r 412 Whitlock av Gibson N Louise student r 523 Page Gibson N Morris (Ethel J) 3 mech Bell Aircraft Corp h 1509 Hillside dr Gibson Roy (Eliz D) 5 emp W P Stephens Lbr Co h 523 Page Gibson Thos (Mary) carp h 912 N Cole Gidish Geo C cigar mkr Marietta Cigar Factory h 400 N Waddell Gifford Eug (Willie K) electn City Board of Light & Water Wks h 207*4 Sessions Gifford Jas E (Martha K) h 300 Maple av Gifford Richd Q (Mary L) 1 slsmn Johnny Walker Inc h 806 E Waterman Gifford Willie G (Mrs Eug) dentist r 207*4 Sessions Gilbert Annie elk r New Marietta Hotel Gilbert Leon A (Martha L) mgr Peters Street Ofc Fulton Natl Bk h 115 Wright Gilbert Wesly (Willie) lab h 207 Rigsby Gilham Lee (Effie D) barber Atlanta Street Barber Shop h 113 Alexander Gilham Lucile opr S B T & T Co r 202 Camp Gilham Pearl A (wid O A) h 202 Camp Gilham Tresa E (wid P C) r 114 Hillside av Gill Ernest S (Iona) 1 ofc wkr Bell Aircraft Corp h 168 W Dixie av Gill John P r 314 Chickopee dr Gill Nathl G (Doris M) 1 asst supt Bell Aircraft Corp h 159 Hedges Apt 2 MARIETTA CITY DIRECTORY 181 Gillam Roney N (Annie C) emp Brumby Chair Co h 716% Roswell Gillard John J porter r 106 Page Gillean J W (Lillie M) 1 mech Bell Aircraft Corp h 705 3d Apt 6 Gillean Jas W emp Bell Aircraft Corp r 412 Whitlock av Gillean L Edw (Ruby M) 3 mech Bell' Aircraft Corp h 208 Aviation rd Gillean Lois E emp Bell Aircraft Corp r 412 Whitlock av Gillenwater J Richd (Irene P) brklyr h 326 Austin av Gilley Etta Z r 815 4th Apt 5 Gilley Mattie H r 815 4th Apt 5 Gilley Tybee (Estelle) 2 emp Bell Aircraft Corp h 815 4th Apt 5 Gillham R Lee (Effie D) barber h 113 S Alexander Gillham Roy L (Vivian H) 1 mech Bell Aircraft Corp r 113 S' Alexander Gilmer Edw C (Frances M) 2 loftsmn Bell. Aircraft Corp h 305 South av Apt 2 Gilstrap Geo W (Willie B) 2 guard Bell Aircraft Corp h 605 3d Apt 5 Girton Verne (May) Marietta Journal h 413 Grover Glasure Alton H Rev (Jean C) 2 pastor First Presbyterian Ch h 606 Church Glenn Earl Rebecca L) inspr Bell Aircraft Corp h 1418 Victory dr Apt 2 Glenn Frank barber Lawrence Street Barber Shop r 120 Henderson Glenn Rebecca (Mrs Earl) elk Bell Aircraft Corp r 1418 Victory dr Apt 2 Gloer Gussie L elk Big Star Food Stores r 208 Geo Hamilton ct Apt 1 Gloer M Rosa Mrs slswn McLellan Stores Co h 208 Geo Hamilton ct Apt 1 Glover Aimee L (wid J W) pres Glover Mach Wks h 620 Whitlock av Glover Camp No 1245 WOW Chas H Hicks Sec meets first and third Wed- nesday ;3{I fir 209 Atlanta Glover Dave (Katie B) 5 lab h 109 Holiday Glover Henry L (Ella D) 1 porter Hodges Drug Co h 507 Lemon Apt 14 Glover Jas B (Prilla R) 4 USA r 620 Whitlock av t Glover J Bol^n IH (Prilla R) 3 sec-genl mgr Glover Mach Wks r 620 Whit- lock av Glover Machine Works Mrs Aimee L Glover pres, Geo V Welsh V-pres, J Bolan Glover III sec-genl mgr, Walter E Jervey Jr treas-asst sec fndry Butler nr Glover Glover Park E Park Square cor Atlanta Glover Wm G (Maxie R) 1 emp Bell Aircraft Corp h 813 4th Apt 1 Gloyd Josephine Mrs r 200 Allgood Apt 1 Gober A Eliz drftsmn r 1109 Powder Springs Gober Alice ofc wkr h 312 Washington Gober Annie L cook 325 Atlanta 224 Montgomery Gober Cleo maid 111 Francis av 223 Montgomery Gober Ella r 209 Mulberry Gober Ellen ofc wkr r 515 Cherokee Gober Gladys ofc wkr r 312 Washington av Gober Jos (Minnie) 3 emp The McNeel Marble Co h 204 Mulberry 183 BALDWIN'S 1944 Gober Katie h 225 Montgomery Gober Leola r 209 Mulberry Gober Levi (Leola) lab h 209 Mulberry Gober Magdlene maid 908 Church r 217 Montgomery Gober Milton (Stella H) 4 trk dr Southland Ice Co h 505 Hunt Gober Nellie smstrs Walter W Hazel r 217 Montgomery Gober Roy (Annie) porter Florence's Inc h 224 Montgomery Gober Roy Jr ydmn 612 Atlanta r 224 Montgomery Gober W Mayes (Grace M) phys 220 Church h 1109 Powder Springs Gober W Mayes Jr student r 1109 Powder Springs Goddard Raymond H (Jo R) 3 (Safety Cab Inc) h 111 Hedges Apt 2 Godwin Thos (Edna W) 2 emp Bell Aircraft Corp h 815 1st Apt 2 Godwin Virginia forwn Marietta Hosiery Co r Atlanta Ga Goebel Warren P (Eliz L) 2 ofc wkr Bell Aircraft Corp h 311 Walthall Goetz John A (Helen H) emp Bell Aircraft Corp h 1514 Roswell Goggins Frank A (May G) guard Bell Aircraft Corp h Kirkpatrick rd Goggins May G (Mrs Frank A) smstrs Owenby Mfg Co r Kirkpatrick rd Golden Ethel A (Mrs Jos E) elk Bell Aircraft Corp r Atlanta rd Golden Jas M mech Bell Aircraft Corp r 607 3d Apt 2 Golden Jas E (Ethel A) 2 carp r Atlanta rd Golden Walter B (Jewel R) 2 mech Bell Aircraft Corp h 607 3d Apt 2 Goldstein Herbert S USN r 111 E Anderson Goldstein Jos (Dorothy G) 1 (Mill End Store) h 201 Waddell pi Apt 10 Goldstein Jos J (Estelle G) (Marietta Bowling Alley) r 119 E Anderson Goldstein Phillip (Rose S) 1 dry goods 15 E Park Sq h 119 E Anderson Goldstein Sarah F slswn Phillip Goldstein r 119 E Anderson Goldwasser Mollie (Mrs Murray) asst mgr Murray's Fashion Shop r 403 Washington av Goldwasser Murray (Mollie R) 1 (Murray Fashion Shop) h 403 Wash- ington av GOLSAN CEPH B (Helen D) Pres Cobb Exchange Bk r McDonough, Ga Gonia Isaac B (Dorothy B) supvr Bell Aircraft Corp h 404 Aviation rd Goocher E J emp Bell Aircraft Corp r 412 Whitlock av Gooden Melvin C (Irma E) 2 mech Bell Aircraft Corp h 906 3d Apt 4 Goodman Eliz B (wid R B) elk The First Natl Bk r 102 Kennesaw Goodman Wm A (Virginia S) h 208 McDonald Goodson Clarence TI (Corinne) 1 aud h 403 Kennesaw av Goodson Roy USN r Austell rd (FO) Goodson W M sch tchr r RD 5 Goodson Wallace E (Mary R) 1 emp Bell Aircraft Corp h 500 Church Apt 4 Goodson Willie M tchr Robt L Osborne Sch r Barber rd (FO) Goodson Wm Leroy (Betty O) USN r 200 Geo Hamilton ct Apt 4 Goodspeed Merle W (Hellen F) 2 emp Bell Aircraft Corp h 159 W Dixie av Goodwin Chas (Naomi) 1 USA r 201 W Lemon MARIETTA CITY DIRECTORY 183 Goodwin Harold M (Susie H) 2 slsmn Earl G Medford h 405i/2 Cherokee Goodwin Schuyler J (Gusta M) jan Court House h 212 E Dixie av Apt 1 Goolsby Annie W opr Goolsby Barber & Beauty Shop r 108 Rigsby Goolsby H Jefferson (Annie W) 1 (Goolsby Barber & Beauty Shop) 108 Rigsby h same Goosby Emmie tch Perkinson High Sch r Lawrence Gordon Lizzie cook h 215 Greer av Gordy Beulah B (wid 0 T) 2 h 207 Goss Gordy Geo M lab r 207 Goss Gordy Pearl (wid A L) r 202 Radium Gore John L (Juanita H) 4 supt Bell Aircraft Corp h 1517 N Park dr Goss Andrew (Willie C) 2 emp Bell Aircraft Corp h Burnap RD 1 Goss Andrew J (Georgia P) (Polk Street Market) h 200 Polk Goss Duncan S (Stella E) 1 tool designer Bell Aircraft Corp h Concord rd Apt 18-b (FO) Goss Frank C (Ruby D) 8 carp W P Stephens Lbr Co h Osborne (FO) Goss Grady r Burnap RD 1 Goss Grady N greaser Gulf Service Sta r Austell Ga RD 1 Goss Marshall M (Lura B) carp h Oak av (FO) Goss Phillip W (Marie S) 0 emp Bell Aircraft Corp h 815 4th Apt 2 Gossett Farris M (Mary T) 1 emp Bell Aircraft Corp h Barber rd (FO) Gott Ruth (Mrs J E)f technician Cecil D Strait h 216 Atlanta st Gouge Horace E (Ada H) USA r 505l/2 Powder Springs Gowder Floyd C USA r 206 Geo Hamilton ct Apt 4 Gowder Floyd R (Lorene W) 1 sheetmetal wkr h 206 Geo Hamilton ct Apt 4 Gowder Hoyt L emp r 206 Geo Hamilton ct Apt 4 Gowder Hugh O USN r 206 Geo Hamilton ct Apt 4 Grady Robt L (Cath J) 1 trk dr Southland Ice Co h 406 W W Lee ct Apt 2 Graham Dorris B (Mrs Leon) emp Marietta Hosiery Co r Rose la (Eliz) Graham E C (Inez) 2 emp Bell Aircraft Corp h Austell rd (FO) Graham Leon (Dorris B) elk W P Stephens Lbr Co h Rose la (Eliz) Graham Martha (wid W A) h Marr (Eliz) Graham Wm G (Bettie H) USN r 111 Stewart av Graham Willis (Narcisse) h 317 Page Grant Eliz Indrs r 113 Maple Grant Lawrence (Lelah J) mach opr Bell Aircraft Corp r 817 Manget Grant Lelah J (Mrs Lawrence) emp Bell Aircraft Corp r 817 Manget Grant Mary 1 cook h 606 Lawrence Grand Shop The (Albert Roth) 58 S Park Square Grant W W (Mattie T) genl mgr W P Stephens Lbr Co h Church (Eliz) Grant W W Jr USN r Church (Eliz) Grantham Mildred B (Mrs R A) inspr Bell Aircraft Corp r 806 3d Apt 2 184 BALDWIN'S 1944 Grantham Robt A (Mildred B) 3 checker Bell Aircraft Corp h 806 3d Apt 2 Gravel Evelyn r 109 S Alexander Gravel Herbert L (Viola G) 2 trk dr Bell Aircraft Corp h Jordan RD 1 Graves Annie H nurse r 503 Lemon Apt 1 Graves Osborne (Cornelia R) trk dr The McNeel Marble Co h 202 John- son Graves Uhlancl B (Annie H) USA r 503 Lemon Apt 1 Gravley Jas F (Annie B) 1 emp Bell Aircraft Corp h Atlanta rd Gray Claude B USN r 407 Fairground Gray Edw (Ruby) 1 ship elk Bell Aircraft Corp h 703 3d Apt 5 Gray Elia A (Eunice B) (Marietta Shoe Shop) h 201 Lawrence Gray Homer C USMC r 407 Fairground Gray Jas A (Leona L) emp Bell Aircraft Corp h 407 Fairground Gray Leona L (Mrs J A) emp Bell Aircraft Corp r 407 Fairground Gray Minnie S (wid Robt) r 206 Lemon Gray W Ross (Glenna B) 1 loftsmn Bell Aircraft Corp h 314 Aviation rd Green Anna maid 225 Rose la 202 Holland Green Austin (Cora) (Green's Barber Shop) h 106 Elk Green Cora maid 835 Church r 106 Johnson Green Florence (wid I G) r 301 Polk Green Fredk (Emma) 4 emp Brumby Chair Co h 207 Mulberry Green Howell P (Maude A) 3 eng N C & St L RR h 409 Wright Green Ina C (Mrs W O) mgr The Hosiery Shop 202 Holland Green Jas H USA r 117 Moon Green John (Marilyn H) USA r 104 3d ct Apt 5 Green John N emp Bell Aircraft Corp/ r 714 Atlanta Green Lee B (Bessie H) 1 h 117 Moon Green Lemma G Mrs 2 h 1809 Roswell Green Mary r 206 Church Green Ralph M (Ruth C) 5 emp Bell Aircraft Corp r 1805 Roswell Green Richd W emp W P Stephens Lbr Co h 301 Polk Green Sami Jr (Juanita H) emp Bell Aircraft Corp h 402 Aviation rd Green Vera (Mrs L B) checker A & P Food Stores r 117 Moon Green Wm O (Ina C) 1 h 202 Holland Green's Barber Shop (Austin Green) 305 Hunt Greene J L (Julia) 1 inspr Bell Aircraft Cor$ h 701 3d Apt 8 Greene Thos E (Vivian M) 2 mach Bell Aircraft Corp h 807 4th Apt 5 Greer C B lab Marietta Trans & Salvage Co r 307 Wright Greer C B (Julia F) 1 lab r 507 Wright Greer Edna B (wid B V) h 311 Washington av Greer Ernest J (Ruby M) 1 electn Bell Aircraft Corp h Atlanta rd Greer Eva J (Ethel K) 1 carp W P Stephens Lbr Co h 127 Trammell Greer Jas C (Lena N) USN r 205 Maple av Greer L Kath ofc wkr Bell Aircraft Corp r 127 Trammell Greer Lee A checker Holeproof Hosiery Co r Atlanta Apt 211 (FO) MARIETTA CITY DIRECTORY 185 Greer Olin T USN r Atlanta rd Apt 211 (FO) Greer Thos C Rev (Ona J) h 221 E Dixie av Greer Thos G (Essie Lee M); 2 mach Bell Aircraft Corp h Atlanta rd Apt 211 (FO) Greer Woodrow lab Marietta Trans & Salvage r 124 Henderson Greenway Dallas (Bessie S) 3 boarder Holeproof Hosiery Co r 103 Locust Greenway Dorothy E ofc wkr Holeproof Hosiery Co r 103 Locust Greenway Harold r 511 W Hanseil Greenway Homer C (Lena) 1 boarder Holeproof Hosiery Co h 511 W Hanseil Greenway Jessie L opr Rose Beauty Shop r 118 Moon Greenway Lawson B (Nannie S) stone ctr The McNeel Marble Co h 118 Moon Greenway Rebecca L (wid M V) h 207 Wayland Apt 7 Greenway Reed B (Edith G) 2 mach h 110 Poplar Gregg Adeline C (wid I L) 2 r 500 Atlanta Gregg Howard (Ethel) 3 lab Brumby Chair Co h 205 Montgomery Gregg John M (Ethel A) millwright Brumby Chair Co h 107 Poplar Gregory Annie maid r 801 Lawrence Gregory Ethel r 820 Rose la Gregory Jeannette P (Mrs Paul) field rep State Dept Public Welfare r 201 Freyer dr Gregory Lena h 320 Lemon Gregory Paul A (Jeannette) ins solr h 201 Freyer dr Gregory Paul A Jr (Ada) 1 USA r 201 Freyer dr Gregory Pomeroy USA r 201 Freyer dr Gregory Talmadge (Georgia R) lab Brumby Chair Co h 408 Robeson ct Apt 8 Gresham Annie cook 114 McDonald h 204 Jones Gresham Carrie 2 Indrs r 806 N Cole Gresham Chas (Bessie C) 4 porter Brumby Chair Co h 700 Lawrence Gresham Chas H (Julia F) USA r Marble Mill (Eliz) Gresham Clarence student r 310 W Goss Gresham Clemmon emp Bell Aircraft Corp r 310 Frasier Gresham Florene maid r 700 Lawrence Gresham Fredk (Louise) 1 emp Brumby Chair Co h 507 W Goss Gresham Jas (Ada P) 1 emp Brumby Chair Co h 316 Lemon Gresham Janie Indrs h 911 N Cole Gresham John lab r 508 W Goss Gresham Martha (wid Jas P) r 504 W Hanseil Gresham Nancy 1 maid h 310 W Goss Gresham Newt F (Mary C> 2 lab Bell Aircraft Corp h 406 Robeson ct Apt 8 Gresham Oliver C (Edna C) porter Allen Drug Co h 710 Lawrence Gresham Sara elk Bell Aircraft Corp r 113 Phillips dr 186 BALDWIN'S 1944 Gresham Sarah nurse r 310 W Goss GREYHOUND BUS STATION H B Allen agt 118 Atlanta--Tel 900 Griffin Donald A (Irene L) eng Bell Aircraft Corp h 157 W Dixie av Griffin Edw C (Mickey H) USA r 120 Kings ct Apt A Griffin Ernest W (Gertrude G) 2 hlpr h 128 Kirkpatrick rd Griffin Geneva B waitress Chester's Cafe r 128 Kirkpatrick rd RD 4 Griffin Geo A USA r 330 Atlanta Griffin Gertrude G (Mrs E.W) uphol r 128 Kirkpatrick rd Griffin Helen B (wid G A) h 330 Atlanta GRIFFIN HELEN C, County Tax Receiver r 330 Atlanta--Tel 125-W Griffin Lloyd H (Evelyn F) 2 guard Bell Aircraft Corp h 423 Park View av Griffin Mary opr S B T & T Co r 206 Lemon Griffin Mary D Mrs h 128 Kirkpatrick rd Griffin Robt B (Robbie P) med dir State Dept Public Health h 504 Church Apt 2 Griffis Geo P (Betty A) 1 USA h 410 Park View av Griffith Clara P (Mrs Eug E) emp Bell Aircraft Corp r 604 Haynes Griffith Eug E (Clara P 2 pntr h 604 Haynes GRIGGS HAROLD P (Sara F) 1 Chief City Police Dept, City Marshall and Supt City Sanitary Dept h 325 Atlanta--Tel 473 Griggs J Arth (Disser S) h Hill RD 5 Griggs Lillian ofc wkr Bell Aircraft Corp r 214 Powder Springs Griggs Lucille bkpr Martin A Griggs r 107 Church Griggs Martin A (Alda) gro 107 Church h 214 Powder Springs Grimes Edna G (Mrs Newt) slswn The Grand Shop r 700 Roswell Grimes NewTt (Edna G) lab r 700 Roswell Grimes Wm (Loulett) emp Bell Aircraft Corp h 305 Harold Grindle Ella (wid J T) r Campbell Hill (Eliz) Grindle Jewel emp Bell Aircraft Corp r 209 Cleveland av Grisholm Gilbert lab Bell Aircraft Corp r 704 Wright Grisholm John lab Bell Aircraft Corp r 704 Wright Grizzle Cora (wid A W) r 615 Cherokee Grizzle J Leon (Emma L W) 3 repr Channell's Radiator Shop h 615 Cherokee Grogan Ada emp Strand Theatre r 201 Franklin Grogan Adelaide maid Strand Theatre r 201 Franklin Grogan Clarence lab Brumby Fum Co r 107 Fort Apt 6 Grogan Cora h 409 Lemon Grogan Edw (Dida J) lab Brumby Chair Co h 107 Fort Apt 6 Grogan Edw Jr USA r 107 Fort Apt 6 Grogan Eug (Masie L) 2 lab Ga Power Co h' 107 Grogan Grogan F (Mary S) 1 USA r 706 Lawrence Grogan Floyd USA r 107 Fort Apt 6 Grogan Geo F lab r 409 Lemon MARIETTA CITY DIRECTORY 187 Grogan Hugh (Mortice C) 3 lab The McNeel Marble Co h 410 Robeson ct Apt 3 Grogan Irene student r 107 Fort Apt 6 Grogan Jesse T (Adelaide) h 201 Franklin Grogan Katie L cook 204 Seminole dr r 214 Montgomery Grogan Mable maid r 415 Cole Grogan Marie plant elk S B T & T Co r Dallas rd Grogan Robt L (Mable) sprayer Brumby Chair Co h 415 Cole Grogan Virginia maid r 107 Grogan Grogan Virginia M (Mrs E D) r 716 Roswell Grogan Willie cook r 409 Lemon Grogans Robt L (Cath G) 1 emp Stonewall Hotel h 410 W W Lee ct Apt 2 Groover Annie L pairer Marietta Hosiery Co r Tower rd (Eliz) Groover Christine typist r 206 Sessions Groover Dana D USA r Atlanta rd (FO) Groover Edw L (Eliz L) USN r 220 Roswell Groover Eliz L (Mrs Edw L) bkpr City Board of Light & Water Wks r 1114 Roswell Groover Hardware Co (Jas H, Joe E and Paul S Groover) 100 Washing- ton av Groover Horace (Annie B) County Treas h Atlanta rd (FO) Groover Hugh 1 carrier US PO h 1403 Roswell Groover Iosyline ofc sec Chas M Brown r 206 Sessions Groover Jas H (Ruby J) 2 (Groover Hwd Co) Member City Council h 710 Roswell Groover Jos D (Gladys F) 2 slsmn h 500 Roswell Groover Jos E (Alice B) (Groover Hardware Co) Roswell rd RD 2 Groover Lewis C (Annie K) 1 emp Holeproof Hosiery Co h Tower rd (Eliz) GROOVER LUTHER L (Fannie P) (Georgia Coal Co) h 220 Roswell Tel 1066 Groover Mary A r 710 Roswell Groover Mildred E (Mrs Wm E) emp Daniell's Jewelry Store r 209 Austin avenue Groover Oliver F h 108 Green Groover Paul S 1 (Groover Hardware Co) r 710 Roswell Groover Plennie M (Odie W) h 205 S Waddell Groover Ralph riveter Bell Aircraft Corp r Tower rd (Eliz) GROOVER ROSELLE S (Annie M) 1 Chief City Fire Dept h 615 Pow- der Springs--Tel 566-W Groover Simpson (Beatrice J) dentist 100i/2 Cherokee h 206 Sessions Groover Wiley S USA r 206 Sessions Groover Wm E (Mildred E) USA r 209 Austin av Groover Wm L (Carolyn B) 4 slsmn h 106 Lakewood 188 BALDWIN'S 1944 Grove Bernice (wid Claude D) h 310 Freyer dr GROVE RUSSELL S (Miriam S) 1 Executive Sec Office Price Admin- istration, Lawyer 116 Atlanta--Tel 1055 h 311 Freyer dr--Tel 487 (See Blue Book) Groves Amanda elk r 903 Cherokee Groves Earl E (Doris S) 1 r 815 Manget Groves Emily sten r 903 Cherokee Groves Gussie h 903 Cherokee Grubbs Cleo E (wid J A) nurse r 406 Church Grubbs Thos C (Arlene) USA r 201 W Lemon Gudger Lorena M elk Bell Aircraft Corp r 125 S Alexander Guess Claude E (wid AH) h 410 Powder Springs Guess Maurine emp Holeproof Hosiery Co r 204 Lemon Guest A A (Mary A) 2 eng h Atlanta rd Guffin Jas welder Bell Aircraft Corp r 105 Moon Guffin R L (Ruth) elk W Z Daniell Gro r Henry RD 5 Guffin Raymond L (Mary S) 2 elk W Z Daniell Gro h Henry RD 5 Guice Jas H (Cordia C) 1 carp h Cranfill (FO) Guinn Artis emp Bell Aircraft Corp r 308 Washington av Guinn Frank A (Irene H) 1 barber Washington Avenue Barber Shop h Austell rd (FO) Guinn Frank A Jr r Austell rd (FO) Guinn Hubert r Austell rd (FO) Gulf Life Insurance Co Jos M Jackson dist supt 64j S Park Square GULF OIL CORP, Fred V Legg Distributor, Wholesale Oil and Lubricant Dealers, Gasoline, Kerosene, Fuel and Tractor Oils, Insecticides and Cleaning Solvents, 129-133 Butler--Tel 81 (See right top lines) Gulf Service Station (Albert Camp) 303 Atlanta Gunnels Gene (Mildred H) 1 inspr Bell Aircraft Corp h 414 Park View av Gunnin Sallie h 517 Page Gunter Hilton D USA r 204 Waterman Gunter Jas A (Emma K) 2 inspr h 204 Waterman Gunter Marilyn S elk Bell Aircraft Corp r 204 Waterman Gunter Mattie I (Mrs V M) emp Bell Aircraft Corp r Marble Mill (Eliz) Gunter V M (Mattie B) 2 emp Bell Aircraft Corp h Marble Mill (Eliz) Gunter W Howell (Eliz) 2 aircraft Bell Aircraft Corp h 133 Hedges Apt 2 Gunther Fay (Mrs Garland) ofc sec Bell Aircraft r 118 McDonald Gunther Garland (Fay) USA r 118 McDonald Gurley Ada B (wid H D) r 228 Atlanta Gurley B Florrie 1 r Atlanta rd (FO) Gurley E Claud bkpr Allen Drug Co h 228 Atlanta Guthrie Riley W (Bertie C) 2 emp Bell Aircraft Corp h 809 4th Apt 4 MARIETTA CITY DIRECTORY 189 TO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Hackett Lillie cook r 112 Maple Hadaway Benj E (Nola T) r 107 Pomeroy Hadaway Blanche G (Mrs John H) emp Bell Aircraft Corp r 107 Pomeroy Hadaway John H (Blanche G) 3 inspr Bell Aircraft Corp h 107 Pomeroy Hadaway Paul E (Willie S) 1 elk Kaplan's h 109 Pomeroy Haddock Dorothy tchr Keith Sch r 113 Forest av Hadaway E Talmage student r 109 Pomeroy Hagerman Jos R (Mary P) designer Bell Aircraft Corp h 102 Colonial cir Apt 3 Hagerman Louie H Jr (Edna S) 2 designer Bell Aircraft Corp h 104 Co- lonial cir Apt 1 Hagood Cave W checker Bell Aircraft Corp r 720 Church Hagood Christine (Mrs G B) elk W P Stephens Lbr Co r Atlanta rd (FO) ETagood Geo B (Christine B) USA r Atlanta rd (FO) Hagood Geo F Jr (Sallie B) 2 dentist 64 S Park Square h 712 Church HAGOOD GEO F (Sara K) Physician Marietta Hospital Bldg--206-210 Cherokee--Tel 181 h 710 Church--Tel 444 Hagood L T (Florence) 1 dist supvr Farm Security Admin h Joyner av (FO) Hagood Lowery T Jr USA r Joyner av (FO) Hagood Mildred student r Joyner av (FO) HAGOOD MURL M (Mary J) 2 Pres Marietta Hospital, Physician Ma- rietta Hospital Bldg 206-210 Cherokee--Tel 181 h 617 Whitlock av Tel 856 Haggard Jas emp Bell Aircraft Corp r 305 Lawrence Hairston Addie D (wid G C) h 111 Henderson Hairston Geo C (Lois D) supt W P Stephens Lbr Co r 111 Henderson Hairston John M (Carole H) 2 emp Atherton Drug Co h 106 Pomeroy Haisley Glen D carp r 301 Cherokee Hale Granville B (Gloria P) 1 mech Bell Aircraft Corp h 404 Alexander cir Apt 2 Hale Martin J (Helen S) 2 tool mkr Bell Aircraft Corp h 303 Lakewood dr Apt A Hale O G (Sadie B) 2 tool mkr Bell Aircraft Corp h 413 Lakewood dr Apt B Hale Walter H (Anna P) atndt McKinney Tire & Battery Service 103 Moon Hale Walter H (Anna P) 1 atndt McKinney Tire & Battery Service r 103 Moon Haley Estella M opr Louise's Beauty Shop r 415 South av Haley Green (Estella) fnshr Brumby Chair Co h 415 South av 190 BALDWIN'S 1914 Haley Harrison (Clara) 1 lab h 108 Franklin Haley Harold USA r 415 South ay Haley Jas (Rosa) 3 lab Ga Power Co h 106 Franklin Haley John L trk dr Field Furn Co r 415 South av Haley Rebecca r 108 Franklin Ilalfacre Lyle S (Margt M) 4 mach Bell Aircraft Corp h 212 Phillips dr Apt A Hall Abbie S (Mrs Alton F) mender Marietta Hosiery C or 501 Atlanta Hall Alice 0 (wid S D) h 307 S Waddell Apt 1 Hall Alton F (Abbie S) 1 road mach opr h 501 Atlanta Hall Frances 1 maid r 404 W Goss Hall Georgia A 1 h 404 W Goss . Hall Jewel (Daisy) USA r 300 Sessions Hall Lelia Y (wid S H) h 408 Lawrence Hall Matthew lab Brumby Chair Co r 404 W Goss Hall Myrtis Mrs emp Bell Aircraft Corp r 201 W Lemon Hall Nell r 408 Lawrence Hall Ralph E (Mary C) 2 mach Bell Aircraft Corp h 801 4th Apt 5 Hall Roland A (Alma H) eng Bell Aircraft Corp h 509 Roosevelt cir Apt A Hall Shelton D USN r 307 S Waddell Apt 1 Hall Wm R (Frances C) 1 emp Victory Homes of Marietta Inc h 832 Church Hall Will (Lizzie) emp Bell Aircraft Corp r 309 Fort Halman Jas C USA r Pearl RD 5 Ham Carrie M maid r 408 Robeson ct Apt 1 Ham Hollis USA r 105 Poplar Ham Jessie (wid HP) r 105 Poplar Ham Jos (Carrie M) lab h 408 Robeson ct Apt 1 Ham LeRoy E (Hazel H) 1 USA r 117j Reynolds Ham Orville USA r 105 Poplar Ham Robt USA r 105 Poplar Hamby Carl E (Edna) project supt Cobb County Rural Elec Membership Cox-p r RD 3 Hamby Harry J (Sarah A) USN h 401 Lawrence Hamby Hazel L emp Bell Aircraft Coi-p r 618 Cherokee Hamby Lura emp Bell Aircraft Corp r 618 Cherokee Hamby Thos J (Chloe R) h 804 Roswell Hames A Jean elk r Concord rd (FO) Hames Albert H (Audie F) 1 h Bingham (FO) Hames Audie F (Mrs A H) r Bingham (FO) Hames Chas P (Nell P) carp h 1416 Cherokee Hames Clarence H r Bingham (FO) Hames E Hei'bert Mary P) h Bingham (FO) Hames Harry O (Margt D) USA h 113 Henderson marietta city directory 191 Hames Hazel (Mrs Carl) opr S B T & T Co r RD 2 Hames Helen bkpr Hanley Co r 704 Lawrence Hames Jas J (Vera J) 1 USA h 204 Holland Hames John L emp Bell Aircraft Corp h 1410 Cherokee Hames L C Grocery (Luther C Hames) Atlanta rd (FO) Hames Luther C (Patience) 1 (LC Hames Gro) h Concord rd (FO) Hames Margt D (Mrs Harry 0) ofc sec W P Stephens Lbr Co 113 Hen- derson Hames Margt D sec W P Stephens Lbr Co r 113 Henderson Hames Mary J (Mrs E H) r Bingham (FO) Hames Ozelle student r Bingham (FO) Hames Patience (Mrs L C) elk L C Hames Gro Atlanta rd r Concord rd (FO) Hames Sarah student r Bingham (FO) Hames Vivian P (Mrs Cecil) r 206 Roswell Apt 1 Hamilton Billiard Parlor (G M Hamilton) 115 Atlanta Hamilton Fred mgr City Incinerator r 702 Lawrence Hamilton Fredk D (Ila B) 1 emp City Disposal Plant h 702 Lawrence Hamilton G M Hamilton Billiard Parlor h 115 Atlanta Hamilton Herbert C (Annie B) 2 mech h 112 Kirkpatrick dr Hamilton Ila B lndrs r 702 Lawrence Hamilton Isaac (Marcia R) lab h 205-a Page Hamilton Lillie cook Model Cafe r 705 Lawrence Hamilton Lucy opr S B T & T Co r Pearl RD 5 Hamilton Margt ofc wkr r 1026 Cherokee Hamilton Ruth P slswn Miller's Inc r 400-b W Hansell Hamilton Sherry M (Mary S) 1 chem Holeproof Hosiery Co h 1026 Cher- okee Hamilton W G ofc wkr Bell Aircraft Corp r 400-b W Hansell Hamley Frances ofc wkr Bell Aircraft Corp r 307 Powder Springs Hamman Gilbert R 1 emp Bell Aircraft Corp h Garrison rd RD 5 Hammond Homer E (Margt B) 2 inspr h 407 Grover Hammond Leonard G (Sybil M) 2 ambulance dr Bell Aircraft Corp h 801 3d Apt 4 Hammond Newton porter Mayes Ward & Co r 105 Rigsby Hammond Richd M (Theresa M) emp Bell Aircraft Corp h 613 2d Apt 1 Hammondtree Cale electn Bell Aircraft Corp r Atlanta rd Hamrick Dewey A (Lilia B) 2 emp Bell Aircraft Corp h 605 2d Apt 3 Hamrick Harvey L (Linnie P) 1 guard County Prison Farm h 314 Fairground Hamrick Letha P slswn W W Mac Co r 314 Fairground HANCOCK DON C, Pres-Treas Southland Ice Co r Cartersville Ga Hancock Hal L (Frances) 1 supvr Bell Aircraft Corp r 208 Gramling 192 BALDWIN'S 1941 HANCOCK R JAS (Jeannette G) V-Pres Southland Ice Co, h 114 Hillside av Hancock Sallie (wid J W) h 513 Kennesaw av Hand Aiding T (Myrtle S) formn Bell Aircraft Corp h 606 2d Apt 1 Haney Beatrice slswn Miller's Inc r 216 E Dixie av Haney Carolyn J student r 626 Atlanta Haney Harley M (May Q) 1 slsmn B & N Auto Parts Co h 210 S Wad- dell Haney Julian L student r 210 S Waddell Haney Morris L (Alice J) guard County Prison Camp h 216 E Dixie av Haney Wayne D (Orlean) mech r 626 Atlanta Haney Wayne D Jr student r 626 Atlanta HANLEY CO J H Hanley Pres, L A Davidjson] Sec-Treas, D H Holmes Mgr, Funeral Directors, Ambulance Service, 120 Lawrence--Tel 657 (See Buyers' Guide) HANLEY J H Pres Hanley Co r Atlanta Ga Hann Yenard E USA r 111 Stewart av Hansard G Howard (Docia D) farmer h Atlanta rd (FO) Hanson Jas B interviewer U S Employment Service War Manpower Comn r Atlanta Ga Happy's Service Station (Wilce W Frazier) 403 Roswell Harbin Barbara A ofc wkr r 407 Atlanta Harbin Cellis W (Callie B) h 401 Fairground Harbin Paul r 336 Atlanta Harbin T Benj (Annabel Y) 1 mach h 407 Atlanta Hardage Carl B (Martha S) 2 (C B Hardage Service Sta) h 208 Wayland Way Apt 2 Hardage C B Service Station (Carl B Hardage) 301 Church Hardage Carrie I smstrs Miller's Inc r 206 Geo Hamilton ct Apt 2 Hardage Cecil M (Mary C) 1 h Fair Oak av (FO) Hardage Chas H (Fannie M) USA h 205 Waddell pi Apt 7 Hardage Chas T (Nola F) 1 prod slsmn h 209 E Dixie av Hardage Danl student r 209 E Dixie av Hardage Ernest G (Virginia S) 2 (Hardage Service Station) h 106 Moon Hardage Fannie M (Mrs C H) dental asst r 205 Waddell pi Apt 7 Hardage Frank (Kath C) auto reprs 208i/2 Waverly Way h 108 Summit av Hardage Hellen K (Mrs R C) waitress Model Cafe r 211 McCord Hardage Henry A (Allie G) farmer h Barber rd (FO) Hardage Henry M (Thelma R) 1 emp Bell Aircraft Corp h 306 Stewart av Hardage Hugh (Sadie B) 3 cash N C & St L RR h 323 Powder Springs Hardage Hugh cash L & N RR and N C & St L RR r 323 Powder Springs Hardage Jas M (Martha L) (Hardage Service Sta) h 407 Polk marietta city directory 193 Hardage Jessie B (wid JD) h 206 Geo Hamilton ct Apt 2 Hardage Jos J h 314 Powder Springs Hardage Kath C (Mrs F R) slswn r 108 Summit av Hardage L Eug (Margt) 1 mach Bell Aircraft Corp h Whitlock av extd RD 4 Hardage Mary C (Mrs Cecil) emp Bell Aircraft Corp r Fair Oak av (FO) Hardage May (Mrs Carl) opr Modern Beauty Shop r 208 Wayland Apt 2 Hardage Ralph C (Hellen K) USN h 211 McCord Hardage Service Station (Jas M Hardage) 309 Cherokee Harden Mason (Evelyn B) 1 USA r 201 N Alexander Harden Richd (Willie B) 1 USA r 201 N Alexander Hardeman Frank USA r 112 Roswell Hardeman Geo H (Julia B) h 212 E Anderson Hardeman Geo H Jr student r 212 E Anderson Hardeman Jas emp Bell Aircraft Corp r 112 Roswell Hardeman Julia B (Mrs Geo H) ofc asst Dr Geo O Allen r 212 E Anderson Hardeman Qrilla (wid Frank) h 112 Roswell Hardie Willie H (Josephine C) 2 emp Holeproof Hosiery Co h Oak av (FO) Hardin Elie lab r 304 Montgomery Hardin Eliz R (wid Jas O) h 311 Powder Springs Hardin Jas H USA r 314 Maple av Hardin Jas O Jr USMC r 311 Powder Springs Hardin Lula Indrs h 304 Montgomery Hardin- Roy (Sudie H) 2 firemn Bell Aircraft Corp h 314 Maple/' av Hardin Roy Jr USA r 314 Maple av Harding Harvey (Wyona H) 2 ofc wkr Bell Aircraft Corp r 110 Forest av Hards Wilson J (Elsa S) 2 mech Bell Aircraft Corp h 510 Alexander cir Hardwick Addie M cook Dixie Cafe r 502 Montgomery Hardwick Lesley A (Xla N) 1 formn Bell Aircraft Corp h 103 Hawkins Apt A Hardwick Minnie cook r 215 Greer av Hardwick Troy (Addie M) lab Marietta Service Sta r 610 Lawrence Hardy Clarence (Clara O) 1 USA r Turner rd (FO) Hardy Dewey C USN r 203 N Alexander Hardy Floy D (Mrs W C) slswn Kaplan's r 203 Awtry Hardy J D (Kate) 1 elk Bell Aircraft Corg h Miller av (FO) Hardy Jesse J USA r 203 N Alexander Hardy John F student r 328 Aviation rd Hardy Louise opr Sou B T & Tel Co r Miller av (FO) Hardy Marjorie (wid Robt) 2 r 203 N Alexander Hardy Opal ofc wkr r 501 Church Apt, 5 Hardy Virginia A (Mrs Wm H) bkpr r 206 Lawrence Hardy Wm C (Floy D) fnshr Abbott Furn Co h 203 Awtry 194 BALDWIN'S 1944 Hare J Vance (Miriam G) 2 emp Bell Aircraft Corp h 805 4th Apt 2 Hargett Louise (Mrs E L) checker Piggly Wiggly Super Mkt r 518 Vic- tory dr Hargis Betty Jo opr S B T & T Co r 1014 Whitlock av Hargis Robt stationary eng r 1014 Whitlock av Hargis Robt B (Mary P) opr N C & St L RR h 1014 Whitlock av Hargis Virginia F elk r 1014 Whitlock av Hargis Wm R USA r 1014 Whitlock av Hargrove Nannie Indrs h 225 Johnson Hariing Lutie A (wid J R) h 504 Church Apt 1 Harmon Clifford E (Grace) tool mkr Bell Aircraft Corp h 705 3d Apt 5 Harmon J Wilson (Gladys W) 2 foremn Bell Aircraft Corp h Fair Oak av (FO) Harmon John W (Helen S) 1 inspr Bell Aircraft Corp h 204 Aviation rd Harmon Oscar R (Esther C) mech Bell Aircraft Corp h 120 Kings ct Apt A Harold Frances marker Nu-Way Clnrs & Lndry r 211 Johnson Harpe Wilson emp Bell Aircraft Corp r 504 Cherokee Harper Alva B phys 1201/2 Lawrence Harper Chas (Lena B) lab W P Stephens Lbr Co h 533 Washington av Harper Chas (Nobie F) 2 lab Bell Aircraft Corp h 511 Lemon Apt 1 Harper Edw (Jewel) slsmn r 222 Rose la Harper Jewel (Mrs Edw) matcher Holeproof Hosiery Co r 222 Rose la Harper Mildred 1 h 507 Lemon Apt 12 Harrel Francis emp Nu-Way Clnrs & Lndry r 211 Johnson Harrell Jean opr Western Union Teleg Co r Atlanta Ga Harrell Robt L hlpr Bell Aircraft Corp r 709 Lawrence Harrelson J Roy (Ruby R) 1 pipeftr Bell Aircraft Corp h 207 Aviation dr Harrington Alex B (Frances R) 3 elk Bell Aircraft Corp h 1612 Hillside dr Harrington G MacKenzie USN r 405 Kennesaw av Harrington John M (Lockie G) ofc wkr Bell Aircraft Corp h 811 1st Apt 1 Harrington Margt S Mrs emp Bell Aircraft Corp r 405 Kennesaw av Harrington W A (Maude) 1 riveter Bell Aircraft Corp h 607 3d Apt 4 Harris Addie 1 Indrs h 219 Maple Harris Addie maid Marietta Hosp r 109 Edwards dr Harris Alice (wid Thomas) r Fair Oak av (FO) Harris Archie USA r 219 Maple Harris Aslee (wid B H) h Bells Ferry rd (Eliz) Harris Audrey maid r 410 W W Lee ct Apt 10 Harris B R (Emily) 1 inspr Bell Aircraft Corp hj 614 2d Apt 1 Harris Belle 1 Indrs h 116 Johnson Harris Correnth (Marie) 2 lab Southland Ice Co r 103 Mulberry Harris Cecil oiler N C & St L RR r Bingham (FO) Harris Chas C (Ivy) hlpr Geo W Whorton Gro h 203 Fort Harris demon (Annie L) 3 lab h 406 Robeson ct Apt 4 Marietta city directory 195 Harris Clifford USA r Bingham (FO) Harris Clyde (Greta) 1 emp Bell Aircraft Corp h 606 1st Apt 4 Harris Edw emp Brumby Chair Co r 503 W Goss Harris Elmer W (Dessie L) 1 USA r Bells Ferry rd (Eliz) Harris Etha M sch tchr r RD 5 Harris Ethel J (Mrs Jas S) tchr Robt L Osborne Sch r Atlanta rd (FO) Harris Frances r 702 Pine Harris Frances student r 112 Cherry Harris Fronie h 116 Lakewood Harris Fannie L (Mrs Wm L) Society Editor The Marietta Journal r 112 Cherry Harris G Elmer (Hazel A) 1 formn Bell Aircraft Corp h 1229 Whitlock av Harris Garland A USA r 120 Lacy Harris Geo (Addie) lab h 109 Edwards dr Harris Grace ofc wkr r 120 Lacy Harris Harold (Willie G) emp h 206 Wayland Apt 2 Harris Hattie maid r 306 Rigsby Harris Hugh W (Evelyn H) 2 ins solr h 207 Stewart av Harris I V maid 312 Kennesaw 203 Fort Harris Ivy maid r 203 Fort Harris Jack W (Louise P) 3 loftsmn Bell Aircraft Corp h 308 Park View av Harris Jas (Ludie) lab h 408 Robeson ct Apt 4 Harris Jas S (Esther J) mech Bell Aircraft Corp h Atlanta (FO) Harris Jas H (Mrs Norris W) emp Bell Aircraft Corp r 205 Waddell pi Apt 1 Harris John lab h 503 Wright Harris John T (Margt H) 2 dr Safety Cab Inc h 201 Waddell pi Apt 6 Harris John T (Lucinda P) h 206 Church Harris Leon H (Dixie R) 1 dr Safety Cab Inc r 206 Church Harris Lester (Audrey) lab h 410 W W Lee ct Apt 10 Harris Lillie H (wid Melvin) emp Clark Hosiery Co r 201 Stewart av Harris Linton I (Georgia H) 1 eng Bell Aircraft Corp h 420 Aviation rd Harris Lloyd W radio tech Eastern Air Lines r 112 Cherry Harris Lula M (wid E L) h 501 Church Apt 1 Harris Margt ofc wkr r Bells Ferry rd (Eliz) Harris Minnie clnr Victory Homes of Marietta Inc r 219 Maple Harris Norman J (Stella P) carp h Fair Oak av (FO) Harris Norris W (Jimmie H) 1 emp Bell Aircraft Corp h 205 Waddell pi Apt 1 Harris R Thos (Annie K) 2 mech h 120 Lacy Harris Robt C USA r Bells Ferry rd (Eliz) Harris Roy (Luvina B) 2 h 201 Page Harris Roy (Lucile A) h Atlanta rd 196 BALDWIN'S 1944 Harris Stella P (Mrs N J) mender Holeproof Hosiery Co r Fair Oak av (FO) Harris Thos W USA r 120 Lacy Harris Wm J emp W P Stephens Lbr Co r 219 Maple Harris Wm L (Fannie L) (The Marietta Journal) h 112 Cherry Harris Willie L (Olin C) carp r Bingham (FO) Harrison Annie G (Mrs H M) emp Bell Aircraft Corp r 1202 Church HARRISON BEAUTY PARLOR (Mrs Lelia Harrison) Five Master Beau- ticians, Twenty Years of Service our Guarantee of Satisfaction, 307-09 Church--Tel 482 Harrison Chas M eng County Health Dept r 109 Freyer dr Holland Wm A emp Bell Aircraft Corp r 307 Powder Springs HARRISON LELIA (Harrison's Beauty Parlor r Smyrna, Ga Harrison Geo L (Irene M) 1 slsmn h 511 Kennesaw av Harrison G L Jr r 511 Kennesaw av Harrison H McCoy (Annie G) USN h 1202 Church Harrison J S (Virginia 0) Editor and Mgr Cobb County Times r RD 5 Harrison Jennie M (wid F L) r 116 Henderson Harrison Lithonia r 121 Fort Harrison Mildred R maid 712 Page r 511 Lemon Apt 2 1 ^ Harrison Rebecca 2 maid h 511 Lemon Apt 2 Harrison Virginia O (Mrs J S) ofc wkr Bell Aircraft Corp r RD 5 Harshbarger Carl J slsmn Brumby Furn Co r 306 Frasier Harshaw Betty J maid 704 Cherokee 120 Johnson Hart Chas M Jr (Agnes O) 2 formn Bell Aircraft Corp h Barber rd (FO) Hartis Jas R emp Bell Aircraft Corp r 313 Roswell Hartsfield Edw slsmn Saul's Dept Store r 200 Geo Hamilton ct Apt 6 Hartsfield Everett Service Station (T Everett Hartsfield) 915 Atlanta Hartsfield Jesse F (Mattie R) emp Nu-Way Clnrs & Lndry h 200 George Hamilton ct Apt 6 Hartsfield R Edw student r 200 Geo Hamilton ct Apt 6 Hartsfield T Everett (Evelyn) 1 (Everett Hartsfield Service Sta) h 218 Gramling Hartsfield Wm L emp Bell Aircraft Corp r 200 Geo Hamilton ct Apt 6 Harvey Walker (Edwina G) 1 lab r 801 Lawrence Harward Harlee H inspr Bell Aircraft Corp r 408 Whitlock av Harwell S R eng U S Farm Security Admn r 401 Atlanta Haskins Aaron G (Lillian D) 3 agt Interstate Life & Accident Ins Co h Austell rd (FO) Haslett A W Mrs tchr Elizabeth Sch r Elberton Ga Haslett Geo T (Lavelle R) 1 mach Bell Aircraft Corp h 702 6th Apt 2 Haslett Mary A student r 405 Atlanta Hassell W Z (Louise) 2 emp Bell Aircraft Corp h 508 Alexander cir Hasty Jas R (Pauline C) h 702 Atlanta Hatch Albert B (Ruth S) 1 contn wkr Bell Aircraft Corp r 201 Sycamore vlARIETTA CITY DIRECTORY J 95 Hatch Harold L (Eliz L) 2 eng Bell Aircraft Corp h 164 W Dixie av Hatcher Wm H (Pauline P) 1 firemn City Fire Dept h 205 Waddell pi Apt 3 Hattaway Mary h 209 Roswell Hattaway Mary Mrs r 207 Roswell Hawkins Ann student r 709 Church Hawkins Daisy emp Bell Aircraft Corp r 505 W Atlanta Hawkins Floyd W (Emma L H) 1 formn Bell Aircraft Corp h 207 Victory drive Hawkins J Eug (Mary W) 1 riveter Bell Aircraft Corp h Bingham (FO) Hawkins J Harold (Irene N) Judge Superior Ct h 709 Church Hawkins John O (Mamie M) USA r Rose la (Eliz) Ha-wkins Jos B (Edna B) 2 ofc wkr W P Stephens Lbr Co h 207 Wayland Apt 3 Hawkins Louise J (Mrs W V) knitter Holeproof Hosiery Co r Marble Hill (Eliz) Hawkins Lula B h 507 Lemon Apt 3 Hawkins Mamie M (Mrs J O) emp Bell Aircraft Corp r Rose la (Eliz) Hawkins W V (Louise J) 3 hlpr L & N RR h Marble Mill (Eliz) Hawkins Wm electn r 228 E Dixie av Hawthorne Henry L (Mary L) 1 hlpr Sou Ry Co h 122 Garrison dr Hayes Annie M r 213 Reynolds Hayes Arth L lab Southland Ice Co r 207 Johnson Hayes Beulah cook 408 Campbell Hill r 207 Johnson Hayes Clarence (Daisy G) 2 trk dr Southland Ice Co r 207 Johnson Hayes Clarence L inspr Bell Aircraft Corp r 801 Church Hayes Daisy maid 309 Kennesaw av 210 Johnson Hayes Donald (Marie) USA r 107 E Dobbs Hayes Edgar M (Inez S) 2 mach Bell Aircraft Corp h 208 Campbell Hill Hayes Jas D (Evelyn W) 5 ins slsmn h Concord rd Apt 19-a (FO) Hayes Mamie cook h 207 Johnson Hayes Marie (Mrs Donald) emp Bell Aircraft Corp r 107 E Dobbs Hayes Mary ofc wkr Holeproof Hosiery Co r Washington av Hayes Paul C (Mabel M) 2 formn Holeproof Hosiery Co h Washington avenue Hayes Rose (Rose Beauty Shoppe) RD 1 Hayes Setta r 1007 Powder Springs Hayes W H (Susie G) r 405^4 Cherokee Haymond Eva B (Mrs H L) forewn Bell Aircraft Corp r 801 Church Haymond Harry L (Eva B) Bell Aircraft Corp h 801 Church Haynes Cecil student r 230 Hill ct Haynes Dolly Mrs 1 emp Bell Aircraft Corp h 230 Hill ct Haynes Lewis lab H N DuPre r 404 W Anderson Haynes Lillie P emp Bell Aircraft Corp r 230 Hill ct 198 BALDWIN'S 1944 Haynes Lewis (Fannie H) trk dr H N DuPre h 404 W Anderson Haynes Napolean (Esther B) 1 yardmn h 611 Lawrence Haynes Thos J (Roberta S) 1 formn Bell Aircraft Corp h 519 Vista cir Apt 1 Haynie Holland H (Julia P) 1 formn Bell Aircraft Corp h 303 Allgood rd Apt 2 Hays Berryhill H (Lulu C) USA h 208 Roswell Haywood Margt ofc wkr Bell Aircraft Corp r 104 3d ct Apt 5 Hazel Prudence maid Greyhound Bus Sta h 208 Johnson HAZEL WALTER W (Pauline) Tailor 111 Waverly Way.--Men's and Women's Tailoring, Work Called For and Delivered, h 300 Reynolds (see right bottom lines) Head Addie M (wid Chas M) 1 h Barber rd (FO) Head Chas h 309 Page Head Clara cook h 321-a Lemon Head Claude bkpr Economy Ice Cream Co r 228 Atlanta Head Eliz maid r 410 W W Lee ct Apt 8 Head Elmer (Eliz) 1 emp McPherson Tire Shop h 410 W W Lee ct Apt 8 Head Frances lndrs r 413 Reynolds Head Geo ydmn 302 Reynolds Head Geo (Nora) ydmn h 302 Reynolds Head Henry (Sara S) carp h 229 Johnson Head Henry (Leila H) 1 jan W P Stephens Lbr Co h 503 Lemon Apt 2 Head Jane E student r 111 N Forest av Head Melvin (Mary) atndt McPherson Tire Shop h 507 Lemon Apt 9 Head Nora* maid 110 McDonald r 413 Reynolds Head Peter (Frances) emp W P Stephens Lbr Co h 413 Reynolds Head Richd G (Edith) const eng h 111 N Forest av Head Robt (Lottie M) plmbr r 316 Reynolds Head Vesta tchr Keith Sch r 108 Forest av Head W Claude ofc wkr Economy Ice Cream Co 228 Atlanta Headley Howard L (Eliz E) 3 reprmn Bell Aircraft Corp h 710 4th Apt 3 Healy Caroline K Mrs ofc wkr Bell Aircraft Corp r 207 Kennesaw av Healy Wm R USA r 207 Kennesaw av Heard Ernest (Georgia G) sander Brumby Chair Co h 112 Maple Heath Blanche emp Bell Aircraft Corp r 107 Hawkins Apt A Heath W Barton (Pauline J) mech Bell Aircraft Corp h 904 3d Apt 1 Heck John A (Alice W) 1 trav slsmn h 302 Kennesaw av Hedges Eliza C elk First Natl Bk r 1235 Whitlock av Hedges Emma tchr Waterman Street Sch r 1235 Whitlock av Hedges Minnie L (wid Chas E) h 1235 Whitlock av Heck Alice W (Mrs J A) ofc wkr r 302 Kennesaw Hefner Coy (Flora) emp Bell Aircraft Corp h 808 4th Apt 1 Height Freddie M maid r 403-a Lemon Height Louie r 403-a Lemon MARIETTA CITY DIRECTORY 199 Height Mary maid 404 N Waddell r 403-a Lemon Helms Roland (Nadine K) 1 tool mkr Bell Aircraft Corp h 608 1st Apt 6 Hembree Fayette (Willie G) 1 emp Bell Aircraft Corp h Campbell Hill (Eliz) Hembree Leatha (Mrs Andrew) opr S B T & T Co r Smyrna, Ga Hembree McKemley farmer r Marble Mill (Eliz) Hembree Sophie (wid Clinton) r 214 Powder Springs Hembree Wesley emp L & N RR r Marble Mill (Eliz) Hembree Willie G (Mrs Fayette) emp Bell Aircraft Corp r Campbell Hill (Eliz) Hemp Sarah (Mrs S S) ofc wkr r 503 Cherokee Hemp Stanley S (Sarah) supvr Bell Aircraft Corp h 503 Cherokee Hemp Thos N designer The McNeel Marble Co r 503 Cherokee Hemperley John H (Mary K) 3 emp Bell Aircraft Corp h 103 3d ct Apt 5 Hemphill Evalyn 3 waitress Stonewall Cafe r 103 Lake Hemphill Louise 1 smstrs Walter W Hazel h 403 Cole Henden Nannie Mrs r 112 S Alexander Henderson Frank firemn Bell Aircraft Corp r Atlanta rd Henderson Grady H i (Mildred I )2 mech Bell Aircraft Corp h 502 Stokes av Apt B Henderson Helen sten Bell Aircraft Corp r New Marietta Hotel HENDERSON JAS A (Ruth T) 3 Sec-Treas Victory Homes of Marietta Inc, h 1523 N Park dr Henderson John C (Imogene A) 2 guard Bell Aircraft Corp h Atlanta rd (FO) Henderson John H (Oma C) 1 County Agrl Agt h 130 TrammM Henderson Louis W (Ruth T) 1 USN h 1510 Hillside dr Henderson Oma (Mrs J H) (Marietta Cigar Factory) sec Blair & Car- michael) r 130 Trammell Henderson Ott T (Laura R) 1 carp Bell Aircraft Corp h 108 Ayers av Hendon D C (Dorothy C) USA r Garrison rd RD 5 Hendon Dorothy C (Mrs D C) slswn Saul's Dept Store r Garrison rd RD 5 Hendon Jas W (Alvina) USN r 310 Freyer dr Hendrix Chas safety eng Bell Aircraft Corp r 204 Glover Hendrix Sallie (wid J W ) h 204 Glover Hendry Ralph A (Clifford B) 2 formn T C Branson Jr Inc h 201 George Hamilton ct Apt 5 Henley Carter (Mamie C) USN r 501 Church Apt 10 Henley Mamie C (Mrs Carter) sten Marietta Coca-Cola Btlg Co r 501 Church Apt 10 Hennigh Clifford E (Jimmie W) eng Bell Aircraft Corp h 303 South av Apt 3 Henrick E Douglas (Eliz B) 1 loftsmn Bell Aircraft Corp h 208 Victory dr Henry A John (Flora W) h 614 Cherokee Henry Alvin (Hattie) butler h 112 Montgomery 200 BALDWIN'S 1944 Henry Felton B (Denver J) 2 slsmn h Concord rd (FO) Henry Geo L (Frances W) 1 supvr Bell Aircraft Corp h 214 Clay Henry Hattie maid 108 Francis av r 110 Montgomery Henry John emp Bell Aircraft Corp r Atlanta rd Henry John D (Dora B) carp h Cogburn av (Eliz) Henry Lila maid 613 Church h 410 W W Lee ct Apt 6 Henry Mattie maid 113 Vance cir r 112 Mulberry Henry Nettie waitress Economy Ice Cream Co 614 Cherokee Henry Peggie h 400 Reynolds Henry Robt A h 106 Page Henson Elaine emp Bell Aircraft Corp r 209 Gramling Hensley Ford W (Arlivia B) 2 electn Bell Aircraft Corp h 104 Kings ct Apt A Henson Margt emp Bell Aircraft Corp r 803 4th Apt 4 Henson Ralph (Wilma O) 1 emp Bell Aircraft Corp h 608 Cole Herman Esther H (Mrs O C) sten r 615 Whitlock av Herman Floyd (Lucille M) 1 emp Bell Aircraft Corp h 818 1st Apt 5 Herman Lucille M (Mrs Floyd) emp Bell Aircraft Corp r 818 1st Apt 5 Herman O Clifford (Esther II) USA r 615 Whitlock av Bering Frank C (Vina M) 2 emp Marietta Housing Authority h 604 2d Apt 4 Heriot Julian C (Harriet H) 1 USA r 416 Park View av Hester Clyde (Louise P) 2 crane opr h 113 North av (Eliz) Herren T A patrolmn County Police Dept r Smyrna, Ga Hewin Clarence L (Mary D) 2 dispr Bell Aircraft Corp h 511 Roosevelt cir Apt B Hewitt John P (Cynthia P) 1 USA r 307 Kennesaw av Hewitt Reaves ofc wkr Bell Aircraft Corp r 307 Kennesaw av Hewitt Strafford R (Caroline D) h 307 Kennesaw av Hiatt Herbert F (Jane B) 3 eng Bell Aircraft Corp h 501 Stokes av Apt A Hibble J Leonard USN r 107 Gramling Hibble L W (Eunice S) estimator The McNeel Marble Co h 714 Church Hibble Leonard A (Thelma J) 1 inspr Bell Aircraft Corp h 107 Gram- ling Hibble Louis R (Ruth) 1 emp Bell Aircraft Corp h 422 Maple av Hibble R Norman ofc wkr Bell Aircraft Corp r 107 Gramling Hibble Ruth G (Mrs L R) elk Ofc of Price Admin r 422 Maple av Hicks Chas H (Florry B) 6 paymaster V P Loftis Co h 204 Clay Hicks Claude M (Louise M) USA r 1314 Cherokee Hicks Cleve O (Eunice B) trk dr h 201 Washington av Hicks Dorsy (Rachel) 1 emp Atlanta Steel Co h 205 George Hamilton ct Apt 9 Hicks Dudley (Eliz B) (Hicks Gro) 203 Washington Hicks Dudley E (Betse B)1 emp H Hicks Gro h 203-a Washington av Hicks Emmett E USA r 204 Clay MARIETTA CITY DIRECTORY 301 Hicks Ernest L USA r 305 Stewart av Hicks Florry B (Mrs C H) mach Bell Aircraft Corp r 204 Clay Hicks Geo M (Ida P) h 107 Henderson Hicks Grocery (Dudley and Regina Hicks) 726 Atlanta Hicks Harold C USA r 204 Clay Hicks H Grady (Lula S) blrmkr Sou RR Co r 101 Locust Hicks Hellen L sten Cobb County Rural Elec Membership Corp r 722 Atlanta HICKS JONAH F (A Maude) 1 County Sheriff h 722 Atlanta--Tel 763-J Hicks J F (Inez C) 1 diesel opr Bell Aircraft Corp h 200 Gramling Hicks J Newt mgr Main Liquor Store r RD 4 Hicks Jas L (Helen E) 2 steel wkr h 302 Stewart av Hicks Jas R (Thelma C) 1 trkr h Joyner av (FO) Hicks Joe S (Bertha) eng L & N RR r 108 Roswell Hicks Jos S (Bertha M) brakemn L & N RR h 106 Henderson Hicks Jos T r 305 Stewart av Hicks Lillie looper Holeproof Hosiery Co r 203 Stewart av Hicks Lillie H (wid HA) 1 smstrs h 305 Stewart av Hicks Maggie ofc wkr Brumby Chair Co r 112 South av Hicks Margt S (wid Thos) r 406 Whitlock av Hicks Pearl H (wid Homer) h 105 E Dixie av Hicks R S (Lula W) atndt Johnson Service Sta h 233 Atlanta Apt 1 Hicks Rachel (Mrs Dorsy) ofc sec Bell Aircraft Corp r 205 Geo Hamilton ct Apt 9 Hicks Regina P (Hicks Gro) r 105 E Dixie av Hicks Ruth cook 312 Freyer dr r same Hicks Steve C patrolmn County Police Dept r 106 Henderson Hickman Plumer porter Atherton Drug Co r 108 Mulberry Hiddleston Eug W (Susie J) USA r 304 Polk Higdon Bryan brkmn L & N RR Co r 212 Sessions Higginbotham B S (Leona V) 1 emp Brumby Chair Co h 311 Clay Hilderbrand Almon L (Bertha C) cond N C & St L RR h 514 Stewart av Hildreth Harold D (Jessie P) 1 eng Bell Aircraft Corp h 331 Aviation rd Hill Albert (Mozelle) h 111 Lake Hill Chas A (Pansy H) 1 h 311 Frasier Hill Chas A Jr USN 311 Frasier Hill Chas G (Mildred D) 3 carrier US PO h 302 Frasier Hill Clarence (Lillian F) (Hill's Gro) h 300 Sessions Hill Duril (Louise W) 1 farmer h 500 W Goss Hill Gordon emp Holeproof Hosiery Co h 304 Cherokee Apt 5 Hill Hugh A (Etta C) h 409 Cherokee Hill John C (Alene C) 2 mach Holeproof Hosiery Co h 203 Campbell Hill Hill John C Jr student r 203 Campbell Hill Hill John J (Irene L) waiter L & N RR Co h 610 Lawrence 202 BALDWIN'S 1944 Hill John W USNA r 311 Frasier Hill Jos student r 311 Frasier Hill Juliet M tchr r 610 Lawrence Hill Leatha maid 106 Vance cir r 214 Montgomery Hill Lovie tailor Johnny Walker Inc r 410 Robeson ct Apt 1 Hill Lulu maid h 707 Lawrence Hillhouse Jessie N (Mrs M M) packer Brumby Chair Co r Rose la (Eliz) Hillhouse M M (Jessie N) section hd L & N RR h Rose la (Eliz) Hill Mae maid 1110 Cherokee 329 Lemon Hill Margt A elk Bell Aircraft Corp r 311 Frasier Hill Mark (Rose W) 4 farmer h Cherokee rd (Eliz) Hill Mildred A (Chas G) emp Bell Aircraft Corp r 302 Frasier Hill Mozelle maid r 111 Lake Hill Nancy (wid R A) h 310 Washington av Apt A Hill Pansy H (Mrs C A) sten r 311 Frasier HILL RAY (J M Fowler Co) r Temple Ga Hill Robt H (Nora) h 132 Trammell Hill Ruth checker A & P Food Stores r Smyrna Ga Hill Thos M (Clara J) 2 emp Bell Aircraft Corp r 300 Washington av Hill's Gro (Clarence Hill) 300 Sessions Hillcrest Cemetery Whitlock av nr city limit Hillsman Ossie (Mrs Thos) emp Bell Aircraft Corp r 806 3d Apt 3 Ilillsman Thos (Ossie) 3 emp Bell Aircraft Corp h 806 3d Apt 3 Hilton Gemma (Mrs J N) emp Bell Aircraft Corp r 530 Roosevelt cir Hilton Gladys (Mrs W H) emp Bell Aircraft Corp r 530 Roosevelt cir Hilton Jas N (Gemma) emp Bell Aircraft Corp r 530 Roosevelt cir Hilton Jesse (Mary J) 2 emp Bell Aircraft Corp h 1210 Frasier Apt A Hilton Mary J (Mrs Jesse) emp Bell Aircraft Corp r 1210 Frasier Apt A Hilton Walker H (Gladys) 1 emp Bell Aircraft Corp h 530 Roosevelt cir Apt B Hinds Berenice E student r 142 Trammell Hinds Bertha (Mrs Paul H) asst sec-treas National Farm Loan Associa- tion r 143 Trammell Hinds Paul H (Bertha L) executive Bell Aircraft Corp h 142 Trammell Hiney Donald H (Leona) USA r 214 Powder Springs Hines Katie h 607 Wright Hinton Alfred USA r 509 Wright Hinton G Hubert USA r 509 Wright Hinton Hattie ins solr r 511 Montgomery Hinton Jas lab r 509 Wright Hinton Wm H (Annie) mach Brumby Chair Co h 511 Montgomery Hinton Wm J (Alvenus B) USN h 507 Lemon Apt 10 Hipp Anna L (wid JD)r Atlanta rd (FO) Hipp Clyde E mech h Atlanta rd (FO) MARIETTA CITY DIRECTORY 203 Hipp Jos C USA r Atlanta rd (FO) Hipp Maggie E r Atlanta rd (FO) Hipps Clara h 117 Reynolds Hipps Gideon E (Daisy 0) 2 mach Bell Aircraft Corp h 512 Page Hipps Mary looper Holeproof Hosiery Co h 113 Reynolds Hipps Nathan R (Eliz A) 4 carp h 512 W Hansell Hipsher Chas H (Myrtle B) 3 mech Holeproof Hosiery Co h 615 Kenne- saw av Hisey J Paul millwright Bell Aircraft Corp r 408 Whitlock av Hitchcock Jas F (Roselle M) mech Bell Aircraft Corp h 801 3d Apt 1 Hitt Jas T (Vivian A) r Oak av (FO) Hobbs Emmett L (Aileene A) 2 eng Bell Aircraft Corp h 204 Phillips dr Hobby Marion L (Katrina H) 2 emp Bell Aircraft Corp h 116 E An- derson Hodges Doyl Mrs msngr Bell Aircraft Corp r 517 Church Hodges Drug Co (Wm H Dunaway) 24 N Park Square Hodges Etta cook Dixie Cafe r 502 Montgomery Hodges Grace C Mrs 1 looper Holeproof Hosiery Co r 523 W Hansell Hodges Jack M (Madeline S) 2 pharm Hodges Drug Co h 102 Forest av Hodges McCormick D (Ruby S) h 107 Forest av Hodges Roy (Etta) lab h 502 Montgomery Hodges Sarah nurse Marietta Hosp r same Hodges Virginia ofc sec dist ofc Farm Security Admn r 1014 Whitlock av Hoffman Earl (Adelaide) USA h 603 Birney Apt 1 Hogan Alton P (Helen) dir Rickenbacker Aircraft Training Sch h Atlanta- Marietta Hwy nr Clay Hogan Jos (Lula II) 1 emp The McNeel Marble Co h Rose la (Eliz) Hogg Robt L del slsmn The Texas Co h 100 Gramling Holbert Edw E USA r 701 Powder Springs Holbert Ernest H (Grace L) gro 701 Powder Springs h same Holbert J Houston (Marjorie P) 1 USA r 108 Trammell Holbrook Agnes h 211 Campbell Hill Holbrook Aurelian C (Sallie N) 5 electn h Cranfill (FO) Holbrook Cornelia US WAVES r Cranfill (FO) Holbrook Dorothy opr S B T & T Co r Cranfill Holbrook Harold student r Cranfill (FO) Holbrook Jessie looper Holeproof Hosiery Co r 211 Campbell Hill Holbrook Martha r 206 Geo Hamilton ct Apt 10 Holbrook Nell opr S B T & T Co r 109 Moon Holbrook Tim W Rev (Grace Mi) 2 pastor Maple Avenue Methodist Ch h 202 Maple av Holcomb Eug W (Jackie H) 1 USA r 411i/2 Lawrence Holcomb Harrel (Annie L) 1 emp Bell Aircraft Corp h 302 Austin av Holcomb Hazel G (Mrs J C) emp Bell Aircraft Corp r 1403 Roswell 204 BALDWIN'S 1944 Holcombe Herman M (Marian M) 1 electn Bell Aircraft Corp h 102 3d ct Apt 3 Holcomb Jackie II (Mrs E W) emp Bell Aircraft Corp r 4111/2 Lawrence Holcomb Jas C (Hazel G) 1 emp Bell Aircraft Corp r 1403 Roswell Holcomb Jas P (Willie C) USA h 411 Lawrence Holcomb Jessie r 522 W Hansell Holcomb Lelar r 119 Covington Holcomb Loraine (Mrs W S) looper Holeproof Hosiery Co r 945 Washing- ton av Holcomb Mamie R (wid E P) r 411 Lawrence Holcomb Marion (Eliz) hlpr City Sanitary Dept h 119 Covington Holcomb Mayes K (Dorothy P) 1 trk dr Peerless Furn Co h 113 Covington Holcomb Newton (Eliz R) 2 r 1407 Washington av Holcomb Warren J (Inas R) 2 formn Bell Aircraft Corp h 610 2d Apt 2 Holcomb Wm S (Loraine H) 1 farmer h 945 Washington av Holcombe Jas E (Mazie H) diesel opr Bell Aircraft Corp h 107 Delk Holcombe Jas H emp Holeproof Hosiery Co r Rose la (Eliz) Holcombe L C Mrs h Rose la Holcombe Loraine (Mrs W S) emp Holeproof Hosiery Co r 943 Washing- ton av Holcombe Luther G (Eliz O) 1 bkpr Harry N DuPre h 305 Maple av Holcombe Thos S student r 943 Washington av Holder Jos T (Della G) splicer S B T & T Co r 209 Geo Hamilton ct Apt 2 Holder Jos H (Jean) 1 emp S B T & T Co h 209 Geo Hamilton ct Apt 2 HOLEPROOF HOSIERY CO, Clyde Wilkins Genl Mgr, Albert A Strang Production Mgr, Guy H Northcutt Office Mgr, Geo W Kappas Supt, Raymond A Torgersen Industrial Relations Mgr, Hosiery Manufacturers, Sales Office, 205 Rose Lane--Tel 715 Hollingshead John H (May M) emp Brumby Chair Co h 608 Roswell Holland Asbury C (Lena W) slsmn Western Auto Assoc Store h 110 Hazel Holland Bryce (Margt G) 3 formn Bell Aircraft Corp h 619 Polk Holland David L r 411 Brook Apt 2 Holland Earl (Mattie) 8 elev opr Bell Aircraft Corp h 311 E Anderson Holland Helen B (Mrs T Scott) tchr Waterman Street Sch r 104 Forest av Holland Irma M elk US PO r 201 Waddell pi Apt 8 Holland Jas H elder Maloney Springs Primitive Baptist Ch r Austell rd (FO) Holland John I (Lucille P) inspr Bell Aircraft Corp h 411 Brook cir Apt 2 Holland Lucille (Mrs John I) emp Bell Aircraft Corp r 411 Brook cir Apt 2 Holland Thos W (Belle J) h 201 Waddell pi Apt 8 Hollemon Mattie 3 Indrs h 208 Mulberry Holliman Beatrice maid r 203 Johnson Holliman Herbert (Beatrice D) lab Bell Aircraft Corp h 203 Johnson marietta city directory 235 Holliman Octavia h 601 Hunt Hollingshead Carl H (Geneva C) 4 emp Brumby Chair Co h rear 1120 Powder Springs Hollingshead Clyde B (Jeanette H) 2 sander Brumby Chair Co h 121 Moores av Hollingsworth Walter tool mkr Bell Aircraft Corp r 513 Frasier Apt 1 Holloman Jas D (Lillia N) 1 lab Bell Aircraft Corp r 206 Fort Holloman Lizzie maid h 206 Fort Holloway Polly r 508 Lakewood dr Apt A Holman Carrie cook r 408 W W Lee ct Holmes Andrew S USA r 408 W W Lee ct Apt 2 Holman Carrie maid r 408 W W Lee ct Apt 2 HOLMES D H (Helen) Mgr Hanley Co h 704 Lawrence Holmes Ethel maid r 104 Harold Holmes Geo trk dr Southland Ice Co r 211 Johnson Holmes Helen W emp Hanley Co r 704 Lawrence Holmes Helen sch tchr r 704 Lawrence Holmes Mary h 408 W W Lee ct Apt 2 Holmes Nathan cook 1030 Cherokee h 313 Harold Holmes Nathan ydmn 1030 Cherokee r 1004 Cherokee Holmes R J (Louise S) 3 USA h 211 Johnson Holmes Robt lab r 104 Harold Holmes Robt J (Louise) 3 USA h 211^ Johnson Holmes Sylvia lndrs r 213 Johnson Holmes Wm H (Annie C) h 329 Lemon Holmes Wm H lab Southland Ice Co r 408 W W Lee ct Apt 2 Holsey Chapel (Methodist) Rev Ingram pastor 515 Montgomery Holt Chas N (Melela S) 1 accnt Bell Aircraft Corp h 540 McArthur dr Apt B Holt Ralph E (Foy W) 2 welder Bell Aircraft Corp h 504 Haynes Apt 3 Hombree John B (Elsie H) 1 emp L & N RR h Marble Mill (Eliz) Home Geo Wm (Nelsie) 1 loftsmn Bell Aircraft Corp h 307 Aviation rd Home Nathan J (Eliz D) furn rms 411 Church h same Honea Charley A (Marveen M) USA h 700 Roswell Honea Myrtle P (Mrs Oscar F) waitress Bell Aircraft Corp r 209 Locust Honey Nuney C (Mrs G P) 1 h Atlanta rd RD 5 Honea Oscar F (Myrtle P) USA r 209 Locust Honea Teresa (wid W T) h 823 Manget Honea W E (Edna R) 2 (Honea's Cafe) h Atlanta rd Honea's Cafe (W E Honea) Atlanta rd Hann Claude E (Christine S) 1 h 111 Stewart av Hood Jas W h 110 Merritt Hood John (Leila H) janitor Waterman Street Sch r RD 2 Hood John W (Ola K) warden County Prison Camp h Fairground nr Clay 206 BALDWIN'S 1944 Hood Jos R (Lois G) 1 swtchmn Bell Aircraft Corp h 612-a E Waterman Hood Max L (Athelene J) 2 mech Bell Aircraft Corp h Lakewood av RD 5 Hood Rosa S (wid Jas W) r 110 Merritt Hook Golson L (Hazel A) 2 carp Bell Aircraft Corp h 210 Fairground Hook Jean S (Mrs Robt H) elk Florence's Inc r 129 Trammell Hoak Robt H (Jean S) USA r 129/ Trammell HOOPER JOHN L (Darlene C) 1 Mgr Cobb Theatre h 802 E Waterman Hooper Sallie H (wid J W) h 209 Cleveland av Hopkins Addison G (Ida P) 1 wtchmn Glover Mach Wks h 520 W Hansell Hopkins Alice looper Holeproof Hosiery Co r 520 W Hansell Hopkins Bertice D (Edna) 2 sander Brumby Chair Co h 111 Gober Hopkins Clara M knitter Holeproof Hosiery Co r 111 Gober Hopkins Dora C elk McLellan Stores Co r Washington av Hopkins Ethel A student r 410 Powder Springs Hopkins Inez E r 111 Gober Hopkins J D (Lena C) USA r Nelson Hopkins Lawrence C (Rachel P) 2 mach Glover Mach Wks h 119 Delk Hopkins Raymond L (Louise P) 3 emp Brumby Chair Co h 115 S Alex- ander Hopkins Wendell (Dora C) emp Brumby Chair Co h Washington av Hood Cath 4 lndrs h 205 Page Hope Frances C (Mrs H E): tchr Elizabeth Stch r 201 McCord Hope H Ewell (Frances C) 1 (Kennesaw Publishing Co 201 McCord h same Hoppe Laura B (wid L D) h 113 Gober Hopper Katie tchr Elizabeth Sch r Marble Hill (Eliz) Hord Florence (Mrs G E) emp Bell Aircraft Corp r 714 4th Apt 2 Hord General E (Florence) 2 emp Bell Aircraft Corp h 714 4th Apt 2 Horn Elmer L (Margt H) 2 mach Bell Aircraft Corp h 117 Kings ct Apt A Horn Fred (Lucile D) 1 emp Bell Aircraft Corp h 406 W W Lee ct Apt 5 Horn House (Nathan J Home) furn rms 411 Church Horne Lucile cook 612 Atlanta 406 W W Lee ct Apt 5 Horne Douglas B (Nancy B) 1 ofc wkr Bell Aircraft Corp h 109 Hedges Apt 2 Horne Lucile cook 512 Atlanta 406 W W Lee ct Apt 5 Horton Earl C (Julia W) 1 loftsmn Bell Aircraft Corp h 304 Park View av Hosiery Shop The (Fred W Clarke) 205 W Anderson Hoskins Homer C (Hellen) USA r 505 Powder Springs Hoskins John W (Mildred B) 1 h 205 Geo Hamilton ct Apt 6 House Frank (Mary C) firemn City Fire Dept 209 Geo Hamilton ct Apt 4 Houston Gloria student r Garrison rd RD 5 Houston L R (Mary R) 4 mech Lewis-Noe Mtr Co h Cogburn rd (Eliz) Houze Glenn W (Daisy) 2 sheetmetal wkr F E A Schilling Inc h 127 Griggs Howard Andrew (Eva B) 3 pntr h 126 Delk Howard Betty Ann emp Bell Aircraft Corp r Joyner av (FO) marietta city directory 207 Howard Buford B (Doris M) 1 pntr Bell Aircraft Corp h 700 6th Apt 1 Howard Chas C (Lemma P) stone ctr McNeel Marble Co h 106 Holland Howard Chas W USA r Joyner av (FO) Howard Clarence E (Paralee B) dr Morrison Taxi h 111 Poplar Howard David R (Irene M) h 120 Clay Howard Della G (wid J E) r 807 4th Apt 3 Howard Esther (Mrs Grady) elk Kaplan's Dept Store r Austell rd (FO) Howard Estelle M (Mrs R E) emp Bell Aircraft Corp r 807 4th Apt 3 Howard Ethel G Mrs waitress Model Cafe r 200 Polk Howard Geraldine P (Mrs H J) of'c wkr Bell Aircraft Corp r 607 3d Apt o Howard Glen O (Ann S) 1 mach Bell Aircraft Corp h 409 Aviation rd Howard Glen O (Eliz C) trk dr American Lndry r 106 Holland Howard Grady H (Esther) whse mgr Sinclair Refining Co r RD 4 Ploward Grady (Esther R) 1 emp Sinclair Refining Co Butler h Aus- tell rd (FO) Howard Henry J (Geraldine C) 1 mech Bell Aircraft Corp h 607 3d Apt 5 Howard Irene (Mrs D R) elk Andrew M Weems r 120 Clay Howard Isaac J (Desse W) 1 emp Bell Aircraft Corp h Joyner av (FO) Howard Jas C elk US PO r 106 Holland Howard Jos (Lillie) 2 emp Ga Power Co h 223 Montgomery Howard Lamar (Ruth L) 2 mech Bell Aircraft Corp h 614 Morningside dr Apt 2 Howard Paul L USN r Joyner av (FO) Howard Paul W (Verna H) 4 cond Atlanta Northern Ry h Joyner av (FO) Howard Priscilla r 323 Lemon Howard Ruel E (Estelle M) 2 welder Bell Aircraft Corp h 807 4th Apt 3 Howard Wallace O (Nell S) dr Safety Cab Inc h 404 Church Apt 1 Howard Wm J USN r Joyner av (FO) Howard Wm L (Lula B) h 110 Forest av Howell Ellen E r 312 Kennesaw av Howell Ethelyne (wid C C) waitress Marietta Cafe r Austell Ga RD 1 Howell Georgia D (wid EC) h 401 Campbell Hill Apt 4 Howell J H (Mary F) mech Bell Aircraft Corp h 610 2d Apt 6 Howell Julia B r 312 Kennesaw av Howell Mary D h 312 Kennesaw Howell Milton L (Gertrude P) 1 trkr h 804 E Waterman Howie David H (Dorris S) 1 rigger Bell Aircraft Corp h 705 3d Apt 1 Hubbard Vanburen (Sarah M) 1 asst supt h 126 South av Hubble Agnes emp Bell Aircraft Corp r 312 Frasier Huber Jos M (Kath) 1 formn Bell Aircraft Corp h 162 Hedges Apt 1 Huddleston D W Jr (Margt P) 3 lab r 703 Cherokee Huddleston H P (Kath) 2 emp Bell Aircraft Corp h 801 4th Apt 3 Hudgins Ralph N (Magdalene W) 3 emp Bell Aircraft Corp h 807 4th Apt 2 208 BALDWIN'S 1941 Hudson Arth (Leo H) 1 emp Brumby Chair Co h 112 S Alexander Hudson Benj h Canton rd (Eliz) Hudson Ernestine 1 r 303 Page Hudson Georgia T r 204 Page Hudson 0 L (Delia C) 4 boiler opr Bell Aircraft Corp h Marble Mill (Eliz) Hudson Wilbur h 204 Page Hudspath Ralph guard Bell Aircraft Corp r 115 Glover Huff Chas F (Frances H) 1 tmkpr Bell Aircraft Corp h 406 Church Huff John H (Evelyn S) 1 emp Bell Aircraft Corp h 102 3d ct Apt 4 Huffman Aubrey D (Willie L) 1 mech Bell Aircraft Corp h 801 1st Apt 1 Huffman Aubrey emp Bell Aircraft Corp r 100 Gramling Huffman Bonnelle student r 801 1st Apt 1 Huffman Hill R (Suzanne H) 2 asst supvr Bell Aircraft Corp h 401 Camp- bell Hill Apt 2 Hughes Elijah D emp W P Stephens Lbr Co r 1120 Powder Springs Hughes Eugene D (Edith H) 2 h 516 Lawrence Hughes Evelyn student r 418 Maple av Hughes Jas W (Lila S) 1 USA r 212 Roswell Hughes Jos C (Mary W) 2 tractor dr Bell Aircraft Corp h 900 3d Apt 4 Hughes Margt (Mrs W A) emp Bell Aircraft Corp r 904 3d Apt 6 Hughes Mary W (Mrs Jos C) emp Bell Aircraft Corp r 900 3d Apt 4 Hughes Millie R (wid W M) 1 h 418 Maple av Hughes W A (Margt) emp Bell Aircraft Corp h 904 3d Apt 6 Huggins John D (Manelle F) 1 formn Bell Aircraft Corp h Darnell rd (FO) Huggins Mineola (wid G H) sten r 210 Campbell Hill Huil Robt (Alberta) 1 lab r 107 Mulberry Hulsey Albert J (Callie B) emp Bell Aircraft Corp h 507 Stewart av Hulsey Eunice M Mrs 1 ship elk Holeproof Hosiery Co r 306 Maple av Hulsey Everhart (Mrs Herman) opr S B T & T Co r Smyrna, Ga Hulsey Jas J USN r Miller av (Fo) Hulsey Josephine (wid J W) h Miller av (FO) Hulsey Leland (Mary L) 1 USA h 815 4th Apt 6 Hulsey Mary L (Mrs Leland) waitress Bell Aircraft Corp r 815 4th Apt 6 Hulsey Mary M emp Bell Aircraft Corp r 815 4th Apt 6 Hulsey R E (Mary B) 3 emp Bell Aircraft Corp h 109 Lacy Hulsey Wm J (Ellen B) 1 pntr Bell Aircraft Corp h Miller av (FO) Hull Wm ydmn r 212 Johnson Hume Robt (Carolyn R) 1 USA r 516 Church Humprey Chas (Coella M) emp Southland Ice Co r 128 Henderson Humprey Coella maid r 128 Henderson Humphrey Lora Mrs r 808 4th Apt 2 Humphreys Alf C (Kath) 2 elk Bell Aircraft Corp h 808 4th Apt 2 marietta city directory 209 Humphries Elmer F (Evelyn V) tool mkr Bell Aircraft Corp h 105 Fairground extd Apt 2 Humphries Mollie cook r 328 Lemon Humphries Wm (Mollie F) h 328 Lemon Hunicutt Wm F (Allie S) 1 stone ctr The McNeel Marble Co h Rose la (Eliz) Hunley Hanna student r 705 Wright Hunley Iommy H r 705 Wright Huntley Lucy h 705 Wright Hunley Martha cook r 705 Wright Hunley Theo (Cora) 2 lab h 126 Mulberry Hunnicutt Clarence B (Effie H) mach h Cogburn av (Eliz) Hunnicutt demon (Christine) 3 trk dr Dunn Feed & Gro Co h Cogburn av (Eliz) Hunnicutt Clinton (Hazel W) 1 r Cogburn av (Eliz) Hunnicutt Edna T (Mrs Ernest N) looper Holeproof Hosiery Co r Ward (Eliz) Hunnicutt Ernest N (Edna T) 3 emp Bell Aircraft Corp h Ward (Eliz) Hunnicutt Ernest T Jr student r Ward (Eliz) Hunnicutt Howard USA r Ward (Eliz) Hunnicutt Howard (Mary D) USA r 124 Moores av Hunnicutt Mary D (Mrs W H) emp Bell Aircraft Corp r Rose la (Eliz) Hunnicutt Mary D (Mrs Howard) emp Bell Aircraft Corp r 124 Moores av Hunnicutt W Howard (Mary D) USA r Rose la (Eliz) Hunnicutt Wm C emp Bell Aircraft Corp r Cogburn av (Eliz) Hunt Armstrong (Helen W) 1 store mgr W P Stephens Lbr Co h 116 Forest av Hunt Buren G (Robbie) 1 (Economy Ice Cream Co) h 114 Butler Hunt Clarence (Joy U) USA r 202 Austin av Hunt Daisy A emp Dixie Cafe r 410 Robeson ct Apt 2 Hunt E R (Ruth W) USA h 109 N Forest av Hunt Elwood M (Ardis G) 2 ofc wkr Bell Aircraft Corp h 161 W Dixie av Hunt Euel (Christine S) 4 emp The McNeel Marble Co h Poplar (FO) HUNT HARVEY H (Harvey H Hunt Co) Certified Public Accountant 1110 First National Bank Bldg, Atlanta--Tel WA 4484 HUNT HARVEY H CO (Harvey H Hunt) Accountants, Auditors and Tax Consultants, 1110 First National Bank Bldg, Atlanta--Tel WA 4484 (See left bottom lines and Buyers' Guide) Hunt Julia (wid R E) r 200 Merritt Hunt Julia G (wid Robt E) r 200 Merritt Hunt Joy (Mrs Clarence) slswn Saul's Dept Store r 202 Austin av Hunt Mae B Mrs 1 h Atlanta rd (FO) Hunt Oliver (Daisy A) 2 USA h 410 Robeson ct Apt 2 Hunt Wm R student r Atlanta rd (FO) 210 BALDWIN'S J!) Hunter Annie M maid h 108 Fort Hunter Chas (Katie) 3 (Hunter's Cafe) h 307 Hunt Hunter Chas F emp Brumby Chair Co r 205 Merritt Hunter Comer (Flora) 2 lab h 215 Maple Hunter Daisy dishwasher Dixie Cafe r 410 Robeson ct Apt 5 Hunter Douglas P (Lola T) electn Bell Aircraft Corp r 809 Manget Hunter Edwin T (Ethel P) 2 patrolmn City Police Dept h 200 Wayland Apt 10 Hunter Eliz emp Bell Aircraft Corp r 106 Delk Hunter Ella Indrs h Rose la (Eliz) Hunter Fay bkpr B & N Auto Parts Co r 106 Delk Hunter Frank P (Minnie T) carp Mitchell Furn Mfg Co h 809 Manget Hunter Gordon mach Bell Aircraft Corp r 235 Hill ct Hunter H Herbert (Willie) (Hunter's Barber Shop) 106 Delk Hunter Jas R USN r 809 Manget Hunter John S USA r 809 Manget Hunter Julius (Lura) emp Anderson Mtr Co h 909 N Cole Hunter Lola T (Mrs D P) bkpr Sears Roebuck & Co r 809 Manget Hunter Willie Indrs r 307 Hunt Hunter's Barber Shop (H Herbert Hunter) 211 Church Hunter's Lunch (Chas C Hunter) restr 231 Montgomery Huntington F B (Zelpha) 3 emp Bell Aircraft Corp h 415 Park View av Huntington Zelpha (Mrs F B) emp Bell Aircraft Corp r 415 Park View av Hunton Geo T (Dora H) guard Bell Aircraft Corp h 205 George Hamilton ct Apt 4 Hunton Mary L slswn Fletcher Studio & Gift Shop r 205 George Hamilton ct Apt 4 Hunton Wm H USN r 205 George Hamilton ct Apt 4 Hurley Jack const wkr r 411 Church Hurley Sweetie cook h 603 Hunt Hurst Alice r 136 Garrison dr Hurst Chas J (Pauline G) 2 guard Bell Aircraft Corp h 136 Garrison dr Hurst Claude student r Nelson Hurst Claude slsmn Kaplan's Dept Store r RD 1 Hurst D Lemuel (Emma B) h Nelson Hurst Frank USA r Nelson Hurst Gordon R (Lizzie H) 4 stock elk Bell Aircraft Corp h 203 Locust Hurst Grace r Nelson Hurst Jeannette emp Bell Aircraft Corp r Nelson Hurst Lee emp Bell Aircraft Corp r Nelson Hurst Lizzie H (Mrs Gordon R) emp Cobb County Times r 203 Locust Hurst Odessa r 203 Locust Hurst Willie B (Mrs E M) nurse County Health 515 Whitlock av Hurst Wm polisher The McNeel Marble Co r 203 Locust marietta CITY DIRECTORY 211 Husley Rachel B (Mrs Roger) usher Strand Theatre r Atlanta rd Husley Roger (Rachel B) USA r Atlanta rd Hutchens Nimrod (Eva S) USA r 318 W Goss Hutcheson John 0 formn Bell Aircraft Corp r 105 Delk Hutcheson Robt H (Christine G) 1 aud Brumby Chair Co h 615 Whitlock avenue Hutchins John C (Lula M) 1 lab h 401 Lemon Hutchins Lula lndrs r 401 Lemon Hutchins Nancy 406 Robeson ct Apt 1 Hutson Roberta 1 ins solr r 101 Edwards dr Hyde Homer Feed Store (Homer L Hyde) 109 Lawrence Hyde Homer L (Bertha R) (Homer Hyde Feed Store) h 800 Church Hyde Horace L (Nannie L) ctr The McNeel Marble Co h 207 Stewart av Industrial Life & Health Insurance Co Ernest E Brown and Jas W Petty agents 64 S Park Square Ingram Ernest S (Eva Y) 4 brklyr h 601 Atlanta Ingram Fredk emp Bell Aircraft Corp h 808 Austin Ingram Fred (Pearl R) 3 oiler Bell Aircraft Corp h Cogburn rd (Eliz) Ingram Jas L (Eliz P) carp h Fair RD 5 Ingram J Kemp (Margt B) 2 ofc wkr h 107 E Dobbs Ingram Lavonne) student r 908 N Cole Ingram R B lab r 206 Fort Interstate Life & Accident Co Aaron G Haskins Jas E Mulkey agts IOOV2 Whitlock av Ireland Gertrude W r 206 Campbell Hill Ireland Sarah ofc wkr r 501 Church Apt 5 Irving's 5 & 10c Store (Irving Bryan) 38 W Park Square Irvin J F (Helen D) 2 mech Bell Aircraft Corp h 417 Brook cir Apt 2 Irvin John T (Mray G) 1 elk US PO h 1008 Whitlock av Irvin Maggie lndrs h Tower rd (Eliz) Itkrin Frank (Mary) trk dr City Sanitary Dept h 700 Pine Itkrin Mary maid r 700 Pine Ivey Douglas USA r Church (Eliz) Ivey Howard (Orene S) 1 dr Safety Cab Inc h Rose la (Eliz) Ivey Jane L (wid C C) h Church (Eliz) Ivey J D (Cora F) trk dr h Marble Mill (Eliz) Ivey J Wm (Mamie C) dr Safety Gab Inc h Cogburn rd (Eliz) Ivy Mary (Mrs A N) 1 emp Bell Aircraft Corp r 100 Henderson 212 BALDWIN'S 1944 JXO FIND A NAME YOU MUST KNOW HOW TO SPELL, IT Jack's Place (Sidney Pace) 102 Washington Jackson Jos M (Julia B) dist supt Gulf Life I nsCo h 602 Alexander cir Jackson Julia (Mrs J M) sten Gulf Life Ins Co r 602 Alexander cir Jackson Alexander (Regina J) 2 USA r 503 Lemon Apt 8 Jackson Berta L (Mrs J R) battery filler r Hill RD 5 Jackson Bertha opr S B T & T Co r 310 Powder Springs Jackson Bertha r 406 Robeson ct Apt 2 Jackson Bonzel emp Bell Aircraft Corp r 308 Washington av Jackson Caroline lndrs h 133 Mulberry Jackson Chester carp r 225 Mlontgomrey Jackson Donovan USN r 132 Garrison dr Jackson Eliz M r 516 Roosevelt cir Apt B Jackson Fannie K 1 lndrs r 224 Johnson Jackson Florie cook r 406 W W Lee ct Apt 7 Jackson Frances (Mrs Marvin) emp Fulton Bag Cotton Mill r Concord rd (FO) Jackson Frank (Bessie H) pattern mkr Bell Aircraft Corp h 516 Roosevelt cir Apt B Jackson Georgia cook 416 Whitlock av r 220 Reynolds Jackson Geridine emp Bell Aircraft Corp r 306 Polk Jackson Gilbert L (Ernestine H) 2 waiter Stonewall Court h 406 W W Lee ct Apt 8 Jackson J W ins slsmn r 602 Alexander cir Jackson Jas P (Clessie S) die mkr Bell Aircraft Corp h 132 Garrison dr Jackson Jesse R (Berta L) 1 weaver h Hill RD 5 Jackson Jos (Evelyn A) 2 lab Bell Aircraft Corp h 406 Robeson ct Apt 2 Jackson Jos M (Julia B) 1 dist supt Gulf Life Ins Co h 602 Alexander cir Jackson Kath sten City Board of Light & Water Wks r 306 Polk Jackson L C (Willie S) lab r 123 Henderson Jackson Lillie M (Mrs M C) asst mgr Excelsior Lndry r 312 Church Apt 1 Jackson Margt student r 227 E Dixie av Jackson Marvin (Frances) 1 h Concord rd (FO) Jackson Mary maid r 107 Mulberry Jackson Mary P (Mrs W A) resident mgr Page Development Co r 521 McArthur dr Apt A Jackson Mattie maid Marietta Hotel r 205 Denmeade Jackson Milo C (Lillie Mae) 1 mgr Excelsior Lndry h 312 Church Apt 1 Jackson Nan C (wid J H) r 204 E Dixie av Jackson Peter taxi dr r 107 Glover Jackson Robt (Eliz) asst mgr A & P Food Stores h 400 Wright marietta city directory 213 Jackson Robt (Beatrice N) 1 lab Bell Aircraft Corp r 210 Maple Jackson Robt H (Georgia) emp Bell Aircraft Corp h 22.0 Reynolds Jackson Robt L (Dorothy P) 2 sign pntr r 115 Delk Jackson Robt W mach r 714 Atlanta Jackson Rosa cook r 320 Lemon Jackson Sam G (Charlotte S) emp Bell Aircraft Corp r 405 Cherokee Jackson Sol (Mary) repr Marietta Shoe Shop h 107 Mulberry Jackson Thos E (Florie H) 1 lab Brumby Chair Co h 406 W W Lee ct Apt 7 Jackson Thos G (Virginia M) 1 meat ctr A & P Food Stores h 109 Maxwell Jackson W A (Mary P) 1 ofc wkr Bell Aircraft Corp h 521 McArthur dr Apt A Jackson W Housan (Beatrice B) eng State Hwy Dept h 227 E Dixie av Jackson Will (Ethel) 1 lab Brumby Chair Co r 505 Montgomery Jackson Wm T (Eliz C) cond N C & St L RR h 306 Polk James Albert C (Eva T) 1 slsmn Brumby Furn Co h 109 Frasier James Annie K maid r 712 Fort James Bessie W (wid H E) 2 inspr Bell Aircraft Corp h 206 George Ham- ilton ct Apt 8 James Cook (Fannie M) elk Stonewall Liquor Store r 119 Trammell James Ina K nurse 620 Whitlock av r 712 E Fort James Jesse C (Rose M) 2 atndt Hardage Service Sta h 206 Cole James John H (Rosa P) 5 lab Brumby Chair Co h 712 Fort James Josie (wid Sami E) h 211 Locust James Luke elk Daniell Jewelry Store r 211 Locust James Luther C (Rosa L) ins solr h 132 Trammell James Mabel S (Mrs J H) r 1210 Frasier Apt A James Mamie emp Nu-Way Clnrs & Lndry r 807 N Cole James Martha C (wid L H) r 1401 Roswell James Mary L maid 100 Wright r 712 Fort James Wm Jr trkr Southland Ice Co r 807 N Cole Janelli Jack (Rachel) USA r 408 Whitlock av Jarard Eston (Lula C) 1 guard Bell Aircraft Corp r 308 Austin Jardine Jas tool designer Bell Aircraft Corp r 212 McCord Jarrard Eston (Lula C) 1 guard Bell Aircraft Corp h 125 Moores av Jarrard Eug ofc wkr Bell Aircraft Corp r Marble Mill (Eliz) Jarvis Thos 1 emp Bell Aircraft Corp h Bingham (FO) Jay Bonnie B (Mrs L D) winder Holeproof Hosiery Co r 322 Campbell Hill Jay Emmett J (Eva B) fixer Holeproof Hosiery Co h 220 Campbell Hill Jay Eva B (Mrs E J) pairer Holeproof Hosiery Co r 220 Campbell Hill Jay Minnie G (Mrs R F) looper Holeproof Hosiery Co r 202 Radium Jay Roland F (Minnie G) 1 mech Holeproof Hosiery Co h 202 Radium Jay Theo D (Bonnie B) 1 fixer Holeproof Hosiery Co h 222 Campbell Hill 214 BALDWIN'S 1944 Jay's Chapel Rev Bayard C Speers Jr pastor 1200 Roswell Jefferson Clara maid r 103 Fort Apt 8 Jefferson Eug . (Bessie) 4 lab h 326 Lemon Apt 1 Jefferson Eugene (Bessie P) 3 h 406 Robeson ct Apt 5 Jefferson Eug Jr r 406 Robeson ct Apt 5 Jefferson Jas C USA r 406 Robeson ct Apt 5 Jefferson Nilous lab r 103 Lake Jefferson Robt USA r 406 Robeson ct Apt 5 Jefferson Wavis (Clara) lab Bell Aircraft Corp h 103 Fort Apt 8 Jefferson Willie lndrs r 108 Mulberry Jenkins Alice M maid h 505 W Goss Jenkins Beulah M student r 410 Powder Springs Jenkins Ella h 206 Maple Jenkins Grady USA r 505 W Goss Jenkins Guy F (Mary C) 1 paymaster W L Florence Constr Co h Concord rd Apt 14-a (FO) Jenkins H Grady (Mary C) 3 slsmn Brumby Chair Co h 403 Polk Jenkins Lawrence D (Martha V) emp Bell Aircraft Corp r 511 Church Jenkins Maggie cook r 409 Cole Jenkins Martha V (Mrs L D) emp Bell Aircraft Corp r 511 Church Jenkins Mollie r 112 Coryell st Jenkins Robbins USA r 206 Maple Jenkins T J USN r 206 Maple Jenkins E Virginia ofc wkr Bell Aircraft Corp r 403 Polk Jenkins Walter USN r 206 Maple Jennings Jas hlpr Carter Candy Co r RD 1 Jennings Leila lndrs h 706 Lawrence Jennings Ludie M maid h 107-c Page Jennings Lunie candy mkr Carter Candy Co r RD 1 Jennings Roy T (Clara E) 1 eng Bell Aircraft Corp h 113 Hedges Apt 2 Jennings Wm (Roselee) 3 emp Brumby Chair Co h 117 Greer av Jennings Wm Jr emp Brumby Chair Co r 117 Greer av Jervey Walter Jr (Margt W) 2 asst sec-treas Glover Mach Wks h 1001 Cherokee Jillson Betty waitress Skinner's Cafe r 106 E Dixie av Jervey W E r 1001 Cherokee Jervey W E III student r 1001 Cherokee Joe's Place (Jos S Townsend) Church (Eliz) Johns E Ralph (Maridell C) 2 emp Bell Aircraft Corp h 412 Grover Johns J Buel (Aleph M) 1 mach opr Bell Aircraft Corp h 712 4th Apt 4 Johnson Alexander tailor Walter W Hazel r 807 Lawrence Johnson Aubrey E (Velma T) 3 h 204 Merritt Johnson Cecil F (Nancy S) eng Bell Aircraft Corp h 110 Colonial cir Apt 2 Johnson Chas (Grace) wtchmn L & N RR h 108 Johnson MARIETTA CITY DIRECTORY 315 Johnson Chas (Odene L) emp Bell Aircraft Corp r 208 Sessions Johnson Chas (Mary L) 1 expeditor Bell Aircraft Corp h 311 Lakewood dr Apt B Johnson Chas (Grace) wtchmn L & N RR h 108 Johnson' Johnson Chas L (Myrtle L) asst U S Postmaster h 226 E Dixie av Johnson Christine cook Abbott's Coffee Shop r 123 Fort Johnson Clarence (Essie K) 1 eng Bell Aircraft Corp h 801 4th Apt 6 Johnson Cleve (Maggie) barber h 602 Hunt Johnson Eliz tchr Marietta High Sch r 104 Forest av Johnson Emma L maid h 2151/2 Johnson Johnson Emma R cook 238 Club dr 401 Club dr Johnson Everett H (Ruth E) 1 formn Bell Aircraft Corp h 102 Phillips drive Johnson Floyd C (Christine) jan First Methodist Ch h 123 Fort Johnson Geo ydmn 215 Wright r 213 Greer av Johnson Harry B (Winifred L) 2 emp Bell Aircraft Corp h 1703 N Park dr Johnson Henry M (Mary T) USN h 205 Waddell pi Apt 4 Johnson Homer H (Cath G) 2 emp Bell Aircraft Corp h Kirkpatrick dr Johnson Howard W (Gertrude S) designer Bell Aircraft Corp h 104 Kings ct Apt B Johnson Hoyt N (Curtis C) 1 rate elk L & N RR and N C & St L RR h 505 Lawrence Johnson Hubert F (Miriam E) linemn S B T & T Co r Jasper, Ga Johnson Hubert R (Sarah L) 2 h Austell rd (FO) Johnson Ina indrs h 908 N Cole Johnson Jas (Nettie M) lab h 503 Lemon Apt 8 Johnson Jas C (Beulah S) 1 eng Bell Aircraft Corp h 229 E Dixie av Johnson Jasper J (Annie P) 3 formn Bell Aircraft Corp h Cochran (FO) Johnson John N sexton Marietta Cemetery r 301 Clay Johnson Leon M (Ara S) 2 emp Bell Aircraft Corp h Atlanta rd Apt 202 (FO) Johnson Loraine ofc wkr Bell Aircraft Corp r Concord rd (FO) Johnson Lorene r 108 Shepard Johnson Louis (Louise T) 2 lab r 805 Lawrence Johnson Louis H (Jeanne O) inspr Bell Aircraft Corp h 118 Hedges Apt 2 Johnson Lula maid 606 2d Apt 2 r Atlanta Ga Johnson Martha cook 515 Whitlock av r 409 Reynolds Johnson Mary maid 601 Whitlock av r 306 Fort Johnson Mary maid r 114 Holiday Johnson Mathews O (Lucile H) 1 elk Bell Aircraft Corp h 219 Waterman Johnson Nettie maid 1026 Cherokee r 503 Lemon Apt 8 JOHNSON ODENE L (Mrs C D) City Clerk and Treas of Board of Light * & Water Works r 208 Sessions--Tel 403-W 216 BALDWIN'S 1944 Johnson Paul E (Christine S) 2 vice-pres Atlanta Hosiery Co h 104 Seminole dr Johnson Ralph B (Marjorie R) 1 ofc wkr Bell Aircraft Corp h 106 Colonial cir Apt 1 Johnson Ralph W electn Bell Aircraft Corp r 600 Roosevelt cir Apt B Johnson Reuben (Hattie H) ydmn h 807 Lawrence Johnson Rhoda lndrs h 702 Wright Johnson Robt L (Irene A) 2 instr Bell Aircraft Corp h 210 Aviation rd Johnson Ruben (Martha) 4 elk h 409 Reynolds Johnson Rufus J (Eliz B) h 303 Lemon Johnson Sallie lndrs r 324 Lemon Johnson Sarah L (Mrs H R) emp Bell Aircraft Corp r Austell rd Johnson Spurgon emp Bell Aircraft Corp r 606 Cole Johnson Theo (Sallie) lab h 324 Lemon Johnson Vera F (wid J W) r 1309 Roswell Johnson Wm (Emma R) emp Marietta Golf Club r 401 Club dr Johnson Wm E (Carrie S) lab Brumby Chair Co h 108 Shepard Johnson Wm M (Jessie H) (Johnson Service Sta) h 139 Trammell JOHNSON WM M (Jessie I) (Johnson's Pontiac Service Station) h 139 Trammell Johnson Wm P (Theresa C) 1 emp Bell Aircraft Corp h 302 Cleburne av JOHNSON'S PONTIAC SERVICE STATION (Wm M Johnson) Pontiac Sales and Service, Woco-Pep Gasoline, Tiolene Oil, Yale Tires and Battery--225 Atlanta--Tel 131 (See Buyers' Guide) Johnston D Russell (Aurelia H) 1 mech Bell Aircraft Corp h 606 2d Apt 6 Jolley Floyd L (Leola H) patrolmn City Police Dept h 424 Atlanta Jolly Hilliard J (Mary R) h 304 Polk Jolley Kath R 1 emp S B T & T Co r 424 Atlanta Jonas Ira C (Doris J) 2 USA h 622 Birney Apt 1 Jones Fannie lndrs h 202 Denmeade Jones Jas (Lizzie J) lab h Concord rd (FO) Jones Arth (Cath) USA h 206 Jones Jones Arth (Bertha F) brklyr h 525 Washington av Jones Augustus P (Opal) County Tax Assessor r Vinings, Ga Jones Benj r 117 Henderson Jones Betty J student r 642 Atlanta Jones Clara Jean reporter The Atlanta Constitution r 300 McDonald Jones Chas carp r 104 Shepard Jones Cornelia r 508 W Goss Jones Denner W (Matie J) uphol 202 Polk h same Jones Duard A (Helen G) welder Bell Aircraft Corp h 805 4th Apt 1 Jones Eug T (Ruby P) 2 drftsmn Bell Aircraft Corp h 504 Page Jones Fannie G (wid J W) r 512 Lakewood dr Apt A Jones Frances cook 404 Cherokee h 503 Lemon Apt 4 MARIETTA CITY DIRECTORY 217 Jones Fred lab r 401 Cole Jones Hoke S (Charlsa H) 1 emp Bell Aircraft Corp h Atlanta rd (FO) Jones J C Jr USN r 203 Sessions Jones Jane S r 503 Lemon Apt 4 Jones Janie tchr Lemon Street Sch r 902 N Cole Jones Jas lab Southland Ice Co r 313 Page Jones Jas (Anna J) hlpr McPherson Tire Shop h 504 Lemon Apt 10 Jones Jewel emp Bell Aircraft Corp r 308 Washington av Jones Joe emp Bell Aircraft Corp h 505 Alexander cir Jones John C (Naomi T) USA r 705 Lawrence Jones John C USA r 504 Lemon Apt 1 Jones John T (Louise L) USMC r 515 Lawrence Jones Julius C (Millie) ofc wkr h 203 Sessions Jones Kath emp Bell Aircraft Corp r 404 Cherokee Jones Louise S (Mrs J T) emp Marietta Hosiery Co r 515 Lawrence Jones Lucile L (wid Earl) r 401 Polk Jones Martin lab The McNeel Marble Co h 120 Johnson Jones Marvin O student r 113 Holiday Jones Mary maid r 409 Lemon Jones Mary maid 308 Campbell Hill r 107 Mulberry Jones Melvin M (Mary D) fnshr Brumby Chair Co h 220 Montgomery Jones Nannie J (wid CL) h 103 Locust Jones Naomi T maid r 705 Lawrence Jones Nelson (Hattie) 2 filler Brumby Chair Co h 634 Pine Jones Nettie emp Bell Aircraft Corp r 642 Atlanta Jones O W emp Bell Aircraft Corp r 617 Powder Springs Jones Paul E USN r 640 Atlanta Jones Pearlina 2 Indrs h 311 Page Jones Peggy emp Western Union Teleg Co r 118 Forest av JONES PHARMACY (Virgil M Jones) Drugs, Prescriptions, Drugs Sun- dries, Surgical Supplies, Kodox Films and Supplies, 18 N Park Square --Tel 305 and 306 (See Buyers' Guide) Jones Rosa cook r 206 Johnson Jones Sami USA r 217 Maple Jones Sarah student r 104 Shepard Jones T D elk Bell Aircraft Corp r 316 Freyer dr Jones Theophilus (Roberta B) lab Bell Aircraft Corp h 511 Lemon Apt 4 Jones Velma maid 301 Washington av r 314 W Goss JONES VIRGIL M (Louise S) 1 (Jones Pharmacy) h 126 Trammell Tel 570 Jones Virginia C Mrs 1 aud r 101 Seminole dr Jones Willie syrayer Brumby Chair Co r 212 Johnson Jones Wm B (Lonettie F) tool mkr Bell Aircraft Corp h 312 Church Apt 4 Jones Wm H (Laura C) 3 emp Bell Aircraft Corp h 642 Atlanta 218 BALDWIN'S 1944 Joop Rudolph F (Othalia K) 1 USA h 604 Birney Apt 1 Jordan Claude M (Norine S) 2 patrolmn City Police Dept h 109 South av Jordan Glenn D emp W P Stephens Lbr Co r 726 Roswell Jordan Harold Rev emp Bell Aircraft Cpro r 102 Denmeade Jordan Jas E USN r 208 Stewart av Jordan Lula maid r 502 W Goss Jordan Norine S (Mrs C M) pairer Marietta Hosiery Co r 109 South av Jordan W Paul (Callie B) 2 carrier US PO h 726 Roswell Jordan Regina B (Mrs W W) ofc wkr Beil Aircraft Corp r 233 Atlanta Apt 2 Jordan Starling E (Janie C) slsmn The McNeel Marble Co h 208 Stew- art av Jordon Steve W (Dorothy B) 1 firemn Bell Aircraft Corp h 900 3d Apt 3 Jordan Thurston trk dr Clackum's Trans Co r 104 Elk Jordan W Clelland USN r 726 Roswell Jordan Wm W (Regina B) 1 drftsmn Bell Aircraft Corp h 233 Atlanta Apt 2 Jorn Ralph E (Geneva M) slsmn r 208 McDonald Joyner Hardy (Mary) emp Brumby Chair Co r 121 Mulberry Joyner Jas B (JosephineM) USA r 105 Waterman Just Theo W (Laverna R) 1 safety mn Bell Aircraft Corp h 205 Phil- lips dr TO FIND A NAME YOU MUST KNOW HOW TO SPELL, IT Kade Dora cook 209 E Dobbs r 217 Reynolds Kakal August (Sarah R) 2 inspr Bell Aircraft Corp h 405 Fairground Kane Chas h 102 Colonial cir Apt 2 KAPLAN BENJ (Ester G) 2 (Kaplan's Department Store) h 849 Church--Tel 849 KAPLAN'S DEPARTMENT STORE (Benj Kaplan) 17-18 E Park Square --Tel 146 KAPPAS GEO W (Lucile) 2 Supt Holeproof Hosiery Co, h 309 Kennesaw av--Tel 29 Karle Hattie (Mrs P H) ofc sec Bell Aircraft Corp r Atlanta rd (FO) Karle P Hester (Hattie B) 2 ofc wkr Bell Aircraft Corp r Atlanta rd (FO) Kay Evelyn ofc wkr r 807 Cherokee Kay Harlen firemn L & N RR r 103 Moon Kay Paul C (Bessie Y) h 807 Cherokee Keahey Thos E (Corinne R) 1 USA h 421 Brooks cir Apt 2 Kee Jack H (Frances S) 1 mech Bell Aircraft Corp h 106 Allgood rd Apt 2 Keefe Angie B (wid J W) r 301 Stewart av Keefe Fred W (Sarah S) 1 emp Bell Aircraft Corp h 218 Roswell MARIETTA CITY DIRECTORY 219 Keefe M Estelle (wid E E) (Model Cafe) r 211 McCord Keeler Sarah (wid Geo H) h 531 Kennesaw av Keener Irwin D (Eloise C) 2 inspr Bell Aircraft Corp h 613 2d Apt 3 Keener J W (Lucille I) dr Morrison Taxi h Rose la (Eliz) Keener Ruby knitter Holeproof Hosiery Co r Rose la (Eliz) Keheley J Edgar (Exie R) mech h Church (Eliz) Kehoe Wm E (Caroline P) mgr Stonewall Hotel h 207 Kennesaw av Kehrle Clifford C (Dorothy A) 3 planing eng Bell Aircraft Corp h 420 Alexander cir Keith Bobbie r 111 Seminole dr Keith Carolyn r 111 Seminole dr Keith Clyde H USN r 307 Harold KEITH ESTHER, Mgr Western Union Teleg Co r 507 Church Keith Grace P (wid C A) emp County Dept Public Welfare h 111 Semi- nole dr Keith Jas A (Lulu) emp Bell Aircraft Corp r 305 Lawrence Keith Louise ofc wkr Ga Power Co r 507 Church Keith School 602 Haynes ,,KeIlams Sara J tutor 816 Whitlock av r same Kelley Elbert M (Christine G) accnt Wofford Oil Co h 1001 Whitlock av Kelley Eliz C (wid M C) r 603 3d Apt 5 Kelly Paul E chauf r 606 Lawrence Kelly Robt (Kay) USA r 117 Hillside av Kelley Wm T (Dorothy R) 2 emp Bell Aircraft Corp h 603 3d Apt 5 Kellog Mollie r 121 Grogan Kemp Alice maid r 103 Fort Apt 10 Kemp Annelle ofc wkr Bell Aircraft Corp r Joyner Lake rd (FO) Kemp Daisy maid r 619 Lawrence Kemp Dari 1 lab Marietta Housing Authority h 511 Lemon Apt 3 Kemp Dennis L r rear 1120 Powder Springs Kemp Guy emp Victory Mtrs Co r 311 Lawrence Kemp Harry L (Margt B) 2 sch tchr h 105 Fairground extd Apt 1 Kemp Helen nurse Marietta Hosp r same Kemp Ima (wid W C) 1 h 200 Radium Kemp Jessie V h 309 Waterman Kemp Julius (Alice) lab Brumby Chair Co h 103 Fort Apt 10 Kemp Junious (Alice A) lab Brumby Chair Co h 103 Fort Apt 10 Kemp Kate P (Mrs Wm E) emp Meinert Florist r 306 S Alexander Kempt Margt (Mrs Henry) emp Bell Aircraft Corp r 105 Fairground extd Apt 1 Kemp Nellie Mrs elk r Joyner Lake rd (FO) KEMP OLIN D (Mary R) asst Cash Cobb Exchange Bk Acworth, Ga. Kemp Ray USA r Joyner Lake rd (FO) 220 BALDWIN'S 1944 Kemp Russell H (Nellie C) 1 dr Southeastern Greyhound Lines h 212 E Dixie av Apt 2 Kemp Wm (Daisy) lab r 619 Lawrence Kemp Wm E (Kate P) 1 carrier US PO h 306 S Alexander Kendrick R C Jr (Geraldine Y) 3 mech Bell Aircraft Corp h 612 2d Apt 4 Kendrick Robt L (Mary C) 2 emp Bell Aircraft Corp h 604 2d Apt 3 Kenimer Sara D Mrs sten r 501 Church Apt 4 Kennamore M A elder Maloney Springs Primitive Baptist Ch r Austell rd (FO) Kinney M W Jr (Billy) asso editor Cobb County Times r 302 Wright Kennedy Clarence P (Eva S) ration board h 908 Church Kennedy Herschel porter McKinney Tire & Battery Service r 207 John- son Kennedy Wm P (Sara M) 2 slsmn Marietta Lbr Co h 304 Freyer dr Kennesaw Council No 10 D of A Mrs Fred Pylant Sec meets second and fourth Monday 3d fir 209 Atlanta Kennesaw Lodge No 33 F & AM E T Lance Sec meets first and third Friday 3d fir 209 Atlanta Kennesaw Mountain National Park end Kennesaw av Kensey Emma cook r 407 Cole Kent Eliz (Mrs Harvey) 1 emp Bell Aircraft Corp r 1615 N Park dr Kent Harvey (Eliz) 1 elk Bell Aircraft Corp h 1615 N Park dr Kent Homer J (Vassie C) farmer h 1908 Roswell Kewon Geneva (Mrs Roy) slswn Saul's Dept Store RD 1 Keown Jas J (Bertha H) emp Bell Aircraft Corp r 200 E Anderson Keown Roy L (Mollie M) stock elk Big Star Food Stores h 900 Roswell Kerley Alice J (Mrs Jas L) ofc wkr r 1309 Roswell KERLEY H E, O DR (Jessie L) Jeweler and Optometrist, Watch Re- pairing, 26 N Park Square---Tel 86, h 324 Lawrence--Tel 359 (See left top lines) KERLEY JAS L (Orene J) Asst H E Kerley, O Dr 130 Roswell--Tel 741-M Kerley Jas L (Alice J) 1 emp H E Kerley h 1309 Roswell Kerr Maggie G (wid A H) tex wkr r 207 Wayland Apt 7 Kershner Virginia riveter Bell Aircraft Corp h 210 Allgood rd Apt 1 Keyes Jack W (Agnes R) 6 cond N C & St L RR h Miller av (FO) Keyes Lizzie sch tchr h 400 Lemon Keyes Sami USN r 400 Lemon Keyser Carrie R maid US PO r 602 Lawrence Keyser Wm (Carrie R) h 602 Lawrence Kidd J M (Rosalie S) expediter W P Stephens Lbr Co r Atlanta, Ga Kidd Josie C (Mrs W W) cash Kidd's Cafe r Atlanta rd Kidd W W (Josie C) 1 (Kidd's Cafe) h Atlanta rd Kidd's Cafe (W W Kidd) Atlanta rd Kienel Fredk B (Louise G) USN r 401 Maple av MARIETTA CITY DIRECTORY 221 Kile Chas USA r 607 Cherokee Kile Chessie M (Mrs C M) slswn Style Shop r 113 South av Kile Floyd J (Mary L) USA r 415 Gramling Kile John B (Mildred G) 1 formn Bell Aircraft Corp h 1007 Powder Springs Kile Melva J emp Bell Aircraft Corp r 1007 Powder Springs Kile Newton J r 1007 Powder Springs Kile Robt (Ruth M) lab r 607 Cherokee Kilgore John (Nona S) USA h 131 Durham Kilgore Mattie tchr Waterman Street Sch r 426 Atlanta Kilgore Noah A (Ruth K) USA r 123 Griggs Kilgore Noah (Nell) carp h 123 Griggs Kilgore Robt L stock mn H N DuPre r 123 Griggs Kilgore Ruth K (Mrs Noah A) emp Ga Power Co r 123 Griggs Kilgore Theora maid Bell Aircraft Corp r 917 N Cole Kilgore Thos (Theora) emp Bell Aircraft Corp h 917 N Cole Killian Edw F Jr (Nina B) 2 accnt Bell Aircraft Corp h 109 Phillips dr Kiliinger Clarence E (Mildred R) 2 emp Bell Aircraft Corp h 1608 Hill- side dr Killenbeck Chas W (Nontine) USA r 326 Atlanta Kimsey Edgar T (Margt G) USA r 117 Moon Kincaid J Roy (Mae D) 1 trav slsmn h 203 Wright Kincaid J Roy Jr USA r 203 Wright Kincaid Mae D home service sec American Red Cross Cobb County Chap- ter r 203 Wright Kincaid Martha A (wid J H) r 206 Forest av King Anna maid Joyner av (FO) r Hiram Ga King Cleveland H (Virginia) principal Elizabeth Sch h 912 Church King Danl C (Bessie M) 2 emp Bell Aircraft Corp h 112 Austin av King Epsie A (wid MC) 2 sheetmetal wkr Bell Aircraft Corp h Con- cord rd (FO) King J B (Virgie L) 1 guard Bell Aircraft Corp h 815 4th Apt 3 King Jas C (Willie S) pharm Hodges Drug Co h 208 Gramling King Loraine (wid Arnold) bkpr Saul's Dept Store r 135 Trammell King Lula B (wid Jas W) h 1112 Frasier Apt A King M Evelyn student r Austell rd (FO) King Octavia emp Holeproof Hosiery Co r Canton rd i(Eliz) King Pearl cook. 903 Cherokee r 210 Montgomery King Pearl C (wid C C) tchr Cobb County h Austell rd (FO) King Rachael E ofc wkr Bell Aircraft Corp r 1112 Frasier Apt A King Reba knitter Holeproof Hosiery Co r Tower rd (Eliz) King Seward W emp Bell Aircraft Corp r Austell rd (FO) King Thos (Christine J) 1 concrete fnshr r 525 Washington av King Vernon F eng Bell Aircraft Corp r 225 E Dixie av 222 BALDWIN'S 1944 King Vivian bkpr H N DuPre r Woodstock Ga King Walter C (Mary C) 2 emp Bell Aircraft Corp h 218 Clay King Willie S (Mrs Jas C) chf opr S B T & T Co r 208 Gramling Kinney W L (Bonnie) tool mkr Bell Aircraft Corp h 902 3d Apt 2 Kinney Melville W (Lida D) food products broker 302 Wright h same Kinney Melville W Jr, editor Cobb Co Times r 302 Wright Kinsman H L (Sue K) coml artist Bell Aircraft Corp h 100 Kennesaw avenue Kirby Tolleson J (Kath N) emp Bell Aircraft Corp h 303 Polk Kirk Adrain F (Eliz H) 2 teller Fulton Natl Bk h 113 Wright Kirk L R (Belinda U) r 101 3d ct Apr 2 Kirk Thos W r 539 Page Kirkpatrick John E (Frances S) 2 pntr r 109 Hawkins Kirkpatrick John E (Frances S) 2 pntr Bell Aircraft Corp r 109 Hawkins Kirth Bessie lndrs h 307 Harold Kiser Edna cook r 508 W Goss Kiser Henry lab r 113 Maple Kiser Jas cook r 113 Maple Kiser Margt inspr Bell Aircraft Corp r 818 1st Apt 2 Kiser Robt (Florence J) lab h 319 Lemon Kiser Vermon (Daisey G) 3 h 818 1st Apt 2 Kiser Willie lab Bell Aircraft Corp r 113 Maple Kiser Willis lab h 508 W Goss Kitchens Thos A (Pearl S) signal mn N C & St L RR' h 310 Lawrence Knight John K emp Bell Aircraft Corp r 617 Powder Springs Knight Lola L (Mrs W L) welder Bell Aircraft Corp r Atlanta rd (FO) Knight W Luther (Lola L) 3 elk US PO h Atlanta rd (FO) Knight Wm L Jr student r Atlanta rd (FO) Knott Geo E (Ora D) h 835 Church Knott Margt mus r 835 Church Knox Danl G USA r Barber rd (FO) Knox Fred (Nettie L) USN r Barber rd (FO) Knox Ida 1 lndrs h 118 Maple Knox Irene maid r 118 Maple Knox Jas I (Lois O) 2 uphol h Cochran (FO) Knox Lillian R (Mrs Wm H) emp Bell Aircraft Corp h Barber rd (FO) Knox Mary L maid 104 3d ct Apt 3 r same Knox Robt A USA r Barber rd (FO) Knox Ruby (wid) emp Marietta Hosiery Co r 209 Locust Knox Thos F (Luella C) h Austell rd (FO) Knox Thos W (Estell B) 2 farmer h Turner rd (FO) Knox W Henry (Ethel M) linemn Ga Power Co h Barber rd (FO) Knox Wm H (Lillian R) 1 h Barber rd (FO) Knuckles Russell section hd N C & St L RR r 404 W Goss marietta city directory 223 Koger John (Rosetta) 2 ofc wkr Bell Aircraft Corp h 1521 N Park dr Roger Rosetta (Mrs John) 2 ofc wkr Bell Aircraft Corp r 1521 N Park dr Koplin A M (Nora) USA h 619 Church Kratokvil Frank M (Harriet) 2 h 700 Page Kress Theo G (Eliz T) elk Bell Aircraft Corp h 159 Hedges Apt 1 Kress Richd G USA r 159 Hedges Apt 1 Kuhlman Herbert J (Annie B) pntr Bell Aircraft Corp h 300 Kennesaw Kuykendoll Connie (wid J W) r 201 Geo Hamilton ct Apt 7 Kuykendall Essie r 228 Campbell Hill Kuykendall Frank mech. Brumby Chair Co r 228 Campbell Hill Kuykendall Wm H (Kate H) refnshr h 230 Campbell Hill Kytle Alepand S (Neta B) bkpr Marietta Hosiery Co h 213 Frasier Kytle Eliz F ofc sec Bell Aircraft Corp r 213 Frasier Ltq find a NAME SOU MUSI KNOW HOW TO SPELL, 15. Lackey Guy (Irene E) 2 eng Bell Aircraft Corp h 158 Hedges Apt 2 Lackey Marvin emp Brumby Chair Co r Ward (Eliz) Laird Robt E (Elsie C) 1 mach Bell Aircraft Corp h Rose la : (Eliz) Laird Thos C (Evelyn W) 3 guard Bell Aircraft Corp h 308 Lakewood dr Apt B Laird W P (Leila G) 5 pntr Bell Aircraft Corp h Tower rd (Eliz) Lemanac Emmett H (Ruby B) press opr Glover Mach Wks h 821 Manget Lamb Chas W (Nettie P) r 505 W Atlanta Lamb Dayid J radio opr Federal Communication Comn Monitoring Sta r 301 Glover Lamb Emly L (Mrs J C) ofc wkr Peerless Furn Co r 209 George Hamil- ton ct Apt 1 Lamb J C (Embly L) emp Bell Aircraft Corp h 209 George Hamilton ct Apt 1 Lamb Wm emp Bell Aircraft Corp r 804 4th Apt 5 Lambert W Parvin (Earline S) 1 millwright Bell Aircraft Corp h 408 Grover Lance Arvil M (Aleene G) 1 USA r 212 E Dixie av Apt 1 Lance Ebie T (Ruby R) justice of peace h Church (Eliz) Lance Ebie T Jr USA r Church (Eliz) Lance Sarah S elk W P Stephens Lbr Co r Church (Eliz) Lancaster Beatrice hlpr Ga Produce Co r RD 3 Lancaster Mary (wid C L) emp Ga Produce Co r RD 3 Land Manilla B ofc asst Dr J D Reynolds r 102 Winn Land Wm F (Mildred P) 1 mach Bell Aircraft Corp h 800 4th Apt 4 Landers Clyde E (Louise R) USA r 106 Covington Landers Earl D (Ella S) 3 shovel opr County Prison Camp h 422 Clay 224: BALDWIN'S 1941 Landers Erline M (Mrs T A) emp Lander's Mattress Shop r 106 Covington Landers Lawrence C (Pauline) (anders Mattress Shop) r Mableton Ga Landers Linnie (wid N M) slswn Style Shop h 208 Sessions Landers Louise R( Mrs C E) emp Holeproof Llosiery Co r 106 Covington Landers Mabel B (Mrs J H) emp Holeproof Hosiery Co r 108 Covington Landers Mattress Shop (Lawrence C Landers) mfrs 107-a S Waddell Landers Newton M (Eliz C) 1 emp Bell Aircraft Corp h 401 Campbell Hill Apt 1 Landers T Harold (Mabel B) 2 trk dr City Street Dept h 108 Covington Landers Thos A (Erline M) formn City Street Dept h 106 Covington Landing Oscar D (Ruth B) 1 inspr Bell Aircraft Corp h 104 3d ct Apt 4 Landis Clarence W (Jeanette G) formn Bell Aircraft Corp h 402 Wright Landrum Everett M (Grace E) 1 mech Bell Aircraft Corp h 511 Lawrence Landrum Merrimac (Rosa S) 1 mach Bell Aircraft Corp h 116 Kings ct Apt A Landrum Minnie (wid Rev L L) h 336 Atlanta Landrum Ruth emp Bell Aircraft Corp r 336 Atlanta Lane Montine O (Mrs R A) emp Bell Aircraft Corp r 904 3d Apt 4 Lane R A (Montine O) 1 fabricator Bell Aircraft Corp h 904 3d Apt 4 Lang Wm F h Pearl RD 5 Lanharn Wm C (Martha R) 2 emp Bell Aircraft Corp h 902 3d Apt 3 Lankford Lyle G (Minnie J) 3 mach Bell Aircraft Cor ph 511 Lakewood dr Apt A Langford Mana K Mrs 1 emp Holeproof Hosiery Co h 301 Stewart av Langford Wm V USN r 301 Stewart av Langley Ethel F (Mrs Thos A) riveter Bell Aircraft Corp r Lakewood av RD 5 Langley Eva r 306 Kennesaw av Langley Kate Mrs 2 emp Holeproof Hosiery Co h 205 George Hamilton ct Apt 3 Langley Mary E emp Bell Aircraft Corp r Lakewood av RD: 5 Langley Ruby A opr S B T & T Co r Lakewood av RD 5 Langley Thos A (Ethel F) 3 rod mn h Lakewood av RD 5 Lanier Jas F (Martha) mgr Sherwin-Williams Co h 304 Cherokee Apt 3 Lanier Theo A (Nellie T) 1 emp Bell Aircraft Corp h 813 4th Apt 3 Largin Andrew ofc wkr Bell Aircraft Corp r 417 Atlanta Larrimore Clifford Jr carp hlpr h Concord rd (FO) Larrimore Florie (wid Clifford) r Concord rd (FO) Larson Raymond J (Iris S) 1 emp Bell Aircraft Corp h 324 Park View av Lassiter Narvel L (Pauline J) 2 guard Bell Aircraft Corp h 1214 Whitlock av LATIMER IRMA (Mrs T E) (Style Shop) r 301 Kennesaw av LATIMER PIERCE B (Willie D) V-Pres Marietta Federal Savings & Loan Assn, h 506 Campbell Hill--Tel 408-XW marietta city directory 325 Latimer Thos E (Irma M) lawyer 102 Atlanta h 301 Kennesaw av Latium Gaynell emp Bell Aircraft Corp r 308 Washington av Lavette Chas (Georgia) 2 h 202 Maple Law Charlotte C chf elk Atlanta Gas Light Co r 401 Polk Law Mary E (wid CM) Ih 401 Polk Law Wm R (Jamie S) 3 emp Bell Aircraft Corp h 111 Clay Lawhon Mary (wid R E) r 426 Atlanta Lawler Bessie (wid L S) r 106 North av (Eliz) Lawler Hubert (Viola B) USA r Rose la (Eliz) Lawler Loyd V (Beatrice T) pntr h 108 Trammell Lawrence Deraid L (Mrs S J) emp Bell Aircraft Corp r 906 3d Apt 2 Lawrence Elmer F USN r 405 Lawrence Lawrence Frances r 405 Lawrence Lawrence Gladys sten City Board of Light & Water Wks r 600 Cole Lawrence Jas A (Eunice A) 1 mech r 405 Lawrence Lawrence Julian A USA r 405 Lawrence Lawrence M McDonald (Mary L) city eng h 900 Whitlock av Lawrence R Edson (Esther T) 2 formn Bell Aircraft Corp h 606 2d Apt 3 Lawrence Starling J (Deraid L) 4 emp Bell Aircraft Corp h 906 3d Apt 2 Lawrence Street Barber Shop Judge Shaw 112 Lawrence Lawrence Street Cafe (Jas Beasley) 118 Lawrence Lawrence T Burt (Martha S) jan Cole Apartments h 600 Cole Lawson Alf E (Lelia B) h Marble Mill (Eliz) Lawson Bud (Lucy R) (Payne Service Sta) h 1400 Cherokee Lawson Gladys mender Holeproof Hosiery Co r 219 Rose la Lawson Jos C (Cecil P) 2 knitter .Holeproof Hosiery Co r Marble Mill (Eliz) Lawson Kath looper Holeproof Hosiery Co r Marble Mill (Eliz) Lawson Lucy R Mrs elk Payne Service Sta r 1400 Cherokee Lay Andrew W Rev (Nancy) pastor The Church of God in Christ r 112 Montgomery Lay Nancy cook 804 Cherokee r 112 Montgomery Layton Lawrence A (Jessie S) 1 mech Bell Aircraft Corp h 709 3d Apt 1 Leaptrott Helen B Mrs 2 elk State Welfare Dept h 404 Church Apt 2 Leard Ethelyn ofc sec Bell Aircraft Corp h 208 Geo Hamilton ct Apt 5 Leavell Doris nurse Marietta Hosp r same Leavell Geo A (Lelia A) lab h 415 Gramling Leavell J Cliffton (Cora S) barber Atlanta Street Barber Shop RD 4 Leavell J Fletcher (Geneva) taxi dr h 613 Atlanta Leavell Juanita nurse Marietta Hosp r same Leavell Ruby M ofc wkr Bell Aircraft Corp r 4151 Gramling LeCroy Glenn P (Velma G) 3 emp Bell Aircraft Corp h 304 Austin av LE CROY JOHN T (Kate H) 1 County Clerk of Court, Member County Advisory Board,, h 1114 Roswell--Tel 787 226 BALDWIN'S 1944 LeCroy Millie F (wid T H) r 302 Austin av LeCroy W Alton (Lois H) 3 patrolmn County Police Dept h 201 Merritt Ledbetter John E (Lenis S) emp Bell Aircraft Corp h 103 3d ct Apt 1 Ledbetter Raymond E (Eliz W) 2 emp Bell Aircraft Corp h 815 1st Apt 8 Ledford Arvin J (Beulah D) mech Bell Aircraft Corp r 205 S Waddell Ledford David (Lula L) 1 USA r 109 S Alexander Ledford Jas E (Rhoda N) 2 lab Bell Aircraft Corp h Beaver av Ledford John O tex wkr r 108 Green Ledford Maurine W nurse r 205 S Waddell Ledford Vaughn E (Minnie V) 3 carrier US PO h Garrison rd RD 5 Ledsinger C L (Clarice A) ins solr h 303 Kennesaw av Lee A Susan (wid Fitzhugh) r 511 Washington av Lee Dorothy ofc sec Bell Aircraft Corp r 333 Atlanta Lee Edw C (Ruth D) 1 safety eng h 810 E Waterman Lee G (Allison M) mech Bell Aircraft Corp h 807 3d Apt 4 Lee Gertrude h 415 Reynolds Lee G Sherman (Lydia H) 4 emp Holeproof Hosiery Co h 214 Rose la Lee Jas W (Lucille G) mech h 104 Moon Lee Kath ofc sec Bell Aircraft Corp r 333 Atlanta Lee Rose tchr Marietta High Sch r 302 Lawrence Lee Roy E (Evelyn S) 3 mech Bell Aircraft Corp h 403 Grover Lee Vera bkpr First Natl Bk r Austell, Ga Lee Wm G (Louise C) loftaimn Bell Aircraft Corp h 326 Aviation rd Lee Wm W (Sarah D) (Lee's Barber Shop) h 333 Atlanta Lee Wm W Jr USA r 333 Atlanta Lee's Barber Shop (Wm W Lee) 41 W Park Square Leek Emerson eng r Cherokee rd (Eliz) Legg Ada S (wid E E) h 320 Washington av Legg Christine S (Mrs Fred V) music tchr 417 Whitlock av r same LEGG FRED V (Christiane S) Distributor Gulf Oil Corp, 417 Whit- lock av--Tel 342 Legg Fred Jr USA r 417 Whitlock av Legg Joe P (Margt J) elk h 104 Oakmont dr Legg Lucia S student r 104 Oakmont dr Leigh Velma tchr Lemon Street Sch r 120 Holiday Leming Francis D USA r 403 Maple av Leming Geo L (Estelle H) h 403 Maple av Leming Geo L (Winnie F) 1 mech Sou RR Co r 411 Cherokee Leming Hollis R mech Sou RR Co r 403 Maple av Lemmon Wm P (Ann W) consulting eng h 102 Oakmont dr Lemon Street School Marion J Woods prin Lemon nr Rigsby Lenkeit Edwin A (Evelyn O) designer Bell Aircraft Corp h 605 2d Apt 6 Leno Effie r 129 Henderson Leonard Herman emp Bell Aircraft Corp r 820 1st Apt 2 marietta city directory 227 Leonard Jos H (Corine L) 5 emp Bell Aircraft Corp h 820 1st Apt 2 Leone John (Mary T) 2 sheetmetal wkr Bell Aircraft Corp h 112 Colonial cir Apt 3 LeRoy Dora C (Mrs H A) emp Bell Aircraft Corp r 612 2d Apt 2 LeRoy H Alvin (Dora C) 4 emp Bell Aircraft Corp h 612 2d Apt 2 Leserton Ralph (Lucy T) USA r 123 South av Lester Cecile cook 1005 Whitlock av h 410 Robeson ct Apt 6 Lester Clarence (Dolly) lab h 121 Mulberry Lester Gennie L (Mrs L D) emp Bell Aircraft Corp r 902 3d Apt 1 Lester H C (Eunice) 2 mach Bell Aircraft Corp h 710 4th Apt 4 Lester Hubert (Myrtle) 2 lab h 114 Mulberry Lester Jas porter McPherton Tire Shop r 410 Robeson ct Apt 10 Lester Jas (Florence) atndt Hardage Service Sta h 406 Montgomery Lester Jas E trk dr r 126 Trammell Lester John E (Nancy F) dir County Board of Health h 205 Washing- ton av Lester Julia maid r 406 Robeson ct Apt 4 Lester L D (Gennie) 1 emp Bell Aircraft Corp h 902 3d Apt 1 Lester Minnie M (Mrs Robt L) ofc asst Dr Robt Lester Blair Bldg r Barber rd (FO) Lester Nancy A (Mrs John E) ofc wkr County Board of Health r 205 Washington av Lester Robt porter McPherson Tire Shop r 410 Robeson ct Apt 10 LESTER ROBT L (Minnie) Optometrist 59 S Park Square--Tel 388 h Barber rd (FO)--Tel 563-J Lester Solomon D (Willie M) porter McKinney Tire & Battery Service h 410 Robeson ct Apt 7 Lester Verna I r 205 Washington av Lewis Annette sten Glover Mach Wks r 103 Gramling Lewis Cabinet Shop (Henry A Lewis) 113^ E Anderson Lewis Doris E sten Bell Aircraft Corp r 103 Gramling Lewis Fred C (Louise) 3 supvr Bell Aircraft Corp h 807 3d Apt 5 Lewis H A (May A) 2 (Lewis Cabinet Shop) h Cogburn Park (Eliz) Lewis Henry A (Lewis Cabinet Shop) r RD 1 Lewis Homer A USA r Cogburn Park (Eliz) Lewis J Homer (Sara P) (Lewis-Noe Mtr Co) h 311 Roswell Lewis Jas O (Anne C) 2 layout mn Bell Aircraft Corp h 500 Atlanta Lewis Jesse D guard Bell Aircraft Corp r 412 Atlanta Lewis John W (Louise R) USA r 504 Powder Springs LEWIS JOHN W (ROSA L) Mayor Pro Tem, Member City Council h 616 Church--Tel 623 Lewis Lawrence (Violet K) 1 tool mkr Bell Aircraft Corp h 507 Whitlock Apt 1-a Lewis Lindsey K (Mary S) 1 mach r 604 Haynes 328 BALDWIN'S 1944 LEWIS M (Anita) 3 Rental Mgr Victory Homes of Marietta Inc 1611 N Park dr Lewis Malcolm (Sibyl G) eng Bell Aircraft Corp h 110 McDonald Lewis Margt F sten r 103 Gramling Lewis-Noe Motor Co, (J Homer Lewis, Ray W Noe) 301-05 Whitlock av Lewis Nora emp Economy Ice Cream Co r Acworth Ga Lewis Playground Campbell Hill nr Hillside av Lewis Sara P (Mrs J H) nurse County Health Dept r 311 Roswell Lewis Sarah L (wid Josiah) r 309 Maple av Lewsi Thos M USMC r 103 Gramling Lewis T Oscar (Vida F) 1 opr L & N RR h 103 Gramling Lewis Wheeler M USN r 110 McDonald Lewis Willie trkr L & N RR and N C & St L RR r Kennesaw Ga RD 1 Liberty Bell Cafe The Willis D Vickers mgr 925 Atlanta Liddell Lizzie lndrs r 109 Lake Liddell Matilda maid r 707 Lawrence Life Insurance Co of Virginia The Hugh W Harris agt 100 Cherokee Lilly Corrie A (Mrs T Richd) cash Bell Aircraft Corp r 312 Aviation rd Lilly F Richd (Corrie A) eng Bell Aircraft Corp h 312 Aviation rd Lilly Mercedes R mail elk Bell Aircraft Corp r 312 Aviation rd LINDLEY F P & BOB Consignees The Texas Co, 108 Glover--Tel 688 BINDLEY FRANK P (Fay B) Consignee The Texas Co, r Powder Springs Georgia Lindley Lois B (Mrs Bob) ckpr The Texas Co r 111 Delk Lindle Y Lottie W (wid L W) nurse r 205 Clay LINDLEY ROBT T "BOB" (Lois B) Consignee The Texas Co h 111 Delk Lindsey Corby T USA r Campbell Hill (Eliz) Lindsey Geo S (Nettie G) emp Bell Aircraft Corp h Campbell Hill (Eliz) Lindsey Guy (Lenna F) emp McKinney Tire & Battery Service h Canton rd (Eliz) Lindsey Homer M (Sarah S) 1 ship elk h 127 Northcutt Lindsey Lenna P (Mrs Guy) knitter Holeproof Hosiery Co r Canton rd (Eliz) Lindsey R Jackson emp McKinney Service Sta r Campbell Hill (Eliz) LINDSEY ROLAND S (Esther S) V-Pres-Genl Mgr Brumby Furniture Co, h 217 Forest av--Tel 1190-J LINDSEY SANFORD J (Geneva) 5 Nu-Way Cleaners & Laundry h 513 Page--Tel 60 Ling Percy (Leonora C) h 300 N Forest av Lingerfelt Albert L (Lola S) 1 atndt Mayes Ward & Co h 205 George Hamilton ct Apt 2 Lingerfelt Christine pairer Holeproof Hosiery Co r 305 N Waddell Lingerfelt J Sami (Lillie E) emp Brumby Chair Co h 305 N Waddell Link Cath opr Marietta Beauty Shop 709 Church marietta city directory 220 Linley Lucy r 124 Holiday Linley Thos lab Bell Aircraft Corp r 709 Lawrence Linning John guard Bell Aircraft Corp r 605 3d Apt 5 Linsley Jas (Essie) 1 USA r 105 Mulberry Lipscomb Nell M (Mrs Wm) student r 605 Birney Apt 1 Lipscomb Wm (Nell M) USN r 605 Birney Apt 1 LITTLE A D (A D Little) General Insurance, Loans, Real Estate 112 At- lanta--Tel 44 LITTLE ADAMS D (Aimee D G) 3 (A D Little Agent) Pres Marietta Federal Savings & Loan Assn, h 606 Whitlock av--Tel 1039 Little Cora G (Mrs Rosser N) ofc sec Blair & Carmichael 205 Lawrence Little Cora G (Mrs R N) recpt Blair & Carmichael r 205 Lawrence Little Gauwain J elk Bell Aircraft Corp r 705 Cherokee Little Irma N (wid DR) h 302 Lawrence Little Jas R (Florine B) USA h 507 Whitlock av Apt 1 Little Joel (Mattie M) 2 mech Holeproof Hosiery Co r Marble Mill (Eliz) Little Rock House (Mrs Clelie K and M Edmond Daniell bed spreads At- lanta rd RD 5 Little Rosser N (Cora T) USA h 205 Lawrence Little Wm D USA r 302 Lawrence Lively Hubert G (Marguerite) radio mn Bell Aircraft Corp r 138 Tram- mell Lively Hubert M (Genevieve) h 138 Trammell Livingston Everett G (Ruby) emp Bell Aircraft Corp h 609 Polk Livingston Harry W (Virginia B) ofc sec Sou RR Co h 302 Polk Livingston Harry W Jr USA r 302 Polk Livingston J C (Loraine) 1 emp Bell Aircraft Corp h Concord rd Apt 17-b (FO) Livingston Jack B USA r 302 Polk Livingston Ruby (Mrs E G) tchr Marietta High Sch r 609 Polk Lloyd Iona Mrs 1 emp Bell Aircraft Corp h Joyner av (FO) Lockaby Wm W (Ida) emp Bell Aircraft Corp h 703 3d Apt 8 Lockhart Jos (Rebecca) lab h 408 Robeson ct Apt 2 Locklin David C (Emma G) 1 lab Bell Aircraft Corp r 127 Franklin Loggins Kinney M (Alma S) USA h Page Loggins Robt B (Mary S) marble rubber The McNeel Marble Co h 202 Locust Loggins Roy B Jr (Martha C) elk John S Frey h 305 Polk Logul Blair (Gladys) emp Bell Aircraft Corp h 201 Phillips dr Logul Gladys (Mrs Blair) emp Bell Aircraft Corp r 201 Phillips dr Lollis Clarence porter McKinney Tire & Battery Service h 207 Johnson Lollis Zennie cook h 600 Hunt Long Edna B (Mrs H C) elk Bell Aircraft Corp r 710 4th Apt 5 Long Geo (Pauline T) 1 emp Bell Aircraft Corp h Austell rd (FO) 230 BALDWIN'S 1944 Long H Clyde (Edna B) 3 emp Bell Aircraft Corp h 710 4th Apt 5 Long John H (Louisa B) 3 trk dr Southland Ice Co h Glover nor Fair- ground Long Julia r 710 4th Apt 5 Long Major emp Bell Aircraft Corp r 200 Greer av Long Martha Mrs tchr r 104 Forest av Long Nancy 2 cook h 504 Lemon Apt 7 Long Willie USA r 504 Lemon Apt 7 Lott Gertha r 113 Page Loudermilk A Frank (Vera P) carp r 615 Powder Springs Loudermilk Horace H (Eva P) 2 (Loudermilk Studio) h 108 Freyer dr Loudermilk Studio (Horace R Loudermilk) 20 N Park Square Loudermilk Vera P (Mrs A Frank) cafeterial wkr Marietta High Sch r 615 Powder Springs Louise's Beauty Shop (Louise Reed) 402 Montgomery Louise Beauty Shoppe (Louise Carter) 111 Atlanta Louisville & Nashville Railroad Ray B Pledger frt & passenger agt, pas- senger depot 208 Mill Louisville & Nashville Railroad Ray B Pledger frt & passenger agt, frt depot 210 Mill Lovell Jas E (Margt L) asst elk U S Selective Service System Local Board No 1 h 301 Mill Lovell Margt (Mrs J E) ofc sec J Guy Roberts r 301 Mill Lovette Kath maid r 326 Lemon Apt 3 Lovette Wm (Kath P) lab h 326 Lemon Apt 3 Lovvorn Effie E (Mrs Elzie P) (Marietta Pottery Sales) r 711 Powder Springs Lovvorn Elzie P (Effie E) emp Connally Shoe Shop h 711 Powder Springs Lovvorn Retha ofc wkr Bell Aircraft Corp r 711 Powder Springs Lovvorn Ronald (Bernice W) USA r 711 Powder Springs Low Earl P (Guyrene K) formn Bell Aircraft Corp h 128 Delk Lowe Alberta cook r 310 W Goss Lowe Ann C (Mrs Wm C) elk Bell Aircraft Corp r 607 2d Apt 4 Lowe C Howard (Evelyn H) 3 emp Bell Aircraft Corp h 513 W Hansell Lowe Ella P (Mrs Jean) emp Bell Aircraft Corp r Cogburn rd (Eliz) Lowe Eug (Ella P) USA h Cogburn rd (Eliz) Lowe Geneva emp Bell Aircraft Corp r 308 Washington av Lowe Hardman ydmn r 212 Johnson Lowe J Edw (Ola P) 1 distr Atlanta Journal r 112 W Dixie av Lowe Lena C cook r 709 Lawrence Lowe Orlando (Jeannette) 1 h Austell rd (FO) Lowe Wm C (Ann C) 3 USA h 607 2d Apt 4 Lowe Wm H (Emily S) 1 mach r 702 Atlanta Lowery Florene P (Mrs John V) presser Owenby Mfg Co r 109 Griggs MARIETTA CITY DIRECTORY 231 Lowery Geo 0 (Letha H) 2 emp Bell Aircraft Corp r 611 Powder Springs owery Jack E (Viola) 1 elk Bell Aircraft Corp h 500 Stewart av Lowery John V (Florene P) 2 h 109 Griggs Lowman Dale D (Jayne W) 1 mech Bell Aircraft Corp h 311 Aviation rd Bowman Louise Mrs 2 emp Bell Aircraft Corp r 1118 Powder Spring's Lowman Ruth S (wid NR) nurse h 222 E Dixie av Loyal Ida Indrs h 311 Cole Ludwick Eliz S (wid D B) 2 ofc wkr U S Selective Service System Local Boaid No 1 h 204 George Hamilton ct Apt 3 Luedtke Arth (Audrey L) 3 radio inspr Federal Communication Comn h 1508 Roswell Luffman Jack B (Ruth M) 2 emp Bell Aircraft Corp h Osborne (FO) Lumpkin Henry lab r 202 Harold Lummus O Lee (Leila W) r 401 Page Luster Cecil maid r 410 Robeson ct Apt 6 Luster Christine maid r 110 Holiday Luster Edw emp Brumby Chair Co r 316 W Goss Luster Jas (Cecil D) 3 emp McPherson Tire Shop h 410 Robeson ct Apt 6 Luster Solomon (Willie M) 2 lab h 410 Robeson ct Apt 7 Lutz Alfred M (Gertrude B) 1 h 1801 Roswell Lutz Bernard L (Louise N) USA r 1801 Roswell Lutz Chas J (Kath A) real estate slsmn h Fair Oak av (FO) Lutz Jas M (Mary B) 3 emp Greyhound Bus Sta h Beaver av Lutz Louise N (Mrs B L) emp Brumby Press Inc r 1801 Roswell Lutz Milton L USN r 1801 Roswell Lutz Reed W USA r 1801 Roswell Lyle Albert M (Lucy) pntr h 202 Lemon Lyle Mary elk Bell Aircraft Corp r 801 3d Apt 4 Lyle Alta G (Marie F) 2 inspr Bell Aircraft Corp h 310 Frasier Lyman Elnora h 124 Henderson Lynes Kate W (wid J Colton) h 601 Whitlock av Lynch Juanita oprSBT&TCor Austell rd (FO) Lynch Mabel (Mrs Scott opr S B T & T Co r 228 Atlanta .Lynch Juanita opr S B T & T Co r Austell rd RD 4 Lynch Martin L (Lillie II) formn h Austell rd (FO) Lynch Mary F opr S B T & T Co r Austell rd (FO) Lynch Ruby ofc wkr r Austell rd (FO) Lynch Scott (Mabel) USA r 228 Atlanta Lynn Arth L (Jessie B) eng N C & St L RR h 317 Atlanta Apt 3 Lynn Arth W USM r 317 Atlanta Apt 3 Lyon Mattie H (wid MR) r 207 Freyer dr Lyon Merritt R ofc wkr The McNeel Marble Co h 207 Freyer dr Lyons John J emp The McNeel Marble Co r Atlanta rd (FO) 233 BALDWIN'S 1944 Lyons Robt A (Eliz G) tex chem h 619 Birney Apt 2 Lytell S W (Fitzhugh) tmkpr Bell Aircraft Corp h 707 Bd Apt 1 Mable Chas R (Maline A) mach Bell Aircraft Corp h Church (Eliz) Mable Maline A (Mrs Chas R) mach opr Bell Aircraft Corp r Church (Eliz) Mabrey Claude (Dovie G) 1 carp h Marr (Eliz) Mabry Burton L (Mrs C W) tmkpr Bell Aircraft Corp r 212 Aviation rd Mabry C W (Burton L) 1 emp Bell Aircraft Corp h 212 Aviation rd Mabry Eliz J (Mrs Forrest) service repr S B T & T Co r 310 Washington avenue Mabry Evie W (Winifred M) 2 emp Bell Aircraft Corp h 415 Aviation rd Mabry Forrest R (Eliz J) elk US PO h 310 Washington av Apt B Mabry H Norris (Sarah K) elk US PO h Austell rd (FO) Mabry Marvin (Ruby P) lab r 124 Henderson Mabry N Kemp student r Austell rd (FO) Mabry Susie M (wid R A) r 114 Colonial cir Apt 1 Mabry Winifred M (Mrs Eric W) ofc wkr Bell Aircraft Corp r 415 Avia- tion rd Mac W W Co Fred Sweet mgr 34-35 W Park Square Mack R C lab Clackum's Trans Co r 212 Johnson MacIntyre Helen L (Mrs P A) asst sec Cobb County Chamber of Com- merce r 200 Freyer dr MacIntyre Peter A (Helen L) supvr Bell Aircraft Corp h 200 Freyer dr Maddox A Laroy (Dorothy L) ptr Brumby Press Inc h 620 Church Maddox Dorothy L (Mrs A L) sten State Dept Public Welfare r 620 Church Maddox Frances 1 emp Nu-Way Clnrs & Lndry h 218 Johnson Maddox Frances D (Mrs Sami S) elk Atherton Drug Co r 302 Maple av Maddox Harriet B (Mrs S S) dept mgr Florence's Inc r 320 Lawrence Maddox Jas H (Cleon H) 1 millwright Bell Aircraft Corp h Gray (Eliz) Maddox Kath E elk Bell Aircraft Corp r 401 W Atlanta Maddox Loma (wid J Mi) ofc wkr Bell Aircraft Corp h Marble Mill (Eliz) Maddox Morris W (Louetta R) 2 ofc wkr Bell Aircraft Corp h 401 W Atlanta Maddox Nathl (Julia) 1 lab h 117 Mulberry Maddox Rosalyn K student r 620 Church Maddox Sami S (Hattie B) h 320 Lawrence Maddox Sami S (Francis D) 2 prsmn Cobb County Times h 302 Maple av Maddox Wm A h 304 Maple av Mahon Chas C (Pearl R) emp City Street Dept h 112 Trammell MARIETTA CITY DIRECTORY 233 Mahone Ellen cook 841 Church r 218 Johnson Main Liquor Store J Newt Hicks mgr 42 W Park Square Majors J Walter (Irene W) 3 mech Holeproof Hosiery Co h Marble Mill (Eliz) Malaier Geo S (Nettie L) slsmn h 300 Polk Malkey Arth lawyer r 621 Cherokee Mallary Nelson D (Hazel M) emp Bell Aircraft Corp h 110 Colonial cir Apt 1 Malone Willie mech Safety Cab Inc Rose la (Eliz) Maloney Robt E (Ella P) 2 mech h Joyner av (FO) Maloney Springs Primitive Baptist Church Eld M A Kennemore Jas H Holland Austell rd (FO) Malphrus Jesse E (Cecelia) 1 emp Bell Aircraft Corp h 608 Birnev Ant 2 Malsby Kath G r 619 Polk P Maner J Howard (Ellen B) 1 slsmn h 501 Church Apt 8 Mangum Arbutus (Mrs Henry) waitress Skinner's Cafe r 106 E Dixie av Mangum Chas R (Alverda) 1 emp Bell Aircraft Corp h 602 Page Mangett Fred P (Louise A) USA r 203 Freyer dr Manhardt Lincoln F (Eliz M) 2 formn Bell Aircraft Corp h 403 Park View av Manley Raymond T (Aldyne J) 2 mech Bell Aircraft Corp h 606 Morn- ingside dr Apt 1 Manley Theo G (Emma) emp Bell Aircraft Corp h 707 3d Apt 8 Mann Guy M guard Bell Aircraft Corp r 412 Atlanta Mann Hilton lab r 206 Harold Mann Hoke S (Lillian) 3 reprmn S B T & T Co h 209 Sessions Mann Jas L farmer r Atlanta rd (FO) Mann Marvin E (Lucille M) 1 inspr Bell Aircraft Corp h 619 Birney Apt 1 Mann Thos P (Sue) 1 slsmn r 116 Freyer dr Maner Clem V (Mary W) 3 pntr h Barber rd (FO) Manfield A Harold lab Gulf Service Sta 808 N Cole Manning Aley W (wid Ralph) r 405 Polk Manning Building 102 Atlanta Manning Edith tchr Keith Sch r RD 4 Manning Edwin G emp McLellan Stores Co r 305 E Anderson Manning Emma emp Bell Aircraft Corp r 515 Whitlock av Manning Eug student r 416 Frasier Apt A Manning Jos C (Irene P) 1 emp Bell Aircraft Corp h Garrison rd RD 5 Manning Mary E (wid C J) r 404 Lawrence Manning Oscar B (Sythany B). carp h 310 S Alexander Manning Robt E (Elsie) 2 brklyr Concord rd Apt 14-b (FO) MANNING THOS S Sec Southland Ice Co r Whitlock av txtd Manning Walter D (Sadie S) 2 con'stn wrkr h 416 Frasier Apt A Manous Henry M (Viola R) slsmn h 626 Atlanta 234 BALDWIN'S 1944 Manzek R Jeam (Jean B) USA h 810 4th Apt 6 Maple Avenue Methodist Church Rev Tim W Holbrooks 200 Maple av Mapes C P (Frances H) USA r 403' Kennesaw Marble Inn (J W Ravan) service *sta Church (Eliz) Marietta Bargain House (Wayman E Clay) shoes 106 Cherokee Marietta Beauty Shop (Harriet Albers) 28 N Park Square Marietta Bowling Alley (Jos J Goldstein) 111 Winters Marietta Cafe (Mrs Lamprine Cutis) 9 E Park Square Marietta Cemetery W Atlanta nr Goss Marietta Chapel (Methodist) 207 Jones Marietta Chapter No 208 OES Mrs Era B Norton Sec meets first and third Monday 3d fir 209 Atlanta Marietta Cigar Factory (Mrs Oma Henderson) 205 E Hansell MARIETTA CITY OF CITY HALL 209 Atlanta City Auditorium 2d fir City Hall CITY BOARD OF LIGHTS & WATER WORKS, L M Blair Chairmn, W W Lee V-Chairmn, 1st fir City Hall--Tel 222 Board of Light & Water Works M McDonald Lawrence supt water and sewers, (plant) 308 Sessions, C W Reid Jr supt electric (plant) 308 Sessions CITY CLERK, Mrs Odene L Johnson, 1st fir City Hall--Tel 222 City Council, W W Lee, John W Lewis, Jas H Groover, Geo Thomas, Frank B Wellons and H P Bishop, Members City Disposal Plant (East) Page nr City limit City Disposal Plant (South) Fair Oaks City Electrician C W Reid Jr 2d fir City Hall City Engineer M McDonald Lawrence 2d fir City Hall City Fire Marshal Howard Schaeffer 2d fir City Hall CITY FIRE DEPARTMENT, Roselle S Groover Chief, 212 Winters --Tel 1162 City Housing Authority R R Cameron 204 Wayland City Incinerator Page nr City limit City Jail 112 Tucker City Marshal Harold P Griggs 109 Atlanta CITY MAYOR Hon Leon M Blair Blair, Bldg--Tel 1340 City Mayor Pro Tern John W Lewis 1st fir City Hall POLICE DEPARTMENT, Harold P Griggs Chief, 109 Atlanta--Tel 920 City Sanitary Department Harold P Griggs supt 109 Atlanta City Street Department M McDonald Lawrence supt 2d fir City Hall City Superintendent of Schools Schuler Antley 2d fir City Hall City Treasurer Ernest L Robinson 1st fir City Hall MARIETTA CITY DIRECTORY 235 MARIETTA COCA-COLA BOTTLING CO INC, Edgar M Smith Mgr 506 Roswell--Tel 70 (See Buyers' Guide) Marietta Council JOUAM H M Haney Sec meets first and third Tuesday 3d fir 209 Atlanta Marietta Council No 74 R & SM E L Moore Sec meets every fifth Friday 3d fir 209 Atlanta Marietta Country Club 817 Powder Springs MARIETTA CREDIT SERVICE, Regina Rambo Benson Manager, Credit Reports and Collection Agency, 600 Roswell--Tel 567 (See Buyers' Guide) Marietta Elks Club BPOE 1657, 112 Waverly Way MARIETTA FEDERAL SAVIGNS & LOAN ASSN, A D Little Pres, Pierce B Latimer V-Pres, Wm L de Jarnette Sec-Treas, Home Financing, Investments and Mortgage Loans 112 Atlanta--Tel 44 (See right and left top lines) Marietta Glass & Cabinet Shop (Joe Y Abercrombie) 300 Whitlock av Marietta Hatchery (Mrs Marie B Rambo) 205 Church MARIETTA HOSIERY CO (Fred W Clarke) 114 Church--Tel 848 MARIETTA HOSPITAL, Murl Hagood Pres, W Howard Perkinson V-Pres Leonard L Welch Sec, 206 and 10 Cherokee--Tel 303 Marietta Journal The Wm L Harris editor 109 W Anderson Marietta Kiwanis Club John A Crumrine sec meets Thur 12:30 p m 31 N Park Square Marietta Liquor Store Newton L Brewer mgr 25 N Park Square Marietta Lions Club J B McClain sec meets first and third Thur nights 31 N Park Square MARIETTA LUMBER CO (J Sigman, R Stevens and Wm L Tumlin) Lumber, Building Materials and Supplies, Flintkote Roofing, Lowe Bros Paints, Glass, Sand, Gravel and Brick Dealers, Old Atlanta rd at Bell Aircraft underpass--Tel 357 (See right bottom lines) Marietta Marble & Stone Wks (Fred L and J Sami Beck) 202 Goss Marietta National Cemertery Jonah C Pumphrey supt 500 Washington av Marietta Pottery Sales (J W Clackum) 110 Cherokee Marietta Publishing Co The (Wm L Harris) 109 W Anderson MARIETTA RADIO CO (Wm S Deik) 116 Cherokee--Tel 400 Marietta Rotary Club P D Reeser sec meets Friday 1 p m 31 N Park Sq MARIETTA SALVAGE CO (Middleton B Broadwell) 102 Lemon Marietta Service Station (Robt T Lindley) 235 Atlanta Marietta Shoe Shop (E A Gray) repr 104 Atlanta MARIETTA TRANSFER AND SALVAGE CO (Middleton B Broadwell) Packing, Crating, Storage, Local and Long Distance Hauling, Cash For All Salvage, 215 Church--Tel 13 and 261 Marietta Women's Club Polk nr Winn Marino Geraldine (Mrs Sonta) emp Bell Aircraft Corp r 201 Roswell 286 BALDWIN'S 1944 Marino Sonta (Geraldine) USA r 201 Roswell Maris Albert P (Wilda G) eng Bell Aircraft Corp h 524 Frasier Apt 2 Marks Frances M, (Mrs Julian A) r 603 3d Apt 2 Marks Julian A (Frances M )1 USA r 603 3d Apt 2 Marks Rosie L (Mrs Gus) elk Hodges Drug Co r RD 1 Marler Carl A elk 0 D Mitchell Gro r 722 Roswell Marler D C (Pearl D) 1 emp Bell Aircraft Corp h 1501 Roswell Marler J Emmett (Carrie D) 1 dep County Sheriff h 206 S Alexander Marlar John waiter Cherokee Street Lunch r 104 Cherokee Marlar Mamie (wid Allan) r 104 Cherokee Marler Mary E student r 206 S Alexander Marler Ralph E USA r 206 S Alexander Marlar Wm D (Cherokee Street Lunch) r 104 Cherokee Marr Ausbon L (Gladys) 1 emp Economy Ice Cream Co h 104 Gramling Marr Bobbie M opr Evelyn's Beauty Shop r 104 Gramling Marr Marion C (Alta M) 1 ins agt h Church (Eliz) Marr Mary D (wid W L) r Church (Eliz) Marrow Ralph M (Myrtle) 1 emp Bell Aircraft Corp h Hill RD 5 Marsh W R emp Bell Aircraft Corp r 214 Powder Springs Marshall Logan (Nora H) trk dr Allgood Dairy r 126 Delk Marshall Nora (Mrs Logan) smstrs Owenby Mfg Co r 126 Delk Marshall Orville (Vera J) 1 pntr h Hill RD 5 Marshall Vera J (Mrs Orville) waitress Economy Ice Cream Co r Hill RD 5 Marston Wm G (Craven W) 2 emp Bell Aircraft Corp h 602 Roosevelt cir Apt A Marten Alyce D (Mrs Cecil B) bkpr City Board of Light & Water Wks r Smyrna Ga RD 1 Martin B R (Dan N) USA r Cherokee rd (Eliz) Martin Beverly (Ella W) USA r Atlanta rd Martin Bradley K (Christine L) 1 eng Bell Aircraft Corp h 313 Park View av Martin Cassie h 116 Black Martin Chas (Dora) 1 lab r 507 Hunt Martin Chas Jr student r 507 Hunt Martin Claude USA r 304 Franklin Martin Clifford B emp Bell Aircraft Corp r 505 Lawrence Martin Clyde R (Mary F) USA r 504 Powder Springs Martin Dan N (Mrs B R) mach opr Bell Aircraft Corp r Cherokee rd (Eliz) Martin Don R (Era H) 3 sander Brumby Chair Co h 611 Cherokee Martin Dora maid r 507 Hunt Martin Eileen W (Mrs Jas) elk Bell Aircraft Corp r 820 Rose la Martin Eula lndrs h 115 Johnson Martin Fannie K (wid T H) h 1418 Cherokee Martin Geo H (Mary H) 2 elk Bell Aircraft Corp h 210 Phillips dr Apt B Martin Geo N (Mildred R) 1 inspr Bell Aircraft Corp h 404 Grover MARIETTA CITY DIRECTORY 337 Martin Harold R student r Joyner av (FO) Martin Herbert L (Sally H) 2 mech Sou RR Co h 109 Moon Martin J Walter (Bessie R) 6 emp Brumby Chair Co h 219 Brumby Martin Jas (Eileen W) USN r 820 Rose la Martin Jas L emp Bell Aircraft Corp r 308 Washington av Martin Jas L (Annie K) 2 electn Federal Communication Comn Moni- toring Sta h 217 Campbell Hill Martin John M carp h Atlanta rd (FO) Martin John M (Doris) 6 plstr h Joyner av (FO) Martin John W (Maxine H) 1 eng Bell Aircraft Corp h 403 Aviation rd Martin Jos K (Mae H) 1 carp h Joyner av (FO) Martin Jos K Jr USN r Joyner av (FO) Martin Leonard C (Nellie P) mech Bell Aircraft Corp r Joyner av (FO) Martin Lester (Lois R) 3 emp Bell Aircraft Corp r 315 Clay Martin Louise r 1418 Cherokee Martin Lucile knitter Holeproof Hosiery Co r 219 Brumby Martin Luke USA r 304 Franklin Martin Luke R (Bessie S) wtchmn Holeproof Hosiery Co h 400 Whitlock av Martin Luther (Sallie) 2 lab h 304 Franklin Martin Luther J (Eloise W) 3 h Barber rd (FO) Martin Maurice M (Lillie L) USN r 120 Kings ct Apt B Martin Mary F (Mrs Clyde R) emp Holeproof Hosiery Co r 504 Powder Springs Martin Mary H opr S B T & T Co r 400 Whitlock av Martin Minnie maid r 115 Johnson Martin Robt H (Ruby T) mach Bell Aircraft Corp h 118 Hedges Apt 1 Martin Rosa L 1 presser Model Dry Clnrs r 109 Elk Martin Ruth educational dir First Baptist Ch r 109 Forest av Martin Wm H emp Economy Ice Cream Co r RD 4 Martin Wm J (Hazel S) 2 firemn Marietta Army Air Port h 101 Poplar Martin Wm W (Irene P) inspr Bell Aircraft Corp h 206 Holland Martz Louise (Mrs W S) emp Bell Aircraft Corp r 500 Church Apt 3 Martz Wm S (Louise H) 1 foremn Bell Aircraft Corp h 500 Church Apt 3 Martz Willis A (Mildred Z) 1 designer Bell Aircraft Corp h 106 Colonial cir Apt 3 Mashburn Alvin G dr American Lndry r 205 Locust Mashburn Howard W USA r 205 Locust Mashburn John H (Belle P) hlpr h 208 Wayland Apt 3 Masburn John M (Florala S) mach wkr W P Stephens Lbr Co h 205 Locust Mashburn Olin E (Ella S) emp Brumby Chair Co h 600 Roswell Mashburn Wm L emp Bell Aircraft Corp r 205 Locust Mashburn Wyotte O (Lee M) 1 pipeftr Bell Aircraft Corp h 808 E Waterman Mason Aaron B emp Bell Aircraft Corp r 214 Powder Springs Mason Donald D USN r 200 Geo Hamilton ct Apt 3 238 BALDWIN'S 1944 Mason Dorothy L slswn Irving's r 200 Geo Hamilton ct Apt 3 Mason Herbert C (Bernice H) 1 USA r 200 Geo Hamilton ct Apt 3 Mason J B (Sue C) 2 emp Bell Aircraft Corp h Atlanta rd Apt 305 (FO) Mason Lillie M (wid G C) h 200 Geo Hamilton ct Apt 3 Mason Lottie M (wid W C) cash McLellan Stores Co r 108 W Dixie av Mason Sue Lane (Mrs J B) ofc wkr Bell Aircraft Corp r Atlanta rd Apt 305 (FO) Mason Walter firemn Marietta Army Air Port r 208 Roswell Masonic Hall 3d fir 209 Atlanta MASSEY J EDW (Eliz W) Pres The First National Bank, h 1008 Cher- okee---Tel 401 Massey Jas Edw Jr USA r 1008 Cherokee Masters Carroll H (Montine W) 4 mech Bell Aircraft Corp h Glover pi RD 5 Masters Montine W (Mrs C H) emp Bell Aircraft Corp r Glover pi RD 5 Mathews Evelyn W (Mrs Ralph) dk r 208 Chickasaw dr Mathews Jason (Pauline M) 5 solr Nu-Way Clnrs & Lndry h 108 Griggs Mathews Josephine A student r 108 Griggs Mathews Ralph (Evelyn W) emp Bell Aircraft Corp h 208 Chickasaw dr Mathis Florida (Mrs Zack R) waitress cafeteria Waterman Street Sch r 107 Hawkins Mathis Howard (Estelle W) emp Monto Shaw & Son h 303 S Waddell Mathis Keith (Frances H) USN r 814 Cherokee Mathis Zack R (Florida R) jan Waterman Street Sch h 108 Manget Matlock John J (Mary W) meat ctr h 114 Freyer dr Matlock O E (Willie M) 1 h Canton rd (Eliz) Matthew Fred R USA r 913 Roswell Matthew Jos D (Edelka S) 1 emp The McNeel Marble Co h 913 Roswell Matthews Doris instr Bell Aircraft Corp r 216 Atlanta Matthews Floyd H (Opal) meat mgr Piggly Wiggly Supt Mkt r RD 4 Matthews Howard mixer Monto Shaw & Son r 303 S Waddell Matthews Robt D (Irene M) 2 serv repr h Concord rd (FO) Matthews Ruth elk Jones Pharm r 126 Trammell Matthews Z R (Florida M) janitor Waterman Street Sch h 107 Hawkins Mauders J W route mn American Lndry & Dry Clnrs r Smyrna, Ga Mauldin Clarence L (Bonnie) supvr Atlanta Gas Light Co r RD 2 Mauldin Homer G (Gertie M) (East Side Gro) h 305 Cole Mauldine Wilber A (Latrelle T) 1 mech Bell Aircraft Corp h 603 Roose- velt cir Apt A Mauthe John H USMC r 618 Atlanta Mauthe John M formn Holeproof Hosiery Co h 618 Atlanta Maxson Sylvia M emp Bell Aircraft Corp r 1000 Roswell Maxwell Artie (Leola) trk dr H N DuPre h 500 Reynolds Maxwell Benj G (Mary W) 1 carp h 1813 Roswell Maxwell Cath E ofc sec Bell Aircraft Corp r 500 Stewart av MARIETTA CITY DIRECTORY 239 Maxwell Everett C USA r 1813 Roswell Maxwell Frances Indrs h 117 Page Maxwell Francis r 500 Reynolds Maxwell Kenneth P r 1813 Roswell Maxwell Lloyd mach Bell Aircraft Corp r 205 Cole Maxwell Mamie cook 303 McDonald r 500 Reynolds Maxwell Mamie L cook 207 E Dobbs r 217 Reynolds Maxwell Verlon E USMC r 1813 Roswell May Edw W (Mary L) 1 accnt Bell Aircraft Corp h 1606 Hillside dr Mayes Anderson L (Lillian) emp Bell Aircraft Corp r 602 Atlanta Mayes Arth F (Dorothy B) 2 supvr Bell Aircraft Corp h Joyner av (FO) Mayes Chas M (Marjorie W) 1 (Mayes Repair Shop) h 403 Wright Mayes Howard (Luvera W) ins solr r 401 Atlanta Mayes John L (Grace W) 1 const wkr Bell Aircraft Corp h 513 Frasier Apt 2 Mayes Luvera W (Mrs W H) tchr Waterman Street Sch r 401 Atlanta Mayes Mamie L r 802 Atlanta Mayes Mark W (Emmie M) 2 slsmn h 900 Cherokee Mayes Mary G (wid N M) h 400 Washington av Mayes Michael emp Brumby Chair Co r 210 Black Mayes Modean r 602 Atlanta Mayes Ray T (Martha K) 1 welder h Joyner Lake rd (FO) Mayes Repair Shop (Chas M Mayes) 215 Church Mays C V (Gertrude M) ofc wkr Bell Aircraft Corp h 100 Colonial cir Apt 4 Mazy Jules G (Gloria J) 2 emp Bell Aircraft Corp h 805 3d Apt 4 McAdams Edwin A USN r Atlanta rd (FO) McAdams J Blanche student r Atlanta rd (FO) McAdams Sallie M (wid W B) 5 emp Bell Aircraft Corp r Atlanta rd (FO) McAfee Albert (Laura) mech Bell Aircraft Corp h 906 N Cole McAfee Alf USA r 906 FT Cole McAfee Annie L 3 maid h 510 Lemon Apt 3 McAfee Clifford (Josie E) lab Brumby Chair Co h 507 Lemon Apt 2 McAfee Creasy h 311 Montgomery McAfee Evans H (Nellie B) 1 emp Bell Aircraft Corp h 232 E Dixie a' McAfee Frances maid r 906 N Cole McAfee Frank porter Filliams Drug Co r 906 N Cole McAfee Henry (Nettie J) 2 lab Brumby Chair Co h 410 W W Lee ct Apt 7 McAfee Herbert USN r 510 Lemon Apt 3 McAfee Herbert (Carrie L) 1 USN r 410 Robeson ct Apt 6 McAfee Howard D (Dessa W) 3 electn Cobb County Rural Elec Mem- bership Assn h 124 South av McAfee John A Jr (Odell S) 1 electn City Board of Lights & Water Wks h 119 South av 240 BALDWIN'S 1944 McAfee Lorena maid r 106 Height McAfee May D lab Brumby Chair Co h 107 Coryell McAfee Robt H (Beatrice) 1 r Rose la (Eliz) McAfee Rosa maid r 410 W W Lee ct Apt 7 McAfee Ruby student r 510 Lemon Apt 3 McAfee Simon hlpr Georgia Power Co r 106 Height McAlister Kenneth C (Bonnie M) emp Bell Aircraft Corp r 513 Kenne saw av McAllister D Vernon (Mary F) electn Victory Homes of Marietta Inc h 328 Aviation rd McAllister Modene opr Bell Aircraft Corp r 113 Phillips dr McArthur Ernestine knitter Holeproof Hosiery Co r Tower rd (Eliz) McArthur Luther T (Clara C) 1 USA r 310 Lemon McArthur Thos A (Miarga A) 1 inspr Bell Aircraft Corp h 307 Lakewood dr Apt 2 McBrayer Claude E (Minnie G) 2 trk dr h 200 Wayland Apt 5 McBrayer Doris slswm Irving's r 200 Wayland Apt 5 McBrayer Dorothy M (Mrs H E) typist Marietta Housing Authoarity r 208 E Dixie av McBrayer Harry E (Dorothy M) USN r 208 E Dixie av McBrayer John E (Ruby P) 1 slsmn Marietta Coca-Cola Btlg Co Inc h 209 Waterman McBrayer Miles A trk dr r 209 Cleveland av McBride Sami J (Willie J) 3 formn S B T & T Co h 106 Trammell McCall Robt F (Edna C) 2 eng Bell Aircraft Corp h 100 Colonial cir Apt 2 McCall W Coy (Wacoe C) 2 emp Bell Aircraft Corp h 407 Church Apt 1 McCall Wacoe C (Mrs W Coy) elk Bell Aircraft Corp r 407 Church Apt 1 McCamy Roy L (Lucy P) USA h 314 Campbell Hill McCarey Raymond L (Dessie D) 1 formn Bell Aircraft Corp h 1224-a Whitlock av McCauley Lee (Janie G) 4 mech Bell Aircraft Corp h 800 4th Apt 2 McCay D Claude (Evangeline C) accnt h Darnell rd (FO) McClain Brown L (Georgia C) 2 h 209 Merritt Apt B McClain Georgia C (Mrs Brown L) emp Bell Aircraft Corp r 209 Merritt Apt B McClain Roy (Telitha) 1 emp Bell Aircraft Corp r 225 Johnson McClain Telitha maid r 225 Johnson McClanahan Bertha r Burnap RD 1 McClanahan Wm L (Dessie B) 6 mach opr Brumby Chair Co h Burnap RD 1 McClarty Ernest M (Pearl R) 2 lab Bell Aircraft Corp h Beaver av McCleskey Albert E (Stella S) formn Ry Exp Agcy Inc, billiards 200 Mill h 307 N Waddell McCleskey Arch H (Jessie D) bkpr & plant mgr Wofford Oid Co r Ac- worth Ga MARIETTA CITY DIRECTORY ?41 ` " McCleskey D Homer (Kate W) slsmn H N DuPre h 311 Lawrence McCleskey Eliza r 109 Mulberry McCleskey Jane elk Mass Mutual Life Ins Co r 1007 Church McCleskey Jas (Pearline B) section hd N C & St L RR h 211 Maple McCleskey Milton (Willie M.) tailor Walter W Hazel h 227 Johnson McCLESKEY ROY (Flora W) Agent Wofford Oil Co, h 1007 Church --Tel 224 McCleskey Ruby B (wid T V) ofc sec County Ordinary r 323 Lawrence McCleskey Sami porter Hodges Drug Co r 807 N Cole McCleskey Willie M cook 301 Kennesaw av r 227 Johnson McClung Andrew (Grace T) emp Monto Shaw & Son h 108 Black McClung Hugh D (Mary A) 2 first aid mn Bell Aircraft Corp h 504 Haynes Apt 1 McClurd Lucille inspr Bell Aircraft Corp h 605 Birney Apt 1 McClure Ernest (Bessie Ms) 1 emp Victory Homes of Marietta Inc h 111 Covington McClure Felton (Dorothy C) carp Bell Aircraft Corp h 805 4th Apt 6 McClure G Earl (Lois C) 2 electn h Bells Ferry rd (Eliz) McClure Geo W (Blonde W) re-capper McPherson Tire Shop r RD 1 McClure Leland (Emma D) 1 lab h 204 Geo Hamilton ct Apt 1 McClure Paul R (Monnie T) 3 pntr h 108 Hawkins McClure Ruby dishwasher Model Cafe r 307 Rigsby McClure Ruby E elk McLellan Stores Co r RD 4 McCluskey Lee R (Cora) emp Brumby Chair Co r 204 Jones McCollum Alf USA r 311 Austin av McCollum Annie Bell (Mrs Hoyt) slswn Saul's Dept Store r RD 4 McCollum Barbara S (Mrs J D) (Cinderella Shop) r 304 McDonald McCollum Carolyn (Mrs A L) slsmn Sunlite Bakery r 209 George Hamil- ton ct Apt 7 McCollum Claude W ins solr r 301 Clay McCollum Clyde (wid J D) r 417 Whitlock av McCollum Flora (Mrs Levi) emp Economy Ice Cream Co r RD 3 McCollum JMBr 309 Austin av McCOLLUM JOHN D (Barbara S) 1 V-Pres Johnny Walker Inc h 304 McDonald--Tel 1024-J McCollum John W (Winnie H) h Barber rd (FO) McCollum Rebecca L (Mrs R L) emp Holeproof Hosiery Co r 311 Austin av McCollum Robt L (Rebecca L) 1 emp Bell Aircraft Corp h 311 Austin av McCollum Talmadge W (Margt S) r 113 Reynolds McConnell Georgie maid 608 Birney Apt 2 r Page McConnell Clyde E (Louise C) 1 gro 1015 Roswell h same McConnell Ephriam (Unicie) 1 emp Bell Aircraft Corp h 205 Mulberry McConnell Grace cook h 618 Wright McConnell Hazel (Mrs Hubert) supt Marietta Hosp r same McConnell Hubert G (Kathleen T) 2 mach h Glover pi RD 5 342 BALDWIN'S 1944 McConnell Mary 2 Indrs r 618 Wright McConnell Paul W (Evelyn T) USA r Joyner av (FO) McConnell Paul W (Evelyn T) USA r Joyner av (FO) McConnell Robt (Queenie L) 4 emp Marietta Trans Co h 125 Henderson McCord Lena emp Bell Aircraft Corp r 301 Butler McCoy Bettie msngr Bell Aircraft Corp r 114 Delk McCoy Artice C (Jessie) 3 carp h Cochran McCoy Bonnie L (Sarah) (Stokes & Co) r Atlanta Ga McCoy Edgar C (Kathleen H) USA r Atlanta rd (FO) McCoy Georgia Mrs dietician Marietta Hosp r same McCoy Kathleen (Mrs E C) ofc wkr r Atlanta rd (FO) McCoy L Herbert (Clara H) 1 emp Bell Aircraft Corp h 212 Campbell Hill McCranie Jas (Johnnie) 1 emp Bell Aircraft Corp h 202 Victory dr McCray Douglas emp Holeproof Hosiery Co r 209 Geo Hamilton ct Apt 5 McCray Eva emp Bell Aircraft Corp r 209 Geo Hamilton ct Apt 5 McCray Geo H (Florence G) 1 mech Bell Aircraft Corp h 605 Roosevelt cir Apt B McCray Herman USN r 209 Geo Hamilton ct Apt 5 McCray Olive Mrs emp Holeproof Hosiery Co h 209 Geo Hamilton ct Apt 5 McCrary J M r Rose la (Eliz) McCrary Wm O (Hazel R) 1 guard Bell Aircraft Corp h 601 Victory dr Apt 2 McCray Robt (Lillian P) 2 emp Bell Aircraft Corp h 130 Garrison dr McCray Wm (Rouel Y) 4 lab h 318 Lemon McCullers Jas F (Janie M) 2 h Cochran (FO) McCulloch Margt h 5051/2 Powder Springs McCulloch William W (Regina T) electn Bell Aircraft Corp h 605 Polk McCurdy Bessie Mrs h 312 E Dixie av McCURDY WM M (Laura B) 2 Agent Railway Express Agency Inc h 420 Maple av--Tel 867-J McCurley Cordie knitter Holeproof Hosiery Co r Rose la (Eliz) McCurley Oscar (Sarah A) carp Brumby Chair Co h Rose la (Eliz) McCurley Pierce USMC r Rose la (Eliz) McCurley Sarah knitter Holeproof Hosiery Co r Rose la (Eliz) McCurley W Keller (Donna M) 2 mech N C & St L RR h Lakewood av RD 5 McCurley Willie V knitter Holeproof Hosiery Co r Rose la (Eliz) McCurry Gladys (Mrs S J) slswn Florence's Inc r 500 Stewart av McDaniel D Orin (Grace F) wtchman Glover Mach Wks h 318 Maple av McDaniel Frank (Janie) emp Brumby Chair Co r 1501 Roswell McDaniel Herbert C (Eliz B) 1 instr Bell Aircraft Corp r 109 Campbell Hill McDaniel J T (Artie L) wtchmn r 109 Campbell Hill McDaniel Larsailte (Lurline) 1 r 808 1st Apt 2 McDaniel Orin D Jr r 318 Maple av McDaniel Robt emp Bell Aircraft Corp r 105 Moon MARIETTA CITY DIRECTORY 243 McDaniel Sarah R US WAVES r 318 Maple av McDaniel Wm L (Margt L) 3 slsmn h 213 Etowah dr McDaniel Wm L (Margt L) 3 slsmn h 213 Etowah dr McDaniel Wm W (Doris L) 2 emp Glover Mach Wks h 318 Maple av McDonald Anna r 119 Barnes McDonald Horace M (Clara M) 2 eng N C & St L RR h Joyner av McDowell Lawrence (Florence V) 2 mach Bell Aircraft Corp h 212(2) S Waddell McDowell Nettie B (wid G B) r 109 Husk McElreath Addie P h 105 Waterman McElreath Lena (wid Augusta) elk Big Star Food Store r 300 Cherokee McEntyre Chas M (Lillie) USN h 415 Maple av McEntyre Chas M (Aimee Q) (Root Barber Shop) 606 Haynes McEntyre Chas M: Rev (Aimee) barber h 606 Haynes McEntyre Claude M (Pearl C) slsmn Field Furn Co h 604 Cherokee McEntyre Jack baker Sunlite Bakery r 417 Maple av McEntyre Jas P (Pearl G) 4 pntr Wofford Oil Co r 205 Fairground McEntyre John H r 417 Maple av McEntyre John T (Bettie H) formn Brumby Chair Co h 417 Maple av McEntyre Lucy B (wid A M) 2 r 1303 Roswell McEntyre Pearl C (Mrs C M) ofc wkr Bell Aircraft Corp r 604 Cherokee McEntyre Robt (Evelyn T) 2 (McEntyre Service Sta) h 304 E Dixie av McEntyre Wm L (Ethel D) 1 formn Brumby Chair Co h 201 George Ham- ilton ct Apt 6 McFall Buford (Ruth II) USA r 614 Cherokee McFall Margie ofc wkr Bell Aircraft Corp r 317 E Dixie av McFall Ruth H (Mrs Buford) elk Economy Ice Cream Co r 614 Cherokee McFarland Anne (Mrs C W) ofc sec Stokes & Co r 114 Colonial cir Apt 1 McFarland Clark W (Anne M) sales mgr Stokes & Co h 114 Colonial cir Apt 1 McGaha Garnett (Virginia B) 1 guard Bell Aircraft Corp h 703 3d Apt 4 McGaney Carrie (Mrs L J) elk The Book Store r 505 Page McGaney Lee J (Carrie B) mgr Atlanta Street Barber Shop r 505 Page McGarity Jack (Elsie Mi) 7 lab W P Stephens Lbr Co h 108 Maple McGaughey Robt H (Ola B) emp Bell Aircraft Corp r 504 Haynes Apt 2 McGee Ralph H (Aleita L) emp Bell Aircraft Corp h 201 Stewart av McGill John T (Isabell B) 1 emp Bell Aircraft Corp h 1614 Hillside dr McGouirk Jos W (Floy D) , USA r Bingham McGowan Andrew J (Grace B) 2 mach opr Bell Aircraft Corp h 809 4th Apt 5 McGowan Hugh A (Eliz T) 1 elec eng Bell Aircraft Corp h 203 Max- well McGrath Leo (Helen D) 2 mech Bell Aircraft Corp h 604 Roosevelt cir Apt B McGraw Chas E (Mable P) 1 emp Bell Aircraft Corp h 808 3d Apt 3 244 BALDWIN'S 1944 McGuire Chester (Claudia) lab Brumby Chair Co h rear 813 Church McGuire Claudia maid 813 Church r rear same . McGuire Edw cusp Bell Aircraft Corp r 317 E Dixie ay McGuirk Bailie sell tchr Waterman Street Sch r 108 Forest av McGuthry Annie S 3 h 103 Fort Apt 4 McGuthry Louise A emp Dixie Gate r 103 Fort Apt 4 McHanon Alice r 600 Cole McHenyr Juanita student r 901 N Cole Mclcher Althea (Mrs J E) ofc wkr Bell Aircraft Corp r 227 E Dixie av Mclnnes Eunice T (Mrs J D) ofc wkr Bell Aircraft Corp r Atlanta rd (FO) Mclnnes Geo S r Concord rd (FO) Mclnnes John D (Eunice T) 1 h Atlanta rd (FO) Mclnnes Norman M (Leora S) farmer h Concord rd (FO) McIntosh Chas L student r 1401 Roswell McIntosh Rader E (Opal J) 1 mgr Southland Ice Co h 1401 Roswell McKee Jas B (Pearl B) 1 inspr Bell Aircraft Corp h Glover pi RD 5 McKee Pearl B (Mrs Jas B) emp Bell Aircraft Corp r Glover pi RD 5 McKenzie Jas H (Lillian M) 2 emp Bell Aircraft Corp h 330 Aviation rd McKenzie John W (Hattie M) 1 h 517 Washington av McKenzie Mary student r 517 Washington av McKibben Roy J (Ruth M) 2 plmbr h 117 Moores av McKinley Fannie D (wid Omer) r Barber rd (FO) McKinney Emma (wid Wm) r IIS Freyer dr McKinney Jessie B (Mrs M K Jr) elk W P Stephens Lbr Co r 102 Locust McKinney Lucius (Clara C) slsmn Saul's Dept Store r 404 Maple av McKinney May S (wid W S) r New Marietta Hotel McKinney Michael K (Jessie B) 2 ofc wkr W P Stephens Lbr Co r 102 Locust McKinney Nancy J (Mrs W E) bkpr McKinney Tire & Battery Service r 116 Freyer dr McKinney Pauline E sten Bell Aircraft Corp r 404 Maple av McKinney Ruby L sten r 404 Maple av McKINNEY TIRE & BATTERY SERVICE (Wm E McKinney) Automo- bile Accessories and Supplies, Gulf Gasoline and Oils, Firestone Tires and Tubes and Willard Batteries, 218 Church---Tel 327 (See Buyers' Guide) McKINNEY WM E (Nancy J) (McKinney Tire & Battery Service) h 116 Freyer dr---Tel 786 McKinnon Marwin W (Evelyn S) 1 aud Bell Aircraft Corp h 614 2d Apt 3 McLain Eliz P (Mrs J B) receptionist W P Stephens Lbr Co r 219 Maxwell McLain Arlene C (Mrs T G) radio opr Federal Communication Comn Monitoring Sta r 303 Roswell McLain Jas B (Eliz P) @ ship elk W P Stephens Lbr Co h 219 Maxwell McLain Thos G (Erlene C) USA r 303 Roswell MARIETTA CITY DIRECTORY 245 McLain Thos I r 119 W Dixie av McLarty Georgia (wid Fredk) r Hill RD 5 McLarty Jas F (Nettie B) del slsmn Shell Oil Co hf 201 Sycamore McLarty Jos E (Tiny J) 2 h Bells Ferry rd (Eliz) McLellan Kate M (wid T C) nurse h 309 Maple av McLellan Stores Co John A Crumrine mgr 56-57 S Park Square McLemore Benj F (Betty C) USA h 200 Wayland Apt 8 McLemore Betty C (Mrs Benj F) elk Atherton Drug Co r 200 Wayland Apt 8 McLemore Jeanette emp Cox Prntg Co r RD 4 McLemore Kath B (Mrs Smith) ofc wkr Bell Aircraft Corp r Gray (Eliz) McLemore Leonard H (Velva J) 3 elk Big Star Food Store h 200 Lemon McLemore Marshall E elk Big Star Food Store r 200 Lemon McLemore Milton L USA r 200 Lemon McLemore Riley N prntr Cox Prntg Ct> r RD 4 McLemore Robt E (Louise J) 2 formn Bell Aircraft Corp h 208 Clay McLemore Smith (Kath B) USA r Gray (Eliz) McLemore Wm J USA r 200 Lemon McManus Nolen (Annie M) 4 tex wkr h 523 Washington av McMichean Thos A blue prnt dept Bell Aircraft Corp r 100 McIntosh av Apt B McMichen Napoleon J (Bessie S) h 100 McIntosh av Apt B McMickens Wm del mn Hodges Drug Co r 310 W Goss McMillian Geo H (Evalyn L) 3 County Commissioner h 318 Lawrence McMullan Marion J elk Bell Aircraft Corp r 714 Atlanta McNamara Geo C (Helen L) 1 stereotyper The Marietta Journal h 200 George Hamilton ct Apt 9 McNEEL ADA (wid M L) Pres The McNeel Marble Co h 1013 Chero- kee---Tel 954-W McNEEL EUG E (Louise I) 1 V-Pres The McNeel Marble Co, h 815 Church--Tel 635 McNeel Eug E Jr student r 815 Church McNEEL FRANK F (Mary B) Y-Pres The McNeel Marble Co r RD 1 McNeel Harry H student r 1224 Whitlock av McNeel Katie emp Bell Aircraft Corp r 505 W Atlanta McNEEL MARBLE CO THE, Mrs Ada McNeel Pres, Eug E McNeel, Frank F McNeel and Geo Thomas V-Prest, Morgan L McNeel Jr V-PresTreas, America's Largest Builders of Memorials, 355 Sessions--Tels 19 and 20 (See Buyers' Guide) McNEEL MORGAN L JR (Hazel H) 1 V-Pres-Treas The McNeel Marble Co h 1224 Whitlock av--Tel 702-J McNeely Blanche H sten County Board of Education r Atlanta (FO) McNeely Leon G (Blanch H) 1 bkpr r Atlanta rd (FO) McNeely Leon W student r Atlanta rd (FO) 246 BALDWIN'S 1944 McNeil Gomer T (Mertie M) 2 emp Bell Aircraft Corp h Concord rd Apt 13-b (FO) McNutt Robt W (Virginia) 1 USA r 601 Polk McPHERSON EDW W (Mary L) 1 (McPherson Tire Shop) h 503 Ken- nesaw av--Tel 53 McPherson Evelyn K (Mrs R L) elk First Natl Bk r 230 Campbell Hill McPherson Grady USA r 215 Campbell Hill McPherson Jas M (Louise E) h 215 Campbell Hill McPherson Mae (wid G A) knitter Holeproof Hosiery Co r 315 Glover McPherson Mary L (Mrs Edw W) cash McPherson Tire Shop r 503 Ken- nesaw av McPherson Richd L (Evelyn K) 1 USA r 230 Campbell Hill McPherson Ruth tchr Elizabeth Sch r Rabun Gap Ga McPHERSON TIRE SHOP (Edw W McPherson) Goodyear Tires, Batter- ies, Quality Tire Re-capping and Repairing, Sinclair Gasoline and Oil, Auto Accessories and Supplies, Automobile Washing and Polishing, 219-21 Church--Tel 355 (See front supplement cover and Buyers' Guide) McPherson W Claude (Alpha B) 4 mech h Ward (Eliz) McRae Henry T (Ethelle) del slsmn Gulf Oil Corp r RD 3 McRae Ethel E (Mrs C E) elk County Health Dept r 405 Powder Springs McRae Nancy (wid J D) r Rose la (Eliz) McRae Cora (wid W H) h 228 Campbell Hill McTyre Edwin H (Virginia V) checker W P Stephens Lbr Co h Joyner av (FO) McTyre Geo W (Hattie B) 1 h Joyner av (FO) McTyre Helen student r Joyner av (FO) McTyre Luther D (Vera W) 2 atndt Paul Thomas Service Sta h 117 Griggs McTyre Myra opr S B T & T Co r Joyner av (FO) McTyre W Henry (Chessie B) 1 atndt Johnson Service Sta h Joyner av (FO) McVicker Lula (wid Chas) r 400 N Waddell McWhirter Roy (Wylene B) 1 h Burnap RD 1 McWilliams Wm L (Madeline C) 2 linemn S B T & T Co h 208 George Hamilton ct Apt 2 Means Clair A (Bernice) 1 osteo 100% Whitlock av h 608 Church Means Faraba r 400 Lemon Means Wm H (Allison F) formn Bell Aircraft Corp h 318 Park View av Mecca Annie L inspr Bell Aircraft Corp r 120 Lacy Mecca Peter E (Annie H) USA r 120 Lacy Medford Annie h 201 Waterman Medford Betty ofc wkr Earl G Medford r 110 Margaret av MEDFORD DEMPSEY B (Mabel) (The Book Store) h 301 Washington av--Tel 983 MARIETTA CITY DIRECTORY 247 MEDFORD EARL G (Samye B) Genl Insurance and Notary, 215 Atlanta Tell--1098 h 110 Margaret av--Tel 808 Medford Louella M Mrs 2 ofc wkr Bell Aircraft Corp h 616 Atlanta Medford Maude housekpr r 109 Forest av Medford Robt L (Eliz Me) firemn General Lawson Ilosp r 309 Maple av Medford Sanford C hlpr r 200 Roswell Medford Walter W (Leila T) 1 eng Bell Aircraft Corp h 200 Roswell Medford Wm G (Mildred H) formn Bell Aircraft Corp h Bells Ferry rd (Eliz) Medlen Frank J (Alice T) fdrymn Bell Aircraft Corp h 614 Birney Apt 2 Medley Edna G (wid J E) h Beaver av Medley F H (Alice A) 2 emp Bell Aircraft Corp h Concord rd Apt 15-a (FO) Medley Frank H Jr student r Concord rd Apt 15-a (FO) Medlin Vester guard Bell Aircraft Corp r Atlanta rd Meek Bessie A (wid L B) housekpr 122 Hedges Apt 1 r same Meek Bessie H (wid W A) h 306 Maple av Meek Dorothy opr S B T & T Co r 316 Maple av Meek Kath opr' S B T & T Co r 316 Maple av MEEKS PAUL F (Floy) (J M Fowler Co) r Villa Rica Ga Meek Sarah E (wid GW) 2 h 316 Maple av Meeks Sami hlpr Brumby Chair Co r 615 Lawrence Megarity Edw G (Pearlie S) h Roswell nr Atlanta-Marietta Hwy MEINERT FLORIST (Mrs Henry Meinert) "The Beauty of Our Business Is Flowers" 310 Roswell--Tel 35 (See Buyers' Guide) MEINERT HENRY MRS (Meinert Florist) h 310 Roswell--Tel 35 Meister Robt G (Mary E) 1 supvr Bell Aircraft Corp h 113 Hedges Apt 1 Mell Herb C (Ida P) ins solr h 400 Lawrence Meil Robt W r 400 Lawrence Memorial Baptist Church 831 Manget Men's Garden Club meets 2d Monday Night 31 N Park Square Mcntz Albert W (Anne T) emp Beil Aircraft Corp h 605 Page MERCANTILE AGENCY THE--Dun & Bradstreet Inc, G A Giese, Mana- ger 101 Marietta N W, Atlanta Ga--Tel MA 4144 Merrett Wilber M (Myrtle L) 1 carp h 405 Maple av Merrill Bernice (Mrs E K) emp Bell Aircraft Corp r 702 6th Apt 3 Merrill E K (Bernice) 2 USA h 702 6th Apt 3 Merritt Addie cook r 910 N Cole Merritt Allen T Jr (Christine W) 1 civ eng HOVa Washington av h 410 Roswell Merritt Betty Jo student r 410 Roswell MerritftJack (Georgia C) 4 carp h Hill RD 5 Merritt Julius (Inez C) 1 trav slsmn h 205 E Dixie av Merritt Lpy emp Bell Aircraft Corp r Hill RD 5 Merritt Oscar (Dora C) lab h 909 Lawrence \ -- \ 248 -- . BALDWIN'S 1944 Merritt Oscar J lab Bell Aircraft Corp r 909 Lawrence Merritt Ralph USA r 909 Lawrence Merritt Wilber M Jr (Irene B) 1 USN r 405 Maple av Merriweather Ethel 1 maid h 503 Lemon Apt 7 Merriweather "Walter (Emma S) lab h 414 Reynolds Metcalf Claude F (Norma M) 2 carp h Oak av (FO) Mex Carl H (Julia W) loftsmn Bell Aircraft Corp h 1625 Hillside dr Meyers Roy T (Susie L) S' lab Bell Aircraft Corp h 408 W W Lee ct Apt 8 Michael Annette student r 227 E Dixie av Michaels Bettie S (Mrs Edw F) emp Bell Aircraft Corp r 507 Stewart av Michaels Edw F (Bettie S) 2 emp Bell Aircraft Corp r 507 Stewart av Michael Goldenberg (Esther E) 2 mech Bell Aircraft Corp h 409 Lake- wood dr Apt B Michael Randolph R (Lorene S) 1 formn Bell Aircraft Corp r 105 Delk Milam Curtis L (Mettie F) 1 formn Holeproof Hosiery Co h 414 Maple av Milam E Edw (Jodie M) emp Bell Aircraft Corp h 109 Radium Milam E S Jr (Glennis S) USA r Henry RD 5 Milam Irving E r 122 Trammell Milam Irving E r 122 Trammell Milam Mettie F (Mrs Curtis L) ship elk Holeproof Hosiery Co r 414 Maple av Mill End Store The (Jos Goldstein) 205 Mill Miles Elvin G r 209 Campbell Hill Miles Ethel Mrs 1 inspr Holeproof Hosiery Co r 111 Campbell Hill Miles Martin L (Ella K) 2 h 209 Campbell Hill Miles Mary L emp Bell Aircraft Corp r 209 Campbell Hill Milkbrook Chas lab Brumby Chair Co r 124 Henderson Miller Alice (wid T C) r 311 Washington av Miller Alice cook 620 Whitlock av 115 Greer Miller Annie L student r 410 W W Lee ct Apt 4 Miller Betty student r 114 Holiday Miller Clara T 2 maid h 114 Holiday Miller David E USN r 316 Washington av Miller Edw F (Doris S) mach Bell Aircraft Corp h 707 3d Apt 2 Miller Ethel D tmkpr Bell Aircraft Corp r 604 2d Apt 1 Miller Eva A bkpr County Tax Collectors r 326 Atlanta Miller Geo W (Alva M) mach Bell Aircraft Corp h 208 Wayland Apt 5 Miller Gertrude I (Mrs T C) ofc wkr Holeproof Hosiery Co r 206 Camp- bell Hill Miller Harlan (Helen) USA h 521 Vista cir Apt 2 Miller Henry (Louella T) 1 mach opr Glover Mach Wks h 404 S Waddell Miller Henry Jr lab r 404 S Waddell Miller Howard W (Alice M) 2 mach Bell Aircraft Corp h 521 Frasier Apt 1 MARIETTA CITY DIRECTORY 349 Miller Hubert trkr L & N RR and N C & St L RR b. 115 Greer av Miller Hugh hlpr Carter Candy Co r RD 1 Miller's Inc Carroll V Bushong mgr 37 W Park Square Miller Jas (Marian) 1 porter Strand Theatre h 510 Lemon Apt 2 Miller John R (Sallie A) tax adjuster h 326 Atlanta Miller Kingsly Jr (Lois L) 3 (Ga Produce Co) h 306 Kennesaw av Miller Kingsley E (Lois L) (Ga Produce Co) 306 Kennesaw av Miller Leo (Mary L) eng h 316 Washington av Miller Lois L (Mrs Kingsly) bkpr First Natl Bk r 306 Kennesaw av Miller Lucile maid r 314 W Goss Miller Mary L (Mrs Leo) ofc dep County Sheriff r 316 Washington av Miller Mattie maid 222 Rose la r 314 Goss Miller Millard (Letha C) 1 ydmn h 305 Page Miller Pledger (Ethel) emp Bell Aircraft Corp h 604 2d Apt 1 Miller Quinton C (Ellen S) 1 welder Bell Aircraft Corp h 608 1st Apt 4 Miller R Danl lab r 314 W Goss Miller Robt (Helen B) lab The McNeel Marble Co h 511 Lemon Apt 5 Miller Robt L (Mattie G) emp Brumby Chair Co h 314 W Goss Miller Rube r 114 Holiday Miller Sami (Annie L) ydmn h 410 W W Lee ct Apt 4 Miller Theo C (Gertrude I) 1 loftsmn Bell Aircraft Corp h 206 Campbell Hill Miller Wm A (Eliz B) emp Bell Aircraft Corp h 206 Aviation rd Miller Willie hlpr McCleskey Bros r Rose la (Eliz) Mills Alton (Mary M) 2 hlpr h 115 Clay Mills Gratia A (wid B R) r 810 E Waterman st Millwood Anna L r Marble Mill (Eliz) Millwood Benj J (Maud K) 1 emp Bell Aircraft Corp h 211 Austin av Millwood Gillie F (Mrs W T) cook Elizabeth Sch r Marble Mill (Eliz) Millwood H Fredk (Burnie M) (Millwood's Lunch Room h 211 Holland Millwood Henry J (Addie C) h 1926 Roswell Millwood Hugh F Jr USA r 211 Holland Millwood Sarah C knitter Holeproof Hosiery Co r 211 Holland Millwood W T (Gillie F) 1 lab L & N RR h Marble Mill (Eliz) Millwood W Thos r 211 Holland Millwood's Lunch Room (H Fred Millwood) 107 Root Milton Adolphus E USN r 402 W Goss Milton Clarence (Katie B) 7 jan Holeproof Hosiery Co h 402 W Goss Milton Clyde (Sylvenia W) 1 hlpr Brumby Chair Co h 400 W Goss Milton Elmer emp Brumby Chair Co r 402 W Goss Milton Nellie r 402 W Goss Mims Edw C (Mary M) drftsmn h 405 Polk Mims Mary M (Mrs Edw C) bkpr r 405 Polk Mince Jesse porter Marietta Hatchery r RD 4 Miniafield Harvey (Izzie) lab h 301 Montgomery 250 BALDWIN'S 1944 Minniefee Baswell (Jennie) lab h 311-a Page Mjnnefee Edw (Irene J) 2 lab Brumby Chair Co h 808 N Cole Minnefee Harold porter Jones Pharm r 808 N Cole Minnefee Jennie L maid r 311-a Page Minnefee John (Ardena) 1 lab Brumby Chair Co h 904 N Cole Min shew Clayton T (Tressie H) mach Bell Aircraft Corp h 416 Maple av Mint Carrie cook h 102 Rigsby Mint Jesse ydmn 909 Whitlock av r Dallas rd RD 4 Mint Sarah cook 909 Whitlock av r Dallas rd RD- 4 Minter Wm L (Gladys) 4 emp Bell Aircraft Corp h Rose la (Eliz) Minter Wm M tractor dr r Rose la (Eliz) Minter Virginia student r Rose la (Eliz) Mintz Harold S (Dorothy C) 2 formn Bell Aircraft Corp h 608 Morning- side dr Apt 2 Miolen Homer Y (Grace S) 1 elk Brumby Chair Co r 307 Stewart av Miolen Joan 1 instr Bell Aircraft Corp h 806 4th Apt 1 Mitchell Beulah S (wid Benj) h 108 W Dixie av Mitchell Chas F (Rosa A) (Mitchell Furn Mfg Co) h 109 Butler Mitchell Carl F (Annie S) 2 (Mitchell Furn Mfg Co h 117 Butler Mitchell Dorothy student r 105 Hawkins Mitchell Dorothy (Mrs N E) asst mgr Sunlite Bakery r 403 Powder Springs Mitchell E Lee (Mary A) guard Bell Aircraft Corp h 204 George Hamil- ton ct Apt 6 Mitchell Edw USN r 117 Butler Mitchell Eloise maid 302 Frasier r 207 Maple Mitchell Elsie L student r 109 Butler Mitchell Eliz ofc sec & bkpr Kaplan's Dept Store r 117 ButFr Mitchell Emma D (wid BE) h Atlanta rd (FO) Mitchell Furniture Mrg Co (Chas F and Carl F Mitchell) 109 Butler Mitchell & Gentry (Onnie D Mitchell, Geo M Gentry live stock rear 105-07 S Waddell Mitchell Guy (Irene P) 2 uphol Mitchell Furn Mfg Co r 109 Butler Mitchell Harrison D (Margt B) USA r Atlanta rd (FO) Mitchell Henry M (Marian T) 1 formn Bell Aircraft Corp h 804 4th Apt 3 Mitchell Herbert (Elaine R) 1 uphol Mitchell Furn Mfg Co r 109 Butler Mitchell Hope S (Beulah S) 7 pntr W P Stephens Lbr Co h 105 Hawkins Mitchell Hubert H (Montee R) 1 pntr h 830 Manget Mitchell Isaac (Bessie) emp W P Stephens Lbr Co h 213 Reynolds Mitchell Margt B (Mrs H P) ofc wkr r Atlanta rd (FO) Mitchell Margt V student r Atlanta rd Mitchell Mary R slswn Diamond Jewelry Co r 204 Geo Hamilton ct Apt 6 Mitchell May drsmkr h 405 Cherokee Mitchell N E (Dorothy B) mgr Sunlite Bakery 403 Powder Springs Mitchell Norris r 108 W Dixie av Mitchell O D Grocery (Onnie D Mitchell) 112 Washington av MARIETTA CITY DIRECTORY 251 Mitchell Onnie D (Ruby H) (Mitchell & Gentry, O D Mtichell Gro) h 728 Roswell Mitchell Owen J (Oneal P) emp Bell Aircraft Corp h Atlanta rd Mitchell Ralph G (Pauline R) pntr W P Stephens Lbr Co h Atlanta rd Mitchell Roy boarder Holeproof Hosiery Co r 108 W Dixie av Mitchell Ruby H (Mrs 0 D) elk 0 D Mitchell Gro r 728 Roswell Mitchell Thelma E emp Holeproof Hosiery Co r 204 Geo Hamilton ct Apt 6 Mitchell Thos H (Harriet L) 3 expeditor Bell Aircraft Corp h 1105 Church Mochone Ellen cook r 225 Johnson Model Cafe (Mrs M Estelle Keefe) 112 Cherokee MODEL DRY CLEANERS, (Wm L Aldridge) Hats Cleaned and Blocked, Fur Cleaning and Glazing, Alterations and Moth-Proofing, 117 Cherokee--Tel 150 (See right top lines) Moffitt T Franklin (Frances H) emp Bell Aircraft Corp h 202 cramling Mohon J A (Nola S) h Miller av (FO) Mohon Senate C (Annie C) wtchmn County Farm h 407 Powder Springs Molloy Jas W (Jane A) formn Bell Aircraft Corp h 110 Colonial cir Apt 3 Mann Harry T grinder Bell Aircraft Corp r 605 2d Apt 5 Monroe Edw (Grace) 1 USA h Hill RD 5 Montgomery Ada maid r 204 Maple Montgomery Chas C USA r 810 4th Apt 2 Montgomery Check (Loraine) USA r 221 Powder Springs Montgomery Clint B (Evelyn W) 2 ptrn mkr Bell Aircraft Corp h 810 4th Apt 2 Montgomery Corinne student r 810 4th Apt 2 Montgomery Fredk C (Lucille T) 1 mech McIntyre Garage r 601 Cherokee Montgomery Geo F (Susie W) rationing board r 900 Cherokee Montgomery Geo F Jr (Dorothy F) 1 loftsmn Bell Aircraft Corp h 103 Seminole dr Montgomery Ruby Indrs r rear 420 Atlanta Montgomery Wallace N (Mary R) 1 br mgr The McNeil Marble Co h h 202 Seminole dr Mooar Louise tchr Keith Sch h 507 Cherokee Apt 2 Moody Ola G (Mrs A P) slswn Saul's Dept Store r RD 3 Moon Alonzo L (Bonnie C) h Concord rd (FO) Moon Cleo B (wid R D) boxer Holeproof Hosiery Co h Atlanta rd (FO) Moon Cora K slswn Kaplan's Dept Store r Atlanta rd (FO) Moon Darling J (BessF A) (Moon Gro) h 1515 Roswell Moon Dora opr S B T & T Co r Atlanta rd (FO) Moore E Hammond (Havis S) 1 guard Bell Aircraft Corp h Fair Oak av (FO) Moon Ethel Mrs looper Holeproof Hosiery Co r 800 Washington Moon Eula M (wid Lee) h Barber rd (FO) Moon Florence knitter Holeproof Hosiery Co r Henry RD 5 25 '2 BALDWIN'S 1944 Moon Grocery (Darling J Moon) 1517 Roswell Moon Henry S (Lillie R) farmer h Henry RD 5 Moon Hubert L (Eliz C) 2 trk dr Clackum's Trans h Henry RD 5 Moon Irene knitter Holeproof Hosiery Co r Henry RD 5 Moon Jos (Inez S) 3 sander Brumby Chair Co h Ward (Eliz) Moon Mildred 1 lndrs r 104 Mulberry Moon Ralph USA r Henry RD 5 Moon Robt USA r Atlanta rd (FO) Moon Robt T (Lois C) 1 carrier US PO h 1519 Roswell Moon Tallulah P (wid David C) h Barber rd (FO) Moon Wm L USA r Barber rd (FO) Moon Weldon r Henry RD 5 Moor Arth F (Eva F) farmer h 801 Church Moor Bertha B ofc sec r 213 Chickopee dr Moor Clara ofc wkr Bell Aircraft Corp r 711 Powder Springs Moor Clarence B elk Office of Price Admn r 207 Kennesaw av Moor Clifton B (Nell F) USA r 1314 Cherokee Moor Emly F ofc wkr r 213 Chickopee dr Moor Everett emp Brooks Service Sta r 203 E Dobbs Moor Geo A (Ruby S) farmer h 213 Chickopee dr Moore Geo W USA r 213 Chickopee dr Moor Henry C (Fannie G) cattle buyer h 1314 Cherokee Moor Jos USA r Concord rd (FO) Moor Louise slswn Coggins Shoe Store r 203 E Dobbs Moor Mary D Mrs h 203 E Dobbs Moor Sarah r Concord rd (FO) Moor Wilber G (Mary E) 1 h Concord rd (FO) Moor Wilbur T USN r 213 Chickopee dr Moore Bessie r 313 E Anderson Moore Christine (Victory Beauty Shop) r RD 1 Moore Clara maid r 313 E Anderson Moore Clarence W (Sarah N) 4 reprmn SBT&TCoh703 Powder Springs Moore E Lane (Viva C) h 309 Lawrence Moore Elmer R (Mae B) mech City of Marietta h 621 Powder Springs Moore Elsie H (Mrs J D) ofc wkr Bell Aircraft Corp r 805 3d Apt 1 Moore Era E emp Marietta Hosiery Co r Powder Springs RD 4 Moore Fred D (Johnnie W) 3 h 215 Johnson Moore Glenn (Dorothy) 1 emp Bell Aircraft Corp h 315 Park View av Moore Guss W (Sally) lab h 124 Franklin Moore H C (Rachel R) 1 ofc wkr Bell Aircraft Corp h 703 3d Apt 2 Moore J Henry (Ida M) r 621 Powder Springs Moore Jack D (Elsie H) emp Bell Aircraft Corp h 805 3d Apt 1 Moore Jas T atndt r 608 2d Apt 5 Moore Jessie S (Mrs John H) waitress Bell Aircraft Corp r 301 S Waddell MARIETTA CITv DIRECTORY Moore John H (Jessie C) barber h 301 S Waddell Moore Joy H r 608 2d Apt 5 Moore Lucy 1 maid r 308 Harold Moore Mildred r 621 Powder Springs Moore Mildred M (Mrs Wm T) ofc wkr Bell Aircraft Corp r 608 2d Apt 5 Moore Minnie 1 h 120 Henderson Moore Morgan A (Maggie H) h 206 McCord Moore Noma (wid H T) h Powder Springs RD 4 Moore Peggy A student r 608 2d Apt 5 MJoore Robt C (Omie H) 2 emp Bell Aircraft Corp h 803 1st Apt 4 Moore Roy H Jr (Virginia L) 1 guard Bell Aircraft Corp h 154 W Dixie av Moore Thos J (Bonnie M) 1 emp S B T & T Co h 201 Geo Hamilton ct Apt 8 Moore Wm T (Mildred M) emp Bell Aircraft Corp h 608 2d Apt 5 Mooreland Frances lndrs h 104 Height Moreland John (Emma P) emp W P Stephens Lbr Co h 117 Henderson Morgan Amos J (Lucile G) 1 mach Bell Aircraft Corp h 205 Aviation rd Morgan C Estelle (Mrs F L) emp Bell Aircraft Corp r 202 Camp Morgan Earl W (Pearl S) 2 mach Brumby Chair Co h 827 Manget Morgan Ernest N (Cath C) 2 supt Marietta Hosiery Co h 224 Campbell Hill Morgan Fredk L (Estelle G) USA r 202 Camp Morgan Geo W (Irene G) 2 carp h 116 North av (Eliz) Morgan Ida emp Nu-Way Clnrs & Lndry r 807 N Cole Morgan Jas (Ruby) USA h 517 Vista cir Apt 2 Morgan Jas T (Mary H) 3 emp Bell Aircraft Corp h 808 4th Apt 5 Morgan Martha J ofc wkr U S Selective Service System r 410 Powder Springs Morgan Richd L r 224 Campbell Hill Morgan Robt H USN r 224 Campbell Hill Morgan Robt L (Jetty B) inspr Bell Aircraft Corp h 906 3d Apt 6 Morgan Sybil student r 224 Campbell Hill Morgan Warren W plmbr Mayes Repair Shop r Rose la (Eliz) Morgan Walter (Wilma B) 1 r 237 Hill ct Morgan Wm F (Dorris F) 1 mach Bell Aircraft Corp h 815 1st Apt 1 Moroge C J (Evelyn F) 4 emp Bell Aircraft Corp h 905 Frasier Moroge Evelyn F (Mrs C J) emp Bell Aircraft Corp r 905 Frasier Morrell Otto C (Gladys S) 2 emp Bell Aircraft Corp h 707 3d Apt 3 Morris Andrew W (Geneva P) 1 emp Bell Aircraft Corp h 805 Frasier Morris Annie lndrs r 519 Fort Morris Arnold M (Adeline H) 1 guard Bell Aircraft Corp h 1002 Roswell Morris Dora G (wid Newton M) h 640 Atlanta Morris Eliz E (wid Jas W) slswn h 109 Stewart Morris Fred (Virginia G) lawyer h 200 Seminole dr 254 BALDWIN'S 1044 Morris Geo W (Lucille R) USA h Church (Eliz) Morris Henry C (Myrtle H) carp h Bingham (FO) Morris Jas R USN r 102 Colonial cir Apt 4 Morris Jean emp Bell Aircraft Corp r 108 Forest av Morris Lizzie M maid r 519 Fort Morris Lucille R (wid Geo W) nurse Church (Eliz) r same Morris Mary maid 1606 Hillside dr 519 Fort Morris Mary J (wid J G) r 201 E Dixie av Morris Minnie Indrs h 128 Henderson Morris Newton A (Cora C) h 713 Church Morris R T (Virginia) mech Bell Aircraft Corp h 804 3d Apt 4 Morris S John (Mary D) 1 emp Bell Aircraft Corp r 900 Roswell Morrisette Leila C (wid H H) soc editor The Marietta Journal h 619 Cole Morrison Cab Co (Wm Morrison) 310 Atlanta Morrison Esther tchr Waterman Street Sch r 104 Forest av Morrison Ervin H USA r 617 Ramona Apt 1 Morrison M Smith (Allie M) carp h Concord rd (FO) Morrison Margt r Concord rd (FO) Morrison Mary waitress Liberty Bell r Concord rd (FO) Morrison Mary waitress The Liberty Bell Cafe r RD 5 Morrison Wm (Morrison Cab Co) 310 Atlanta Morrison Wm (Morrison Taxi) r 215 Powder Springs Morrison Wilbur C (Evelyn N) tool mkr Bell Aircraft Corp h 617 Ramona Apt 1 Moseley Chas M (Iris M) elk Bell Aircraft Corp h 112 Hazel Mosely Mattie 2 Indrs h 306 Rigsby Moseley Robt G (Lillian F) 1 mgr Bell Aircraft Corp h 404 Manget Apt 1 Moses Ernest student r 108 Page Mosher Jane A (wid W T) r 504 Cherokee Mosley Brincy R (Mrs John) ofc wkr Bell Aircraft Corp r 305 South av Apt 4 Mosley Fannie h 202 Greer av Mosley John W (Brincy R) 1 emp Bell Aircraft Corp h.305 South av Apt 4 Moss Cyntha r Hill RD 5 Moss Elmer (Lois M) 2 mech Bell Aircraft Corp h 605 3d Apt 4 Moss Freeman (Nellie A) 1 lab h 312 W Goss Moss Lois M (Mrs Elmer) emp Bell Aircraft Corp r 605 3d Apt 4 Moss Mamie L student r 312 W Goss Moss Robt E (Essie G) carp h 107 North av (Eliz) Moss Wm A demurrage supt L & N RR and N C & St L RR h Oak av (Eliz) Mote Lawrence (Grace C) 1 mgr Carl Smith Tire Co h 201 Waddell pi Apt 2 MARIETTA CITY DIRECTORY 255 Mt Calvary Baptist Church Rose la (Eliz) Mount Annie ofc wkr Bell Aircraft Corp r 100 Colonial cir Apt 4 Mountain View Park Cemetery Whitlock av Mozby Seaborn A (Thelma) 1 meat ctr Big-, Star Food Store h 501 Haynes Mozley Building- 64 S Park Square Mozely H E (Ethel H) (Atlanta Street Barber Shop) 602 Church Mozley Hiram E (Ethel H) h 602 Church Mozley Hiram E Jr USA r 602 Church Mozley John W (Lois) carp h 115 Franklin Mozley Lois maid 104 S Waddell r 115 Franklin Mozley Nettie furn apts 305 Lawrence h same Mozley Robt USA r 602 Church Mudrack Jane (wid August) r 516 Church Mulkey A F (Mary S) farmer h Page Mulkey Frank J r Page Mulkey Jas E (Irene) 1 agt Interstate Life & Accident Ins Co h 703 Cherokee Mulkey Raymond O r 621 Cherokee Mulkey Visie W (wid C O) h 621 Cherokee Mull Glen A (Wylene W) 2 inspr Bell Aircraft Corp h 811 4th Apt 4 Mull Rassie (Dovie L) inspr Holeproof Hosiery Co r 619 Cherokee Mullinax Ina inspr Bell Aircraft Corp r 605 Birney Apt 1 Murdock Chas D (Nadine B) 6 mech r Washington av Murdock Geo E (Mary B) trk dr h 527 W Hansell Murdock Lizzie G (Mrs G T) r Beaver av Murdock Mary B (Mrs Geo E) knitter Holeproof Hosiery Co r 527 W Han- sell Murdock Thos G (Lizzie G) emp The McNeel Marble Co h Washing- ton av Murner Mattie (wid E F) r 120 Kings ct Apt B Murner Thos B (Louise J) 2 emp Bell Aircraft Corp h 120 Kings ct Apt B Murphy Henry (Mabel D) USA h 905 Lawrence Murphy Inez maid 406 Haynes h 535 Washington av Murphy Jack (Virginia R) emp Bell Aircraft Corp h 524 Page Murphy Mabel D emp City Cafe r 905 Lawrence Murphy Ralph H (Laura G) 1 guard Bell Aircraft Corp h Church (Eliz) Murray's Fashion Shop (Murray Goldwasser) women's clo 63 S Park Sq Murray Clyde F (Dorothy L) elk h 215 Powder Springs Murray Lottie L r 215 Powder Springs Murray Wm M (Ruth M) 1 accnt r 602 Church Musarra E A (Helen B) USA h 121 Wright Musarra Helen B (Mrs E A) nurse 121 Wright r same Muse Homer F (Ruby C) 1 emp Bell Aircraft Corp h 1410 Roswell Myer Willie M elk Bell Aircraft Corp r 304 Kennesaw av Myers Alice D (Mrs Glynn A) emp Bell Aircraft Corp r 610 2d Ant 5 Z56 BaLOvVLV'S 1344 Myers Beaiar (Mary W) 1 lab h 805 Lawrence Myers Carl (Pauline) opr Bell Aircraft Corp h 503 Lemon Apt 3 Myers Eleanor (Mrs Fredk) ofc wkr r Garrison rd RD 5 MYERS FRED (Eleanor) 3 General Insurance 59 S Park Square--Tel 327 h Garrison rd RD 5--Tel 182 Myers Fredk Jr student r Garrison rd Myers Gardner L (Virginia) 1 USA h Hill RD 5 Myers Glynn A (Alice D) 2 ofc wkr Bell Aircraft Corp h 610 2d Apt 5 Myers Mamie E maid r 105 Lake Myers Roy (Mamie E) 1 jan h 105 Lake Myler Thos J (Helen E) 2 emp Bell Aircraft Corp h 315 Aviation rd Myriek Doris emp Sears Roebuck & Co r 121 Moores av Myrick Mack (Doris C) 1 USN r 121 Moores av g TO FIND A NAME YOU MUST Si KNOW HOW TO SPEIX IT Najjar Cornelia slswn Najjar Dept Store r 613 Cherokee Najjar Dept Store (Kilil Najjar) 40 W Park Square Najjar Kilil (Annie G) (Najjar Dpet Store) h 613 Cherokee Najjar Louise slswn Najjar Dept Store r 613 Cherokee Najjar Sarah slswn Najjar Dept Store r 613 Cherokee Nance Lou T mech Bell Aircraft Corp r 607 3d Apt 3 Nance Lou T Jr (Eliz E) 1 mach Bell Aircraft Corp h 607 3d Apt 3 Nashville Chattanooga & St Louis RR crossing sta 210 Cleveland av Nashville Chattanooga & St Louis RR crossing sta 111 Whitlock Nashville Chattanooga & St Louis Railroad Ray B Pledger frt & passen- ger agt frt depot 210 Mill Nashville Chattanooga & St Louis Railroad Ray B Pledger frt & passen- get agt passenger depot 208 Mill Napier Lester L emp Holeproof Hosiery Co h 6193/2 Cherokee Nash Claude H (Daisy M) h Austell rd (FO) Nash Doris L r Austell rd (FO) Nash Richd R (Mary C) 1 archt 47 W Park Sq h 1005 Whitlock av Nassh Theo (Mary E) USA r 125 W Dixie av Nathan Ora cook r 209 Mulberry National Farm Loan Association J Broadus Brown sec-treas 102 Atlanta Neal Anna r 305 Mulberry Neal Ella A (wid R T) r 421 Brook cir Apt 1 Neal Mary S (wid W D) h 306 Lawrence Neal Rufus K (Geraldine F) 2 dispr Bell Aircraft Corp h 415 Brook cir Apt 2 Neary Geo R USN r Cherokee rd (Eliz) Neary Doe elk McLellan Stores Co r Cherokee rd (Eliz) MARIETTA CITY DIRECTORY 257 Neary Martin A (Bonnie D) USA r Cherokee rd (Eliz) Neary Wesley E USA r Cherokee rd (Eliz) Neary Wm E (Mamie R) 3' roofing contr W P Stephens Lbr Co h Cher- okee rd (Eliz) Neel Frank W (Ruth L) 1 eng Bell Aircraft Corp r 200 Seminole dr Neese Bailey W crane opr Glover Mach Wks r 203 Glover Neese Claude D (Jessie K) 1 carp h 603 Powder Springs Neese C Boyd (Fay B) 3 emp Bell Aircraft Corp h 506 Powder Springs Neese Edw D (Mary R) 1 farmer h 209 Glover Neese Glen (Mattie B) 3 mach Glover Mach Wks h 203 Glover Neese Wade USA r 209 Glover Neill Miriam G bkpr r 1110 Church Nelenson David (Frances) 1 USA h 605 Birney Apt 2 Nelson Anne emp Atherton's Greenhouse h 220 Johnson Nelson Chas B (Willie G) 4 electn Bell Aircraft Corp h 102 Awtry Nelson Chas V USMC r 102 Awtry Nelson Durell (Susie A) 1 waiter Elk's Club h 406 W W Lee ct Apt 10 Nelson Elmer (Mamie) 1 jan Marietta Coca-Cola Btlg Co Inc h 111 Mulberry Nelson Gus M (Isabelle W) formn Brumby Chair Co h 501 Church Apt 7 Nelson Jas lab Bell Aircraft Corp r 704 Wright Nelson Jas J (Christine D) 4 emp Bell Aircraft Corp h 204 Victory dr Nelson J Thos lab Bell Aircraft Corp r 704 Wright Nelson Jas V Jr (Margt S) h 213 McCord Nelson John V (Lena C) mech Brumby Chair Co h 205 Maple av NELSON LAE, Pres Baldwin Directory Co Inc r Charleston, S. C. NELSON L A R MRS, Sec-Treas Baldwin Directory Co Inc, r Charles- ton, S. C. Nelson Mamie maid r 111 Mulberry Nelson Margt S (Mrs J V) slswn Florence's Inc r 213 McCord Nelson Martha J student r 102 Awtry Nelson Susie A maid r 406 W W Lee ct Apt 10 Nelson Virginia opr S B T & T Co r Lakewood dr RD 5 Nelson Wm C (Genie R) h Burnap RD 1 Neuman John C (Jean A) USA h 605 Cole New E D (Lonie H) 1 mech Allen Brown h 520 Campbell Hill NEW MARIETTA HOTEL Mrs Marvin D Norton Mgr 200 Depot--Tel 488 New Marietta Hotel Coffee Shop (Mrs Julia Abbott) 200 Depot Newell Laura N (wid G F) r 511 Church Newman Judith E (wid A L) h 235 Hill ct Newman Lewis A formn Bell Aircraft Corp r 235 Hill ct Newsome Jas A (Myrtle H) 2 USN h 603 Cherokee Newsome Jas A J student r 603 Cherokee Newsome Joe B (Mae T) 5 guard Bell Aircraft Corp h 604 Morningside dr Apt 1 258 BALDWIN'S 1944 Newsome Myrtle H (Mrs J A) looper Holeproof Hosiery Co r 603 Cherokee Newton Daisy nurse Marietta Hosp r same Newton David (wid WT) h Fair Oak av (FO) Newton Dewey A fnshr Holeproof Hosiery Co r Newton (Eliz) Newton Ethel r Fair Oak av (FO) Newton Frances emp Cobb County Times r Concord rd (FO) Newton Florel emp Bell Aircraft Corp r Concord rd (FO) Newton Hazel r Concord rd (FO) Newton Hoke S (Annie W) 5 emp Holeproof Hosiery Co h 524 W Hansell Newton Howard E (Edith W) 1 emp Bell Aircraft Corp h 500 Church Apt 5 Newton Jas C emp Glover Mach Wks h Concord rd (FO) Newton L Pauline (wid FA) 3 h Newton (Eliz) Newton Pauline emp Brumby Chair Co r 500 Powder Springs Newton Roy E (Hattie B) USA h Rose la (Eliz) Newton Walter T (Hester H) 2 emp Bell Aircraft Corp h 1009 Roswell Newton Willie M 1 h 307-a Page Niblett Richd A (Blanche) installer S B T & T Co Clarkdale, Ga Nichols A E (Ella A) wtchmn h Church (Eliz) Nichols David E (Norma R) 2 crane opr Bell Aircraft Corp h Darnell rd (FO) Nichols Edith emp Bell Aircraft Corp r 904 3d Apt 2 Nichols Marvin R (Eloise K) 2 riveter Bell Aircraft Corp h 803 1st Apt 1 Nichols Ray Jr USA r Church (Eliz) Nicholson Jas W (Mamie) 2 dispr Bell Aircraft Corp h 601 3d Apt 2 Niece Wm C (Florence W) 3 h Lakewood av RD 5 Nimmons Jos G (Helen C) 2 emp Bell Aircraft Corp h 1705 N Park dr Nix Alice T (Mrs W Simpson) looper Holeproof Hosiery Co r Cogburn av (Eliz) Nix Carl projectionist Cobb Theatre h Cogburn Park (Eliz) ; Nix Cline (Edna) mgr Gilbert Shaw Feed Store r RD 2 Nix Fred (Myrtle T) h Cogburn Park (Eliz) Nix Harry (Barbara L) r Cogburn Park (Eliz) Nix Harry elk A & P Food Stores r RD 3 INix Jas USN r Cogburn Park Eliz) Nix Junior USA r Cogburn Park (Eliz) Nix Lonis L (Caudle H) 2 mech Holeproof Hosiery Co h 204 Camp Nix O M (Martha) 1 mach opr Bell Aircraft Corp h 700 6th Apt 3 Nix W Simpson (Alice T) 1 emp Holeproof Hosiery Co h Cogburn av (Eliz) Noe Ray W (Daisy M) (Lewis-Noe Mtr Co) h 312 Lawrence Noe Ruth bkpr Lewis-Noe Mtr Co r 312 Lawrence Nolen Clara tchr r 322 Campbell Hill Nolen Clara C (wid ME) tchr Marietta High Sch h 322 Campbell Hill MARIETTA CITY DIRECTORY 259 Nolen Malcolm P (Eugenia C) 2 r 201 Gramling Norcom Florence E (wid H S) r Concord rd Apt 12-a (FQ) Norman J A (Kath C) 2 USA r 507 Kennesaw av Norman F Jas (Zadie P) 1 mach Bell Aircraft Corp h 900 3d Apt 1 Norman Kath C (Mrs J A) ofc wkr Bell Aircraft Corp r 507 Kennesaw av Northern Fannie cook 900 Church r 107 Elk Northcutt Eug S (Charlie W) 1 aud h 309 Freyer dr Northcutt Geo T supt Holeproof Hosiery Co r 205 Sessions Northcutt Geo T Jr (Pauline D) 2 eng Bell Aircraft Corp h 205 Sessions NORTHCUTT GUY H (Ruth A) office Mgr Holeproof Hosiery Co, h 823 Church Northcutt Howard N Jr (Dorothy) slsmn h 721 Church Northcutt Jesse J r 841 Church Northcutt Lizzie W (wid J D) h 841 Church Northcutt Robt H (Polly W) 3 (B N Auto Parts Co) h 110 N Forest av Northcutt Sallie (wid EH) r 709 Church Norton Alfred T (Mary M) 6 tractor opr Bell Aircraft Corp h 126 Kirk- patrick rd Norton Bertha M, (wid J E) h 608 Church NORTON ERA B (Mrs M D) Mgt New Marietta Hotel r same--Tel 488 Norton Fred (Lillie S) 2 emp Bell Aircraft Corp h 701 3d Apt 3 Norton Henry (Mildred L) mech Cram's Garage r Belmont Ga Norton King Co (Mary F) inspr Bell Aircraft Corp h 705 3d Apt 4 Norton Maiden Mrs 1 r 208 Wayland Apt 7 Norton Marvin D (Era B) elk W P Stephens Lbr Co r New Marietta Hotel Norton Mary F opr S B T & T Co r 705 3d Norton Mary (wid W Y) hsekpr 1615 N Park dr r same Norton Mary F (Mrs K C) opr S B T & T Co r 705 3d Apt 4 Norton Wallace F (Hazel S) 4 firemn Bell Aircraft Corp h 206 E Anderson Norton W Cecil (Dorothy S) 3 firemn Bell Aircraft Corp h Garrison rd RD 5 Norton Wm F (Dorothy M) USA h 507 Whitlock av Apt 3 Notgrass Jas B (Maude M) 2 formn Bell Aircraft Corp h 502 Stokes av Apt A Nunn Barney P (Charlotte C) 3 carp h 105 Moon Nunn Robt M (Willie G) guard Bell Aircraft Corp h 705 3d Apt 7 NU-WAY CLEANERS & LAUNDRY (Sanford J Lindsey) Hats Cleaned and Blocked, Fur Cleaning and Glazing, 118 Cherokee--Tel 1150 (See left top and right bottom lines and Buyers' Guide) 0TO FIND A NAME YOU MUST KNOW HOW TO SPELL IT O K Candy Co (Wm D Crumbier, O Kelly Wallace) 104 Cherokee 260 BAUDWIN'S 1944 O'Bannon Bennett (Georgianna C) 1 inspr Federal Commumciation Comn h 320 Park View av O'Dell Chas L (Marian K) 2 USA h 307 Walthall Odum Mamie (wid J W) r 100 Campbell Hill OFFICE SALES & SERVICE (Raymond E Bailey, Margaret L Carpen- ter) Office Equipment and Supplies, Complete Typewriter, Rentals and Repairers, Greeting Cards, Stationery, 114 Atlanta--Tel 1083 O'Laughlin Wm P (Vera F) 1 mech Bell Aircraft Corp h 207 Fairground Oldsen Frank W (Maud R) pntr h Atlanta rd Oliphant Chas Sara T) 1 USA r 117 Forest av Oliphant Leonard R Margie V) rd supvr N C & St L RR h 212 Mill Olive Springs Baptist Church Austell rd (FO) Oliver Clyde (Jewel B) sander Brumby Chair Co h 301 Page Oliver Elmer (Ota H) lab Brumby Chair Co h 406 Robeson ct Apt 1 Oliver Geo hlpr Carter Candy Co r 313 Fairground Oliver Mandy maid r 301 Page O'Neal Amelia 1 h 316 Reynolds Orr Clara R Mrs 1 h 213 Cherokee Orrell J Gordon (Henrietta B) 2 emp Bell Aircraft Corp h 520 Page Orr Horace Post American Legion Warren Baker meets 3d Thur 31 N Park Square Orr Hugh L Jr USA r 213 Cherokee Orr Leora emp Bell Aircraft Corp r 212 E Dixie av Apt 3 Orr Lilah J (wid A E) h 300 McDonald Orr Lucille H (Mrs J C) 3 h 200 Geo Hamilton ct Apt 4 Orr Mary M sten r 300 McDonald Orr Robt H (Sue W) 1 USA r 214 Ayers av Orr T B (Hazel S) 2 mech Bell Aircraft Corp h Atlanta rd Apt 204 (FO) Orr Wm N photog Fletcher Studio & Gift Shop r 213 Cherokee Orton Clyde H (Mary R) 2 emp Bell Aircraft Corp r 500 Atlanta Orton Edw R USA r 500 Atlanta Orton Inez M (Mrs W R) emp Holeproof Hosiery! Co r Rose la (Eliz) Orton Lee (Garna L) 3 riveter Bell Aircraft Corp h 604 2d Apt 6 Orton Wm R (Inez M) h Rose la (Eliz) ORVIN JESSE W, V-Pres Baldwin Directory Co Inc, r Charleston, S. C. Osborne Ada S Mrs r 305 Maple av Osborne Benj T guard Bell Aircraft Corp r 305 Maple av Osborne Bessie C Mrs h 310 Lemon Osborne Esther student r 310 Lemon Osborne Gilbert G 2 h Garrison rd nr Hill RD 5 Osborne Gober F emp Bell Aircraft Corp h 300 Washington av Osborne Robt L prin Robt L Osborne Sch r RD 4 Osborne Robt L School Robt L Osborne prin Joyner av (FO) Osborne Virginia L cash Legion Theatre r 310 Lemon O'Shaughnessy John (Jenny F) USA r 405 Cherokee MARIETTA CITY DIRECTORY 261 Ossler Leila (Mrs Richd) ofc sec Blair & Carmichael r 206 Victory dr Ossler Richd (Leila) USA h 206 Victory dr O'Sullivan Wm E (Janet S) guard Bell Aircraft Corp h 23B Atlanta Apt 4 Otey W Madison (Emelyne M) 1 tool designer Bell Aircraft Corp h 1621 Hillside dr OVERCASH B BRUCE (Julia B) 1 Asst Cashier The First National Bank h 102 Seminole dr--Tel 681 Overcash Evelyn elk W P Stephens Lbr Co r Canton rd (Eliz) Overcash Julia B (Mrs B B) tchr Waterman Street Sch r 102 Seminole dr Overcash Walter D (Dorothy H) 2 mach Bell Aircraft Corp h 509 Vic- tory dr Apt 1 Owen Albert L (Lela M) 1 mach Bell Aircraft Corp h 610 Wings av Apt 1 Owens Arth constn wkr r Joyner av Owens Bonnie (Mrs Wm Z) smstrs Marietta Hosiery Co r 507 Whitlock av Apt 9 Owen C I (Frances H) 2 formn Bell Aircraft Corp h Atlanta rd Owens Doris (Mrs M H) opr Harrison Beauty Parlor r Acworth Ga Owens Emma maid Bell Aircraft Corp r 116 Montgomery Owen Frances H (Mrs C I) ofc wkr Bell Aircraft Corp r Atlanta rd Owens Florence Mrs r Marble Mill (Eliz) Owen Iva r 404 Lawrence Owens James (Emma) USA r 116 Montgomery Owens Laymon H (Lula C) 1 h Joyner av (FO) Owen Lola R (wid Geo S) h 102 Kennesaw Owens Minnie 1 maid h 313 Page Owens Wm Z (Bonnie) 1 oiler Bell Aircraft Corp h 507 Whitlock av Apt 9 Owenby Aubrey USA r Turner rd Owenby Floyd (Lelia R) 1 emp Ga Power Co h Turner rd (FO) Owenby Frank C (Julia A) 3 (Owenby Mfg Co) h 114 Hazel Owenby Julia (Mrs Frank) emp Owenby Mfg Col r 114 Hazel Owenby Lora E (wid D F) r 201 Maple av Owenby Mfg Co (Frank C and Paul B Owenby) 207 McNeel Owenby Paul B (Owenby Mfg Co) r Murphy N Car Ozburn Idus V (Sue S) 1 elk Bell Aircraft Corp h 601 3d Apt 4 PTO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Pace Bennett B (Marie L) 2 oiler Bell Aircraft Corp h Garrison rd RD 5 Pace Corine tchr Keith Sch r 411 Campbell Hill Pace J Edw (Ida L) 1 opr Southeastern Greyhound Lines h 207 Wayland Apt 1 Pace Mack H presser Walter W Hazel r 109 Lake Pace Patience maid 215 Powder Springs r 109 Lake 263 BALDWIN'S 1944 Pace Ruby tchr r 411 Campbell Hill Pace Sidney (Anna M) (Jack's Place) r 721 Church Pace Sophie h 109 Lake Paden Edw (Willie S) 1 section hd N C & St L RR h 214 Maple Paden Jas (Carrie L) 1 r 210 Maple Padgett Barney W (Mary L) 3 mech Bell Aircraft Corp h 804 4th Apt 2 Padgett Barron H (Louise G) 1 USA h 522 W Hansell Padgett Carolyn student r Joyner av (FO) Padget Claude student r Hill RD 5 Padgett Ernest B (Grace S) 1 hlpr US PQ h Joyner av (FO) Padgett John (Josie M) cook h 307 Page Padgett Ruel student r Hill RD 5 Padgett Walter (Virginia) 1 lab h 211 Mulberry Padgett Walter Jr (Evelyn) 1 lab r 211 Mulberry Page Cecil E (Bertha C) 2 carp h 114 Moores av Page Geo hlpr Monto Shaw & Son r 704 Wright Page H Clay emp Bell Aircraft Corp r Austell rd (FO) Page Robt W (Mary S) 2 supvr Am Tel & Teleg Co h 718 Church Painter Jack Jr (Faye P) 1 USA r 212 Allgood Apt 1 Pair Jacie H( Nellie M) 2 h Fair Oak av (FO) Pair Jas A (Villa G) (Roswell St Gro) h 404 Roswell Pair Margt W (Mrs R T) emp Bell Aircraft Corp r Fair Oak av (FO) Pair Ralph T (Margt W) emp Bell Aircraft Corp h Fair Oak av Paisley Anne dir religious education First Presbyterian Ch r 506 Church Palmatuer Wm W pntr r 111 Stewart av Palmer Bessie A (Mrs D W) emp Bell Aircraft Corp r Rose la (Eliz) Palmer D W (Bessie A) 2 emp Bell Aircraft Corp h Rose la (Eliz) Palmer Dorothy H (Mrs John) nurse Bell Aircraft Corp r 122 Hedges Apt 1 Palmer E Charlie (Linda G) h Cogburn rd (Eliz) Palmer John (Dorothy H) 1 instr Bell Aircraft Corp h 122 Hedges Apt 1 Palmer Max (Althea R) pipe ftr r 107 E Dobbs Palmer Nellie L (Mrs Walter L) boarder Holeproof Hosiery Co r Ward (Eliz) Palmer Thos W (Dorris A) USA r 614 2d Apt 2 Palmer Verdie M student r Ward (Eliz) Palmer Vernon USN r Ward (Eliz) Palmer Walter L (Nellie L) 3 wtchmn h Ward (Eliz) Palmer Walter P (Jessie H) 3 mach Bell Aircraft Corp h 808 3d Apt 2 Palmer Wm E (Virginia J) 2 pattern mkr Bell Aircraft Corp h 200 Phillips dr Panfilis Esther waitress Marietta Cafe r 501 W Atlanta Panfilis Eva waitress Marietta Cafe r 501 W Atlanta Panflis Geo elk Marietta Liquor Store r 108 Forest av Pannell Berry M (Janie) emp Victory Homes- of Marietta Inc r RD 4 MARIETTA CITY DIRECTORY 363 Pannell J Wheeler r Bells Ferry rd (Eliz) Panter Danl W (Lavada S) h 1805 Roswell Panter Ella B r 1805 Roswell Panter Phoebe Mrs 1 emp Bell Aircraft Corp r 1805 Roswell Panter Ruth E emp Bell Aircraft Corp r 1805 Roswell Parham Duvall M, (Velma 0) 1 mach Bell Aircraft Corp h 103 Hawkins Apt B Parham Emma (wid J H) r Darnell rd (FO) Parham Robt E elk Bell Aircraft Corp r 103 Hawkins Apt B Parker Chas L (Pearl S) emp Bell Aircraft Corp h 212 Allgood rd Apt 1 Parker Chas R (Maye R) 2 tool mkr Bell Aircraft Corp h 201 Roswell Parker Delford F (Ruth O) 2 mech h 209 Frasier Parker Geo R (Gladys W) 2 emp N C & St L RR h Joyner av (FO) Parker Harry (Annie L ) elect Bell Aircraft Corp h 805 3d Apt 5 Parker Jack L (Clara Bell P) 1 tool & die Bell Aircraft Corp r 212 All- good Apt 1 Parker Jas farmer r 326 Lemon Apt 1 Parker Leon (Pena) USA h 119 Mulberry Parker Levi (Maggie B) emp Marietta Golf Club h 401 Club dr Parker Lucille emp Bell Aircraft Corp r Atlanta rd (FO) Parker Lucius (Cath B) jan First Natl Bk h 712 N Cole Parker Mary maid 705 Page r 807 N Cole Parker Robt baker Sunlite Bakery r Field Hotel Parker Wm E (Garion T) furn wkr r 108 Trammell Parker Wm W (Annetta M) 1 tool mkr Bell Aircraft Corp r 201 Roswell Parks Anne student r Joyner av (FO) Parks Floy B Mrs h Joyner av (FO) Parks Lucille Mrs emp National Biscuit Co r 707 Powder Springs Parks Marie D (Mrs W G) slswn r 205 Campbell Hill Parks Nell ofc wkr Bell Aircraft Corp r Joyner av (FO) Parks O D Jr (Pantha) emp Bell Aircraft Corp h 114 Colonial cir Apt 3 Parks Pantha (Mrs O D) emp Bell Aircraft Corp r 114 Colonial cir Apt 3 Parks Stokely (Annie S) prntr Brumby Press Inc r 405 Cherokee Parks W Glover (Marie D) 1 meat ctr L C Hames Gro Co h 205 Camp- bell Parlor Lilly lndrs r 102 Lake Parnell Sue r 801 Cherokee Parnell Sue sten Marietta Housing Authority r 801 Cherokee Parris Boyd (Leola) 2 asst mgr Dixie Cafe r 9 E Park Square Parris Isaac W r 207 Locust Parris Neta (Mrs Wm G) knitter Holeproof Hosiery Co r 517 W Hansell Parris T A (Clifford E) jan US PO h Tower rd (Eliz) Parris Wm G (Neta D) 1 hlpr h 517 W Hansell Partain Grace slswn Style Shop r 119 S Alexander 264 BALDWIN'S 1944 Partin Harry D (Ditha) 2 welder Bell Aircraft Corp h 701 3d Apt 4 Partain Jas G USA r 113 Hillside av Partain John J emp Holeproof Hosiery Co h 119 S Alexander Partain Lamar (Maedell S) h 113 Hillside av Partain Lucille S (wid H H) 2 r 209 Hawkins Paschal Grace cook r 126 Mulberry Pate Carl T (Evelyn M) USA r 205 Locust Pate Evelyn E (Mrs Carl T) inspr r 205 Locust Pate Lillian emp Carter Candy Co r 800 Roswell Patterson Clinton emp Bell Aircraft Corp r 411 Church Patterson Chas F (Floyd R) 1 formn Bell Aircraft Corp h 406 Aviation rd Patterson Edwin emp Bell Aircraft Corp r 409 Cherokee Patterson Eula C (Mrs Rolow W) emp Bell Aircraft Corp r 207 Reynolds Patterson Gertrude (Mrs Tate) emp Bell Aircraft Corp r 100 Roswell Patterson Gilbert USA r 207 Awtry Patterson Helen emp Bell Aircraft Corp r 108 Roswell Patterson Hugh T (Ernstine M) carp h 207 Awtry Patterson Ide W (wid W A) r 207 Reynolds Patterson Janet (Mrs J Claude Jr) opr S B T & T Co r 206 George Hamil- ton ct Apt 10 Patterson Jean M r 215 Montgomery Patterson Jennings C Jr (Jeanet S) 1 USA h 206 Geo Hamilton ct Apt 10 Patterson John W USA r 215 Montgomery Patterson Leete W USA r 215 Montgomery Patterson Louella tchr Lemon Street Sch h 215 Montgomery Patterson Otha U USN r 215 Montgomery Patterson Robt D (Eula P) 3 carp h Poplar (FO) Patterson Rolow W (Eula C) 2 emp Bell Aircraft Corp h 207 Reynolds Patterson Rosa Lee maid 511 Kennesaw av r 510 Lemon Apt 4 Patterson Rubye Mrs emp Bell Aircraft Corp r 207 Awtry Patterson Tate (Gertrude) h 100 Roswell PATTERSON WM C (Anna B) cash Cobb Exchange Bk r 115 Forest av Pattillo Maude S (wid Howard) r 515 Whitlock av Patton J E (Floraine) 1 emp Bell Aircraft Corp h 608 2d Apt 1 Patton John H Rev h 514 Church Patton John radio opr Federal Communications Comn r 100 Gramling Paulk Max w (Dorris J) 1 loftsmn Bell Aircraft Corp h 901 Frasier Pavlovsky Burma C (Mrs Ralph) slswn The Mill End Store r 200 George Hamilton ct Apt 5 Pavlosky Jas carp W P Stephens Lbr Co r 103 Moon Pavlovsky Jas W (Bertha E) 1 electn h 206 Geo Hamilton ct Apt 6 Pavlosky John carp Brumby Chair Co r 209 Waterman Pavlosky Ralph C (Burma C) 2 trk dr Brumby Chair Co h 200 George Hamilton ct Apt 5 Payne Arvil E (Marie C) mach opr Bell Aircraft Corp h 614 2d Apt 6 MARIETTA CITE DIRECTORY 265 Payne Douglass emp W P Stephens Lbr Co r 206 Church Payne Frank (Eliz S) 1 uphol r 125 Durham Payne Frances P (Mrs Jas C) sten r 121 Moon Payne A Jackson (Clarice G) 1 formn Bell Aircraft Corp h 186 Trammell Payne Jas C (Frances P) USA r 121 Moon Payne Jas H (Cecelia B) USA r 401 Washington av Payne Lee (Dorothy H) emp Bell Aircraft Corp r 112 Henderson Payne Louise student r 306 Frasier Payne Olin (Carrie) 1 emp Bell Aircraft Corp h 610 1st Apt 6 Payne Olin (Louise) emp Bell Aircraft Corp r 209 Cleveland av Payne Service Station (Bud Lawson) 1400 Cherokee Payne Susie L r 510 Lemon Apt 5 Payne Thos G (Harriett G) mach Bell Aircraft Corp h 304 Frasier Payne Van C (Annie G) 2 carp h Cogburn rd (Eliz) Payne W Clayton emp Holeproof Hosiery Co h 121 Moon Payne Walter F (Maude H) 1 h 1312 Cherokee Payton Felix USA r 700 Fort Payton Fred USA r 700 Fort Payton Mary maid r 700 Fort Payton Mittie maid r 700 Fort Payton Will (Ruby J) 4 lab h 700 Fort Peacock Frank R (Margt P) 3 mech Bell Aircraft Corp h 610 Birney Apt 2 Pearson D Y (Ruth) ofc wkr Bell Aircraft Corp h 613 Church Pearson Geo S (Maud W) mech h Church (Eliz) Pearson Lars (Caroline) 1 h 205 Geo Hamilton ct Apt 8 Pearson Ruth (Mrs D Y) inspr Bell Aircraft Corp r 613 Church Pearson Silas L (Edith R) 5 emp Bell Aircraft Corp h Austell rd (FO) Peary Martin (Bonnie D) USA r Rose la (Eliz) Pavey Ellis W (Blanche S) 2 USA h 610 Morningside dr Apt 1 Peddicord Anne emp Holeproof Hosiery Co r 629 Kennesaw av Peek Thos F (Betty L) 1 USA h Cranfill (FO) Peeler Porter C (Clare R) 1 emp Bell Aircraft Corp h 521 Vista cir Apt 1 Peeples Arth (Adell) jan S B T & T Co r 503 Montgomery Peeples Geo jan County Court House h 100 Height Peeples Geo (Georgia D) hlpr Five Point Service h 503 Lemon Apt 5 PEERLESS FURNITURE CO INC, Hugh L Duncan Mgr, Furniture, Floor Coverings, Radios, Stoves and Rugs, 102 Whitlock av--Tel 1173 Pellit J B emp Bell Aircraft Corp r 714 Atlanta Pless Jas W (Pauline S) barber Atlanta Street Barber Shop r RD 4 Pence Grady E (Nellie M) 2 mach opr Bell Aircraft Corp h 110 Moores av Pence Ira (Vada S) farmer h Barber rd (FO) Pendler Chas r 309 Maple av Pendley Dallas H (Margt W) 1 emp Bell Aircraft Corp h 615 Atlanta Pendlum Newton (Florence) emp Bell Aircraft Corp r 1106 Roswell 266 BALDWIN'S 1944 Penn Victor H (Alice R) drfsmn h 703 Church Peoples Alene cook r 308 Reynolds People Azzie L cook h 217 Reynolds Peoples Herbert (Alma) USN h 308 Reynolds Peoples Loan & Finance Corp John R Fowler pres, J Robt Fowler Jr V-Pres genl mgr 110 Atlanta Peoples Nannie h 416 Reynolds People Nola 1 lndrs r 217 Reynolds Peoples Odene ydmn 408 Campbell Hill r 416 Reynolds Peppers Charlie R (Nellie P) fixer Holeproof Hosiery Co h 220 Rose la Peppers Nellie P (Mrs C R) knitter Holeproof Hosiery Co r 220 Rose la Perkins Robt K (Thelma B) 2 USA h 207 Fairground extd Apt 1 Perkinson Amelia (Mrs T G) emp Bell Aircraft Corp r 819 Church Perkinson High School Marion J Woods prin Lemon nr Rigsby Perkinson Jesse D Jr (Dorothy L) US WAVES r 101 Oakmont dr Perkinson Neil G USN r 819 Church Perkinson Thos G USMC r 819 Church PERKINSON W HOWARD (Emmie L) V-Pres Marietta Hospital, Phy- sician Marietta Hospital Bldg 206-210 Cherokee--Tel 23 h 819 Church Tel 191 Perrow Carl G (Victoria C) 2 emp Bell Aircraft Corp h 807 4th Apt 6 Perrow Fred V student r 807 4th Apt 6 Perrow Victoria C (Mrs C G) emp Bell Aircraft Corp r 807 4th Apt 6 Perry Betty elk Allen Drug Co r 107 E Dobbs Perry Gordon (Helen) emp Bell Aircraft Corp h 114 Colonial cir Apt 2 Perry Helen (Mrs Gordon) emp Bell Aircraft Corp r 114 Colonial cir Apt 2 Perry Helen A (Mrs Hubert A) ofc wkr Bell Aircraft Corp r 622 Atlanta Perry Hubert A (Helen A) USA r 622 Atlanta Perry Ina cook h 113 Lakewood Perry Mattie r 406 Reynolds Perry Oliver P (Christine C) 2 tchr U S Dept Agriculture h 108 Brown Perry Steve emp Brumby Chair Co h 406 Reynolds Person Chas M H (Edith D) 2 ins solr h 120 McDonald Peterson Emil S (Sally S) 2 emp Bell ircraft Corp h 412 Victory dr Peters Ernest (Beulah) 2 lab h 102 Harold Petree Nola (wid John) slswn The Grand Shop r Powder Springs RD 2 Petree Ruby Mrs r 207 Wayland Apt 2 Pettett Chas L (Jewell) 1 h 613 Atlanta Pettett Dock A (Fannie E) (Pettett Gro) h 133 Trammell Petterr Grocery (Dock A Pettett) 209 Powder Springs Pettett Thos O (Hassie M) 2 meat ctr Pettett Gro h 108 Henderson Pettibone Bros Mfg Co Len C Baldwin rep 108 Root Petts Juanita tch r 104 Forest av Petty Campbell (Sarah K) r 303 Kennesaw av marietta city directory 267 1 Petty Jas W (Lula W) agt Industrial Life & Health Ins Co h 803 Kenne- saw av Petty Jas W (Lillie F) 3 fixer Holeproof Hosiery Co h Rose la (Eliz) Petty Lawrence W (Jeanette M) restr Rose la (Eliz) h same Petty Mary h Rose la (Eliz) Pettyjohn Doris E ofc wkr r 113 Radium Pettyjohn Lon E (Mary S) fnshr Holeproof Hosiery Co h 113 Radium Pettyjohn Wm J student r 113 Radium Peyton Jas 1 r 405 W Anderson Phagan C Walker r 302 Clay Phillips Albert (Cora B) 4 tex wkr r 827 Manget Phillips Arnold L emp Economy Ice Cream Co r Canton Ga Phillips Chas G USA r 115 Frasier Phillips Clara (wid Chas G) h 115 Frasier Phillips Clifton E (Emily G) 2 surveyor h 112 Frasier ) Phillips Eunice tchr Keith Sch r 104 Forest av Phillips Guy (Netie N) 3 lab Bell Aircraft Corp h 406 W Anderson Phillips Hager 5 cook 206 Stewart av h 531 Washington av Phillips Harley (Manda S) lab r 827 Manget Phillips Hazel elk Bell Aircraft Corp r 106 Pierce Phillips Henry J (Sigrid J) 2 elec eng h 714 Atlanta Phillips Herbert emp Bell Aircraft Corp r 228 E Dixie av Phillips Irene maid Kennesaw Hotel h 307 Rigsby Phillips Joy S (Mrs W A) sch tchr r Austell rd (FO) Phillips John H r 531 Washington av Phillips John P (Lucy B) emp City En gh 306 Roswell Phillips Mary student r 106 Pierce Phillips Mary M sten Marietta Housing Authority r 115 Frasier Phillips Mark S (Mary S) lab The McNeel Marble Co h 507 Lemon Apt 16 Phillips Moody M (Mary W) 1 inspr Bell Aircraft Corp h 431 Alexander circle Phillips Nancy ofc wkr Bell Aircraft Corp r 223 Powder Springs Phillips Oliver L (Pauline W) 3 auto mech McPherson Tire Shop h 106 Pierce Phillips W W res eng State Hwy Dept r Cartersville Ga Phillips Walter A (Joy S) emp Bell Aircraft Corp h Austell rd (FO) Philson Fannie cook 420 Atlanta h 206 Montgomery Pickens Algernon H r 501 Church Apt 12 Pickens Anna maid 614 Church r 409 W Reynolds Pickens Chas R student r Fair RD 5 Pickens Dixie waitress cafeteria Bell Aircraft Corp r 301 Butler Pickens Eliz W (wid O M) h 112 W Dixie av Pickens G Forest h 320 Ayers av 268 BALDWIN'S 1944 Pickens Geneva I ofc wkr Bell Aircraft Corp r 112 W Dixie av Pickens Mary presser Nu-Way Clnrs & Lndry r 600 Hunt Pickens Raymond A (Ruth H) emp Glover Mach Wks h Fair RD 5 Pickens Sami lab Brumby Chair C or 204 Denmeade Pickens Wm J cook Bell Aircraft Corp r 207 Maple Pickering J G 2 emp Holeproof Hosiery Co r 202 Radium Pierce Ada C (wid W F) emp Bell Aircraft Corp h 210 Locust Pierce Minnie r 215 Montgomery Pierce Ralph E USN r 210 Locust Pierce Raymond D (Anita G) 2 mech Bell Aircraft Corp h 610 Birney Apt 1 Piggly Wiggly Super Market Robt H Bartley br mgr 113 Church Pilgrim Jas H (Bessie M) h 112 Henderson Pilgrim Leonard P (Martha M) 4 mech Bell Aircraft Corp h 100 McIntosh av Apt A Pilgrim M Destell (wid J T) r 220 Rose la Pinckley Paul W (Ruth C) 1 checker Bell Aircraft Corp h 608 1st Apt 1 Pine Ozier C (Louise K) 2 emp Bell Aircraft Corp h 201 George Hamil- ton ct Apt 7 Pinson Pauline M sten r 125 S Alexander Pique Chas Mrs h 109 Freyer dr Pitner Clarence W (Agnes M) (City Cafe) 119 W Dixie av Pitner Fred L (Jessie) guard Bell Aircraft Corp h 206 Roswell Apt 1 Pitner Horace T mgr City Cafe r 119 W Dixie av Pitner J M elk L & N RR and N C and St L RR r Acworth RD 2 Pitner Jessie slswn Cinderella Shop r 206 Roswell Apt 1 Pitner Martha slswn McLellan Stores Co r 207 Frasier Pittard Cyrus D (Vida C) 1 formn Bell Aircraft Corp h 1518 Hillside dr Pittard Mary C ofc wkr r 1518 Hillside dr PITTARD MAX C (Louise S) Agent Standard Oil Co of Kentucky h 815 Whitlock av--Tel 1005 Pittard Martha ofc wkr r 1518 Hillside dr Pittman Jas J (Flossie M) mach Bell Aircraft Corp h 301 Glover Pittman Frank (Ruby) repr Connolly Shoe Shop r Acworth Ga RD 1 Pittman Geneva knitter Holeproof Hosiery Co r 301 Glover Pittman Jennie S (Mrs Sidney) bkpr Anderson Mtr Co r 301 Glover Pittman Laura B waitress Economy Ice Cream Co Acworth RD 1 Pittman Marie waitress Economy Ice Cream Co r Acworth Ga RD 1 Pittman Sidney (Jennie S) USA r 301 Glover Pitts Henry D (Lillian T) 1 emp Bell Aircraft Corp h 511 Victory dr Apt 1 Pitts Juanita tchr Marietta High Sch r 104 Forest av Plage Jack H (Lillian S) elk US PO h 118 Wright Plage Jack H Jr USA r 118 Wright Plage Lillian S (Mrs J H) cash Bell Aircraft Corp r 118 Wright MARIETTA CITY DIRECTORY 289 Pledger Ray B (Nellie C) frt & passenger agt L&N RR and N C & St L RR h 208 McCord Plemel Emily F emp Bell Aircraft Corp r 701 Page Plemel Florence I emp Bell Aircraft Corp r 701 Page Plemel Frank J (Frances S) emp Bell Aircraft Corp h 701 Page Plumley Odene riveter Bell Aircraft Corp r Gray (Eliz) Poirier Laurier A (Jane W) 1 elec eng Bell Aircraft Corp h 214 Gramling Polk Street Market (Andrew J Goss) 200 Polk Poison John emy Natl Paper Co r Furner rd Poison Lillian emp Stone Baking Co r Turner rd Polly Annie cook 412 Whitlock av r rear same Ponder Augustus D (Virginia D) 2 carp h Atlanta rd (FO) Pondexter Chas emp Bell Aircraft Corp r 409 Cherokee Pondexter Earl emp Bell Aircraft Corp r 409 Cherokee Pool Cora B looper Holeproof Hosiery Co r 208 Locust Poole Alice cook r 205 Harold Poole Francis (Louise) 2 emp Bell Aircraft Corp r 704 Cherokee Poole John (Alice) lab h 205 Harold Poor Agner opr S B T & T Co r Canton rd Poor Arth (Louise B) USA r Atlanta rd (FO) Poor Chas (Rachael H) repr Holeproof Hosiery Co h Rose la (Eliz) Poore Rachael (Mrs Chas) knitter Holeproof Hosiery Co r Rose la (Eliz) Pope Carl E lab Bell Aircraft Corp r 1801 Roswell Pope Joel W (Eliz T) 1 trk dr Bell Aircraft Corp h 802 4th Apt 6 Pope John H (Suzanne T) USA r 1511 Hillside dr Pope Suzanne (Mrs J H) ofc sec Bell Aircraft Corp r 1511 Hillside dr Pope Willa D riveter Bell Aircraft Corp r Gray (Eliz) Pope Wm T (Vera G) 1 elk Bell Aircraft Corp h 701 3d Apt 6 Popham Harrison emp Brumby Chair Co r 207 Wayland Apt 6 Popum Mariah G Mrs r 605 Powder Springs Poretsky Sidney (Mildred) USA h 618 Birney Apt 2 Porter Annie 1 h 800 Lawrence Porter Eliz 1 cook h 510 Lemon Apt 1 Porter Elmo (Annie R) lab h 605 Washington av Porter Jas lab The McNeel Marble Co r 800 Lawrence Porter Katie 2 h 123 Henderson Porter Webster butler r 800 Lawrence Portin Eliz emp Federal Communication Comn r 426 Atlanta Poss Fred R (Florence S) USA r 1104 Roswell Poss Mae A (wid R J) r 209 Gramling Poteete D Lake (Lemma G) 2 ofc wkr Bell Aircraft Corp h Austell rd (FO) Poteete Robt L (Edith R) 1 core mkr h 1916 Roswell Poteet Ulius N riveter Bell Aircraft Corp r 201 W Lemon 270 BALDWIN'S 1944 Powell Abron (Susie B) emp Meinert Florist h 117 Fort Powell Conway (Gwendolyn) emp Bell Aircraft Corp h 401 Aviation rd Powell Elmer emp Bell Aircraft Corp r 502 Cherokee Powell Eugenia lndrs r 117 Fort Powell Frank G (Bell S) 1 mech r 100 Henderson Powell Guy A (Florine) Rich & Powell Barber Shop r RD 4 Powell H Hoyt emp Bell Aircraft Corp r 213 Austin av Powell H Clifford (Anne F) 5 mach h 116 Moores av Powell H Grier (Susie C) 4 USA h 523 W Hansell Powell Henry A Rev (Ada H) pastor The Church of God h 215 Clay Powell Herbert cook Chester's Cafe r RD 4 Powell Lewis Y (Ella U) h 313 Roswell Powell Maude H ofc wkr r 313 Roswell Powell Paul H hlpr r 115 Delk Powell Robt C (Sue T) r 414 Powder Springs Powell Susie B cook r 117 Fort Powell Wm (Pearl M) 1 USA h 410 !W W Lee ct Apt 1 Powell Wm R (Mattie L) h 115 Delk Power Clarence E (Pearl C) mfrs agt h 301 Cherokee Power Edna P (wid Wm H) emp Barron Elec Co h 200 Wayland Apt 9 Power Mamie E (wid Gus W) 2 h Atlanta rd (FO) Power Pearl C (Mrs C E) librarian Clarke Library r 301 Cherokee Power Sarah ofc wkr r 200 Wayland Apt 9 Prance Watson (Edna P) 1 slsmn h 206 Geo Hamilton ct Apt 1 Prat Bascomb D (Pearl C) 3 eng N C & St L RR h 313 Maple av Pratt Dorothy ofc wkr Holeproof Hosiery Co r 312 Maple av Pratt Fannie K (wid Henry J) h 411 Polk Pratt Jas E (Margaret L) r 311 Roswell Pratt Mable emp Fletcher Studio & Gift Shop r 313 Maple av Prather Jewell G (Mrs N L) ofc wkr Bell Aircraft Cor pr 507 Cherokee Prater Milton (Earko H) 3 guard Bell Aircraft Corp h 805 4th Apt 4 Prather N L (Jewell G) USA r 507 Cherokee Praytpr Myrtle emp Bell Aircraft Corp r 200 Waylan dApt 9 Preece Mrs emp Chester's Cafe h 114 Rogers Presbyterian Colored Mission 101 Elk Pressley Gaines W (Frances M) 2 dispr Bell Aircraft Corp h 105 Phil- lips dr Prewett Andrew J 3 inspr Bell Aircraft Corp h 712 4th Apt 2 Prewett Amos, L (Delphia R) 1 r 550 Stewart av Prewett Clyde W (Helen M) 1 USA r 550 Stewart av Prewett Earl (Ivy W) riveter Bell Aircraft Corp h 609 2d Apt 6 Prewett Gordon L (Nila D) 2 emp Bell Aircraft Corp h 205 George Hamilton ct Apt 5 Prewett Herbert L (Claudia H) 1 pntr h 207 Wayland Apt 2 MARIETTA CITY DIRECTORY 271 Prewett John 0 (Cath B) 1 pntr h 550 Stewart av Price J Gordon (Azelee R) emp Bell Aircraft Corp h Glover pi RD 5 Price Hollist USA r 109 Elk Price Ivan G (Kath S) USN r 619 Kennesaw av Price Jas B USA r 200 Holland Price Kath S (Mrs I G) ofc wkr J Loy Carpenter r 619 Kenneasw av Price R Waymon (Gertrude A) fnshr The McNeel Marble Co h 205 Holland Price Ross V (Ada C) 2 carp h 200 Holland Price Sallie r 109 Elk Price Suzanna 2 lndrs h 202 Harold Price Wm C (Eliz M) cabinet mkr Bell Aircraft Corp h 112 South av Pride Horace (Letha H) lab r 2151//2 Johnson Pride Jos (Frances W) const wkr r 215^/2 Johnson Priest Florence (wid D P) waitress Chester's Cafe r 114 Rogers Priest Jasper S (Emma G) h 208 Wayland Apt 6 Prince Carl (Frances N) r 228 E Dixie av Prince Frances N (Mrs Carl) emp Brumby Press Inc r 228 E Dixie av Prince Fred P (Sadie B) emp Bell Aircraft Corp h 228 E Dixie av Prince Jas USA r 228 E Dixie av Pruitt Amos r 550 Stewart av Pruitt Thelma Mrs elk Philip Goldstein r 609 Cherokee Pruitt J Alec (Gladys M) 2 trk dr h Marble Mill (Eliz) Pruitt John A (Louise B) pntr h 550 Stewart av Pruitt Lurene Mrs elk McLellan Stores Co r Canton rd (Eliz) Pruitt Terrell D (Grace G) 5 trk dr h Henry RD 5 Pruitt Wade (Mary D) 2 uphol h 1205 Roswell Puckett Dorothy typist Bell Aircraft Corp r 212 E Dixie av Apt 3 Puckett Sami F asst mgr Piggly Wiggly Super Mkt 118 Moon Pullin Albert (Estelle W) 1 lab Bell Aircraft Corp h 109 Curry al Pumphrey Jonah C (Ida M) supt Marietta Natl Cemetery h 500 Wash- ington av Purcell Boyd H (Grace S) 3 emp Bently Cafe h Oak av (FO) Purcell Frank M (Sarah T) 5 emp Bell Aircraft Corp h Oak av (FO) PURITY DAIRY (J Malvin Alexander) Milk, Cream, Butter and Butter- milk, RD 4--Tel County 2004 (See Buyers' Guide) Putman Merrill B (Vera H) 2 formn Bell Aircraft Corp h 111 Hawkins Apt B Pye Gladys ofc asst Dr Geo F Hagood Jr r 1611 Roswell Pylant & Cook (Ray Cook, Fred Pylant) blksmith 211 Root Pylant Edw I (Mayr D) 1 tchr h 307 Maple av Pylant Fred (Nellie B) 2 (Pylant & Cook) h 503 Haynes Pylant Fred (Nell B) (Pylant & Cook) 503 Haynes Pylant Marion F emp Holeproof Hosiery Co r 307 Maple av 272 BALDWIN'S 1944 Pylant Nellie B (Mrs Fred) slswn Sauls' Dept Store r 503 Haynes TO FIND A NAME YOU MUST KNOW HOW TO SPELL, IT Quarles Ethel M (Mrs Hubert) looper Holeproof Hosiery Co r 525 W Hansell Quarles Hubert (Ethel M) 3 mach h 525 W Hansell Quarles Hubert Jr (Sarah D) 2 USA r Marble Mill (Eliz) Quarles Hubert Jr USA r 525 W Hansell Quarles J Lee slswn Kaplan's Dept Store r 617 Cherokee Quarles Jimmie slswn Kaplan's Dept Store r RD 1 Quarles John C USA r 525 W Hansell Quarles John E (Minnie) del slsmn Std Oil Co of Ky r RD Quarles Martha tchr Waterman Street Sch r Smyrna, Ga Quarles Sarah D (Mrs Hubert Jr) emp Holeproof Hosiery Co r Marble Mill (Eliz) m Quarles Wm T asst mgr McLellan Stores Co r RD 1 RTO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Rabun John E (Rose S) emp W P Stephens Lbr Co h Hill RD 5 Rabun J Elbert (Madge M) USA h Hill RD 5 Rabun Rose S (Mrs John E) seamer Atlanta Knitting Co r Hill RD 5 Rackley Dewey (Ruby W) 4 emp Bell Aircraft Corp h 309 Clay Rackley Gerald D (Edna C) 1 emp Bell Aircraft Corp h 803 4th Apt 3 Rackley Harold L (Lois A) 1 emp Bell Aircraft Corp h 806 1st Apt 4 Rackley Jas C (Edith H) 1 emp Bell Aircraft Corp h 803 4th Apt 4 Rackley Jewel emp Bell Aircraft Corp r 309 Clay Rackley Lois A (Mrs H L) ofc wkr Bell Aircraft Corp r 806 1st Apt 4 Rackley Ruth H emp Bell Aircraft Corp r 806 4th Apt 3 Ragan Gordon (Pearl L) elk L & N RR and N C & St L RR h 203 Ken- nesaw av Ragans Maggie h 216 Johnson Ragans Nellie cook r 216 Johnson Ragland Howard L h 102 Colonial cir Apt 1 Ragland Julius (Simmy S) USA h 507 Lemon Apt 5 Ragsdale Edith tmkpr Bell Aircraft Corp r Atlanta rd Railway Express Agency whse 208 Mill Railway Express Agency Wm M McCurdy Agt 210 Depot Raines Fred (Maybelle S) 5 emp The McNeel Marble Co h Page MARIETTA city directory 273 Eaines Harley H (Charlotte A) 2 eng Bell Aircraft Corp h 102, Stokes av Apt B Raines Wayne L (Ellen D) 8 firemn Bell Aircraft Corp h Fair RD 5 Rainey Crillon E (Hattie P) 1 mech h 114 Covington Rainey Glenn W 2 h 504 Powder Springs Rainey Hiram C (Mintie R) USN h 1407 Washington av Rainey L L constn wkr r 411 Church Rainey Luther J (Viola B) 2 fixer Holeproof Hosiery Co h 216 Camp- bell Hill Rainey Susie M maid h 103 Fort Apt 2 Rainey Wm C USA r 504 Powder Springs Rains Cleo Mrs 2 r 612 Cherokee Rains Wm emp Bell Aircraft Corp r 208 Roswell Rakestraw Elzie (Lizzie R) 1 h 315 Clay Rakestraw Geo D (Louise H) USA r 516 Lawrence Rakestraw Hugh C (Nina L) USN h Ward (Eliz) Rakestraw Juanita r 315 Clay Rakestraw Louise H (Mrs G D) ofc elk The McNeel Marble Co r 516 Law- rence Rakestraw R T (Lena B) linemn Ga Power Co r 509 Page Rambo Albert emp Marietta Hatchery r 909 Whitlock av Rambo David B emp Marietta Hatchery r 909 Whitlock av Rambo Marie B (wid S L) 1 (Marietta Hatchery) h 909 Whitlock av Ramsey Milton (Estell) emp American Lndry & Dry Clnrs h 309 Montgomery Rambo Sami L USMC r 909 Whitlock av Ramsey Heyward (Annie M) ydmn h rear 420 Atlanta Ramsbotham Allan J (Sibyl M) 1 eng Bell Aircraft Corp h 153 W Dixie av Randall Shirley (Emily H) 3 tool mkr Bell Aircraft Corp r 513 Frasier Apt 1 Randall Jas W (Thelma W) 2 emp Bell Aircraft Corp h 1307 Roswell Randolph Jos (Jeanette) lab N C & St L RR r 602 Hunt Randall Robt (Alberta) lab Brumby Chair Co h 201 Fort Randall Lucy maid r 201 Fort Randolph M Ruth sten County Dept Public Welfare r 409 Washington av Randolph Thos M (Florence H) electn h 409 Washington Ransom Mary maid h 103 Fort Ravan Horace USA r Marble Hill (Eliz) Ravan Howell USN r Marble Mill (Eliz) Ravan J W (Bertha J) (Caldwell & Ravan) h Marble Mill (Eliz) Ray Alice r 200 George Hamilton ct Apt 7 Ray Almo P (Mrs Thomas W) seamer Holeproof Hosiery Co r Cogburn av (Eliz) 274 BALDWIN'S 1944 Eay Arth (Thelma M) 1 farmer r 523 Washington av Eay Inez (Mrs Fred) emp Economy Ice Crea mCo r RD 3 Ray Cliff (Leo) USA h 212 Greer av Ray Eber H (Ruth R) 2 firemn Bell Aircraft Corp h 202 E Anderson Ray Emma L elk Bell Aircraft Corp r 226 Campbell Hill Ray Eula E mender Holeproof Hosiery Co h 226 Campbell Hill Ray Frank H emp Bell Aircraft Corp r 411 Church Ray Geo W (Wynelle J) USA r 306 Polk Ray Herman P (Alga S) 1 firemn Bell Aircraft Corp h 110 Gober Ray J Vernon (Eleanor P) pharm Hodges Drug Co h 502 Cherokee Ray John W r 226 Campbell Hill Ray Leo cook r 212 Greer av Ray R C emp Bell Aircraft Corp r 208 Roswell Ray Rebecca r 703 Page Ray Susie C Indrs r 103 Lake Ray Theo T emp Bell Aircraft Corp r 200 E Anderson Ray Thos W (Almo P) 1 switchmn Bell Aircraft Corp h Cogburn av (Eliz) Ray Wynelle (Mrs Geo W) elk Sears Roebuck & Co r 306 Polk Ray Wiley (Susie C) firemn Natl Paper Co h 103 Lake Read Pauline S (wid T W) h 905 Cherokee Read Patrick elk r 905 Cherokee Read Robt C (Alice R) 1 emp Bell Aircraft Corp h 208 Seminole dr Read Stanton J (Rebecca C) 1 slsmn h 615 Cole Red & White Service Station No 3 Marvin Dudley mgr Atlanta rd Redd Hazel G (Mrs P A) ofc sec r 201 E Dixie av Redd Paul A (Hazel G) mech r 201 E Dixie av Redd W 3?madAP (NelHe (Nettie H) 1 1 ofc wkr mech ShouAthulsatnedll Ircde (CFoOh) 105 S Alexander Reddin Hattie B maid r 106 Rigsby Reddin John W (Hattie B) lab Bell Aircraft Corp r 106 Rigsby Reddings Mary maid 617 Kennesaw av r RD 1 Redding Roy L (Lucy J) lab r 712 Fort Reece,Annie E (Mrs J E) looper Holeproof Hosiery Co r 500 Kennesaw av Reece's Barber Shop (H Leon, Jas A & M Hal Reece) 211 Cherokee Reece Elise (Mrs H T) emp Bell Aircraft Corp r 209 Gramling Reece Forrest D (Mildred M) 1 emp Bell Aircraft Corp h 1412, Roswell Reece Geo R (Winnie M) crane opr Bell Aircraft Corp h Marble Mill (Eliz) Reece Glenis Mrs sten r 644 Atlanta Reece Harold T (Elise) mech Bell Aircraft Corp r 209 Gramling Reece H Leon (Margie F) (Reece's Barber Shop) 216 E Dixie REECE JAS A ELECTRICAL APPLIANC CO lectrical Construction, Commercial and Industrial Equipment, Electrical Appliances and MARIETTA CITY DIRECTORY 275 -- -- Supplies, Radio Sets and Supplies, 211 Cherokee--Tel 9158 (See Buyers' Guide) REESE JAS A (Sarah A) 2 James A Reece Electrical Appliance Co, Reece's Barber Shop h 402 Grover--Tel 1353-J Reece J Edw (Annie E) r 500 Kennesaw av Reece John T (Ora D) 4 supvr h 209 Reynolds Reece Julia maid 162 Hedges Apt 2 r 316 W Goss Reece Leon H (Margt F) barber Reece Barber Shop r 216 E Dixie av Reece Lucille (Mrs Loomis) slswn Florence's r 806 Church Reece Loomis (Lucille S) h 806 Church Reece Lena M student r 500 Kennesaw av Reece Marion H (Sarah G) 1 USA r 716)4 Roswell Reece Mattie B (wid Hubert) nurse h Church (Eliz) Reece M Hal (Pearl S) (Reece Barber Shop) h 600 Cherokee Reece Raymond E (Alice G) 1 designer The McNeel Marble Co h 502 Kennesaw av Reece Ray V student r 502 Kennesaw av Reece Sarah G (Mrs M H) emp Bell Aircraft Corp r 716i/2 Roswell Reece Thurloe R (Jeanette G) 3 emp Ga Power Co h 905 Roswell Reece Warren D student r Church (Eliz) Reed Chester L (Frances R) 2 h Austell rd (FO) Reed Choice C (Mace S) bridge supt County Prison Camp r 220 E Dixie av Reed Clifford USA r 116 Montgomery Reed Corbin D (Allie T) 1 ship elk Sears Roebuck & Co h Joyner av (FO) Reed Dessie L (wid J C) 1 emp Bell Aircraft Corp h 505 W Atlanta Reed Emma maid r 107 Fort Apt 6 Reed Hubert USA r Austell rd (FO) Reed Isaac V (Lula S) h Fair Oak av (FO) Reed Ishie I (Sallie D) farmer h Austell rd (FO) Reed J David USA r 116 Montgomery Reed Jack L (Ola P) 2 ofc wkr Bell Aircraft Corp h 704 E Waterman Apt B Reed John L (Annie H) jan Robt L Osborne Sch h Bingham (FO) Reed Jos L (Pearl S) mach Glover Mach Wks h Hill RD 5 Reed Lester L r Barber rd (FO) Reed Louise (Louise's Beauty Shop) r 402 Montgomery Reed Louis N (Louise) waiter Stonewall Cafe h 402 Montgomery Reed Minnie maid r 107 Fort Apt 6 Reed Minnie L maid 110 N Forest av r Fort Hill Homes Reed R Glenn dentist 47 W Park Square r Acworth Ga Reed R David porter h 116 Montgomery Reed Sara J dispr Safety Cab Inc r 111 Hedges Reed Wayne (Louise) 1 emp Marietta Hosiery Co r 100 Roswell Reese Melvin C foremn Bell Aircraft Corp h 600 Roosevelt cir Apt B 276 BALDWIN'S 1944 Reese Rilla (wid C C) waitress cafeteria Marietta High Sch r 606 Roswell Reese Warren D (Betty B) emp Bell Aircraft Corp r 524 Page Reeser Paul D (Lillian K) ins agt h 211 Cleburne Reeves Claude B (Annie H) 5 h Hill RD 5 Reeves Fred lab Marietta Trans & Salvage Co r 407 W Reynolds Reeves Jones W Rev (Estie H) pastor Sweetwater Baptist Ch h 301 Maple av Reeves Ross N (Linda C) (Reeves Seed Store) h 204 Maple av Reeves Ross N Jr (Ima S) USA r 204 Maple av Reeves Sami D (Eileen M) loftsmn Bell Aircraft Corp r 618 Atlanta Reeves Seed Store (Ross N Reeves) 213 Church Reeves Susie cook 303 Kennesaw r 407 Reynolds Reeves Willie F (Susie) emp Marietta Trans h 407 Reynolds Register Holt E (Sara S) mgr U S Employment Service War Manpower Comn h 500 Church Apt 2 Register Wm emp Bell Aircraft Corp r 214 Powder Springs Reid Annie lndrs r 403 Hunt Reid C Q (Flora R) 1 emp Bell Aircraft Corp h 104 Colonial cir Apt 4 Reid C W Jr city electn h 309 Kennesaw av Reid Edw J (Beatrice K) 3 inspr Bell Aircraft Corp h 417 Brook cir Apt 1 Reid Frank (Ellie G) porter Coggins Shoe Store h 403 Hunt Reid Geo W eng Sou RR Co r 125 Durham Reid H H (Nellie) electn Bell Aircraft Corp h 707 3d Apt 7 Reid Harvey E (Leon R) carp h 212 Durham Reid M Louise h 515 Whitlock av Reid Millie P (wid J P) h 125 Durham Reid T Wayne (Louise) mach Marietta Hosiery Co r 100 Roswell Reinhart Cath h 305 Manget Apt B Reitz Arth (Emma P) emp Bell Aircraft Corp h 1512 Roswell Rembert Davis M (Amy T) 2 ofc wkr Bell Aircraft^ Corp h 613 2d Apt 5 Renault Julius H emp Bell Aircraft Corp r 308 Washington av Renshaw Robt W slsmn Diamond Jewelry Co r 611 Polk Renshaw Theo J (Beatrice W) 2 emp Bell Aircraft Corp h 611 Polk Renshaw Theo J Jr USA r 6111 Polk RESPESS JAS L (Respess & Respess) Certified Public Accountant 1305 First National Bank Bldg, Atlanta--Tel WA 2628 RESPESS & RESPESS (Jas L and Thos S) Accountants, Auditors and Tax Consultants 1305 First National Bank Bldg, Atlanta--Tel WA 2628 (See Buyers' Guide) RESPESS THOS S (Respess & Respess) Certified Public Accountant 1305 First National Bank Bldg, Atlanta--Tel WA 2628 Reuel Bettis A (M Ruth) electn hlpr Bell Aircraft Corp h 201 Waddell pi Apt 7 Rex John T (Sara H) opr Bell Aircraft Corpj h 807 3d Apt 6 marietta city directory 277 Rex Pool Room (Cornelius Sheets) 108 Lawrence Reynolds Bldg 47 W Park Square Reynolds Claude (Lois R) 2 eng Bell Aircraft Corp h Concord rd Apt 17-a (FO) Reynolds Daisy lndrs h 123 Mulberry Reynolds Gary emp Bell Aircraft Corp r 1031 Cherokee Reynolds J D (Mary) emp Bell Aircraft Corp h 608 2d Apt 6 Reynolds J Dunklin (Exa B) dentist S Park Sq h 102 Winn Reynolds Jessie M r 401 Kennesaw av Reynolds John C USN r Church (Eliz) Reynolds Marcellus (Carrie) hlpr Sunlite Bakery r 106 Page Reynolds Mary M student r Church (Eliz) Reynolds S Fannie (wid J V) h 205 Clay Reynolds Welborn M (Alice C) farmer h Church (Eliz) Rhodes Florene R) emp Marietta Hosp r 519 Lawrence Rhodes Robt (Florene R) 6 cook Marietta Hosp h 519 Lawrence RICE EUGENE (Virginia) Rice Furniture Co r Austell hwy RICE FURNITURE CO (Eugene Rice) Furniture Dealers, Floor Cover- ings, Stoves and Ranges, Radio Dealers, 108 Washington av--Tel 1571 (See right top lines) Rice Lizzie 1 maid h rear 710 Roswell Rice Lucille r rear 710 Reynolds Rice Marvin C lab r rear 710 Roswell Rice Pierce V (Mildred L) 3 h 111 W Dixie av Rice Pierce V Jr r 111 W Dixie av Rich A Jackson (Betty R) 1 rubber The McNeel Marble Co h Cogburn rd (Eliz) Rich J Esco (Martha R) 1 r Fair Oak av (FO) Rich Jas W (Blanche B) (Rich & Powell Barber Shop) h 201 Lemon Rich Jas W Jr elk Bell Aircraft Corp r 201 Lemon Rich Jas T (Mildred C) 4 emp Bell Aircraft Corp h Canton rd (Eliz) Rich Paul Edw (Cath B) USA r Cogburn rd (Eliz) Rich & Powell Barber Shop (Guy A Powell and J Williard Rich) 105 Whitlock av Rich Wm W USA r Cogburn rd (Eliz) Richard Modaree waitress City Cafe r Cogburn av (Eliz) Richard W demon (Virginia G) 2 mech Bell Aircraft Corp h 611 2d Apt 1 Richards Bessie C (Mrs W D) bkpr Richards Service Sta r Bells Ferry (Eliz) Richards Eddie (Mrs Henry) hlpr Ga Produce Co Powder Springs Ga Richards Eloise opr S B T & T Co r 510 Lawrence Richards Georgia M (wid Guy) r 209 Holland Richards Irene U (Mrs Paul R) elk Bell Aircraft Corp r 211 E Dixie av Richards Jas M emp Bell Aircraft Corp r Fair RD 5 278 BALDWIN'S 1944 Richards Maybelle 3 lndrs h 204 Maple Richards Paul R (Irene U) 1 emp Bell Aircraft Corp h 211 E Dixie av Richards Raymond M (Frances P) 1 emp Bell Aircraft Corp h Fair RD 5 Richards Service Station (W D Richards) Church (Eliz) Richards Vasco (Mae R) 5 brklyr h Cogburn (Eliz) Richards W D (Bessie C) 1 (Richards Service Sta) h Bells Ferry rd (Eliz) Richards Wm D (Frances S) 1 dr Bell Aircraft Corp h 415 Brook cir Apt 1 Richards Wm A (Kathleen B) 1 elk Bell Aircraft Corp h 400 Lakewood dr Apt B Richardson Alice cook r 209 Mlaple-- Richardson Alice J (Mrs Wm H) emp Bell Aircraft Corp r 1101 Law- rence Richardson Annie nurse r 414 Reynolds Richardson Anna r 209 Maple Richardson Bicycle Shop (Jas B Richardson) 207 Mill Richardson C L (Florida M) pntr Brumby Chair Co r 612 Cherokee Richardson Daisy (wid M G) r 208 Locust Richardson Dealie L (wid Lee) h Marble Mill (Eliz) Richardson Edw T (Lillian P) 1 USN h 207 Frasier Richardson Eug (Alice) emp Clackum's Trans h 209 Maple Richardson Jas B (Frances) 2 (Richardson Bicycle Shop) h 1105 Law- rence Richardson John J (Margery) 1 eng Bell Aircraft Corp h 166 W Dixie av Richardson John R lab Brumby Chair Co r 408 Robeson ct Apt 8 Richardson Judd N (Pariee W) 2 emp Bell Aircraft Corp h Garrison rd RD 5 Richardson Mallie (Mary B) 3 bkpr h Cochran (FO) Richardson N B (Sarah G) h Rose la (Eliz) Richardson Wilber L (Mary J) h 204 Freyer dr Richardson Wm H (Alice J) hlpr Richardson Bicycle Shop h 1101 Lawrence Richardson Wm L (Lillie B) 2 emp Bell' Aircraft Corp h Hill RD 5 Richelt Mary T Mrs emp Bell Aircraft Corp h 403 Kennesaw av Rickert R Douglas (Marie W) 1 emp Bell Aircraft Corp h 530 Page Rickenbacker Aircraft Training School Alton P Hogan dir 205 Wayland Rickman T Clifton (Emma S) 5 firemn Bell Aircraft Corp h 112 North av (Eliz) Ridding Robt emp Holeproof Hosiery Co r 206 Wayland Apt 3 Riddle John T (Carolyn C) graduate vet 117 Winters h 612 Church Apt 2 Rideway M L emp Bell Aircraft Corp r 109 Freyer dr Ridgeway Anna J (wid Henry) h 119 Trammell Ridings Betty J r Tower rd (Eliz) Ridings Geo C (Savannah Y) 2 h 612 Cherokee MARIETTA CITY DIRECTORY 319 Riding's Henry D (Emma S) h Cogburn (Eliz) Ridings Troy F (Lucille B) 1 pntr h Tower rd (Eliz) Ridley Frank lab r 124 Henderson Ries Alma G (Mrs Wesley R) ofc wkr Bell Aircraft Corp r 200 Allgood Apt 1 Ries Wesley R (Alma G) USA h 200 Allgood rd Apt 1 Riggins Thos H USN r 213' Clay Riley Chas W (Arelia G) lab Brumby Chair Co h 507 Lemon Apt 8 Riley Isaac (Lou) plmbr h 209 Montgomery Ring E Nan r 513 Kennesaw av Rives R E (Ethel S) supvr r 405 Cherokee Roach Artis (Dorothy H) 1 ins solr r Rose la (Eliz) Roach Quillan E (Daisy A) carp h 200-a Roswell Roff Milton J (Anne G) 1 emp Bell Aircraft Corp h 314 Cleburne Robbins Jas (Charlotte L) USA h 621 Birney Apt 2 Robinson Albert W (Mary K) 2 tool mkr Bell Aircraft Corp h 513 Frasier Apt 1 Robinson Alice cook h 705 Lawrence Robinson Arth (Hazel) 2 guard Bell Aircraft Corp h 603 3d Apt 4 Robinson Benj lab r 104 Rigsby Robinson Bruce (Polly) 4 emp Bell Aircraft Corp h 801 3d Apt 5 Robinson Clover (Annie B) 1 lab Brumby Chair Co h 110 Elk Robinson Eckle (Leola W) 4 lab r 508 W Goss Robinson Frank lab Brumby Chair Co r 404 W Goss Robinson Howard ydmn 629 Kennesaw av r same Robinson Isaac N Jr USA r 119 Henderson Robinson Jefferson pntr h 101 Edwards dr Robinson Lewis (Eliz) 1 USA r 408 Reynolds Robinson Lewis B USA r 119 Henderson Robinson Marie 3 lndrs h 701 Lawrence Robinson Mamie R sch tchr r 119 Henderson Robinson Polly (Mrs Bruce) emp Bell Aircraft Corp r 801 3d Apt 5 Robinson Susie sch tchr h 119 Henderson Robinson Wesley (Bleake R) 3 USA h 204 Harold Robinson Wesley J USA r 119 Henderson Robinson Wm R emp Bell Aircraft Corp r 505 Lawrence Robinson Willie 1 maid Elks Club r 416 Reynolds Roberson Edw (Mattie H) emp The McNeel Marble Co h 119 Fort Roberson Hazel L r 107 Hawkins Apt A Roberson Lee r 321 Lemon Roberson Paul (Helen D) emp Bell Aircraft Corp h 801 3d Apt 6, Roberson Willie E emp Bell Aircraft Corp h 107 Hawkins Apt A Roberts Beatrice S (Mrs Buster) enip Holeproof Hosiery Co r 205 Lemon Roberts Buster (Beatrice S) mech r 205 Lemon 280 BALDWIN'S 1944 Roberts Cecil (Lois) inspr Brumby Chari Co h 609 Cherokee Roberts Elsie waitress The Liberty Bell Cafe r Smyrna Ga Roberts Elsie V (Mrs Harley) ofc wkr Bell Aircraft Corp r 806 4th Apt 6 Roberts Esther L (wid Wm) 2 h 110 Trammell Roberts Frances emp J P Allen Co r 122 Henderson Roberts Frances L student r 609 Cherokee Roberts G G r 1005 Church Roberts Gladys r 605 Atlanta Roberts Harley (Elise V) emp Bell Aircraft Corp h 806 4th Apt 6 Roberts Hugh (Bunnie A) 1 USA r 504 Church Apt 4 Roberts Irene emp Bell Aircraft Corp r 904 3d Apt 5 Roberts Inez r 605 Atlanta Roberts J F (Mary C)? 3 emp Bell Aircraft Corp h 904 3d Apt 5 ROBERTS J GUY ATTORNEY (Nellie D) Lawyer 2d Fir Anderson Building--Tel 324 h 103 Frances av--Tel 662-W (See Buyers' Guide) Roberts J W r 110 Trammell Roberts John H (Irene D) 2 electn Bell Aircraft Corp h 427 Brook cir Apt 2 Roberts John I (Irene E) 2 emp Bell Aircraft Corp h 811 4th Apt 2 Roberts John W emp Marietta Cafe r 110 Trammell Roberts L C (Mable S) 2 USA h 317 E Dixie av Roberts Lois A ofc wkr r 605 Atlanta Roberts Luther E (Martha C) emp Ga Power Co h 605 Atlanta Roberts Mable S (Mrs L C) ofc wkr Marietta Housing Authority r 317 E Dixie av Roberts Mae B (wid W E) h 1030 Cherokee ' Roberts Margt M (wid J M.) r 1234 Whitlock av Roberts Mary Sue (Mrs J F) emp Bell Aircraft Corp r 904 3d Apt 5> Roberts Mildred r 122 Henderson Roberts Pearlene cook 1003 Powder Springs 607 Wright Roberts Pepper R (Louise B) 1 fed probation officer h 131 Trammell Roberts Ralph lab The McNeel Marble Co r 409 Lemon Roberts Rebecca (wid M S) Indrs h 503 Hunt Roberts Thelma r 605 Atlanta Roberts Wm (Addie J) lab Holeproof Hosiery Co h 122 Henderson Roberts Willie (Mattie). lab r 203 Montgomery Roberts Willis emp Loudermilk Studio r 131 Trammell Robertson Ella A Mrs r Hill RD 5 Robertson Evie tchr Perkinson High Sch r 403 Cole Robertson Ernest L (Ruby R) 2 elk h 501 Washington av Robertson Freddie 1 maid h 308 Harold Robertson Homer R slsmn r Atlanta rd Robertson Jas (Annie) lab h 202 Page ^ MARIETTA CITY DIRECTORY 281 Robertson Nellie C (wid Thos) 1 seamre Marietta Hosiery Co h 209 Locust Robertson Raymond R (Annie) mach h Hill RD 5 Robertson Thos (Mary S) 1 lab r 202 Page Rocker Alvin G (Anna W) 2 emp Bell Aircraft Corp h 316 Frasier Roddenberry W Blair (Virginia M) 2 supvr Bell Aircraft Corp h 101 Francis av Rodgers Ethel maid 411 Church r Delk Roe Jas F (Eloise) 1 inspr Bell Aircraft Corp h 819 1st Apt 2 Rogers Ada r 204 Fort Rogers Alton R (Cora S) r 211 Locust Rogers Amelia maid 203 N Forest av r 204 Fort Rogers Amelia maid r 204 Fort Rogers Annie r 503 Hunt Rogers Benj 1 emp Southland Ice Co h 215 Reynolds Rogers Clara E elk Piggly Wiggly Super Mkt r RD 2 Rogers Cecil H (Robbie S) chf elk Bell Aircraft Corp h 309 Allgood Apt 1 Rogers Clara G (Mrs O K) emp Bell Aircraft Corp r 1805 Roswell Rogers Cora S (Mrs Alton R) mender Holeproof Hosiery Co r 211 Locust Roger Eug r 114 Page Rogers Ethel 2 maid h 109 Elk Rogers Emory (Margie B) USA r Concord rd (FO) Rogers Freddie elk Piggly Wiggly Super Mkt r RD 2 Rogers Geo H (Essie W) emp Bell Aircraft Corp h 703 3d Apt 7 Rogers Geo H (Betty B) 2 USN h 202 Austin av Rogers Geo S (Carolyn S) tool mkr Bell Aircraft Corp h 534 Roosevelt cir Apt A ROGERS HARRIS J (Irma H) Mgr Strand Theatre h 222 Hunt--Tel 583-J Rogers Henry Rev (Christine W) 4 pastor Red Rock Baptist Ch h Page Rogers Isaac B (Emma G) wtchmn h 208 Wayland Apt 4 Rogers J Emory (Margie B) USA h Atlanta rd (FO) Rogers Jack (Daisy) restr 320 W Goss h same Rogers Jos lab r 117 Maple Rogers L Olivia (wid A J) beautician h 107 E Anderson Rogers Lillie h 114 Page Rogers Martin (Mary F) lab h 104 Fort Rogers Mary r 215 Reynolds Rogers Mary A lndrs r 217 Maple Rogers Mildred student r 107 E Anderson Rogers Wm (Lillie M) lab h 406 S Waddell Rohner Clarence C USA r 408 Maple av Rohner Clarence E (Mattie C) 1 (Rohner Bros) h 408 Maple 282 BALDWIN'S 1944 Rohner Fredk F (Gussie S) 4 plmbr h 211 Waterman Rohner Fredk J (Willie C) USA h 132 Griggs Rohner Martha A student r 408 Maple av Rohner Wm F USA r 408 Maple av Robertson Ernest L (Ruby) elk Office Price Administration h 501 Washington Romer Selma R (wid Chas) r 159 Hedges Apt 1 Rooney Patrick F polisher The McNeel Marble Co r 109 Stewart Roosevelt Clifford (Bessie) 1 fnshr h Bells Ferry rd (Eliz) Root Street Barber Shop Chas M McEntyre mgr 105 Root Roper Claude E emp Bell Aircraft Corp r 313 Roswell Roper Paul emp Bell Aircraft Corp r 214 Powder Springs Rose Beauty Shoppe (Hayes Rose) 205 Powder Springs Rose Bruce (Glenna Q) emp Bell Aircraft Corp h 819 1st Apt 1 Rose Glenna Q (Mrs Bruce) emp Bell Aircraft Corp r 819 1st Apt 1 Rose Wm A r 819 1st Apt 1 Roselane Baptist Church 208 Rose la Ross Edna emp Bell Aircraft Corp r 112 Colonial cir Apt 2 Ross J Frank (Mortiree G) 2 trk dr W P Stephens Lbr Co h 51Q1 Cherokee Roswell Street Baptist Church Rev Hoypt G Farr pastor 1504 Roswell Roswell Street Grocery ( Jas A Pair) 401 Roswell Roth Albert (Ella) (The Grand Shop) r Atlanta Ga Rothgeb Jacob B (Mable F) 4 USA h 204 Allgood rd Apt 1 Roukoski Harold J (Leila S) 1 emp Bell Aircraft Corp h 204 Allgood rd Apt 2 Routh Martha R (wid H S) r Pearl RD 5 Rowland Mary (wid John) h 503 Powder Springs Ruback Jos M (Joan S) emp Bell Aircraft Corp h 212. Allgood Apt 2 Rucker G M (Pearl T) 2 lab Bell Aircraft Corp h Rose la (Eliz) Rucker John S (Emma C) r 1916 Roswell Rucker Silvia (Beatrice T) USA r Rose la (Eliz) Rudiseal Alpha Mj (Mrs L G) emp Bell Aircraft Corp r Joyner av (FO) Rudeseal Lewis G (Alpha M) 1 deputy warden Cobb County h Joyner av (FO) Rudolph Wm J (Allene) 2 mech Bell Aircraft Corp h 613 2d Apt 2 Ruffin Peter emp Bell Aircraft Corp r 839 Church Rumsey Howard L (Vera E) emp Bell Aircraft Corp h 528 Page Runyan Chas PI formn h Church (Eliz) Runyan Elmer ctr McNeel Marble Wks r 400 Maple av Runyan May (wid E C) h 204 Sessions Runyan Mary F student r Church (Eliz) Runyan R A (Effie S) farmer h Cherokee rd (Eliz) Rusk Jas E r 210 Sessions Russell Andrew Q (Sara G) hlpr h 116 Delk MARIETTA CITY DIRECTORY 283 Russell Allen B (Louella F) 1 mech h 307 Austin av Russell Harry F (Halloween) 2 emp Bell Aircraft Corp h 610 1st Apt 4 Russell Robt lab r 113 Page Russell Zachariah T (Huldah S) towermn N C & St L RR h 606 Roswell Ruth Robt (Delthia B) emp Monto Shaw & Son h 200 Maple Rutledge Chester M (Idelle J) 1 formn Bell Aircraft Corp h 104 Phil- lips dr Rutledge Fredk T (Margt D) const wkr r 326 Atlanta Rutledge Margt D (Mrs F T) slswn Sears Roebuck & Co r 325 Atlanta STO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Sachs Ward H (Mary M) 2 USN r 326 Atlanta Saffo Lois maid 306 Kennesaw av r 112 Mulberry Saflover Edw J (Annie D) USA r 803 Cherokee Safety Cab Inc Raymond H Goddard mgr 200 Cherokee St James Episcopal Church The Rev Jas Savoy rector 401 Church St Joseph's Catholic Church 607 Church Saine Alex USMC r 406 N Waddell Same Jas student r 406 N Waddell Saine Jessie Mrs 1 emp Bell Aircraft Corp r 406 N Waddell Salmon Aleene cook 317 E Dixie r 121 Grogan Salmon Harry (Henrietta L) emp Bell Aircraft Corp h 405 Aviation rd Sampson R B meat ctr O D Mitchell Gro RD 2 Sams Bertha (Mrs W F) emp Bell Aircraft Corp r Fair Oak av (FO) Sams Columbus B (Lillie L) carp Bell Aircraft Corp h 112 Fairground Sams Garvis elk r Fair Oak av (FO) Sams Geo F (Bertha) carp Bell Aircraft Corp h Fair Oak av (FO) Sams LeRoy (Evelyn F) 3 guard Bell Aircraft Corp h 1008 Roswell Sams Regenia r 112 Fairground Samuels Cecil USA r Page Samuels Cinda (wid J A) h Page Sands Cordelia maid 204 Sessions r 303 Mulberry Sand Garfield (Leila K) emp Brumby Chair Co h 217 Maple Sands Henry ydmn 606 Church r 303 Mulberry Sands John D USA r 108 Coryell Sands John F (Eliz G) 1 dispr Bell Aircraft Corp h 325 Aviation rd Sanders C L (Christine PI) opr Ga Power Co h Page Sanders Cafe (Effie Sanders) 624 Cherokee Sanders Claude L (Cassie T) 1 h 821 Rose la Sanders Dovie elk Sanders Cafe r 624 Cherokee Sanders Effie (Sanders Cafe) h 624 Cherokee 284 BALDWIN'S 19B Sanders Ernest R (Jeanette W) 1 patrolmn City Police Force h 312 Wright Sanders Kermit C USA r 314 Wright Sanders John H pntr h Jordan RD 1 Sanders Leolyn tchr Keith Sch r Austell rd (FO) Sanders Mary F emp Marietta Army Air Port r Page Sanders Rodney W (Virginia Y) 1 inspr Bell Aircraft Corp h 532 Roose- velt cir Apt A Sanders Ruth tchr Marietta High Sch r 106 Vance cir Sanders T Albert (Rose H) brkmn L & N RR Co h 100 Henderson Sanders Thos M (Mable B) (Sanders & Channell) h 314 Wright Sanders Wilburn K (Clara M) 1 fanner h 406 W Goss Sangster Chas C (Lorene M) USA h Hill RD 5 Sanger Chas 0 (Margt C) 2 h 426 Atlanta Sanges Dovie P (Mrs Robt) emp Holeproof Hosiery Co r 800 Roswell Sanges Frank C h Beaver av Sanges Frank J (Edna) 2 stone ctr The McNeel Marble Co h 309 Glover Sanges Frank L (Bonnie) mach h 211 Gramling Sanges Ida r 109 Gober Sanges J Morton (Marian P) asst mkt mgr A & P Food Stores h 501 Church Apt 12 Sanges Marion S sten r 501 Church Apt 12 Sanges Miriam P (Mrs M J) slswn Sears Roebuck & Co r 501 Church Apt 12 Sanges Morton J (Miriam P) meat ctr A & P Food Stores h 501 Church Apt 12 Sanges Allie M (Mrs S G) slswn Style Shop r 500 Haynes Sanges Sarah emp Holeproof Hosiery Co r rear 1916 Roswell Sanges Searle G (Ollie S) pntr h 500 Haynes Sangster Lorene M (Mrs Chas C) checker Model Lndry r Hill RD 5 Sapp Jesse B (Mary W) 4 granite ctr The McNeel Marble Co h 300 Fair- ground Sappington Jacques C USA r 105 W Dixie av Sappington Joshua L (Annie C) ofc wkr The McNeel Marble Co h 105 W Dixie av Sappington Joshua L Jr USA r 105 W Dixie av Sappington Sheila C student r 105 W Dixie av Sargent Gloria A waitress The Liberty Bell Cafe r RD 5 Sargent R L (Lissie S) lab r Rose la (Eliz) Sarr Ada (wid Young) r 407 Atlanta Sasser Ossie L Mrs 1 emp Bell Aircraft Corp h 701 3d Apt 1 Satterfield Carl Beatrice W) 1 emp Bell Aircraft Corp r 501 Campbell Hill Satterfield Chas D (Willie I) opr N C & St L RR h 209 McDonald Sauls Annie M (wid E N) h 200 E Anderson marietta city directory Z85 Sauls Elisha r 117 Butler SAUL'S DEPARTMENT STORE (Jos L Saul) Ladies Ready-to-Wear, Men's Clothing, Milliners, Luggage, Piece Goods and Household Furnishing, 59-61 S Park Square--Tel 287 (See left top lines) Sauls Evie H (Mrs Roy P) emp Brumby Chair Co r 200 E Anderson SAUL JOS L (Celia) (Saul's Department Store) r Atlanta Ga Sauls Roy P (Evie H) trk dr Brumby Furn Co r 200 E Anderson Sauls Thos 0 2 elk Johnny Walker Inc h 405 Atlanta Sauls Wm A (Mamie G) USA r 200 E Anderson Saunders Virginia T elk Bell Aircraft Corp r 209 McCord Savage Clifford (Lillian W) chem Bell Aircraft Corp h 422 Park View av Savage Lillian (Mrs Clifton) tchr Waterman Sch r 422 Park View av Savoy Jas E Rev rector St James Episcopal Ch r 322 Campbell Hill Sawyer Edna Mrs 1 ofc wkr Bell Aircraft Corp h 300 Manget Apt A Sawyer Geo L (Eva D) 1 eng Bell Aircraft Corp h 409 Fairground Sawyer Paul O (Pearl R) 1 formn Bell Aircraft Corp h 806 4th Apt 3 Scarborough Arth J (Minnie S) formn Holeproof Hosiery Co h 207 Lawrence Scarbrough Edgar M (Mattie K) 2 formn Bell Aircraft Corp h 904 3d Apt 3 Scarbrough Grace (Mrs Willie) emp Bell Aircraft Corp r 815 4th Apt 1 Scarborough Minnie S (Mrs A J) slswn Florence's Inc r 207 Lawrence Scarborough Walter S (Edna P) 1 emp Sears Roebuck & Co r 207 Lawrence Scarbrough Willie (Grace) emp Bell Aircraft Corp h 815 4th Apt 1 Scarr Francis J (Mildred C) 1 eng Bell Aircraft Corp h 917 Whitlock av Scarr Jas B USMC r 917 Whitlock av Scarr Ruth L student r 917 Whitlock av Schaeffer Howard (Virginia) City Fire Marshal h 233 Atlanta Apt 1 Schaeffer Ilene ofc wkr Bell Aircraft Corp r 232 Powder Springs Schaeffer Nellie K h 232 Powder Springs Schaeffer Virginia H (Mrs Howard) sten Bell Aircraft Corp r 233 Atlanta Apt 1 Schaeffer Wm C USN r 232 Powder Springs Schaffer Frank (Mary) lino opr The Marietta Journal h 103 Henderson Schaffer Mary (M;rs Frank) ofc wkr Bell Aircraft Corp r 103 Henderson Sheffield Herbert L (Ollie T) 1 sign writer r 1511 Roswell SCHILLING F E A INC, F E A Schilling Jr Pres, Harold O. Schilling V-Pres, Hardware, Electric Appliances and Paints, Plumbing, Heating and Sheet Metal Contractors, 33 N Park Square--Tel 258 (See Buyers' Guide) SCHILLING FEAJR (Kate B) 1 Pres F E A Schilling Inc h 205 Freyer dr--Tel 112 286 BALDWIN'S 1944 SCHILLING HAROLD O (Margt) Y-Pres F E A Schilling Inc, Chairman of the Board Cobb Exchange Bank h 836 Church--Tel 56 SCHILLING WALTER E (Mary H) HUS Postmaster h 301 Lawrence --Tel 368 Schmucky Mary L (wid J C) r 105 Northcutt Schoof John (Gertrude L) eng Bell Aircraft Corp h 424 Maple av Schroeder Edw M (Minnie L) emp Brumby Chair Co h 204 Lemon Schroeder Fred (Lois B) gro 1509 Roswell h same Schroeder Hubert C (Ruby) lawyer 59 S Park Sq r Atlanta Ga Schroeder John emp Brumby Chair Co r 206 Church Schuster Ernest E (Lillian G) 1 supvr Bell Aircraft Corp h 414 Aviation rd Schuster H Fredk E Jr (Kath T) 1 emp Bell Aircraft Corp h 510 Page Scoggins Cath opr Evelyn's Beauty Shop r 103 Poplar Scoggins Eva (wid T L) r Nelson Scoggins Fred (Nita) guard Bell Aircraft Corp h 509 Cherokee Scoggins Fronie B (wid R A) h 1104 Roswell Scoggins Grocery (W Lee Scoggins) 622 Cherokee Scoggins Harry USA r 103 Poplar Scoggins Harry R (Eva J) 1 formn Bell Aircraft Corp h 103 Poplar Scoggins Jas R USA r 400 Powder Springs Scoggins R Alvin (Edith A) 1 h 205 Merritt Scoggins Sara S opr S B T & T Co r 103 Poplar Scoggins Vivian student r 509 Cherokee Scoggins W Lee (Pearl F) 1 (Scoggins Gro) h 400 Powder Springs Scoggins Willis L Jr USMC r 400 Powder Springs Scott Allen D (Lucille M) 3 mach Bell Aircraft Corp h 112 Kings ct Apt B Scott Amy cook Marietta Cafe r 214 Greer av Scott Beatrice maid h 107 Fort Apt 2 Scott Clomer (Hattie J) 1 clnr Nu-Way Clnrs & Lndry h 410 Robeson ct Apt 8 Scott Edw .(Ida G) h 704 Wright Scott Eliz r 207 Mulberry Scott Ethel K slswn McLellan Stores Co r RD 1 Scott Ralph porter Williams Drug Co r 207 Mulberry Scott Grover USA r 504 Lemon Apt 5 Scott Gus R emp Brumby Chair Co r 109 South av Scott Hattie J cafeteria Bell Aircraft Corp r 410 Robeson ct Apt 8 Scott Howard student r 112 Kings ct Apt B Scott Ida cook r 704 Wright Scott Jesse (Amy) h 214 Greer av Scott Leslie (Annie) 2 emp W P Stephens Lbr Co h 213-a Mulberry Scott Louis student r 504 Lemon Apt 5 Scott Lucy M ofc sec Bell Aircraft Corp r 501 Church Scott Maggie cook h 309 Cole * Scott Marvin ofc wkr r 126 Trammell Scott Marvin E (Margt, B) 1 trk dr r 1303 Roswell Scott Otis USA r 504 Lemon Apt 5 Scott S D emp Brumby Chair Co r 123 South av Scott Thos P (Minnie L) mach Bell Aircraft Corp r 112 Kings ct Apt 3 Scott Weyman W (Ogie D) h 123 South av Scudders Cleo cook 111 Francis av h 223(4 Montgomery Seaborn Geo (Rebecca S) const eng Bell Aircraft Corp r 615 Whitlock av Seagraves Bertie L (Allie M) 1 welder Bell Aircraft Corp h 413 Frasier Apt A Seal John Rev (Sarah) h Canton rd (Eliz) Seals Mildred msngr Bell Aircraft Corp r 313 Lemon Sears Edgar L (Mary M) farmer h Fair RD 5 SEARS, ROEBUCK & CO, E E Thompson Mgr, Department Store, All State Tires, Cross Country Batteries, Master Mixed Paints, Prosperity Ranges, Hercules Heating Equipment, Rugs, Aristocrat Plumbing Fixtures, Clothing, 238 Atlanta--Tels 1068 and 1069 (See right bottom lines) Seay Allen B (Kate C) h Barber rd (FO) Seay Ellen maid 616 Church r 123 Holiday Second Baptist Church 720 Atlanta Seeley Elsworth L (Pauline P) 1 ofc wkr Bell Aircraft Corp h 108 Allgood rd Apt 2 Seeman Rosamond (Mrs Anton) ofc mgr Mield Furn Co r 516 Church Seeman Anton (Rosamond F) 1 r 516 Church Seifrit Lucia A student r 104 Oakmont dr Self Donald slsmn r 113 E Anderson Self Robt D (Dovia) 1 slsmn h 208 E Anderson Sellers Cleo L (Mrs J J) emp Bell Aircraft Corp r 511 Lawrence Sellers Helen O (Mrs W H) sten r Austell rd (FO) Sellers Jas J (Cleo L) 1 carp r 511 Lawrence Sellers Wade hlpr Fair Oak Dairy r Austell rd (FO) Sellers Wade H (Helen O) 1 USN h Austell rd (FO) Sellers Sami M (Thelma E) 3 eng Bell Aircraft Corp h 535 McArthur dr Apt B Sessions Caroline r 312 Freyer dr Sessions Jessie G nurse Bell Aircraft Corp h 501 Church Apt 11 Sessions Lee M (Mary L) 1 ins solr h 816 Whitlock av Sessions Mildred tchr Marietta High Sch r 113 Forest av Sewell Herman (Blanche J) USA r 510 Cherokee Sewell John P USA r 602 Cherokee Sewell Robt USN r 602 Cherokee Sewell Ruby E supvr County Board of Education r Roswell RD 2 Sexton Frank r 702 Lawrence 288 BALDWIN'S 1944 Sexton Gladys (Mrs S G) (Black Beauty Salon) r 200 Geo Hamilton ct Apt 8 Sexton Irene maid r 702 Lawrence Sexton Stanley G (Gladys B) guard Bell Aircraft Corp h 200 Geo Ham- ilton ct Apt 8 Sexton Wiley H (Grace P) guard Bell Aircraft Corp h 613 Church Seymour John O (Annie T) 2 rigger Bell Aircraft Corp h 708 4th Apt 3 Seymour Mary ofc wkr Bell Aircraft Corp r 107 Fairground extd Apt 2 Shackelford Willis T (Mac W) 1 die mkr Bell Aircraft Corp h 136 W Dixie av Apt 2 Shanahan Ray emp Bell Aircraft Corp r 530 Page Shanell Essie cook r 408 Fairground Sharp Dorothy sten Southland Ice Co r Atlanta rd (FO) Sharp Eber I (Ellen L) farmer h Atlanta rd (FO) Sharp H Alice r Atlanta rd (FO) Shattles Jas W (Caroline B) 4 constn formn h 206 Roswell Apt 2 Shaw Alvin L plmbr Groover Hdw Co r 706 Roswell Shaw Annie lndrs Nu-Way Clnrs & Lndry r 509 Montgomery Shaw Billie P r 206 E Dobbs Shaw Carnel (Ida) 1 lab h 213 Maple Shaw Chas USA r 504 N Waddell Shaw Chas L (Stella W) emp City Light & Water h 201 Geo Hamilton ct Apt 10 Shaw Chas M (Irene F) USA h 205 Geo Hamilton ct Apt 1 Shaw Eleanor G (Mrs F Jr) ofc wkr Bell Aircraft Corp r 203 McCord Shaw Emma I (wid Jas F) h 122 Trammell Shaw Fannie cook County Jail r 504 Montgomery Shaw Fannie J emp Dixie Cafe h 504 Lemon Apt 1 Shaw Florence (Mrs Gilbert) bkpr Monto Shaw & Son r 409 Washington av Shaw Florine emp Nu-Way Clnrs & Lndry h 135 Mulberry Shaw Floyd (Rosa) USA r 121 Barnes ShawT Fred (Annie) emp Brumby Chair Co h 509 Montgomery Shaw Gilbert C (Florence R) USA r 409 Washington av Shaw Gilbert Feed Store (Monto Shaw & Son) 223-25 Powder Springs Shaw Glover (Jenny L) emp Brumby Chair Co r 215 Reynolds Shaw H W (Cauline H) 2 formn Bell Aircraft Corp h 238 Hill ct Shaw Harold A (Sarah H) USA r 307 S Waddell Apt 1 Shaw Harold S student r Powder Springs RD 4 Shaw Henry W (Margt M) supvr Brumby Chair Co h 405 Kennesaw av Shaw Hugh L (Hazel N) 1 firemn Bell Aircraft Corp h Lakewood av RD 5 Shaw Ida emp Marietta Cafe r 213' Maple Shaw J E (Emma) emp Monto Shaw & Son h 504 N Waddell Shaw Jas (Rosa P) 4 lab City of Marietta h 405 W Anderson Shaw Jas F Jr (Eleanor G) USA h 203 McCord MARIETTA CITY DIRECTORY 289 Shaw Judge (Eliz) 1 (Lawrence Street Barber Shop) h 113 Curry al Shaw Lillie lndrs r 118 Page Shaw Lizzie 3 midwife 213 Rigsby h same Shaw Louise S (Mrs Virgil M) elk Jones Pharm r 126 Trammell Shaw Mamie L maid 208 Kennesaw av r 209 Montgomery Shaw Mary ofc wkr r 122 Trammell SHAW MONTO (Mary McC) 1 (Monto Shaw & Son) h 209 E Dobbs--- Tel 176-J SHAW MONTO & SON (Monto and T G Shaw) Blenders of Monto's Flour Manufacturers of Shaw's Dairy Feed, Broiler and Laying Mash, 113 Tucker--Tel 671 Shaw Oscar h 206 E Dobbs Shaw Ozeal cook 300 N Forest av r 216 Montgomery Shaw Peter C (Beulah B) 2 brklyr h Powder Springs Shaw Philip USA r 504 Montgomery Shaw Rachael r 504 N Waddell Shaw Ralph N (Mary G) 1 tool mkr Bell Aircraft Corp r 203 McCord Shaw Raymond M (Ernie I) 1 USA h 207 E Dobbs Shaw Richd M (Dorris B) 1 guard Bell Aircraft Corp h 705 3d Apt 3 Shaw Robt E (Vesta J) 2 electn Brumby Chair Co h 116 Garrison dr Shaw Sadie M 1 maid r 109 Elk Shaw Rosa P cook City Cafe r 405 W Anderson Shaw Sami D (Alma D) slsmn h Barber rd (FO) SHAW T G (Lucille C) 1 (Monto Shaw & Son) h 507 Haynes--Tel 896-W Shaw Wanell (Mrs Jock) ofc wkr Earl G Medford r 113 Henderson Shea Barbara ofc wkr Bell Aircraft Corp r 110 Freyer dr Shea D Eug (Anna) h 110 Freyer dr Shea John student r 110 Freyer dr Shea Wm E USMC r 110 Freyer dr Shealy Forrest H (Fay J) inspr Bell Aircraft Corp h 605 Morningside dr Apt 1 Sheats Cornelius (Neanor L) (Rex Pool Rm) h 218 Montgomery Sheats Neanor maid r 218 Montgomery Shell Jeanne K elk W P Stephens Lbr Co r 700 Church SHELL OIL CO, Forrest C Brook Agent, Wholesale Oil and Lubricant Dealers, Gasoline, Kerosene, Fuel and Tractor Oils, Insecticides and Cleaning Solvents, Atlanta rd RD 5--Tel 1268 (See right bottom lines) Shell Paul E (Mary L) 4 motion picture opr h 700 Church Shelley Troy L (Louise G) 1 USA r 202 Holland Shelnutt D B Rev pastor Elizabeth Methodist Ch r Clarkdale Ga Shelton Sarah M r 113 Curry al Shelton Sofie lndrs r 120 Johnson Sheppherd Daisy opr Victory Beauty Shop r RD 1 290 BALDWIN'S 19 Sheppard Raymond (Evelyn S) 2 electn Bell Aircraft Corp h 300 Lakewood dr Apt\ A Shepherd Alice H (Mrs Ansel H Jr) ofc wkr Brumby Chair Co r 317 Atlanta Apt 1 Shepherd Ansel H (Mattie G) formn Brumby Chair Co h 317 Atlanta Apt 1 Shepherd Ansel H Jr (Alice H) atndt McKinney Tire & Battery Service r 317 Atlanta Apt 1 Shepherd John lab W P Stephens Lbr Co r 704 Wright Shepherd Martha ofc wkr Sears Roebuck & Co r 317 Atlanta Apt 1 Shepherd Ruth ofc wkr Cobb County Federal Savings & Loan Assn r 317 Atlanta Apt 1 Sherman Betty I student r 214 Rose la Sherman Robt H (Olivia L) 1 eng Bell Aircraft Corp h 608-a E Waterman Sherrill Leo K (Gladys J) 1 USA h Hill RD 5 Sherwin-Williams Co J Fargo Lanier mgr 114 Powder Springs Shields Bess C (wid J M) 2 sch tchr h Concord rd (FO) Shields Guy M (Zelma) h 815 4th Apt 4 Shields Zelma (Mrs G M) elk Bell Aircraft Corp r 815 4th Apt 4 Shifflett Martha (Clyde) 1 emp Bell Aircraft Corp h 412 Park View av Shinall Lula (wid Jas) h 109 S Alexander Shinall Mary emp Brumby Chair Co r 109 S Alexander Shinn Eug emp Bell Aircraft Corp r 507 Cherokee Shipp A L (Maggie R) guard Bell Aircraft Corp h 308 Campbell Hill Shipp G W (Irene K) 1 h Henry RD 5 Shipp Grace (Mrs R W) emp Bell Aircraft Corp r 309 Wright Shipp Quinton (Sara H) 1 formn Bell Aircraft Corp r 307 Powder Spring Shipp Ralph W (Grace) 1 camp mgr S B T & T Co h 309 Wright Shipp W Ernest (Annie T) h 307 Powder Springs Shirley Andrew J r 109 Hawkins Shirley Carl H (Lillie S) pntr h 109 Hawkins Shirley Chas F USA r 109 Hawkins Shirley Jeanette T (Mrs Wileby) looper Holeproof Hosiery Co r Rose la (Eliz) Shirley Lilia (Mrs C H) nurse 109 Hawkins h same Shirley Wileby (Jeanette T) USA r Rose la (Eliz) Shockley John R (Emma) 1 emp Bell Aircraft Corp h 420 Park Vew av Shore Roselyn student r Atlanta rd (FO) Shore Sidney E (Lillian W) 1 dispr Ga Power Co h Atlanta rd (FO) Shoup Francis P (Lillian M) 1 (S & W Constn Co) h 607 Polk Shugart B D (Evelyn W) USA r 314 Campbell Hill Shugart Evelyn W (Mrs B D) ofc wkr Bell Aircraft Corp r 314 Campbell Hill Shurman Julietta r 108 Francis av Sibley Florence W librarian Clarke Library r 305 Kennesaw av marietta city directory 291 Sibley Sami H Hon judge U S Circuit Court of Appeals h 305 Kennesaw av Siegfries Jas (Mary B) USA h Concord rd (FO) Sims Jack USA r 203 Kennesaw Sims Rose Mrs opr S B T & T Co r 203 Kennesaw Silk Gladys G (Mrs John) waitress Marietta Cafe r 307 Waddell Silk John (Gladys G) USA h 307 N Waddell Silman Aleene r 121 Grogan Silvey Beatrice ofc wkr Rickenbacker Aircraft Training Sch r 302 Lemon Sims Albert emp Bell Aircraft Corp r 214 Powder Springs Simmons Claude lab Bell Aircraft Corp r 704 Wright Simmons Evalyn waitress r 100 Height Simmons Flora r 228 Johnson Simmons Frank (Evalyn R) waiter Southern RR Co r 100 Height Simmons O D (Callie F) h Atlanta rd Simmons Rosa r 100 Height Simonds Claude (Ruby N) 2 mech Bell Aircraft Corp h 904 3d Apt 2 Simpson Beatrice cook Marietta High Sch r 118 Johnson Simpson Dorsey T (Dorothy E) 3 emp Bell Aircraft Corp h 805 4th Apt 5 Simpson Geo emp Bell Aircraft Corp r 206 Forest av Simpson J A (Nellie) mech Bell Aircraft Corp h 609 2d Apt 1 Simpson J B (Louise D) mach Bell Aircraft Corp h Atlanta rd (FO) Simpson John D (Beatrice H) 1 lab Bell Aircraft Corp r 118 Johnson Simpson Nellie (Mrs J A) mech Bell Aircraft Corp r 609 2d Apt 1 Simpson Wm G loftsmn Bell Aircraft Corp h 210 Victory dr Sims Bertha emp Bell Aircraft Corp r 309 Roswell Sims Clara student r 410 W W Lee ct Apt 3 Sims Frances opr S B T & T Co r 300 Polk Sims Geo O (Annie L O) 2 eng h 109 Francis av Sims J Edgar (Eliz H) 1 electn Bell Aircraft Corp h 151 W Dixie av Sims Jos M (Edna E) 1 ofc wkr Bell Aircraft Corp r 151 W Dixie av Sims Nellie H maid r 410 W W Lee ct Apt 3 Sims Rose T Mrs opr S B T & T Co r 127 Cleveland av Sims Thos (Nellie H) lab Brumby Chair Co h 410 W W Lee ct Apt 3 Sims Willie bkpr F E A Schilling Inc r 309 Roswell SINCLAIR REFINING CO, Sami A White Agent, Wholesale Gasoline, Oils, Greases, Kerosene, Insecticides, Tractor Fuel, Butler nr Glover Tel 691 (See front supplement cover and Buyers' Guide) Singleton Dennis J (Pearl R) 2 asst formn Bell Aircraft Corp h 616 Ramona Apt 2 Singleton Doyal L (Lessie H) 2 emp Bell Aircraft Corp h 603 3d Apt 3 Sinyard Lawrence G (Billie A) 2 emp Bell Aircraft Corp h 101 3d ct Apt 3 Sisson Clifford del slsmn Wofford Oil Co r RD 2 Sisk Eliz (wid Ottis) r 315 Waterman Skelton Blake B (Lucille P) 1 emp N C & St L'RR h 111 Hedges Apt 1 292 BALDWIN'S 1944 Skelton Elija M (Effie E) cond N C & St L RR h 309 E Dixie av Skelton Frances opr Evelyn's Beauty Shop r Smyrna Ga Skelton Glenn bkrmn N C & St L RR r 309 E Dixie av Skelton J Lawton ship elk r 219 Green Skelton John R Jr (Edna H) 1 cond N C & St L RR h 219 Green Skelton Robt E USA r 309 E Dixie av Skillington Bessie (wid S J) elk Bell Aircraft Corp r 212 E Dixie av Apt 2 Skinner Jas H (Martha) (Skinner's Cafe) h 106 E Dixie av Skinner Martha (Mrs J H) cook Skinner's Cafe r 106 E Dixie av Skinner's Cafe (Jas H Skinner) 106 E Dixie av Slade Horace (Ernestine) 5 caretkr National Cemetery h 306 Fort Slade Ernestine maid r 306 Fort Slappey Jack emp Bell Aircraft Corp r 808 Church Slaugher Geo R (Leon W) USA h 518 Bellvue rd Apt 2 Slay Jos Herbert (Nellie L) hatchery mn Marietta Hatchery r RD 4 Slay Melay (wid J) r 101 Gober Slay Nellie (Mrs J H) emp Marietta Hatchery r RD 4 Sloan Ama L sch tchr r Campbell Hill (Eliz) : 4'^ ` Sloan Ralph M (Allie) 1 inspr Bell Aircraft Corp h 607 2d Apt 1 Smallwood Lee (Julia P) emp Victory Homes of Marietta Inc h 1924 Ros- well Smallwood Paul E USA r 1924 Roswell Smallwood Raymond (Vada S) emp Holeproof Hosiery Co h 213 Camp- bell Hill Smallwood Vada S (Mrs R) knitter Holeproof Hosiery Co r 213 Campbell Hill Smallwood Willie R USA r 1924 Roswell Smathers Olivia mgr Economy Ice Cream Co No 3 r Kennesaw Ga Smith Allen (Annie) emp Bell Aircraft Corp h 509 Victory dr Apt 2 Smith Annie lndrs r 217 Johnson Smith Annie (Mrs Allen) emp Bell Aircraft Corp r 509 Victory dr Apt 2 Smith Arth emp Bell Aircraft Corp r 217 Reynolds Smith Benj C (Margt S) 1 tool designer Bell Aircraft Corp h 402 Park View av Smith Betty student r 301 E Dixie av SMITH CARL (Marie M) (Carl Smith Tire Co) h 301 E Dixie av--Tel 522 SMITH CARL TIRE CO (Carl Smith) Auto Accessories and Supplies, Lubrication, Tire Recapping and Vulcanizing, Road Service, 222 At- lanta--Tel 1014 (See Buyers' Guide) Smith Chas L elk r 116 Trammell Smith Chas W (Jennie R) service mgr Anderson Mtr Co r Whitlock av extd Smith Charlotte E student r 117 Vance cir omith Christine D Mrs inspr Bell Aircraft Corp h 807 4th Apt 1 Smith Clarence A (Nell H) dist mgr Martin Theatres h 119 Northcutt MARIETTA CITY DIRECTORY 293 Smith Cynthia M retoucher Loudermilk Studio r 301 E Dixie av Smith Dessy D (Edith) mech Bell Aircraft Corp h 512 Victory dr Apt 2 Smith Dorothy (Mrs Neal) emp Bell Aircraft Corp r 119 Trammell SMITH EDGAR M (Ruby H) Mgr Marietta Coca-Cola Bottling Co Inc, h 406 Lawrence--Tel 638 Smith Edw C sexton Confederate Cemetery r 233 E Dixie av Smith Edwin R USA r 210 Rose la Smith Ellie M (wid H G) 2 h 223 Powder Springs Smith Elmer (Bertie W) 2 emp Brumby Chair Co h Tower rd (Eliz) Smith Emma M (wid W P) h 205 Lemon Smith Elmore (Eleanor H) 1 instr Rickenbacker Aircraft Training Sell h 117 Vance cir Smith F V elk L & N RR and N C & St L RR r Acworth Ga Smith Frances r Rose la (Eliz) Smith Fred G (Mable R) 1 carp W P Stephens Lbr Co h Cogburn rd (Eliz) Smith Geo W (Nannie B) 1 emp Bell Aircraft Corp h 813 4th Apt 6 Smith Gilbert (Jean) mech Bell Aircraft Corp r 405 Cherokee Smith Glover (Miriam R) emp J M Fowler Co h 1234 Whitlock av Smith Harold USA r 223 Powder Springs Smith Harry A (Frankie G) tool mkr r 604 Cherokee Smith Henry C (Ora B) USA h 115 Freyer dr Smith Herschell S (Annie B) gro Rose la (Eliz) h same Smith Hugh Eug emp Bell Aircraft Corp r 308 Washington av Smith J E (Leila B) pntr W P Stephens Lbr Co h Page SMITH J G (Miriam R) (J M Fowler Co) Whitlock av extd RD 4 Smith Jacqueline ofc wkr Bell Aircraft Corp r 223 Powder Springs Smith Jas r Page Smith Jas A (Sallie C) 1 ship elk Holeproof Hosiery Co r 210 Rose la Smith Jeanette V r 406 Lawrence Smith Jerry B (Eliz S) eng N C & St L RR h 116 Trammell Smith John D (Roberta B) 2 rural carrier US PO h 233 E Dixie av Smith John D (Dorothy H) 2 mach h 218 E Dixie av Smith John J (Louise B) 2 brklyr h 119 Gober Smith John R wtchmn r rear 1120 Powder Springs Smith John S USA r 608 Atlanta Smith John T USA r 116 Trammell Smith Jos R electn r 223 Powder Springs Smith Jos R (Mary P) 1 mach Bell Aircraft Corp h 300 Manget Apt B Smith Kenneth E (Ellie R) 2 mach Holeproof Hosiery Co h 207 Camp Smith Kinnaman USMC r 608 Atlanta Smith Lizzie B maid r 112 Page Smith Lorene 4 maid h 116 Coryell Smith M S ofc wkr Bell Aircraft Corp r 317 E Dixie av Smith Mabel H Mrs r 212 E Anderson Smith Maggie knitter Holeproof Hosiery Co r 213 Campbell Hill 294 BALDWIN'S 1944 Smith Margt student r 608 Atlanta Smith Margt elk Daniell Jewlr Store r Page Smith Margt maid 1515 Hillside dr r 529 Washington av Smith Mary E tchr Marietta High Sch r 309(4 Lawrence Smith Milton r 508 W Goss Smith Murray pntr W P Stephens Lbr Co r Page Smith Neal (Dorothy C) USN r 119 Trammell Smith Neual L (Yvonne C) 1 electn Bell Aircraft Corp h Concord rd (FO) Smith T Nolan (Lizzie M) 2 pntr h Page Smith T Nolan Jr USN r Page Smith Orrie D waiter Stonewall Cafe r 704 Lawrence Smith P J lab McKinney Tire & Battery Service r 118 Page SMITH P GROVER (Eliz B) Sec-Treas Cobb County Federal Savings & Loan Assn of Marietta h 608 Atlanta--Tel 490 Smith R Hoke (Sittie D) 3 emp Bell Aircraft Corp h 808 1st Apt 5 Smith Reba L (wid G H) 1 h Austell rd (FO) Smith Robt R (Audrey J) loftsmn Bell Aircraft Corp h 319 Aviation rd Smith Rurie B (Helen) emp Holeproof Hosiery Co h 210 Rose la Smith T Louise cash Hodges Drug Co r 116 Trammell Smith Thos F (Helon G) 1 USA r Tower rd (Eliz) Smith Thos S (Octavia H) 1 formn Brumby Chair Co r 303 Polk Smith V (Gladys) 1 emp Bell Aircraft Corp h 807 3d Apt 3 Smith Vallaha (wid C A) looper Holeproof Hosiery Co h 200 Stewart av Smith Versie Mrs 1 elk Clay Bargain Store r Hill RD 5 Smith W Ray mech Southland Ice Co r 108 Poplar Smith Walter (Lizzie B) 3 dishwasher h 112 Page Smith Walter W (Atha L) 3 h 107 South av Smith Wiley F (Bonnie) 1 mech h 708 Atlanta Smith Wm B (Helen B) 1 emp Bell Aircraft Corp h 605 2d Apt 1 Smith Wm A USA r 223 Powder Springs Smith Wm H (Irene G) 2 emp Bell Aircraft Corp h 413 Brook cir Apt 1 Smith Wm T (Louise C) 1 lab h 408 W W Lee ct Apt 1 Smith's Service Station (Walter W Smith) Roswell nr Atlanta-Marietta Hwy Smithweck G W (Jessie L) 1 ofc wkr Holeproof Hosiery Co h 102 Moon Smithweck Artie pairer Holeproof Hosiery Co r 101 Locust Smithweck Clinton (Mary A) 2 h 302 Forest av Smithweck John W (Victoria B) slsmn Reeves Seed Store h 107 Moon Smithweck Maggie D pairer Holeproof Hosiery Co h 101 Locust Smithweck Martha L sten Marietta Hosiery Co r 704 Church Smithweck Mary A (Mrs Clinton) bkpr Peoples Loan & Finance Corp r 302 Forest av Smithweck McNeely T (Charlotte C) 2 bkpr Anderson Mtr Co r 405 Washington av MARIETTA CITY DIRECTORY J2U5 Smithweck Tyre M (Mattie W) elk Coggins Shoe Co h 704 Church Smithwick Lucille H (Mrs L D) smstrs r 411i/o Lawrence Smithwick Sami D (Lucille H) hlpr Bell Aircraft Corp h 41114 Lawrence SMOKY MOUNTAIN TRAILWAY H B Allen Agt 118 Atlanta Snell Fred C (Simpson D) ofc wkr Bell Aircraft Corp h 712 4th Apt 3 Snell Louie F (Bernice W) inspr Bell Aircraft Corp h 707 3d Apt 4 Snipes Willie E (Rebecca L) 1 electn Bell Aircraft Corp h 601 3d Apt 3 Snyder Floyd M (Paul S) 1 emp Bell Aircraft Corp r 621 Kennesaw av Snyder H C (Gladys H) 1 brkmn N C & St L RR h 621 Kennesaw av Snyder J E (Melvina D) USA r 109 N Forest av Sockwell Wm C (Mary P) slsmn h 100 W Dixie av Sockwell Wm G (Marjorie M) 2 firemn Marietta Army Air Field h 205 Waddell pi Apt 8 Soloman Jas lab h 107V& Mulberry Soloman Lena maid h 304 Harold Soloman Thos (Arzie) lab r 304 Harold Sommers J L (Hattie B) supt Wilson & Henderson Constn Co h 304 Av- iation rd SOPER ROLLA N Mgr Cowan Auto Supply r Cartersville Ga Sorrels Len (Annette) 1 gro 209 Greer av h same Sorrels Lenie maid 1608 Hillside dr 111 Shepard Sorrels Michl emp Bell Aircraft Corp r 208 Greer av Sossoman Walter C (Katie H) pattern mkr Bell Aircraft Corp h 109 Hedges Apt 1 Southern A Coy (Louise R) 2 guard Bell Aircraft Corp h Hill RD 5 Southern Arth F (Hassie D) formn Brumby Chair Co h 1118 Powder Springs SOUTHERN BELL TEL. & TELEG CO, Forman B Dodd Mgr 208 Powder Springs--Tel 9000 Southern JHIr Marble Mill (Eliz) Southern Mary L (Mrs Zettler) emp Brumby Chair Co r Hill RD 5 Southern Wm emp Brumby Chair Co r Hill RD 5 Southern Zettler (Mary L) 3 trk dr h Hill RD 5 SOUTHLAND ICE CO, Don C Hancock Pres-Treas, R Jas Hancock V-Pres, Thos S Manning Sec, Ice Mfrs, Coal Stokers, Water Heaters, Refrigerators and Beer Distributors, 100 W Dobbs--Tel 1 and 2 (See inside margin back supplement cover) Spake Boyd P (Vivian A) 1 mach Bell Aircraft Corp h 121 Covington Spake Chas (Juanita M) USA r 139 South av Spake G Sami (Savannah W) 1 fir sander 139 South av h same Spake Juanita M (Mrs Chas) looper Holeproof Hosiery Co r 139 South av Spang Geo J (Dorothy W) 2 elk Bell Aircraft Corp h 406 Park View av Spears Alice pairer Holeproof Hosiery Co r Rose la (Eliz) Spears Annie lndrs h 902 N Cole Spears Betty C ofc wkr Bell Aircraft Corp r 707 3d Apt 6 296 BALDWIN'S 1914 Spears C Hunter USA r Rose la (Eliz) Spears Chas C (Ida T) carp W P Stephens Lbr Co h Rose la (Eliz) Spears Chas H (Willie Q) 1 USA r 525 W Hansell Spears Clyde W USA r Rose la (Eliz) Spears Edw P (Margaret C) 2 emp Bell Aircraft Corp h 1301 Roswell Spears Frank L (Agnes 0) 3 (Frank Spears Sales Stable) h 319 Pow- der Springs Spears Frank G student r 319 Powder Springs Spears Frank Sales Stable (Frank Spears) 205 Cleveland av Spears Jessie L r Rose la (Eliz) Spears Ollie B (wid W H) r 707 3d Apt 6 Spears Ollie M boarder Holeproof Hosiery Co r Rose la (Eliz) Spears W Thomas USMC r 319 Powder Springs Spears Wm H (Jennie V) lab H N DuPre h 507 Lemon Apt 7 Speers B C Jr Rev pastor Joy's Chapel r 203 Sessions Spence Alf C (Celia A) h 817 Manget Spence Jean (Mrs L D) emp Bell Aircraft Corp r 703 3d Apt 1 Spence Jolly L (Linne W) 1 presmn h 815 Manget Spence Louie D (Jean) guard Bell Aircraft Corp h 703 3d Apt 1 Spence Morgan L USMC r 214 Campbell Hill Spence Olivia K ofc wkr Bell Aircraft Corp r 214 Campbell Hill Spence Sallie E (wid D M) h 214 Campbell Hill Spencer Louis D (Eva H) r 208 Roswell Spencer Susan E (wid J J) sten h 501 Church Apt 6 Spinks Dorothy L waitress Marietta Cafe r 516 W Hansell Spinks Emmett S (Inez W) 1 trk dr h 601 Powder Springs Spinks F L (Annie M) 3 emp Bell Aircraft Corp h Nelson Spinks Helen (Mrs Wm) bkpr Cowan Auto Supply r 509 Cherokee Spinks Thos H (Margt S) h 516 W Hansell Spivey S B (Alma) 1 emp S B T & T Co h 208 Wayland Apt 1 Sprague John C (Irene W) 1 USA h 112 McDonald Spratlin Edgar B Jr (Daisy P) 2 elk Bell Aircraft Corp h 900 3d Apt 2 Spratling Grover B (Inez B) mech Bell Aircraft Corp h Gray (Eliz) Spratling Inez B (Mrs G B) inspr Bell Aircraft Corp r Gray (Eliz) Sprayberry Herbert J (Dorothy G) 1 agt The Atlanta Constitution r 511 Church Spruell John C (Dora P) wtchmn W P Stephens Lbr Co h 213 Locust Squires Chas N USA r 619 Kennesaw av Squires Jesse B (Ruthel B) firemn N C & St L RR h 322 Lawrence Squires R L (Dura B) eng N C & St L Rif; h 619 Kennesaw av Squires R L Jr USA r 619 Kennesaw av Spur Distributing Co Leland Garland mgr Atlanta rd Stahl Dwight W (Mary W) 1 foremn Bell Aircraft Corp r 301 Cherokee Stall Newton A (Helen H) 1 emp Bell Aircraft Corp h 128 Garrison dr Stancil Annie F r Marble Mill (Eliz) MARIETTA CITY DIRECTORY 297 Stancil Bonnie emp Bell Aircraft Corp r Atlanta rd (FO) Stancil Hulan hlpr h Marble Mill (Eliz) STANDARD OIL CO OF KENTUCKY, Max C Pittard Agent, Wholesale Oil and Lubricant Dealers, Gasoline, Kerosene, Fuel and Tractor Oils, Insecticides, Tire and Battery Dealers, 127 Butler--Tel 679 (See Buyers' Guide) Stands Eug (Kate W) 4 constn wkr h 108 Coryell Stanford J Walter (Muriel P) chiro 517 Church h same Stanfield Lemuel W (Lillie S) 1 woodwkr Bell Aircraft Corp h Henry RD 5 Stanfield Mary L (wid L L) h Henry RD 5 Stanley Clarence W (Daisy H) 3 emp Bell Aircraft Corp h Marr av (Eliz) Stanley Jas M (Louise L) 1 ofc mgr W L Stephens Lbr Co h 206 Stewart avenue Stanley Leonard E (Mary B) 1 USA r Cochran (FO) Stanley Louise (Mrs Jas) ofc wkr Earl G Medford r 206 Stewart av Stancil Lelia Mrs tchr Robt L Osborne Sch r Barber rd (FO) Stanley Leslie (Bertha) 2 fnshr Brumby Chair Co r 608 Cole Stansell Betty student r 105 Husk Stansell Carolyn ofc wkr Bell Aircraft Corp r 105 Husk Stansell Jas C (Alleen M) lino opr Brumby Press Inc h 105 Husk Stansel Luther B (Minnie F) 4 trk dr County Prison Camp h 412 Clay Stanton Chas C (Daisy R) 1 USA r 200-a Roswell Staples John T USA r Austell rd (FO) Stark Sidney L (Cynthia D) 1 sales rep h 312 Church Apt 2 Starke Helen C Mrs 1 r 808 Church Starr John P (Willovada C) fire trk dr Bell Aircraft Corp h 425 Brook cir Apt 2 Staton Lewis L (Mamie M) roofer W P Stephens Lbr Co h Hill RD 5 Steadwell Fay r 714 Fort Steel Fred N USA r 105 Radium Steel Homer T (Nora R) 2 emp Holeproof Hosiery Co h 105 Radium Steel Hubert M USA r 105 Radium Steel Marvene ofc wkr Holeproof Hosiery Co r 105 Radium Steel Mattie S ofc wkr Holeproof Hosiery Co r 105 Radium Steele Thos F (Ruby W) 2 gro 214 S Waddell h same Stell Harold G (Mozelle) emp Bell Aircraft Corp r 1515 Roswell Stell Hettie r Ward (Eliz) Stell Mary A Mrs slswn The Book Store r Woodstock Ga Stell Mozelle (Mrs H G) emp Bell Aircraft Corp r 1515 Roswell Stells Dorothy B (Mrs J C) ofc wkr r 514 Lawrence Stells J Earl (Dorothy B) bill poster h 514 Lawrence Stells W Luther (Belle T) bill poster h 515 Lawrence Stephens Chas (Inez) 2 lab h 504 Lemon Apt 6 Stephens DuPont USA r Rose la (Eliz) Stephens Frank (Willie G) jan Cobb Theatre h 106 Fort 298 BALDWIN'S 1944 Stephens Irene M Mrs cash Strand Theatre 218 Roswell Stephens Inez waitress Marietta Hotel Coffee Shop r 504 Lemon Apt 6 Stephens May M (wid CP) emp Strand Theatre r 2.18 Roswell Stephens Sarah Mrs 1 emp Bell Aircraft Corp r 204 Campbell Hill STEPHENS T EDW (Creswell M) 3 V-Pres and Mgr of Contracting Dept of W P Stephens Lumber Co h Cherokee rd (Eliz)--Tel 772 Stephens V E (Doner C) oiler r Rose la (Eliz) Stephens Veania W (wid J L) h 401 N Waddell Stephens Walker D (Ada W) 6 gro Rose la (Eliz) h same Stephens Walter R (Ethelene S) 1 emp City Lights & Water Dept r 122 Trammell Stephens Willie G maid h 106 Fort STEPHENS W P (Lena N) Pres W P Stephens Lumber Co h 900 Church--Tel 552 STEPHENS W P LUMBER CO, W P Stephens Pres, Wm N Stephens V-Pres-Genl Mgr, T Edw Stephens V-Pres and Mgr of Contracting Dept, Lumber Mfrs, Building Materials and Supplies, Glass, Roofing and Paints, 315 Church--Tel 840 (See back supplement cover) STEPHENS WM N (Nancy L) V-Pres-Genl Mgr W P Stephens Lumber Co, V-Pres Cobb County Federal Savings and Loan Assn of Marietta h 104 Francis av--Tel 423 Stephens Wilma student r 208 Locust Stephenson Minnie student r 104 Franklin Stevens Annie lndry r 109 Franklin Stevens Chas (Inez H) butler 305 Kennesaw 504 Lemon Stevens Eliz (wid J H) r Church (Eliz) Stevens Geo W (Virginia K) eng Bell Aircraft Corp h 308 Aviation rd Stevens M J (Eleanor) asst supt Bell Aircraft Corp h 540 Page Stevens Sara cook 1224 Whitlock r same Stevens Virginia ( Mrs Warren) elk First Natl Bk r 308 Aviation rd Stevens Willie Mae maid 302 Kennesaw av r 106 Fort Stevens Wm P (Lanette C) trk dr h Church (Eliz) Stevenson Clarence (Dorothy D) mech Bell Aircraft Corp h 605 Alexander cir Apt B Stevenson Jesse N (Bertha L) 3 lab h 104 Franklin Stevenson Lillie M maid r 114 Holiday Stevenson Milous (Lillie) 1 trk dr City Board of Light & Water Wks h 117 Franklin Stewart Barrett (Clara) 1 dr Safety Cab Inc r 201 W Lemon Steward H Edw hlpr Model Dry Clnrs r 105 Rigsby Stewart C Elder (Ida W) 2 elk Safety Cab Inc h 201 Lemon Stewart Carrie r 309 Maple av Stewart Claudia I (Mrs W F) tchr Waterman Street Sch r Smyrna, Ga Stewart Frank L (Betty J) 1 mech Bell Aircraft Corp h Austell rd (FO) MARIETTA CITY DIRECTORY 299 " ~ ~ Stewart Holland W (Mary I) 2 formn Bell Aircraft Corp h 128 Butler Apt B Stewart Jackson constn wkr r 307 Powder Springs Stewart Ralph (Christine N) 3 dr Morrison Taxi h 500 W Hansell Stidham Arth barber Rich & Powell Barber Shop r RD 2 Stidwell Charlie trk dr Southland Ice Co r 307 Page Stidwell Eug (Fannie P) USA r 703 Wright Stidwell John USA r 703 Wright Stidwell Julius (Mary L) 2 lab Brumby Chair Co h 703 Wright Stiles Edw trkr L & N RR and N C & St L RR r Powder Springs Ga RD 2 Stiles Harley S (Bessie S) 1 mech Anderson Mtr Co h 115 Butler Stiles Myrtle I checker American Lndry r 115 Butler Stimson Lloyd K (Isabella S) 1 production mgr Brumby Chair Co h 118 McDonald Stockton Mae riveter Bell Aircraft Corp r 210 Allgood rd Apt 1 Stokes Arra B r 1007 Powder Springs Stokes & Co (Bonnie L McCoy and Davis L Stokes) 119 Atlanta Stokes Davis L (Florence) (Stokes & Co) r Atlanta Ga Stoker Geo W (Willie M) formn Bell Aircraft Corp h 601 Victory dr Apt 1 Stokes Lawyer V (Savannah) tailor Walter W Hazel h 306 Cole Stokes Robt P (Eunice R) 2 USA r 332 Sessions Stokes Savannah lndrs r 306 Cole Stokes Vivian lndrs r 306 Cole Stoner Arvil W Rev (Cora H) 7 (City Curb Mkt) h 1120 Powder Springs Stonewall Hotel Wm E Kehoe mgr 10 E Park Square Stonewall Liquor Store Wayne Thackston mgr 11 E Park Square Stoney John W (Margt P) 2 emp Bell Aircraft Corp h 713 Page Story H Paul (Ruth N) emp Bell Aircraft Corp h 120 Wright Story Ruth N (Mrs H P) emp Marietta Federal Sav & Loan Assn r 120 Wright Stover Arvel W (Cora H) (City Curb Mkt) r Dalton Ga STOWE JAS R Mgr Field Hotel r Field Hotel Stoyle Lou B (wid W C) r Bells Ferry rd (Eliz) Strait Cecil D (Faye P) 3 chiro 216 Atlanta h Powder Springs rd RD 5 STRAND THEATRE Harris J Rogers Mgr 19 N Park Sq--Tel 476 STRANG ALBERT R (Eliz M) Production Mgr Holeproof Hosiery Co, h 100 Chickasaw drive--Tel 599 Street Fred C (Dorothy L) 2 formn Bell Aircraft Corp h 603 2d Apt 3 Streeter Wm (Fannie) USA r 201 Denmeade Strickland Christine cook 108 Freyer dr r 119 Johnson Strickland Corine S Mrs 3 h 200 Wayland Apt 7 Strickland David USN r 108 Lake Strickland Helen maid r 212 Johnson Strickland Homer lab h 108 Mulberry Strickland Julia 1 lndrs r 407 Reynolds 300 BALDWIN'S 1944 Strickland Letha nurse h 403 Lemon Strickland Mack elk A & P Food Stores r 200 Wayland Apt 7 Strickland Mary 4 lndrs h 206 Mulberry Strickland Mary r 212 Johnson Strickland Mozelle maid r 108 Lake Strickland Paul (Pinnie C) 8 jan Bell Aircraft Corp h 108 Lake Strickland Paul Jr USA r 108 Lake Strickland Richd L meat ctr H N DuPre r 119 Washington av Strickland Sadie B 1 cook r 318 W Goss Strickland Scott emp Holeproof Hosiery Co r 200 Wayland Apt 7 Strickland Wilber H (Evelyn B) 2 emp Bell Aircraft Corp h 609 2d Apt 5 Strickland Willie P (Christine) emp City Street Dept h 119 Johnson String Anne student r 307 S Alexander Stringer Alice R (wid EL) h 108 Forest av Stripland Bailey H (Pauline C) trk dr h Poplar (FO) Strong Mary r 503 Powder Springs Strong Walter L (Ida M) 4 emp Brumby Chair Co h 102 Lake Strozier Jos L (Lillian H) mgr Dunlop Tire Co r 203 Lawrence Strozier Lillian elk Ofc of Price Administrator r 203 Lawrence Strozier Ola T (wid H M) h 203 Lawrence Stuart C Edw (Maidee H) 1 drftsmn Bell Aircraft Corp h 104 Camp Stuart Wm D (Josephine W) 1 radio inspr Bell Aircraft Corp h 305 South av Apt 1 Stumphf Ira (Reba J) 1 emp Bell Aircraft Corp h 512 Lakewood dr Apt A Stumphf Reba J (Mrs Ira) sten Bell Aircraft Corp r 512 Lakewood dr Apt A Sturghall Algernon (Rachel) 1 lab h 310 Harold Sturghall Rachel cook r 310 Harold Sturgis Dudley C Jr (Lila P) 1 USA h 104 Colonial cir Apt 2 STYLE SHOP, (J L Brantley, Mrs J L Brantley, Mrs Irma Latimer) Wom- en's and Misses Clothing, Dresses, Coats, Sweaters, Millinery, 62 S Park Square--Tel 564 (See Buyers' Guide) Styles Clyde emp Bell Aircraft Corp r 411 Church Styles Myrtle I slswn American Lndry & Dry Clnrs r 115 Butler Suchy Laverne P Mrs checker H N DuPre r 205 Holland Suchey Edgar USA r 205 Holland Suddeth Benj F (Wilda M) 1 crane opr Bell Aircraft Corp h Hill RD 5 Sudderth Chas H (Marie B) fnshr Bell Aircraft Corp h 103 Jones Suhr Phillip B USN r 319 Campbell Hill Suhr Robt C (Lucille M,) h 319 Campbell Hill Suhr Robt N student r 319 Canmbell Hill Sullivan Eliz I riveter Bell Aircraft Corp r 200 Wayland Apt 4 Sullivan H G emp Bell Aircraft Corp r 109 Freyer dr Sullivan Jas F (Virginia C) 2 emp Bell Aircraft Corp h 200 Wayland Apt 4 MARIETTA CITY DIRECTORY SOi I Sullivan John G (Lillian B) treas Nat Nu-Grape Co h 408 Polk Sullivan John W (Ruth D) USN r 408 Polk Sullivan Walter H hlpr r 200 Wayland Apt 4 Summerall Clifton L (Ida S) 1 mach opr h Tower rd (Eliz) Summerlin Nobie cook r 706 Lawrence Summerour Beve N (Amanda M) farmer h 417 Polk Summerour Chas (Marie R) 1 emp Bell Aircraft Corp h 207 Maple Summerour Clara cook 222 Club dr r 316 Goss Summerour Danl (Alice S) lab Bell Aircraft Corp h 114 Lakewood Summerour Edna M maid r 113 Curry al Summerour H Clay (Irma S) 5 emp Bell Aircraft Corp h 1627 Hillside dr Summerour Jas (Clara N) emp Brumby Chair Co h 316 W Goss Summerour John M (Louise B) 2 emp Bell Aircraft Corp h 409 Polk Summerour Patricia tchr Waterman Street Sch r 417 Polk Summerour T H trk dr H N DuPre r 207 Maple Sunlite Baker (Ray Durden) 117 Church Sutherland Louis (Sallie) 1 supt Bell Aircraft Corp h 611 3d Apt 3 Sutton Jas E (Evelyn) formn Bell Aircraft Corp h 507 Alexander cir Sutton Remar M (Mildred G) 2 emp Bell Aircraft Corp h 202 Aviation rd S & W Construction Co Inc (Francis S Shoup, Walter H Warnke) 110 Atlanta Swain Mary H (Mrs Fred) tchr Waterman Street Sch r Smyrna Ga Swalley Frank F emp Brumby Chair Co h 406 Church Swancy Rebie M Mrs emp Bell Aircraft Corp r 504 Powder Springs Swanson Carrie emp Bell Aircraft Corp r 807 4th Apt 1 Swanson Geo E (Johnnie D) 2 asst mgr Greyhound Bus Sta h 209 Freyer dr Swanson J H Jr USN r 209 Sessions Swanson Jas student r Concord rd (FO) Swanson Mae (wid J H) 1 ofc wkr Holeproof Hosiery Co h 209 Sessions Swanson Mary cook 714 Church rd RD 1 Swanson Ruth cook r 904 N Cole Swanson Thos slsmn r 129 Henderson Swanson Wm USA r Concord rd (FO) Sweet Fred (Natalye L) mgr W W Mac Co h 617 Church Apt B Sweet Natalye L (Mrs F W) cash W W Mac Co r 617-b Church Apt B Swift Margt emp Bell Aircraft Corp r 108 Forest av Swilley Lonnie (Lucy) teller First Natl Bk r 301 Kennesaw av Swilling Aline A (wid RE) h 209 Gramling Sykes Walter D (Johnnie S) 2 mach Bell Aircraft Corp h 103 3d ct Apt 2 TO FIND A NAME YOU MUST T KNOW HOW TO SPELL IT Taff W T (Aranelle) 2 inspr Bell Aircraft Corp 818 1st Apt 6 302 BALDWIN'S 1944 Taft Walter H (Maxine M) 1 formn Bell Aircraft Corp h 113 Phillips drive Talbot H Inman (Maude H) 1 ofc wkr Bell Aircraft Corp h 1511 Hillside drive Talbot Hilda sten Bell Aircraft Corp r 1511 Hillside dr Talbot Mary I typist Bell Aircraft Corp r 1511 Hillside dr Talley Wm E (Helen D) 1 inspr Bell Aircraft Corp h 135 Hedges Apt 1 Tapper Anna R r 614 Birney Apt 2 Tanner Chester E mach Bell Aircraft Corp r 100 Gramling Tanner Edw (Sarah S) r 409 Atlanta Tanner Essie (wid Jos) h 621 Birney Apt 1 Tanner Leland H emp Bell Aircraft Corp r 621 Birney Apt 1 Tanner Morris emp Don Ree Cafe r Smyrna Ga Tanner Sarah (Mrs Edw) ofc wkr Bell Aircraft Corp r 409 Atlanta Tanner Wm H (Addie G) County Tax Assessor r Acworth, Ga Tarlton Annie (wid F S) r 305 Husk Tarr Donald T ( Jean B) 1 eng Bell Aircraft Corp h 810 4th Apt 1 Tart Wm r 206 Church Tate Beatrice elk Bell Aircraft Corp r 123 Moon Tate Bessie cook r 110 Johnson Tate Betty student r 113 Vance cir Tate Eliz S student r 113 Vance cir Tate Eliz S (wid Howard) asst librarian Clarke Library h 113 Vance eir Tate Jennie (wid W B) h 1009 Cherokee Tate Lucy probation officer r 1009 Cherokee Tatum Emma H (wid S B) r Marble Mill (Eliz) Taulman Dan C (Vernelle) 2 eng Bell Aircraft Corp h 810 4th Apt 3 Taylor Bertha K cook h 118 Page Taylor Bessie S (Mrs E O) emp Holeproof Hosiery Co r 107 Moon Taylor C Lyman (Beatrice B) 3 mach Brumby Chair Co h 103 Campbell Hill Taylor Chas E USA r 408 W W Lee ct Apt 5 Taylor Davis (Annie C) instr Rickenbacker Aircraft Training Sch h 601 Cherokee Taylor Davis E (Mary L) USMC r 405 Lawrence Eaylor Ed ydmn r Austell rd (FO) Taylor Ernest O (Bessie S) 1 roofer W P Stephens Lbr Co r 107 Moon Taylor Everett mach Bell Aircraft Corp r 714 Atlanta Taylor Fannie opr Harrison Beauty Parlor r Smyrna Ga Taylor Fannie S (wid F) r 408 Lawrence Taylor Helen ofc sec Victory Homes of Marietta Inc r 1523 N Park dr Taylor L M (Fannie J) 2 mech Bell Aircraft Corp h 107 Fairground extd Apt 1 Taylor Lillian (wid Wm H) r 1523 N Park dr Taylor Lizzie lndrs h 212. Johnson marietta city directory 303 Taylor Marguerite lndrs r I28V2 Henderson Taylor Minnie (wid HR) r 105 Henderson Taylor Nolen J (Cath) 2 emp Bell Aircraft Corp h 803 3d Apt 4 Taylor Robt L (Marguerite M) 4 lab Brumby Furn Co h 128i/2 Henderson Teague Ella G (Mrs Tracy) ofc sec Brumby Furn Co r 209 McCord Teague Eva S (Mrs J M) emp Western Union Teleg Co r Barber rd (FO) Teague J M (Eva S) USA h Barber rd (FO) Teague John R (Mary C) 2 emp Bell Aircraft Corp h 111 Hawkins Apt A Teasley Mary maid 111 Hedges Apt 1 r 114 Holiday Teague Tracy T (Ellagee) 1 mach Holeproof Hosiery Co h 209 McCord Teal Nancy student r 811 4th Apt 3 Teem Herschel E r Austell rd (FO) Teem Wm M (Maggie F) h Austell rd (FO) Temple Sarah G (Mrs Mark) executive dir American Red Cross Cobb County Chapter r 515 Cherokee Temple Mark (Sarah G) prsmn h 515 Cherokee TENNESSEE COACH CO, H B Allen agt 118 Atlanta Terrell Maud cook 619 Cole r 113 Page Terrell Pleas (Maud R) lab h 113 Page Terrell Robt L (Dorothy B) 1 emp Ga Power Co r 300 S Alexander Terrell Thos (Mary) 1 inspr Bell Aircraft Corp r 212 Sessions Terry Jas (Frances C) meat ctr h 3091/2 Lawrence Terry John H (Sarah O) 1 emp Marietta Housing Authority h 307 Cleveland av Terry Robt A prsmn Brumby Press Inc r 307 Cleveland av TEXAS CO THE, F P & BOB BINDLEY Consignees, Wholesale Oil and Lubricant Dealers, Gasoline, Kerosene, Diesel Fuels, Industrial Oils and Greases, 108 Glover--Tel 688 (See left top lines) Thacker Arth A (Willie C) emp Bell Aircraft Corp h 619 Atlanta Thacker Louise E emp S B T & T Co r 619 Atlanta Thacker Mae r 303 E Dixie av Thackston C Wayne (Evelyn M) mgr Stonewall Liquor Store r 407 Powder Springs Thackston Evelyn M (Mrs C Wayne) nurse r 407 Powder Springs Thigpen Claude L (Doris W) 2 ofc wkr Bell Aircraft Corp h 708 4th Apt 5 Thigpen Marvin M (Ruby H) 2 mech Bell Aircraft Corp h 600 Alexan- der cir Thomas Baxter emp Owenby Mfg Co r Cogbum rd (Eliz) Thomas Dennis (Frankie) lab Bell Aircraft Corp r 911 Lawrence Thomas Dorothy K (Mrs H L) inspr Holeproof Hosiery Co r 108 Alexan- der Thomas Ernest J (Louise H) 2 elk County Comn h 412 Fairground Thomas Ethel cook Atlanta rd r 110 Fort Thomas Felton (Frances T) brklyr r 325 Lemon 304 BALDWIN'S 19h Thomas Frances 2 lndrs h 504 Lemon Apt 5 Thomas Frankie maid Bell Aircraft Corp r 911 Lawrence THOMAS GEO E (Margt McN) 3 V-Pres The McNeel Marble Co h 203 Seminole dr--Tel 299 Thomas H 0 aud Bell Aircraft Corp r 411 Church Thomas Henry L (Dorothy K) USA h 108 S Alexander Thomas Hollis (Lois C) USA r 315 Powder Springs Thomas Jas A (Clara B) USA r 108 S Alexander Thomas Jas H (Mary C) 1 farmer h Concord rd (FO) Thomas John W (Willie G) 2 formn Bell Aircraft Corp h 801 4th Apt 2 Thomas Laura cook 603 Powder Springs 319 Lemon Thomas Lois C (Mrs Hollis) uphol Brumby Chair Co r 315 Powder Springs Thomas Lou E maid h 309 Fort Thomas Madelle (Mrs Jas) elk Hodges Drug Co r 108 Alexander Thomas Nellie looper Holeproof Hosiery Co r 615 Cherokee Thomas Paul E (Alice H) service sta Atlanta rd h same Thomas Robt (Susie K) 3 emp Brumby Chair Co r 319 Lemon Thomas Robt (Susie) 1 lab Brumby Chair Co r 403 Lemon Thomas Roy USA r 511 Whitlock av Thomas Thos h 110 Fort Thomas Walter K (Suwnie B) 1 mach Bell Aircraft Corp h 802 4th Apt 3 Thomas Willa N (wid G H) 1 cash Stonewall Cafe h 200 George Hamil- ton ct Apt 10 Thomas Wm (Christine) USA r 313 Page Thomas Wm C USA r Concord rd (FO) Thomason Alf H (Annie T) mgr Big Star Food Stores h Powder Springs nr Garrison rd Thompson Carolyn ofc wkr Bell Aircraft Corp r 515 Whitlock av Thompson Chas F elk W P Stephens Lbr Co r Holly Springs, Ga Thompson Dwight (Eliz G) 1 emp Bell Aircraft Corp h 1512 Hillside dr THOMPSON E E (Vernie C) 1 Mgr Sears Roebuck & Co, h 317 Atlanta Apt 4--Tel 1004 Thompson Eliz G (Mrs Hugh D) ofc wkr U S Selective Service System Local Board No 1 r 410 Powder Springs Thomason Eliz J student r Powder Springs RD 4 Thomason Eug A mach Bell Aircraft Corp r 603 2d Apt 5 Thompson Frank (Blanche) h 301 Fort Thomason Harry (Rose R) optometrist 101^ Whitlock av h .107 Husk Thompson Hugh D (Eliz G) electn Bell Aircraft Corp r 410 Powder Springs Thompson Inzer J (Jewel A) 1 guard Bell Aircraft Corp h 808 4th Apt 3 Thomason Jewel mach Bell Aircraft Corp r 603 2d Apt 5 Thomason John H (Mary C) 1 guard Bell Aircraft Corp h 603 2d Apt 5 Thomason John H Jr r 603 2d Apt 5 Thomson Kath (wid J W) r 503 Powder Springs marietta city directory 305 Thomason Loral r 603 2d Apt 5 Thompson Lawrence H (Mildred K) 2 USA h 606 Bimey Apt 1 Thompson Lucile (Mrs Wm C) boarder Holeproof Hosiery Co r 106 Green Thompson Marie (Mrs Jesse) waitress Economy Ice Cream Co r RD 2 Thompson Marion ofc sec Bell Aircraft Corp r 336 Atlanta Thompson Pearl nurse Marietta Hosp r same Thompson Robt R (Gladys M) 3 mech Bell Aircraft Corp h 605 2d Apt 5 Thompson Wm C (Lucile) 2 trk dr h 106 Green Thompson Wm H USA r Powder Springs RD 4 Thompson Zuett brklyr r 301 Fort Thornton Albert USA r 410 W W Lee ct Apt 6 Thornton Callaway L (Dorothy W) 1 repr Bell Aircraft Corp h 303 South av Apt 4 Thornton Elsie maid Holeproof Hosiery Co h 213 Montgomery Thornton Gordon (Georgianna C) gro 604 Lawrence r same Thornton H F emp Bell Aircraft Corp r 642 Atlanta Thornton Vivian 1 cook r 114 Page Thrasher Zack lab r 615 Lawrence Thurman Carl (Cath W) 1 plstr r 205 Glover Thurman Hazel emp Holeproof Hosiery Co r 304 Sessions Thurman J C (Lillie M) 1 USA r 210 Johnson Thurman Lillie cook r 210 Johnson Thurman Warren (Della M) lab h 219 Johnson Thurmond Felton M slsmn h Rose la (Eliz) Thurmond Mary r Rose la (Eliz) Thurmond Ollie L farmer r 821 Rose la Tibbitts J Elbert (Cora P) solr Industrial Life & Health Ins Co h 308 S Alexander Tibbitts Louise slswn Saul's Dept Store r 308 S Alexander Tidwell Jas A (Namoni T) 2 emp Bell Aircraft Corp h 817 1st Apt 6 Tidwell Namoni (Mrs Alex) emp Bell Aircraft Corp r 817 1st Apt 6 Tiedell Jessie maid h 807 N Cole Tiggs J T constn wkr r 615 Lawrence Tiggs Virgil (Abigale) 2 h 118 Black Tigner John (Clara G) trk slsmn Southland Ice Co h 615 Lawrence Tilard Foy (Lillie M) 4 cook Marietta Cafe h 107 Fort Apt 4 Tilard Foy Jr student r 107 Fort Apt 4 Tilard Jas R USA r 107 Fort Apt 4 Tiller Foy cook Marietta Cafe r 107 Fort Tilley Frank L (Bessie S) pump opr Bell Aircraft Corp h Church (Eliz) Tilley Jack C (Barbara S) USN r Church (Eliz) Tilley Jas D (Azzie) mech Holeproof Hosiery Co h Rose la (Eliz) RD 1 Tilley Nanette ofc wkr Holeproof Hosiery Co r Church (Eliz) Tillman Edd (Bessie S) 2 lab Brumby Chain co h 410 Robeson ct Apt 4 Tillman Edw E USA r 410 Robeson ct Apt 4 806 BALDWIN'S 1944 Tillman Mattie r 410 Robeson ct Apt 4 Tillman Robt W (Florence B) 2 mach Bell Aircraft Corp h 301 Manget Apt A Tillman Willie T USA r 410 Robeson ct Apt 4 Tillson Jas E (Lillie S) checker Bell Aircraft Corp h 906 3d Apt 1 Timmons John L (Marian F) 1 loftsmn Bell Aircraft Corp h 305 South av Apt 3 Tinch Charlie cook Lawrence Street Cafe r Atlanta Ga Tindale Kath B (Mrs A C Jr) nurse Bell Aircraft Corp r 504 Haynes Apt 4 Tindle A C Jr (Kath B) 5 h 504 Haynes Apt 4 Tipton Winona mech Bell Aircraft Corp r 813 4th Apt 2 Tomlinson Frances r 613 2d Apt 5 Tomlinson Wm S h 117 Forest av TORGERSON RAYMOND A (Anita M) 2 Industrial Relation Mgr Hole- proof Hosiery Co, h 105 Oakmont drive--Tel 798 Toward Richd C (Alice C) 1 emp Bell Aircraft Corp h 308 Manget Apt A Towers Mary r 305 Lawrence Towery Dorothy (wid W R) 2 waitress Dixie Cafe r 113 North av (Eliz) Towery Harold (Geneva D) 1 USA r Marble Mill (Eliz) Towns Clyde USA r 305 Glover Towns Emma h 408 W W Lee ct Apt 7 Towns Geo (Katie J) 1 pntr h 214 Jones Towns Hugh G (Mazie C) 2 electn Bell Aircraft Corp r 305 Glover Towns Wm C (Allie M) 2 electn Bell Aircraft Corp h 305 Glover Towns Wm E r 305 Glover Townsend Agnes opr S B T & T Co r 709 Church Townsend C Hill (Ethel L) 3 instr Rickenbacker Aircraft Training Sch h Church (Eliz) lownsend Jos S (Eliz A) (Joe's Place) h Church (Eliz) Townsend Luke T (Christine G) 2 emp Holeproof Hosiery Co h 209 Geo Hamilton ct Apt 8 Townsend Thos L (Daisy P) 3 opr Bell Aircraft Corp h 206 Wayland Apt 5 Lafton Roland M (Rose M) 1 USA h 510 Victory dr Apt 2 Trammell Jas V emp Bell Aircraft Corp r 307 S Waddell Apt 7 Trammell Nora L (Mrs T C) emp Owenby Mfg Co r 209 Geo Hamilton ct Apt 3 Trammell Ralph r 209 George Hamilton ct Apt 3 Trammell Tolvin C (Nora L) trk dr Murray Gin Co h 209 George Hamilton ct Apt 3 Tregone Alec (Madge S) USN r 301 Lawrence Trezevant Fred H USA r 811 Powder Springs TREZEVANT W HOWELL MRS (Colonial Cottage Gardens) 811 Powder Springs -- Tel 484 marietta city directory 307 Trezevant W Howell (Kath S) supt mails Atlanta US PO h 811 Powder Springs Tribble C L (Mary B) mgr W Z Daniell Gro h 105 Prances av Tribble Frances (Mrs L R) bkpr First Natl Bk r 303 Seminole dr Tribble L Revere (Frances) formn Holeproof Hosiery Co h 303 Sem- inole dr Triggs Albert J (Edith N) h 303 Freyer dr Trippe Jas F (Ethel P) 1 emp Metallic Casket Co h 414 Powder Springs Trippe Jewell tcbr Marietta High Sch r 104 Forest av Tritt Shoe Repair Shop (Wm P Tritt) 105 Lawrence Tritt Wm H (Mary J) 1 elk US PO h 206 Geo Hamilton ct Apt 9 Tritt Wm P (Myrtle M) 1 (Tritt Shoe Repair Shop) h 104 E Hansell Triumph Holiness Church 201 Johnson Trout Anna R lndrs r 509 Wright Trout Aralanda r 219 Reynolds Trout Eliz h 219 Reynolds Trout H Eug (Lois P) 1 USA r 220 Rose la Trout Jas emp Monto Shaw & Son r RD 1 Trout Otis D (Anna R) lab h 509 Wright Trout Robt G (Mae T) 2 mach opr Brumby Chair Co h 206 Wayland Apt 8 Trout Rosetta r 219 Reynolds Trudy Frank emp Bell Aircraft Corp r 603 Page Trulove G Vernon (Mary T) 2 radio rpr Sears Roebuck & Co h 105 Hen- derson Truelove Geo C (Grace M) 1 gro Church (Eliz) h same Truelove Jefferson R guard Bell Aircraft Corp r 412 Atlanta Truler Evelyn R (Mrs Lewis) elk Allen Drug Co r 823 Manget Truler Lewis (Evelyn) USA r 823 Manget Trussell Ralph (Jacquelin B) USN r 205 Polk Tuck Charlotte ofc wkr Bell Aircraft Corp r 517 Church Tucker Beth ofc wkr Bell Aircraft Corp r 105 Fairground extd Apt 2 Tucker Dora L (wid M J) r 118 Hedges Apt 1 Tucker Emerson (Eliz L) 1 carp h 106 North av (Eliz) Tucker Ermal (Mae L) 1 mech Bell Aircraft Corp h 714 4th Apt 3 Tucker Floy Mrs 2 looper Holeproof Hosiery Co h Rose la (Eliz) Tucker Geraldine looper Holeproof Hosiery Co r Rose la (Eliz) Tucker Homer T (Joe L) 2 riveter Bell Aircraft Corp h Campbell Hill (Eliz) Tucker J W (Lucy G) h Rose la (Eliz) Tucker R Dean (Margt E) 1 carp r 1312 Cherokee Tuggle Frank guard Bell Aircraft Corp r 317 E Dixie av Tuggle Howell eng Bell Aircraft Corp r 205 Sessions TIMLIN R STEVENS (Virginia) USA h Canton rd (Eliz)--Tel 478-M 308 BALDWIN'S 19^4 TUMLIN J SIGMAN (Sara T) 2 (Marietta Lumber Co) h Canton rd (Eliz)--Tel 478-M TUMLIN WM L (Jeanne) 2 (Marietta Lumber Co) h 222 Club dr-- Tel 936 Turman Lillie emp Marietta Cafe 408 W W Lee ct Turner Chapel A M Church 121 Lawrence Turner Chas E (Susie H) engvr h 815 E Waterman Turner Clara maid Bell Aircraft Corp r 104 Elk Turner Claude T tmkpr Bell Aircraft Corp r 307 S Waddell Apt 4 Turner Dorothy M (Mrs Wm) ofc wkr Bell Aircraft Corp r Hill RD 5 Turner Dorothy W (Mrs E P) supvr Bell Aircraft Corp r 800 E Waterman Turner Edw G (Dessie S) 3 contr h Fair Oak av (E0) Turner Etta r 322 Lemon Turner Etna P (Dorothy W) 1 const formn h 800 E Waterman Turner Florence r 301 S Waddell Turner G P (Jerrene A) 5 formn Bell Aircraft Corp h Osborne (FO) Turner Gartrell W (Estelle) 2 lab Anderson Mtr Co h 107 Edwards dr Turner Geo F (Estelle L) 2 body bldr h 811 E Waterman Turner Hellen emp Western Union Teleg Co r Barber rd (FO) Turner Inez mender Holeproof Hosiery Co r 303 Lemon Turner Jack A (Irene W) 2 carp h 309U> Washington Turner Jas E (Margt S) 2 steel wkr r Turner rd Turner John T (Alice W) electn Brumby Chair Co h 809 E Waterman Turner John T USA r Joyner av (FO) Turner Lewis C Jr asst Dr John T Riddle r 514 Hansell Turner Leila L (wid JL) h 506 Church Turner Leon L (Ester H) 1 mech Bell Aircraft Corp h 428 Alexander cir Turner Lewis C (Magdalene C) 5 pntr h 514 W Hansell Turner Lena M (Mrs Worth) opr S B T & T Co Bells Ferry rd Turner Lucy tchr Waterman Street Sch r 113 Forest av Turner Madge opr S B T & T Co r 300 Polk Turner Nell A elk Office of Price Administrator 307 S Waddell Turner Oscar E (Emilene B) 2 elk Saul's Dept Store h 107 Maxwell Turner Paul hlpr r Fair Oak av (FO) Turner Robt (Clara P) 3 jan Dobbins Funeral Service Home h 104 Elk Turner Ray USA r Fair Oak av (FO) Turner Ruth plater r 301 S Waddell Turner Sallie (wid J W') h 501 Church Apt 5 Turner Sami R (Gladys P) 1 USN h 200 Geo Hamilton ct Apt 2 Turner Seldon guard Bell Aircraft Corp r Hill RD 5 Turner Sue opr Harrison Beauty Parlor r 501 Church Apt 5 Turner Trudie M usher Cobb Theatre r 527 W Hansell Turner W Louise ofc wkr Bell Aircraft Corp r 307 S Waddell Apt 4 Turner W Monroe (Dorothy M) emp Glover Mach Shop h Hill RD 5 marietta city directory 309 Turner Wm H USN r Joyner av (FO) Turner Wm R (Beatrice C) gro Joyner av (FO) h same Tyson Ernest L (Thelma W) 1 supvr Bell Aircraft Corp h 107 Fairground extd Apt 2 Tyson Marshall O (Dora C) (Washington Ave Barber Shop) h 211 Roswell Tyson T Fred Jr ofc wkr Earl G Medford r 200 Locust Tyson T Fred (Jennie G) plmbr F E A Schilling Inc h 200 Locust TO FISH A NAME YOU MUST KNOW HOW TO SPELL IT Umland Rosa B (Mrs Walter) ofc sec Brumby Chair Co r 307 S Alexander Umland Walter (Rosa B) 1 USA h 307 S Alexander UNITED STATES GOVERNMENT Department of Agriculture (AAA) Hoyt C Price county administrative officer 202 Lawrence Department of Agriculture (Farm Security Administration) Lowery T Hagood dist supvr 215 y2 Atlanta Department of Agriculture (Farm Security Administration) C C Crowther county supvr 2d fir 201 Atlanta Department of Agriculture (Soil Conservation Survey) Oliver P Perry tech 202 Lawrence Employment Service War Manpower Commission Hoyt E Register mgr 116-18 Powder Springs " POST OFFICE Walter E Schilling Postmaster 201 Atlanta--Tel 758 Selective Service System Cobb County Board No 1 100*4 Whitlock av--Tel 1063 *Office of Price Administration--Russell S Grove executive sec 116 Atlanta Underwood A Isabell sten U S Employment Service Manpower Commis- sion r 707 Powder Springs Underwood Alice (wid Robt) h 707 Powder Springs Underwood C C (Exie P) ctr The McNeel Marble Co h Church (Eliz) Underwood Cecil USA r Church (Eliz) Underwood David D wtchmn Ga Marble Co r 207 Sessions Underwood Doss M (Eliz G) 1 safety dir Murray Gin Co h 200 George Hamilton ct Apt 1 Underwood E D (Frances M) 1 h 207 Sessions Underwood Ewing D Jr asst mgr Sherwin-Williams Co r 207 Sessions Underwood Frances A (Mrs E D) ofc wkr Holeproof Hosiery Co r 207 Sessions Underwood Isabel emp U S Employment Service r 707 Powder Springs Underwood Jas W USA r 207 Sessions Underwood Mae checker Nu-Way Clnrs & Lndry r Church Ext (Eliz) RD 1 310 BALDWIN'S 1944 Underwood Mina M bkpr r 403 Cherokee Underwood Robt F (Ora W) 2 binder h 200 Wayland Apt 2 Underwood W L (Allene G) ofc wkr h 403 Cherokee Union Chapel Rev Johnson pastor (Atlanta Ga) 325 Page Unold Wm J constn wkr r 206 McCord Upshaw Erby (Irene W) 1 lab Clackum's Trans h Tower rd (Eliz) Upshaw Marjorie mus tchr Marietta High Sch music dir First Baptist Ch h 304 Cherokee Apt 1 Upshaw Mary Jean slswn The Book Store r Canton rd (Eliz) Ussery John B (Mable B) inspr Bell Aircraft Corp h 102 McIntosh av Apt B Ussry Harold A (Gwendolyn S) 3 emp Bell Aircraft Corp h 106 Gober VTO FIND A NAME YOU MUST KNOW HOW TO SPELL IT Vance Malon A (Mattie P) 2 guard Bell Aircraft Corp r 208 Roswell Vance Wm L (Georgia H) h 201 N Forest av Vann H Sellie (Mamie) sawfiler Bell Aircraft Corp h Marble Mill (Eliz) Vanous Jean R (Mrs Marvin L) nurse r Cranfill (FO) Vanous Marvin L (Jean R) USA h Cranfill (FO) Van Varick Mary E r 823 Whitlock av Van Woeart Lem A (Beaulah G) h 121 Park Varnadoe Mary L r 801 1st Apt 1 Varrial Ralph W (Malvina P) production mgr Bell Aircraft Corp h 410 Vic- tory dr Vaugh Darwin emp Bell Aircraft Corp r 109 Freyer dr Vaughan Jas A (Edna T) 2 inspr Bell Aircraft Corp h 413 Park View av Vaughn Bradford (Christine W) emp Bell Aircraft Corp h Atlanta rd Vaughn Christine W (Mrs Bradford) sch tchr r Atlanta rd Vaughn Dwight (Maude) instr h 107 Seminole dr Vaughn Eliz emp Cobb County Times r 315 Powder Springs Vaughn Hoile (Clarice H) 1 r Cherokee rd (Eliz) Vaughn Jas R (Jewel W) 4 trk dr h Joyner av (FO) Vaughn Mary R (wid Robt) h 315 Powder Springs Vaughan Maud P (Mrs D L) sten County Clerk of Court r 107 Seminole drive leach Grady A (Sara R) 1 (Veach Gro Co) h 201 Seminole dr l each Grocery Co (Grady A, Mrs Serena R Veach) 209 Mill Veach Sara R (Mrs Grady A) elk Veach Gro Co r 201 Seminole dr Veal Grade 1 h 506 Reynolds Veazey Rainwater emp Bell Aircraft Corp r 1031 Cherokee Veitch Isaac I (Estell C) 4 barber Hunter Barber Shop h Pearl RD 5 Veitch J W (Elise C) USN r 605 3d Apt 4 marietta city directory 311 Veitch Jos H (Zella M) r 117 Glover Veitch Jos S USA r 103 Moon Veitch Jos W USN r Pearl RD 5 Veitch Kathaleen waitress Bell Aircraft Corp r 117 Glover Veitch Marion 0 (Bertha M) guard Marietta Army Air Port h 103 Moon Veitch Quillan R (Virgie S) 5 crane opr Bell Aircraft Corp h 117 Glover Venable Charlotte (Mrs M W) slswn H E Kerley O Dr r 841 Church Venable M Wellborn Jr (Charlotte N) emp Bell Aircraft Corp r 841 Church Venable Wellborn W student r 841 Church Vennes Grant R (Virginia) 2 emp Bell Aircraft Corp h 1517 Hillside dr Verdery Sarah G (wid HP) r 309 Maple av Verhine Annie R (wid J W) h Jordan RD 1 Vetter Eileen D (Mrs W T) emp Bell Aircraft Corp r 534 Page Vetter W Thos (Eileen D) elk h 534 Page Vickers Buman H USA r Bells Ferry rd (Eliz) Vickers Jas B USA r Bells Ferry rd (Eliz) Vickers W L (Alba M) 2 guard Bell Aircraft Corp h Bells Ferry rd (Eliz) Victory Beauty Shop (Christine Moore) 47 W Park Square VICTORY HOMES OF MARIETTA INC, Fred B Wilson Pres, F. S- Wil- son V-Pres, Jas O Henderson Sec-Treas, M Lewis Rental Mgr, 501 Victory dr--Tel 1166 (See right top lines) VICTORY TRAILER PARK (Lonnie E Carter) Atlanta rd--U S 41 Vincent H D (Oneda) USMC r 238 Hill ct Vincent Oneda (Mrs H P) riveter Bell Aircraft Corp r 238 Hill ct Vinson Carlton J (Mary S) 2 guard Bell Aircraft Corp h 1511 Roswell Vinson Eliz Mrs 1 knitter Holeproof Hosiery Co r 309 Clay Von Hofe Bertha L (wid G E) r 809 Church Von Hofe Floy E US WAVES r 809 Church Von Hofe Gustav E USA r 809 Church Voyles Cecil R (Sarah M) 1 emp Marietta Coca-Cola Btlg Co Inc h Garrison rd RD 5 Voyles Sarah M (Mrs Cecil R) opr S B T & T Co r Garrison rd RD 5 WTO FIND A NAME YOU MUST KNOW HOW TO SFEUL IT Waddell S Curtis (Vola A) 2 formn Bell Aircraft Corp h 1619 Hillside dr Wade Carrie (wid R M) emp Bell Aircraft Corp r 108 Forest av Wade Frances O student r 401 Lawrence Wade Hirour B (Bessie M) rl est slsmn h 315 Washington av Wade Jane ofc wkr S B T & T Co r 401 Lawrence Wade John L (Julia J) 1 trk dr Brumby Chair Co h 110 S Alexander Wade L Idell r 107 Glover 312 BALDWIN'S 19 Wade Leila H (wid J 0) h 107 Glover Wade Leonard L (Lydia A) emp Bell Aircraft Corp h 401 Lawrence Wade Quentin D USA r 110 S Alexander Waggoner Carl C (Jeanette S) 1 welder Bell Aircraft Corp h 304 Manget Apt B Wagner Edw E (Ethel W) 1 inspr Bell Aircraft Corp h 902 3d Apt 4 Wagner John emp Bell Aircraft Corp r 502 Cherokee Wagner Josef (Gertrude S) 2 tool mkr Bell Aircraft Corp h 506 E Water- man Apt A Waite Chas (Lillie H) 2 hlpr City Disposal Plant h 110 Holiday Waits Geo W (Effie P) 3 barber h 201 Waddell pi Apt 9 Waites Isabelle maid r 107 Height Waite John L (Virginia) 2 emp Bell Aircraft Corp h 608 2d Apt 3 Waite Lillie H Indrs r 110 Holiday Waits Roland (Mary C) jan US PO h 120 Franklin Wakefield W Crawford (Annie C) 1 emp Bell Aircraft Corp h 809 4th Apt 2 Wakefield W Crawford Jr emp Bell Aircraft Corp r 809 4th Apt 2 Walden Dennis (Lou J) h 325 Lemon WALDRIP GAINS T (Floy M) 1 (Western Auto Associate Store) h 1100 Whitlock--Tel 1155 Waldrop A H Jr r 305 Cherokee Waldrop Clyde J (Inez H) 1 emp Bell Aircraft Corp h 427 Gramling Waldrop Jas F (Nell M) 1 mech Bell Aircraft Corp h 305 Cherokee Waldrop Jesse A (Margt T) brkmn L & N RR r 516 Lawrence Waldrop L Frank (Neppie R) emp W P Stephens Lbr Co h Marble Mill (Eliz) Walker Agnes M (Mrs John S) (Cinderella Shop) r 106 Forest av Walker Benj 1 ydmn r Rose la (Eliz) Walker Berlie emp Bell Aircraft Corp r 211 Maple Walker Davis USA r 106 Forest av Walker Ervin L (Beatrice K) formn Bell Aircraft Corp h 112 Phillips dr Walker Flournoy C (Louise C) 1 mech Bell Aircraft Corp h 305 Allgood rd Apt 2 Walker Harold M lawyer 59 S Park Square r 709 Church Walker Howard trk dr Harry N DuPre r 124 Henderson Walker Irene student r 413 Lakeview dr Apt A Walker John C (Velma S) 2 emp Bell Aircraft Corp h Allgood rd Walker John L (Kathleen S) 2 emp Bell Aircraft Corp h Austell rd (FO) WALKER JOHNNY INC, John S Walker Pres-Treas, John D McCollum V-Pres-Sec, Men's Furnishing Goods, Stetson Hats, Arrow Shirts and Nunn-Bush Shoes, Men's clo 45 W Park Square--Tel 331 (See left top lines) WALKER JOHN S (Agnes M) 1 Pres-Treas Johnny Walker Inc, h 106 Forest av--Tel 67 marietta city directory 313 Walker Marvin L (Amy B) USA r 401 N Waddell Walker Myrtle emp Bell Aircraft Corp r 111 Poplar Walker Raphael B (Robbie H) 3 mach h 233 Atlanta Apt 3 Walker Uel T (Gladys H) 1 mech Bell Aircraft Corp h 413 Lakewood dr Apt A Walker Willie C (Dorothy K) USA r Barber rd (FO) Wallace Bertha I r 311 Lemon Waljace Bonnie M student r 214 Ayers av Wallace Byron C (Janie S) 2 patrolmn City Police Dept h 131 South av Wallace David W (Mada) 1 emp Bell Aircraft Corp h 110 Colonial cir Apt 4 Wallace Glenn A (Ina T) 1 emp Bell Aircraft Corp h 123 Moores av Wallace Harold E (Florence W) 3 guard Bell Aircraft Corp h 205 Wad- dell pi Apt 2 Wallace Jas W h 1919 Roswell Wallace Janie S (Mrs B C) mach opr Holeproof Hosiery Co r 131 South av Wallace John H (Austine B) emp Bell Aircraft Corp h Atlanta rd Wallace Oscar K (Ida L) (0 K Candy Co) h 214 Ayers av Wallace S Frank (Flora) stone wkr The McNeel Marble Co h 311 Lemon Wallace W Herbert (Edna W) 3 die fnshr Bell Aircraft Corp h 200 Clay Walters Allen J (Allie J) 1 inspr Bell Aircraft Corp h 524 Roosevelt cir Apt B Walton Fannie cook h 206 Johnson Walters Harold L (Louise R) emp Bell Aircraft Corp r 116 Forest av Walters J R (Florence N) 2 formn Bell Aircraft Corp h Concord rd Apt 12-a (FO) Walters Louise R (Mrs H L) Bell Aircraft Corp r 116 Forest av Walton Robt (Mayo R) lab Brumby Chair Co h 508 Hunt Ward Billy r 800 4th Apt 5 Ward Carl USA r 115 Campbell Hill WARD CLARA M (Mrs Mayes) (Mayes Ward & Co) 408 Church--Tel 549 Ward Edna r 301 Butler Ward Esmer C (Ollie M) 1 chf County Police r 404 Lawrence Ward Fred L (Margt) 1 emp Bell Aircraft Corp h 800 4th Apt 5 Ward Glen knitter Marietta Hosiery Co r 115 Campbell Hill WARD HARVEY T (Iris N) (Mayes Ward & Co) h 322 Lawrence-- Tel 508 Ward Henry A (Eliz C) slsmn Kaplan's h 507 Church Ward Jos M (Mildred C) 1 emp Bell Aircraft Corp h 803 3d Apt 3 Ward Judson C (Howard B) (Benson & Ward) r Canton rd RD 1 Ward Louise M Mrs pairer Holeproof Hosiery Co r 316 Maple av Ward Luther (Tishie F) emp Bell Aircraft Corp h 115 Campbell Hill Ward Margt (Mrs F S) emp Bell Aircraft Corp r 800 4th Apt 5 Ward Mary E emp Bell Aircraft Corp r 404 Lawrence WARD MAYES (Clara M) 1 (Mayes Ward & Co) h 408 Church--Tel 549 314 BALDWIN'S 1944 WARD MAYES & CO (Mrs Clara M, Harvey T and Mayes Ward) Ambulance Service, Embalmers, Funeral Chapel and Funeral Directors, 408 Church--Tel 549 (See back supplement cover) Ward Ollie M (Mrs E C) elk County Comn r 404 Lawrence Wardlaw Doyle S (Evelyn) ofc wkr Glover Mach Wks h 107 W Dixie av Wardlaw Ira T (Lola E) mech Glover Mach Wks h Atlanta rd Wardlaw Jas F USA r Atlanta rd War Housing Center Mrs Elma Collins mgr 209 Atlanta Ware Robt lab r 226 Johnson Warner Lula maid 1517 Hillside dr r Atlanta Ga Warner Robt (Idella J) 1 emp Brumby Chair Co h 200 Greer av Warnke Berniece (Mrs W H) ofc sec S & W Constn Co r 308 Cleburne Warnke Walter H (Berniece D) 3 (S & W Constn Co) h 308 Cleburne Warren Ardis L (Dora G) USA r 206 Lemon Warren Coy (Mary) 1 guard Bell Aircraft Corp 519 Vista cir Apt 2 Warren Fred S (Eva Mi) 1 constn wkr r 501 Washington av Warren Jas T (Frances B) 1 h Joyner (FO) Warren John B (Josephine) cook Don Ree Cafe h 208 Montgomery Warren Rowena student r 508 W Hanseil Warren Tharon D (Mabell B) 1 emp Bell Aircraft Corp h Concord rd Apt 19-b (FO) Warren Tharon D Jr emp N C & St L RR r Concord rd Apt 19-b (FO) Warren Thos E checker N C & St L RR r Concord rd Apt 19-b (FO) Warwick Barron (Ella J) eng h Atlanta rd (FO) Washington Avenue Barber Shop Marshall O Tyson 104 Washington av Washington Chas (Georgia S) 1 lab L & N RR h 713 Fort Washington Edw (Jeanie) ydmn 1031 Cherokee r Montgomery Washington Edw (Janie) ydmn h 207 Montgomery Washington Jeanie cook 1224 Whitlock av r 207 Montgomery Waterman Street School Ruth Whitehead prin 214 Waterman Waters John H (Julia H) 2 ofc wkr h 107 Francis av Waters Julia H (Mrs J H) ofc wkr Bell Aircraft Corp r 107 Francis av Waters Ruby (wid John) slswn The Grand Shop r 107 Francis Watkins Chas E (Geraldine P) 1 emp Bell Aircraft Corp r 118 Wright Watkins Ernest (Kate N) 3 mech Bell Aircraft Corp h Bells Ferry rd (Eliz) Watkins Ernest R (Marie M) 2 mach Bell Aircraft Corp h 206 Frasier Watkins Eug A USA r Bells Ferry rd (Eliz) Watkins Geraldine (Mrs C E) tmkpr Bell Aircraft Corp r 118 Wright Watkins Gloria L ofc wkr Glover Mach Co h 403 Powder Springs Watkins Herbert USA r 222 Campbell Hill Watkins J Robt (Ina H) 1 dyer Holeproof Hosiery Co h Church (Eliz) Watkins Nora (wid Reese) waitress Cherokee Street Lunch r 104 Cher okee Watkins Nora (wid C N) 2 r 222 Campbell Hill marietta city directory 315 Watkins R L (Louise B) doffer h 111 Radium Watkins Richd USA r 409 Maple av Watkins Raymond emp Bell Aircraft Corp r 222 Campbell Hill Watkins Sallie D (Mrs W W Jr) bkpr The Grand Shop r 409 Maple av Watkins Ward W (Sallie D) slsmn h 409 Maple av Watkins Wm E USN r Bells Ferry rd (Eliz) WATKINS WM W III (Virginia B) 3 (J M Fowler Co) h 1002 Church Tel 147 Watson Aranna student r 322 Maple av Watson Chas R (Ottie K) elk L C Hames Gro Co h 322 Maple av Watson Chas R Jr USA r 322 Maple av Watson Izora (wid G A) h Rose la (Eliz) Wafts Benj M (Mable C) 3 USA h Henry RD 5 Watts Cora S (wid J S) h 206 Lemon Watts Willie L (Reva G) 2 trk dr h Henry RD 5 Wayland H T (Frances) 1 emp Bell Aircraft Corp h 310 Merritt Wayne Gene W (Frances) 1 USA r 208 Wayland Apt 5 Weatherson John (Thelma C) mach Bell Aircraft Corp h 524 Frasier Apt 3 Weaver Conrad C (Ida J) electn h 107 Cole Weaver John S ofc mgr Stokes & Co r Atlanta Ga Weaver Jas W (Mary R) lino opr Cobb County Times h 402 Washington avenue Webb Alice nurse r 106 E Dobbs Webb Allen (Martha B) 2 slsmn h 300 Chickasaw dr Webb Allen Jr USA r 300 Chickasaw dr Webb Arth E (Lillie L) machinist N C & St L RR r 202 Locust Webb Callie B tchr Marietta High Sch r 104 Forest av Webb E Lula (wid E T) r 813 Church Webb Geo ydmn r 202 Denmeade Webb J Homer (Mae L) 2 emp Bell Aircraft Corp h 116 Griggs Webb Jack emp Brumby Chair Co r 206 Church Webb Leonard (Marie) 2 408 Reynolds Webb Leonard Jr r 408 Reynolds Webb Martha B (Mrs Allen) echr Waterman Sch r 300 Chickasaw dr Webb Nathan (Grace) 2 emp Brumby Chair Co h 104 Harold Webb Paul (Carol O) emp Brumby Chair Co h 226 Johnson Webb Rex L (Frances C) 2 emp Bell Aircraft Corp h 1414 Roswell Webb Robt J (F Pauline) 2 eng Bell Aircraft Corp h 206 Wayland Apt 4 Webb Ruth ofc sec Industrial Life & Health Ins Co r 813 Church Weber Caroline student r 720 Church Weber Chas J (Helen R) 1 eng Bell Aircraft Corp h 720 Church Weber Chas J Jr USA r 720 Church Weber Wm IJ USN r 720 Church Webster Frances 1 cashier Big Star Food Store r Garrison rd 316 BALDWIN'S 1911 Webster Mary (Mrs W E) ofc see Bell Aircraft Corp r 104 Colonial cir Apt 3 Webster W E (Mary) designer Bell Aircraft Corp h 104 Colonial cir Apt 3 Weddington Modister (Bessie G) 1 jan Bell Aircraft Corp h 703 Lawrence Weeks Walter W patrolmn County Police Dept r Kennesaw, Ga. Weems Alonzo (Samantha R) 2 lab City Street Dept h 111 Holiday Weems Andrew M piano repr 105 Cleveland av h same Weems Eug porter Std Oil Co of Ky r 200 Page Weems Flora maid 510 Church r Lemon Weems Jean Indrs r 406 Robeson ct Apt 6 Weems Jos (Laura F) 2 lab The McNeel Marble Co h 406 Robeson ct Apt 7 Weems Laura cook r 406 Robeson ct Apt 7 Weems Lillie M student r 507 Lemon Apt 4 Weems Ruby maid 510 Church h 507 Lemon Apt 4 Weems Sears porter Connally Shoe Shop r 111 Holiday Weems Samantha maid 301 Lawrence r 111 Holiday Weesner Margt service repr S B T & T Co r 307 Wright Weesner Mary J service repr S B T & T Co r 307 Wright Wehunt Charlotte waitress Marietta Cafe r 317 E Dixie av Wehunt Clarence A (Myrtle H) inspr h Bingham (FO) Wehunt Clyde A (Telete E) 2 guard Bell Aircraft Corp h 702 6th Apt 4 Wehunt Grace inspr Bell Aircraft Corp r 111 Poplar Wehunt Lucille waitress Dixie Cafe r 317 E Dixie av Wehunt Myrtle (Mrs C A) mender Holeproof Hosiery Co r Bingham (FO) Weinman Carl A (Dorothy F) USA h 505 Powder Springs Welch Emily E (wid W H) h 300 Roswell WELCH LEONARD L (Mary E) 3 Sec Marietta Hospital, Physician Marietta Hospital Bldg 206-210 Cherokee--Tel 27 h 1011 Church Tel 104 Welch Mary ofc wkr Bell Aircraft Corp r 902 3d Apt 2 Wellman Odell H (Beatrice E) inspr Bell Aircraft Corp h 703 3d Apt 3 Wellons Ben H (Julia M) slsmn h 505 Powder Springs Wellons Frank B (Helen B) sales mgr Brumby Chair Co h 309 Kennesaw av WELLONS POLLY, Director County Department of Public Welfare r 505 Powder Springs--Tel 409-1 Wells Jos fnshr Bell Aircraft Corp r 103 Jones Wells Walter C (Louise S) formn Bell Aircraft Corp h 906 3d Apt 3 Wells Warner E (Ruth) 2 emp Bell Aircraft Corp h 520 McArthur dr Apt A Welsch Sami J lawyer 110 Atlanta r 511 Church Welsh Frances G ofc wkr r 512 Whitlock av Welsh Geo V (Earl G) Y-Pres Glover Mach Wks h 512 Whitlock av marietta city directory 317 Welsh Lois ofc wkr The McNeel Warble Co h 717 Church Welsh Stanley formn Holeproof Hosiery Co r 717 Church West Frances T (Mrs F S) ofc wkr McLellan Stores Co r Concord rd (FO) West Frank (Roxy P) 5 oiler h 1406 Roswell West Foster S (Frances T) USA r Concord rd (FO) West H G (Mattie L) cond L & N RR h 508 Cherokee West Martha L typist r 508 Cherokee West P R (Thelma L) 4 guard Bell Aircraft Corp h 811 4th Apt 5 West Raymond Q (Reba T) 2 electn Bell Aircraft Corp h 511 Bellvue rd Apt 1 Westbrook Esther (wid J V) h Barber rd (FO) Westbrook Holbert M (Vera B) 3 elec W P Stephens Lbr Co h Marr av (Eliz) Westbrooks Homer A (Pauline C) 1 tex wkr h 118(4 Henderson Westbrooks John T (Nora E) 1 emp Bell Aircraft Corp h 126 Moores av Westbrooks John W (Pearl C) 1 emp Whittier Mill h 118 Henderson Westbrooks Nell J Mrs 2 h 113 E Anderson Westbrook Pauline elk Williams Drug Co r Barber rd (FO) Westbrooks Pearl C (Mrs John W) smstrs Owenby Mfg Co r 118 Henderson Westbrook Ruth opr S B T & T Co r Smyrna, Ga Westbrook Sami (Josephine G) 1 trk dr McPherson Tire Shop h Barber rd (Fo) WESTERN AUTO ASSOCIATE STORE, (Gains T Waldrip) Auto Accessories and Supplies, Tire Dealers, Electrical Appliances, Radios, Sporting Goods, 16 E Park Square--Tel 940 (See Buyers' Guide) WESTERN UNION TELEGRAPH CO, Esther Keith mgr, 110 Powder Springs Whatley Victoria tchr r Atlanta rd (FO) Wheat Theo (Opal H) 1 emp Bell Aircraft Corp h 307 S Waddell Apt 6 Wheeler Alice 1 r 115 Maple Wheeler Benj J lab h 115 Maple Wheeler Bessie ofc wkr Bell Aircraft Corp r 314 Campbell Hill Wheeler Clifford A (Nellie W) 2 emp Bell Aircraft Corp h Marble Mill (Eliz) Wheeler Cleo slswn Allen Drug Co r 205 Cole Wheeler Geo (Atlee W) hlpr Brumby Recreation Center h 515 Fort Wheeler Howard F (Idell C) USA r 107 Reynolds Wheeler Lillian 4 cook 202 Radium h 403 Montgomery Wheeler Rachel W (wid B A) r Barber rd (FO) Wheeler Roger A (Leola B) elk US PO h Atlanta rd (FO) Wheeler Wright G (Marie F) 1 dispr Bell Aircraft Corp h 108 Kings ct Apt B Wheeless Otis F (Mlary T) 3 electn City Board of Light & Water Wks h 605 3d Apt 2 Whelchel Willie L (Effie M) 1 mech hlpr h Henry RD 5 318 BALDWIN'S 1941 Whiddon Letha opr Western Union Teleg Co r 408 Lawrence Whigham Carey C (Louella C) 1 emp Bell Aircraft Corp h 617 Powder Springs White A Kenan (Julia A) plmbr h 207 Washington av White Betty J student r Hill RD 5 White Beulah I (Mrs Garnett L) emp Owenby Mfg Co r Hill RD 5 White Carl (Gladys) 1 emp Bell Aircraft Corp r Turner rd White Chas (Maudel) porter McKinney Tire & Battery Service h 205 Denmeade White Chas B (Edna G) emp Bell Aircraft Corp h 507 Cherokee Apt 8 White Carl C (Grace H) 2 riveter Bell Aircraft Corp h 308 E Dixie av White Cornelius W (Lillie D) 1 emp Bell Aircraft Corp h'110 Maple White Cornelia r 411 Reynolds White Earl USA r 518 W Hansell White Edna G (Mrs C B) emp Bell Aircraft Corp r 507 Cherokee White Eliz sch tchr r 809 Church White Ella r 109 Forest av White Floyd (Lena M) 2 trk dr h 519 Fort White Garnett L (Beulah I) 1 stone ctr h Hill RD 5 White Harold F (Geraldine N) 1 emp Bell Aircraft Corp h Henry RD 5 White Harry elev opr Bell Aircraft Corp r 700 Pine White Home The (Rev Isaac A White) furn rms 809 Church White Irene maid r 904 N Cole White Isaac A Rev (The White Home) h 809 Church White J Edw (Donie R) (Fair Oaks Dairy) h Austell rd (FO) White Jas M emp Bell Aircraft Corp r 308 E Dixie av White Jeannette emp Bell Aircraft Corp r 714 4th Apt 2 White John L (Doris M) 1 trk dr h Hill RD 5 White John R (Louise B) formn Bell Aircraft Corp h 711 Page White Lou lndrs h 411 Reynolds White Louise r 406 W W Lee ct Apt 3 White Louise B (Mrs John R) tchr Marietta High Sch r 711 Page White Lowell USA r 518 W Hansell White Loyd J (Alline E) 1 emp Bell Aircraft Corp h North av (Eliz) White Maggie maid Rose la (Eliz) White Marion J (Mary O) 2 518 W Hansell White Melvinia maid r 714 Lawrence White Napoleon B (Mary S) 2 emp Bell Aircraft Corp h 604 Page White Roy (Mary Y) lab W P Stephens Lbr Co h 406 W W Lee ct Apt 3 WHITE SAML A (Willie) 2 Agent Sinclair Refining Co, h 602 Atlanta Tel 1581-W White Steve C (Ethelene C) h 100 Seminole dr White Walter (Annabelle B) lab h 113 Lake White Wilson W (Marie) ofc wkr Bell Aircraft Corp r 401 Atlanta White Willie (Mrs S A) bkpr Sinclair Refining Co r 602 Atlanta marietta city directory 819 White Wm T (Dorothy G) 1 emp Bell Aircraft Corp r Atlanta rd (FO) Whitt Bedford L (Odell M) 1 carp Bell Aircraft Corp h 212 S Waddell Whitaker Sally r 827 Church Whitaker Seff D (Anna) eng h 827 Church Whitehead Ruth S prin Waterman Street Sch r 386 Atlanta Whitemore Myrtle S r 406 Whitlock av Whitten Eliz F looper Holeproof Hosiery Co r 403 N Waddell Whitten J Edw (Ollie B) 2 ydmn h 513 Lawrence Whitten Jas E Jr USA r 513 Lawrence Whitfield Geo R (Effie S) 1 emp The McNeel Marble Co h 203 Lemon Whitfield Henry (Ola S) h Burnap RD 1 Whitfield Leon student, r 203 Lemon Whitfield Wm R emp Bell Aircraft Corp r 306 Cherokee Whitlock Adrian C (Lanna P) inspr Bell Aircraft Corp r 315 Washing ton av Whitlock Benj L (Ollie S) mach Holeproof Hosiery Co r 205 Campbell Hill Whitlock Benj L Jr USA r 205 Campbell Hill Whitlock Betty J elk Cobb Exchange Bk r 205 Campbell Hill Whitlock Nannie C (wid M N) 1 emp Bell Aircraft Corp B-2 r 403 Whit- lock av Whitlock Raymond H ofc wkr Holeproof Hosiery Co r 205 Campbell Hill Whitman M Donalee usher Strand Theatre r 513 Lawrence Whitman Mansel O (Ruth P) 1 emp Bell Aircraft Corp h 404 Park View av Whitmore Jas G (Cath B) 6 emp Bell Aircraft Corp h Osborne (FO) Whitney Harry (Marie) plant formn S B T & T Co 316 Park View dr Whitworth Amalee S (wid W H) emp Bell Aircraft Corp h 304 S Al- exander Whitworth J Kath typist Bell Aircraft Corp r 304 S Alexander Whitworth Wm R emp Bell Aircraft Corp r 304 S Alexander Whorten Geo W (Gertrude K) gro & meats 102 Cherokee h 206 Forest av Whorton Gertrude (Mrs Geo W) teller First Natl Bk r 206 Forest av Wicker Eliz County Home Demonstration Agt r 113 Forest av Wickham Vernon T (Bertie S) 1 USN r 109 Hedges Apt 1 Wigley Jas W (Ella E) h Rose la (Eliz) Wigginton Louise P (wid D S) h Jordan RD 1 Wiggenton Ida T (Mrs Lewis F) riveter Bell Aircraft Corp r Marble Mill (Eliz) Wiggenton Lewis F (Ida T) mach Bell Aircraft Corp h Marble Mill (Eliz) Wigley Effie riveter Bell Aircraft Corp r 304 Kennesaw av Wilbanks Laura r 615 Atlanta Wilber Fred Service Station (Fred Wilber) Atlanta rd Wilber R Lee (Viola W) 2 mach h Lakewood av RD 5 Wilbur Dooley A (Maggie K) pntr h 607 Cherokee Wilbur Fred (Delilah M) (Fred Wilbur Service Sta) r4205 Glover 320 BALDWIN'S 19R Wilbur Herbert (Ruby R) USA r Hill RD 5 Wilbur Howard P (Jimmy M) 5 electn Bell Aircraft Corp h Atlanta rd Wilbur Jas E (Juel C) uphol 205 Glover h same ' Wilbur Millie P (Mrs T Elbert) emp Marietta Hosiery Co r Hill RD 5 Wilbur Ruby R (Mrs Herbert) looper Holeproof Hosiery Co r Hill RD 5 Wilbur T Elbert (Millie P) 1 h Hill RD 5 Wilde Sarepta (wid J W) r 207 Camp Wilder Edw A (Elsie B) 1 elk r 319 Lawrence Wilder Edw A (Elsie B) 1 mgr-job analyst U S Employment Service War Manpower Comn h 319 Lawrence Apt 2 Wilder Elsie B (Mrs Edw A) ofc wkr Bell Aircraft Corp r 319 Lawrence Apt 2 Wilder Jas W (Inez M) 2 emp Bell Aircraft Corp r 310 S Alexander Wiley Geo T (Clara J) 1 opr D B Thornton Co h 108 Gober Wiley Herbert C (Gussie C) 2 emp Bell Aircraft Corp h 700 6th Apt 4 WILKINS CLYDE (Hilda) Genl Mgr Holeproof Hosiery Co, r Atlanta, Ga. Wilkins Edwin S (Levia E) 1 miller Monto Shaw & Son h 106 E Dobbs Wilkins Jessie h 303 Montgomery Wilkins Levia E (Mrs Edwin S) pairer Holeproof Hosiery Co r 106 E Dobbs Wilks Dorothy Mrs 1 emp Bell Aircraft Corp r Rose la (Eliz) Wilkson Buck student r 400 Maple av Wilkson Ethyl mender Holeproof Hosiery Co r 400 Maple av Wilkson Roy mech Bell Aircraft Corp r 400 Maple av Willauer A Osborne (Alice H) 2 emp Bell Aircraft Corp h 712 Page Williams Alberta 2 cook Dixie Cafe r 213 Rigsby Williams Arth h 119 Barnes Williams Arth jan YWCA r 320 W Goss Williams C Buford (Esther S) 1 emp Bell Aircraft Corp h 612 2d Apt 3 Williams Carl L (Ruth W) 2 inspr Bell Aircraft Corp h 805 4th Apt 3 Williams Chas P (Clyde M) mgr Piggly Wiggly Store h 708 Church Williams Cliff cook h 223 Johnson William Clyde E guard Bell Aircraft Corp r 233 Atlanta Apt 4 Williams Clyde M (Mrs E P) elk Ga Power Co r 708 Church WILLIAMS COACH LINES, H B Allen agt, 118 Atlanta Williams Cogan (Odene) 1 lab W H Stephens Lbr Co r 110 Shepard Williams Danl (Lucinda) emp Brumby Chair Co h 216 Greer av Williams Dorothy E (wid T F) r 403 Wright WILLIAMS DRUG CO (Earl D Williams) Drugs, School Supplies, Pre- scriptions, Drug Sundries, Kodak Films and Supplies, Candies, Cosmetics, and Parker Fountain Pens, 39 W Park Square--Tels 49 and 50 (See front supplement cover and Buyers' Guide) Williams Durward Mrs emp Bell Aircraft Corp r 608 Church t f ELLIAMS EARL DR W (Willie M) 2 (Williams Drug Co) h 116 Hillside av--Tel 367 MARIETTA CITY DIRECTORY 321 Williams Eldridge H (Jerusha P) (Williams Coach Line) r 634 Atlanta Williams Ethel A (wid John K) h 115 Brown Williams Flossie B emp Bell Aircraft Corp r 103 3d ct Apt 3 Williams Georgia Mae cook 208 Montgomery Williams Gertrude 3 maid h 404 Montgomery Williams Gladys maid 507 Whitlock Apt 13 r 107 Fort Williams H Y (Eliz P) inspr Bell Aircraft Corp h 612 Church Apt 1 Williams Henry lab r 120 Henderson Williams Henry L (Mae 0)3 supt Holeproof Hosiery Co h 201 Maple av Williams Henry L Jr student r 201 Maple av Williams Ida lndrs r 506 W Goss Williams Ida P 1 lndrs r 210 Maple Williams Jas porter Hodges Drug Co r 806 N Cole Williams Jas E (Pauline R) 1 r 905 Cherokee Williams Jas E (Mary S) 1 emp Bell Aircraft Corp h 707 3d Apt 5 Williams Janie r 403 Cole Williams Jessie cook 201 McCord r 806 N Cole Williams Jewel S (Mrs Richd H) ofc wkr Bell Aircraft Corp r 307 Powder Springs Williams Joel B (Martha B) USN r 634 Atlanta Williams Joel S (Opal P) 1 emp Western Union Teleg Co h 201 E Dobbs Williams John (Clara F) 1 porter Sears Roebuck & Co r 121 Lawrence Williams John H (Gladys) 3 hlpr Brumby Recreation Center h 107 Fort Apt 1 Williams John K III (Virginia W) 1 USA r 115 Brown Williams John R (Ada L) County Coroner h 201 Geo Hamilton ct Apt 2 Williams John W USA r 210 Maple Williams Lena B Mrs nurse 205 Waddell pi Apt 1 r Hill RD 5 Williams Lettie maid r 227 Montgomery Williams Lettie R US WAC r 507 Lemon Apt 3 Williams Lillie M maid 712 Church h 503 Lemon Apt 1 Williams Lula lndrs r 115 Page Williams Marvin D h 607 Alexander cir Apt A Williams Mattie A (wid W E) h 634 Atlanta Williams Mary cook 200 Seminole dr Hunt Williams Mary lndrs h 115 Page Williams Mary emp Nu-Way Clnrs & Lndry r 135 Mulberry Williams Mary D Mrs 1 interviewer U S Employment Service War Man- power Comn h 301 Mills Williams Maybelle G (wdd G B) h 303 Husk Williams Mose (Della) lab Brumby Chair Co h 222 Montgomery William Odene maid r 110 Shepard Williams Opal (Mrs Joe) opr S B T & T Co r 201 Dobbs Williams Oscar h 213 Johnson Williams Pearl M (Mrs Sami W) looper Holeproof Hosiery Co r 219 Rose la 322 BALDWIN'S 1944 Williams Percy r 409 Cole Williams Ray S Jr student r 301 Mill W illiams Richd H (Jewel S) emp Atlantic Steel Co r 307 Powder Springs Williams Robt r 210 Montgomery Williams Robt P guard Bell Aircraft Corp r 104 Gramling Williams Rosalee (wid J Z) r 208 Locust Williams Rose 1 cook h Canton rd (Eliz) Williams Rosella r 320 Lemon Williams Rowan A USA r 115 Brown Williams Ruth cook h 209 Johnson Williams Sami W (Pearl M) fixer Holeproof Hosiery Co h 219 Rose la Williams Thos (Loudella) 7 firemn Brumby Chair Co h 206 N Cole Williams Thos porter Hodges Drug Co r 806 N Cole Williams Wm ydmn r 115 Page Williams Wm S emp Bell Aircraft Corp r 707 3d Apt 5 Williams Willie M 1 cook r Tower rd (Eliz) Williamson Doris cook 601 Polk r 307 Montgomery Williamson Jas C (Gladys) 1 emp Ga Power Co h 604 Alexander cir Willingham Campbell W USA r 1202 Church Willingham Chas B USA r 1202 Church Willingham Eliz W (wid H S) h 846 Church Willingham Harold S USN r 1202 Church Willingham Robt T (Anne C) 2 (Willingham-Little Stone Co) h 810 Whitlock av Willingham Robt T Jr USA r 810 Whitlock av Willis Addie cook h 123 Holiday Willis Arth (Addie W) USA r 122 Holiday Willis Cuma (wid Lewis) 2 h 1215 Whitlock av Willis Jas (Lillian A) jan Bell Aircraft Corp h 307 Cole Willis Lee W (Corine T) 2 lab r 120 Black Willis Lewis Jr elk Ry Mail Service r 1215 Whitlock av Willis Lillian maid 305 Polk r 307 Cole Willis Margt T sch tchr r 1215 Whitlock av Willis Mose (Josie) checker Brumby Chair Co h 226 Montgomery Willis Sarah L expediter Bell Aircraft Corp r 1215 Whitlock av Willis Stephen N USA r 1215 Whitlock av Willis Wm J guard Bell Aircraft Corp r 100 Gramling Wills C W emp Bell Aircraft Corp r Austell rd (FO) Wills F Theo (Ida) supt County Board of Education r Smyrna Ga Wills Mary (Mrs Z T) tchr Robt L Osborne Sch r Smyrna Ga Wilmoth Cuba looper Holeproof Hosiery Co r 108 North av (Eliz) Wilmoth L E (Cuba K) 3 wtchmn h 108 North av (Eliz) Wilson Carter E (Hope C) 3 tmkpr Bell Aircraft Corp h 409 Frasier Apt A Wilson Clyde V (Geneva D) 1 USA h 707 N Cole Wilson Dorothy P student r 101 Maxwell marietta city directory isi ~~ - Wilson E A USN r 109 Gober Wilson E G Jr mgr Paul E Thomas Service Sta r Atlanta rd Wilson E S (Zula B) h 109 Gober Wilson Elbert G (Kate K) emp Ga Power Co h 665 Page Wilson Elbert G Jr r 665 Page Wilson Eliz B (Mrs Jack) ofc sec Kennesaw Mountain Natl Battlefield Pk r 813 Church Wilson Florrie r 336 Atlanta Wilson Francis A (Callie T) h Atlanta rd (FO) WILSON FRED B Pres Victory Homes of Marietta Inc r Duluth Ga WILSON F S (Martha W) (Wilson & Henderson Construction Co) V-Pres Victory Homes of Marietta Inc h 1611 Hillside dr--Tel 883-R Wilson G E (Irene D) 4 firemn Bell Aircraft Corp r 109 Gober Wilson Harold USA r 908 Church WILSON HERMAN P (Lucile) Mgr American Laundry and Dry Clean- ers, h 101 Maxwell av--Tel 764-J Wilson Homer C emp Bell Aircraft Corp r 215 Holland Wilson Imogene emp Bell Aircraft Corp r 665 Page Wilson J Patterson (Mae B) 5 carp h 215 Holland Wilson Jack (Eliz B) USA r 813' Church Wilson Jack (Marian) emp Bell Aircraft Corp r 107 Gramling Wilson Jas I plmbr City Board of Light & Water Wks h 203 Mont- gomery Wilson Jean (Mrs Leonard S) sten r 500 Haynes Wilson Jos D (Annie C) jewlr 201 Mill r RD 2 Wilson Jos E (Maud S) slsmn Nu-Way Clnrs & Lndry h 901 Roswell Wilson Josephine tchr Lemon Street Sch r 701 Lawrence Wilson Julian A (Nancy W) 2 USA h 118 Forest av Wilson Kath L student r 101 Maxwell Wilson Leon L (Beatrice R) mach Bell Aircraft Corp h 225 E Dixie av Wilson Leonard S (Jean) emp Bell Aircraft Corp r 500 Haynes Wilson Mae Indrs r 133 Mulberry Wilson Mansfield (Sara D) waitress r Atlanta rd (FO) Wilson Marion E Rev (Bessie A) 2 h Rose la (Eliz) Wilson Mattie r 336 Atlanta Wilson Minnie waitress Dixie Cafe r Kennesaw Ga Wilson Nannie A (Mrs Walter B) opr S B T & T Co r 202 Stewart av Wilson Nellie r 300 Reynolds Wilson Parker emp Bell Aircraft Corp r 408 Victory dr Wilson Ray (Louise C) 2 mach Glover Mach Wks r 211 Glover Wilson Robt A (Nina G) r Marr (Eliz) Wilson Ruby opr S B T & T Co r 215 Holland Wilson Sami U (Mary P) 1 formn Bell Aircraft Corp h 607 Morningside drive Wilson Thos E USA r 215 Holland 324 BALDWIN'S 1M4 Wilson Verlin E USA r 215 Holland Wilson Walter B (Nannie A) 1 emp Marietta Coca-Cola Btlg Co Inc h 202 Stewart av Wilson Wm C (Hettie T) 1 firemn City Fir Dept h 107 Gober Wimberly Thos emp Bell Aircraft Corp r 410 Reynolds Wimberly Wm emp Bell Aircraft Corp r 410 Reynolds Wimby Cora D hsekpr h 129 Henderson Wimby John (Cora D) r 12.9 Henderson Wimby Retta r 129 Henderson Wimpy Carrie cook Dixie Cafe h 102 Elk Wimpy Jas E (Lillie R) emp Bell Aircraft Corp h 108 Kings ct Apt A Wims John (Gladys) 1 emp Bell Aircraft Corp h 101 3d ct Apt 1 Winfrey Howard D 1 r 204 Montgomery Winfrey Willie 2 cook 900 Cherokee h 204 Montgomery Wing Gertrude (wid Richd) h 504 Cherokee Wing Pheriby M (Mrs W J) ofc wkr Bell Aircraft Corp r 504 Cherokee Wing Stephen M bkpr r 504 Cherokee Wing Wm J (Pheriby M) elk Bell Aircraft Corp r 504 Cherokee Wingo Brownie (Mrs J S) nurse Bell Aircraft Corp r 211 Victory dr Mingo Jos S (Brownie) 1 emp Bell Aircraft Corp h 211 Victory dr Wmkley Arnoldena maid r 211 Montgomery Winkley Osborne (Katie) 1 lab Bell Aircraft Corp h 211 Montgomery Wmkley Savannah h 401 Cole Montgomery Winkles Verna B h 619 Cherokee Winters Clarence J (Lora M) 5 mach opr h Cogburn av (Eliz) Wisdom Woodrow W (Willeen B) ofc wkr Bell Aircraft Corp h 704 E Wa terman Apt A Wise Addie C cook h 306 Montgomery Wise Annette student r 306 Montgomery Wise Flay (Edna M) 2 lab r 121 Fort Wisener C J (Ethel M) h Rose la (Eliz) Wisner Eug dispr Safety Cab Inc r Rose la (Eliz) JIar^K welder BeI1 Aircraft Corp h 125 S Alexander Geo F (Gladys H) 1 elk Bell Aircraft Corp h 103 3d ct Ant 4 WOFFORD OIL CO, Roy McCleskey Agent, Wholesale OH fnd Lubrilt %n enattfs SF'uel OH, Kero0slelsnea, nWd oCcor-ePaespes,GTasiorelisn,eBaantdterTiieosl,enCeleManoitnogr OSoills- w i-c kur
Mrs --736-M Jones Hoke S Knight W Luther --480-J Martin John M @ Mclnnes John D Mitchell Emma D Powder Augustus D Power Mamie E Mrs Rogers J Emory Simpson J B Shore Sidney E @ Warwick Barron --480-M Wheeler Rogers A--1275-R Wilson Francis A AUSTELL RD (Fair Oaks) -- West from Atlanta rd Anglin Irene Mrs Bray J T Brookshire Horace F Burt H M--1569-M Camp Albert R Cassidy I V-^655-J Cassidy Martha F Mrs Davis Chas C --614-M Dunstan Albert E Earwood Ennis S --1585-R Eaton Wm O Jr --232-W Fair Oaks Dairy--179-J Gantt Carl E --232-R Garrison W Ewell --655-W Graham E C Guinn Frank A FOREST 6. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 u>. STEPHENS LUMBER CO. PHONE 840 marietta city directory 341 FUNERAL MAYES WARD & CO. DIRECTORS PRORE 549 BRUMBY E. PARK SQUARE PHONE 198 f *!C! om!ple!te Ho me Furnishers In Marietta Since 1916" Austell ltd--(Contd) Haskin Aaron G @--655-XM Howard Grady Johnson Hubert R--179-W King Pearl C Knox Thos F Long Geo Lowe Orlando Lynch Martin L --1585-J Mabry H Norris --655-R Maloney Springs Primitive Baptist Ch Nash Claude H Olive Springs Baptist Ch Pearson Silas L Phillips Walter A @--972-M Poteete D Lake Reed Chester L --232-J Reed Ishire I (h) Redd Wm A. --614-J Seller Wade H Smith Reta L Stewart Frank L Teem Wm M Daniell W Z Grocery--724-W Walker John L White J Edw 179-J York Vesta M--517-J AUSTIN AV--North from 1311 Roswell, 1st east of Moore 109 Blackwell Morris J 112 King Danl C 114 Church of God The Washington av intersects 202 Rogers Geo H 206 Ellison Jas M 210 Wright Theo 211 Millwood Benj J 212 Austin Av Baptist Ch 213 Boyd Jas E Lawrence intersects 301 Chalker Amos R Rev @--102-J 302 Holcomb Barrel--1122-J 304 Lecroy Glenn P 305 Dobbins Willie G @^120-J 307 Russell Allen B 308 Ingram Fredk 309 Flynn Mary B--1281-R 311 McCollum Robt L 322 Burton Luther P 326 Glennwater J Richd --1026 328 Vacant 330 Bishop Claude G AVIATION RD--South from 608 Eoswell, to Clay 202 Sutton Remar M 204 Harmon John W 205 Morgan Amos J 206 Miller Wm A 207 Harrelson J Roy 208 Gillian L Edw 209 Burrett Chas H 210 Johnson Robt L 211 Vacant PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 342 BALDWIN'S 19M ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW THE? HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY T.TKF, KENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 ). J. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. Aviation Rd--(Contel) 212 Mabry C W 213 Wood John D--950-J 214 Vacant 302 Vacant 304 Sommers J L 306 Vacant 307 Home Geo W 308 Stevens Geo W--950-W 309 Alb'ee Richd L--950-XM 311 Lowman Dale D 312 Vacant 314 Gray W Ross 315 Myler Thos J 316 Colvir Henry M 317 Gary Claude W--895-J 318 Wolf Gordon C 319 Smith Robt R--558-XM 322 Vacant 323 Burch Nathan H--895-W 324 Fremming Geo J 325 Sando John F 326 Lee Wm G--257-R 327 Downen David El--257-XM 328 McAllister D Vernon 329 Zimmerman Jack J--257-M 330 McKenzie Jas H 331 Hildreth Harold D 401 Powell Conway 402 Green Sami Jr--1562-R 403 Martin John W 404 Gonia Isaac B--H562-J 405 Salmon Harry 406 Patterson Chas F 408 Fricks John H 409 Howard Glen O 411 Vacant 412 Crawford Pauline Mrs 413 Vacant 414 Schuster Ernest E 415 Mabry Eric W 416 Vacant 418 Dembik Danl D 420 Harris Linton I 422 Vacant 424 Battles Harold L * AWTRY--North from Maple av, 1st west of Locust 102 Nelson Chas B --676-J 203 Hardy Wm C --676-W 207 Patterson Hugh T--1151-W AYRES AV--North from 1407 Roswell, 1st east of Austin av 106 Boyd Sami D 108 Henderson Ott T Washington av intersects 214 Wallace Oscar K --1283-W Lawrence intersects 308 Vacant 320 Pickens G Forest PHONE 69 OLDEST -- LARGEST -- BEST j NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. S. J. LINDSEY Owner w. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA city directory 343 \ MAYES WARD & CO Ax^r PHONE 549 A. 9. LITTLE- AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. BARBER BD (Fair Oaks) -- West from intersection of Atlanta rd and Concord rd Camp Paul R Crider Arry R Daniel M Edmond Darnel H Holbert Gossett Farris M Hart Chas M Jr Hardage Henry A Head Addie M Knox Lillian R Knox Wm H Knox W Henry --563-R Lester Robt L --563-J Maner Clem V Martin Luther J McCollum John W -- 973-M Moon Eula M Moon Tallulah P Pence Ira @ Seay Allen B Shaw S'aml D Teague J M Westbrook Esther Mrs Westbrook Sam BARNES--North from 1107 Roswell, 1st east of Black 107 Vacant 109 Vacant 117 Eason Henry 119 Williams Arth 121 Vacant BEAVER--South from 606 Roswell, 1st east of Lakewood av No houses BEAVER AV--North from Roswell, 1st bey city limits Cabe Robt M Ledford Jas E Lutz Jas M Medley Edna G McClarty Ernest M Sanges Frank C Wooten Ruth Mrs BELLS FERRY RD (Eliz) -- East from Church (Eliz) Chambers Pearson Clackum Richd C Harris Aslee Mrs McCarty Jas E McClure G Earl Medford Wm, G Richards W D Roosevelt Clifford--1095-M2 Vickers W L --1095-M4 Watkins Ernest Woody Wm P --1095-M2 BELLVUE RD--South from South Park dr, 1st east of Victory dr 508 Invest At Least 10% In War Bonds W. P. STEPHENS LUMBER CO. PHONE 840 344 BALDWIN'S 1941 ICE - Cm - PHONE 1 SOUTHLAND ICE CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES . ... J ,, SCHOOL SUPPLIES a 4 Atlanta St. ______________ Phone 1083 Bellvue Rd--(Contd) 1 Vacant 2 Vacant 509 1 Vacant 2 Vacant 511 1 West Raymond Q 2 Vacant 513 1 Vacant 2 Vacant 517 1 Vacant 2 Vacant 518 1 Vacant 2 Slaugher Geo R 519 1 Vacant 2 Vacant 520 1 Vacant 2 Vacant 522 1 Vacant 2 Vacant 526 1 Vacant 2 Vacant BINGHAM (Fair Oaks)--West from Atlanta rd, 1st south of Austell rd Deal C Boyd @ Elrod Walter Hames Albert H Hamcs E Hebert Hawkins J Eug Jarris Thos Morris Henry C Reed John L Whunt Clarence A --S47-R BIRNEY--East from Allgopd, 1st north of Page 603 1 Hoffman Earl 2 Bollerud John B 604 1 Joop Rudolph F 2 Carmichael Donald E 605 1 McCIurd Lucille 2 Nelenson David 606 1 Thompson Lawrence H 2 Vacant 607 1 Vacant 2 Curtis Richd T 608 1 Vacant 2 Malphrus Jessie E 610 "Serving Cobb County Since 1900" Westinghouse || fl*8 PRF Stoves and Appliances and Radios " ram tin R Wholesale and Retail Kanges p,h^oG ncR7^ 00ERIES^ FEEDS, FERTILIZERS, "Pharis Tires" FARM SUPPLIES Phone 701 % P. STEPHENS LUMBER CO. PHONE 84 Marietta city directory 345 --~ ~ MAYES WARD & CO. Sew PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Birney--(Contd) 1 Pierce Raymond D 2 Peacock Frank R 612 1 Buttram J T 2 Burger Chas E 614 1 Vacant 2 Medlen Frank J 616 1 Childers Delbert O 2 Barnes Retta Mrs 618 1 Vacant 2 Poretsky Sidney 619 Mann Marvin E 2 Lyons Robt H 620 1 Wright Fred D 2 Vacant 621 1 Tanner Essie Mrs 2 Robbins Jas 622 1 Jonas Ira C 2 Vacant 623 1 Davidson Ernest 2 Vacant BLACK--North from 1045 Roswell, 1st east of Covington 108 McClung Andrew Telephone 1098 110 Cooper's Gro Cooper Lonnie S--1283-R 112 Boyd Nannie 116 Martin Cassie 118 Tiggs Virgil 120 Vacant 200 Fuster Edgar 202 Brewer Lilia R @ 206 Elliott John 210 Booker Jas C BOWERS (Eliz) -- West from 824 Rosa la (See Burnap) BROOKS CIR--West from Victory dr, 1st south from Hillside dr 411 1 Vacant 2 Holland John I 413 1 Smith Wm H 2 Bursom C B 415 1 Richards Wm D 2 N'eal Rufus K 417 1 Ried Edw J 2 Irvin J T 421 1 Bourn Jas L 2 Keahey Thos E 423 REFRIGERATION EXCHANGE 337-245 Pryor St., S. W7., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets I. P. STEPHENS UMBER CO. PHONE 849 346 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, IRC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive Phone 1166 Brooks--(Contd) 1 Vacant 425 1 Davis Elbert W 2 Starr John P 427 1 Abbott Ulyess B 2 Roberts John H BROOKS--North from 809 Lawrence, 1st east of Shepard 112 Wright Fredk @ BROWN AV--North from Whitlock av, 1st west of Clebourne 108 Perry Oliver P--913-j 115 Williams Ethel A Mrs @--613 brumby--West from 619 Church to Campbell Hill, 1st north of Kennesaw av 209 Vacant 213 Vacant 219 Martin J Walter 226 Garner J Sam--166-W BURNAP (RD 1)--West from Rose la at city limit, 1st north of Lacy, formerly called Bowers (Eliz) Carney Raymond F Fraser Benj H Freeman John Goss Andrew McClanahan Wm L McWhirter Roy Nelson Wm C Whitfield Henry @ BUTLER -- Southeast from 106 E Dixie av, 1st w est of I)elk 109 Mitchell Furniture Mfg Co Mitchell Chas F 114 Hunt Buren G --625 115 Stiles Harley S 117 Mitchell Carl F -30-R 119 Georgia Coa] Co 124(a) Alley Irvin E (b) Vacant 127 Standard Oil Co of Kentucky 128(a) Bankston Parker J (b) Stewart Holland W 129-33 Gulf Oil Corp 135 Bronson Concrete Products Co --807 Hawkins begins 200 Benson Roy P --30-j 301 Clay Weyman E --30-W 1 Sinclair Refining Co Glover Mach Wks--14 CAMP--North from Maple av, at intersection of Holland 104 Stewart C Edw--943-J 202 Gilham Pearl A @--1033-J 204 Nix Louis L. --1527-J 206 Flym Ada P Mrs SONE F EL D PHONE 1#1* FURNITURE COMPANY 1010 Fmd Your Furniture At Fields''--Ita the Hotel Field Building w. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory mi ~ -- MAYES WARD & CO AMBULANCE n|lfl||C SERVICE rnUIVE HOME OWNED HOME OPERATED PHONE so 11-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- J0TMEY Camp--(Contd) 207 Smith Kenneth E --372-J CAMPBELL HILL -- North from 228 Brumby to bey city limit 100 Brackett J Newel 103 Taylor C Lyman 107 Brackett E V 109 Cottrell Steve C 111 Brown J Homer 113 Brown Walter A 115 Ward Luther Sessions intersects 202 Vacant 203 Hill John C --389-M 204 Bratcher Wm M--988-W 205 Parks W Gloover 206 Miller Theo C --389-W 208 Hayes Edgar M @--889-J 209 Miles Martin L 210 Crowe Jas L--559-J 211 Holbrook Agnes 212 McCoy L Herbert @--559-W 213 Smallwood Raymond 214 Spence Sallie E Mrs 215 McPherson Jas M 216 Rainey Luther J 217 Martin Jas L --988-J 218 Vacant 219 Brooks Mollie R Mrs 220 Jay Emmett J 222 Jay Theo D 224 Morgan Ernest N 226 Ray Eula E 228 McRea Cora Mrs 230 Kuynedall Wm H --293-M 232 Bowman W C 234 Carney J W --293-R Radium intersects * * * Hillside av ends 308 Shipp A L --662-R 312 Burgess Romie L --946 314 McCamy Roy L --270-W 319 Suhr Robb C --810 Lacy ends 322 Nolen. Clara C Mrs 400 Baird Floycl E @--382 401 1 Landers Newton M--206-J 2 Huffman Hill R--727-W 3 Auer D K--206-W 4 Howell Georgia D Mrs -- 592-W 408 Carpender J Loy @--550 411 Bennett W L Bell John H --1124-J 500 Fowler J M Jr @--718 501 Annandale Eug W --963 504 Strang Albert R --599 505 Dobson J C--408-XJ 506 Latimer Pierce B --408-XW 507 Vacant 511 Vacant Lewis Park W. P. STEPHENS LUMBER CCL PHONE 840 348 BALDWIN'S 1944 ICE -C@ftL- PHONE 1 SOUTHLAND ICE CO. Packing Crating -- Storage -- Local & Long Distance Hauling PHONES: church 13 lemon 261 MARIETTA TRANSFER & SALVAGE CO. CASH FOR ALL SALVAGE PAPER, CLOTH, ETC. CAMPBELL HILL (Eliz)--A continuation of Campbell Hill bey city limit Chapman J Harry @ Frasure J H--61-J Tucker Homer T @ CANTON RD (Eliz) -- East from Church extd to Cherokee rd Codding John S Dennis Jas Elizabeth School Farmer Millard A @ Frey Marvin @ Hudson Benj Lindsey Guy Matlock O E @--132-M Rich Jas T Seal John Rev Tumlin Sigman --478-M Williams Rose CARNES--West from Hazel to Durham No houses CARNES RD (RD 4)--North from 1st west of Lind- CEMETERY -- West from W Atlanta, 1st north of Hedges No houses CHEROKEE -- North from North Park Square, 1st east of Church 100 Cobb County Fed Sav & Loan Assn--83 Worley Thurston L ins agt--83 100 % Life Insurance Co of Virginia The 102 Whorton Geo W--157 104 Cherokee Street Lunch Marler Wm D O K Candy Co 106 Marietta Bargain Hse shoes 108 Eason Shoe Shop 110 Marietta Pottery Sales 112 Model Cafe 114 Garner Appliance Co 116-18 Nu Way Clnrs & Lndrv-- 1150 Marietta Radio Co--400 117 Model Dry Cleaners--150 Hansell intersects 200 Safety Cab Inc--39 201 Big Star Food Stores--080 202 Vacant 203 Dunn Feed & Gro Co--282 206-10 Marietta Hospital--303 Fowler A Hubert phys--217 Fowler Ralph H phys--246 Hagood Geo F phys--181 SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 349 MAYES WARD & CO. DIRECTORS1" PHONE 549 Cherokee-- (Contd) Hagood Murl M phys--181 Perkinson W Howell phys--23 Welch Leonard L phys--27 Reece James A electrical appli- 211aRnceee--ce9's15B8 a0 rber Shop--9158 213 Orr Clara R Mrs --693-M 215 Chase Rita 218 Barrett Danl W --988-M Dabbs intersects 300 Galt Lou Mrs 301 Power Carence E --37-J 302 Wyatt Jos F 304 1 Upshaw Marjorie'--37-W 2 Dobbins Albert M Jr 3 Lanier Jas F 4 Birt Aleese--953-R 5 Hill Gordon 305 Waldrop Jas F 306 Dobbins Albert M Funeral Ser- vice Home--437 Dobbins Albert M --437 309 Hardage Service Sta--750 322 Jay Theo D Lemon intersects 400 Cherokee Certified Service Sta --777 Channel's Radiator Shop 401 Cogburn E J --h672-J 402 Fitto Luke W 403 Underwood W L--672-W 404 Edwards Ella --915 405 Mitchell May--216-R 405% Goodwin Harold M 409 Hill Hugh A--1113-J 411 Allen Claborne--1113-W Ardis ends * * * Forrest av begins 502 Ray J Vernon 503 Hemp Stanley S --846-J 504 Wink Gertrude ---675 507 1 Crosby Virginia V--10-W 2 Mooar Louise 3 White Chas B--629-J 508 West H G --160-W 509 Scoggins Fredk--909-R 510 Ross J Frank 515 Temple Mark Gober begins 600 Reece M Hal --1092 601 Taylor Davis--172-J 602 Beavers Wiley G 603 Newsome Jas A 604 McEntyre Claude M --475 605 Evans Harold R 607 Wilbur Dooley A--172-W 608 Duke Errol W 609 Roberts Ceal 610 Brown Dasbury 611 Martin Don R 612 Ridings Geo C --236-J 613 Najjar Kilil _971-W Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 350 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. J^~fied lecc Distributor -- GULF OIL COUP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St. Cherokee-- (Contd) 614 Henry A John 615 Grizzle J Leon--172-R 616 Fricks Hoyt 617 Burgess Chas 618 Adams Wm H 619 Barrett Linton--172-M Winkles Verna B--172-M 619% Napier Lester L 620 Vacant 621 Mulkey Visie W --i531-J 622 Scoggins Grocery 624 Sanders Cafe Sanders Effie Page begins * # * Brumby begins _701_Vacant _703_MuIkey Jas E, 704 Autenrieth Hoy W Burgamy Lucy 705 Chalker Lula Mrs Johnson begins 801 Cain Homer W--454-J 803 Dobbins Louise G --769-W 804 Dupre Harry N --369 806 Bogle C K --1044 807 Kay Paul C --330-W 809 Batman Carrol E--184-W Montgomery begins 900 Mayes Mark W --(36 903 Groves Gussie --184-J 905 Read Pauline @--330-J Sessions begins 1000 Brumby Marie M Mrs --215 1001 Jervey W C Jr --1058-R 1004 Anthy Shuler --954-J 1005 Allen Geo O --209 1008 Massey Jas E --401 1009 Tate Jennie Mrs --231 1015 Brumby Gretchen D --169 1019 Brumby Anne F Mrs --213 1020 Blair Leon M --686 1026 Hamilton Sherry M--531-W 1030 Roberts Mae B --853 1031 McNeel Ada --954-W Freyer dr begins * * * Seminole dr begins * * * Moor's al begins 1110 Fowler A Herbert --644 1214 Dobbins J Stanley --55 1216 Atherton L H --58 1300 Atherton Greenhouse--58 1312 Payne Walter F--1133 1314 Moor Henry C --320-J 1400 Payne Service Sta--9118 Lawson Bud 1408 Blackwell J T 1410 Hames John L 1416 Hames Chas P--317-J 1418 Martin Fannie K Mrs Barger Jos J WUTEH W. HAZEL T,1TMW DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 351 MAYES WARD & CO A1SERVICECE PHONE 549 Marietta's Most Complete Department Store SAUES "The Best - - for Less CHEROKEE RD (Eliz)--A continuation of Clierokee bey city limit Barker Leonard Brown John W--284-J Chandler Esther Cochran Hoyt J Gault Claude @--478-J Gault Tourist Homes & Dormitory 'Hill Mark N'eary Wm E @--1564 Runyan R A--284-W Stephens T Edw --772 CHERRY--East from 1112 Church to Cherokee 112 Harris Wm. L --31 CHICKASAW DR--North from Freyer dr to Moores av CHICKASAW DR--North from Freyer dr to Moor's av 100 Gantt Geo W--579-J 208 Mathews Ralph --288-N 300 Webb Allen --1043 CHICOPEE DR -- East from 1300 Cherokee, 1st north of Seminole dr 213 Moor Geo A --1054-J 314 Brown Jas E --734 501 (12) Sanges Morton J--442-W CHURCH--North from Park Square, 1st west of Cherokee 101-03 A&P Food Store gro--938 105 Benson & Ward gro--486 107 Griggs Martin A gro--103 109 Atlanta Gas Light Co--200 Gas Co The -- 201 113 Piggly Wiggly Super Mkt gro --768 114 Marietta Hosiery Co--848 117 Sunlite Bakery--719 119 Chester's Cafe restr--9110 123 Economy Ice Cream Co br Hansel begins 200 Field Hotel--9116 201 Connally Shoe Shop reprs 202 Field Furn Co--1010 203 Dunlop Tire & Rubber Corp- 220 205 Marietta Hatchery--556 206 Harris John T--1594-J 207 Birdsey Flour Mills br 209 Reeves Seed Store storage 211 Hunter's Barber Shop 213 Reeves Seed Store--99 215 Marietta Trans & Salvage Co-- 13-261 Mayes Repair Shop 216-18 McKinney Tire & Battery Service--327 217 Excelsior Lndry--161 219-21 McPherson Tire Shop--355 220 Gober W Mayes phys--84 "Be Sure -- With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. 352 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE C0T~ WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Church--(Contd) Dobbs intersects 300 First Baptist Ch--957 301 Hardage C B' Service Sta--97 305 Vacant 307-09 Harrison Beauty Parlor--482 312 Apartments: 1 Jackson Milo C--1183-R 2 Stark Sidney L 3 Vacant 4 Jones Wm B 5 Vacant 314 Clackum's Trans service sta 315 Stephens W P Lbr Co--840 Lemon begins 400 Clarke Library ^-- 401 St James Episcopal Ch--593 403 Vacant 404 1 Howard Wallace O 2 Leaptrott Helen B Mrs 406 1 Huff Chas P--1260-XW 2 Swalley Frank F--541-W 407 Apartments: 1 McCall W Coy 2 Chandler J Raymond 3 Fuller C Watson 4 Gardner Walter B 408 Ward Mayes & Co undtkrs--549 Ward Mayes 411 Horn House fum rms Horne Nathan J --59 Ardis begins 500 Apartments: 1 Chandler S Alvin--1103-W 2 Register Holt E--1103-J 3 Martz Wm S 4 Goodson Wallace E--11Q3-M 5 Newton Howard E 501 Cole Apartments apartments: 1 Harris Lula M Mrs--51 2 Cole Ida H Mrs 3 Dudley Gertrude Mrs--507-W 4 Dean Wm H--442-R 5 Turner Sallie Mrs--1103-R 6 Spencer Susan E Mrs 7 Nelson Gus M 8 Maner J Howard--1260-J 9 Brown Rob't M 10 Cowan Otis A 11 Sessions Jessie G 12 Sanges Morton J--442-W 503 First Presbyterian Church 504 Colonial Apartments apartments: 1 Harling Lutie A Mrs--1260-R 2 Griffin Robt B--985 3 Abbott Wm J 4 Abbott Julia M Mrs--699-R 506 Turner Leila L Mrs --699-W 507 Ward Henry A @--637 510 Cortelyou Adrian V --580 511 Galley Nannie M Mrs --690 514 Baxter Eliz R Mrs--281 A GENUINE FLINTKOTE ROOF IS A SMART INVESTMENT MARIETTA LUMBER CO. LUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD MARIETTA city directory 353 MAYES WARD & CO. DmECTORSL PHONE 54S F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOYER ST. Church--(Contd) Patton John H Rev--511-J Kennesaw av begins 516 Field Bertha M Mrs --511-W 517 Stanford J Walter--711 602 Mozley Hiram E --221-W 606 Glasure Alton H Rev--852 607 St Joseph's Catholic Church 608 Means Clair A--584-J Norton Bertha M Mrs--293-W 612 Apartments: 1 Williams H Y 2 Riddle John T--1137-J 3 Fowler Jesse L --604-J 613 Benson Robt L --1583-J Black Linda M Mrs--424-W Pearson D Y Sexton Wiley H 614 Collins John --424-J 616 Lewis John W --623 617-A Collins Norman H--1078 617-b Sweet Fredk W 619 Carpenter Lillie R Mrs -- 366-J Koplin Henry L--425-R 620 Maddox A Leroy --643 Brumby begins 700 Shell Paul E --177-R 701 Bhrrett Robin M--882-J 702 Bushong Carroll V--677 703 Penn Victor H--882-W 704 Smithweck Tyre M--906 705 Vacant 706 Brooks Russell George W Elmer--604-M 708 Black Julia B Mrs Williams Chas P--366-W 709 Hawkins J Harold --661 710 Hagood Geo F --444 712 Hagood Geo F Jr --177-M 713 Morris Newton A 714 Hibble L W --949-R 716 Bailey Lucy --391 717 Welsh Lois --238 718 Page Robt W --66 Sessions begins 720 Weber Chas J --591-J 721 Northcutt Howard N Jr 800 Hyde Homer L---530-W 801 Moor Arth F --203-J Haymond Harry L 803 Butler Margt W Mrs --530-J 804 Allen Hubert B --386-M 806 Reece Loomis --916-W 808 Coleman Marvin H --471-J 809 White Home The furn rms White Isaac A Rev--1124-W 813 Gann Gordon B --100 rear McGuire Chester 815 McNeel Eug E --635 819 Perkinson W Howard --191 823 Northcutt Guy H --722 824 Dobbs C M --528 827 Whitaker Seff D --1245 - 832 Hall Wm R -- 829 835 Knott Geo E @--746-J HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga,, Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 354 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Saving's Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. Church-- (Contd) 836 Schilling- Harold O --56 839 Dunn Fred M --746-W 841 Northcutt Lizzie W Mrs -- 390 842 DuPre Harry N @--960 846 Willingham Eliz W Mrs -- 174 849 Kaplan Benj --849 Hillside av begins 900 Stephens Willis P @--552 904 Cowan Jas R--1175 908 Kennedy Clarence P --464 912 King Cleveland H--916-R Frances av begins 1000 Bryan Irving --628-R 1002 Watkins Wm W III @--147 1005 Clotfelter Max E --205-J 1007 McCleskey Roy --224 1011 Welch Leonard L --104 Margaret av begins 1105 Mitchell Thos H --628-W 1110 Gatlin Otie K Mrs --591-M 1202 Harrison H McCoy --132-R Church St Service Sta--148 Dobbs Ernest Elizabeth Methodist Ch Elizabeth Baptist Ch Embry Hallie J Fitts Miles W Fowler J Robt Jr --386-J Fowler John A --349-M Grant W W--1174-W Ivey Jane L --714-W Joe's Place Keheley J Edgar Lance Ebie T --589-J Mable Chas R Marr Marion C --349-R Marble Inn Service Sta Morris Geo W Murphy Ralph H Nichols A E Pearson Geo S--714-J Reece Mattie B Reynolds Welbom M --730 Richards Service Sta--132-J Runyan Chas P --576-M CHURCH (Eliz)---A continuation of Church bey city limits Baker J W Bettis Herschel J Bl-own J P gro--576-W Stevens Wm P Tilley Frank L Townsend Jos S Truelove Geo C gro Caldwell & Rauman gro--712 Underwood C C --714-M Caylor O Roy Chambers Barlow A @ Watkins J Robh Meinert MARIETTA PHONE 35 florist * GEORGIA 310 ROSWELL ST. f. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 355 Ring Leaders Since 1900" KERLEY--0. D Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 rom 648 Atlanta, 1st Frasier 111 Low Wm P Mills Alton Fields Francis P 120 Howard David R Garrison dr begins 200 Wallace W Hebert--425-M 201 Callahan John 203 Berry John E 631-J 204 Hicks Chas H--574-W 205 Reynolds S Fannie --631-W 208 McLemore Robt E 209 Vacant 210 Vacant 212 Cagle Sherman C--361-M 213 Bothwell Riggins 214 Henry Geo L 215 Rowell Henry A Rev 218 Vacant 21S King Walter C 219 Flanagin Geo W 220 Ebener Lewis E--574-J 222 Vacant 224 Vacant Sycamore begins 226 Boswell John C 302 Barfield Annie 309 Rackley Dewey 311 Higginbotham B S 312 Vacant 315 Rakestraw Elzie Manget intersects * * * South av ends 412 Stansel Luther B 422 Landers Earl D 507 Vacant 509 Vacant 515 Vacant 520 Vacant CLEBURNE -- North from Whitlock av, 1st west of Oakmont dr McCord ends 211 Reeser Paul D @--466 302 Johnson Wm P --753-W 304 Atchison Richd F @--753-M 306 Faudel Edw C --571-W Faudel Lbr Sales 308 Warnke Walter H --753-J 314 Robb Milton J --753-R CLEVELAND AV --- South from 112 Whitlock av to Powder Springs, along N C & St L R R tracks, formerly Railroad av 100 DuPre H N whse 105 Weems Andrew M piano repr 107 Peerless Furniture Co 109 Cobb County Coal Co--529 201 DuPre Cotton Gin 203 Georgia Power Co whse 205 Spears Frank Sales Stable 207 DuPre H N whse Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PRONE 840 356 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND `ICE CO. '`Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Cleveland av--(Contd) 209 Hooper Sallie H Mrs 210 N C & St L R R crossing sta 307 Terry John H CLEVELAND PL--North from Polk to Kennesaw av along N C & St L ft R tracks 101-07 Stephen W P Lbr Co (yard) 119 Vacant CLUB DR -- A continuation of W Dixie av 210 Vacant 222 Tumlin Wm L @--936 238 Casteel Oscar 298 Vacant 401 Parker Levi COCHRAN (FAIR OAKS) -- West from Joyner av, 1st south of Poplar Bagwell Wm W Burgess John A Cranfill Willie C Cochran Bennie A Johnson Jasper J Knox Jas I McCullers Jas F Richardson Mallie COGBURN RD (ELIZ)--Northeast from Tower rd, 3d west of Campbell Hill Lowe Eug Houston L R Hunnicutt demon Ingram Fred Ivey J Wm Palmer E Charlie Payne Van C Rich A Jackson Richards Vasco Ridings Henry D Smith Fred G COLE -- North from 413 Roswell, 1st east of Alexander 105 Vacant 107 Weaver Conrad C Washington av intersects 205 Vacant 206 James Jesse C 210 Dobbs Wm M Lawrence intersects 305 East Side Gro--1144 Mauldin Homer G 306 Stokes Lawyer V 307 Willis Jas 309 Scott Maggie 309% Wright Homer L 311 Loyal Ida 401 Winkley Savannah 403 Hemphill Louise Super Shell Gasoline--Golden Shell Penn Motor Oil Bulk Plant--Atlanta Road W. P. STEPHENS LUMBER CD. PME MARIETTA CITY DIRECTORY 357 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 54 BRUMBY E. PARK SQUARE PHONE 198 F0HH ComIpH leteH HoE me CO Furnishers In Marietta Since 1916" Cole--(Contd) 405 Barron Pauline --135-W 407 Bowden Robt 409 Canty Willie gro 411 Carter Oscar 413 Collins L>ula 415 Grogan Robt L 417 Cole Street Baptist Ch Forest av ends 600 Lawrence T Burt--538-J 604 1 Barnes Claude 2 Dobbs Edw 605 Newman John C 606 Bartlett T E 608 Henson Ralph. 610 Vacant 613 Vacant 614 Carder Alex C 615 Read Stanton J --732 619 Morrisette Leila C Mrs --255 COLE N--North from 405 Montgomery to Pine 705 Vacant 707 Wilson Clyde V 805 Vacant 806 Williams Thos 807 Tiedell Jessie 808 Minnefee Edw @ Mulberry intersects 901 Eppinger Addie 902 Spears Annie --1178-J 904 Minnefee John 906 McAfee Albert 908 Johnson Ina @ 909 Hunter Julius 910 Clark Mattie 911 Gresham Janie @ 912 Gibson Thos 913 Densmore Darnell 917 Kilgore Thos COLONIAL CIR -- East from Fairground, 1st southeast of Waterman 100 1 Divine L R 2 McCall Robt F 3 Bradford Harry E--509-M 4 Mays C V 102 1 Ragland Howard L 2 Kane Chas 3 Hagerman Jos R 4 Morris Fred W 104 1 Hagerman Louie H Jr 2 Sturgis Dudley C Jr 3 Webster W E 4 Reid C O 106 1 Johnson Ralph B 2 Bogner Howard D 3 Martz Willis A 4 Barr Jas H PEERLESS FURNITURE CO.. IRC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 358 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW Till! HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LTKF. RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 I. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. Colonial-- (Contd) 108 1 Clevenger Clarence 14-a Jenkins Guy F 1415- 2 Entwistle Jas W 15- 3 All John H 16- 4 Vacant 16- 110 17- 1 Mallary Nelson D 17- 2 Johnson Cecil F 18- 3 Molloy Jas W 18- 4 Wallace David W 19- 112 1 Armfield C Heath 2 Cooke Kath 3 Leone John 4 Atkins Clarence C 114 1 McFarland Clark W--812 2 Perry Gordon 19-b Warren Tharon D Bartlett Loyd Blake Gerse L Blair Homer D --836-M4 Burgess Hoyt C --836-W3 Burgess Mae B Mrs Clay H W Floyd Bennie F 3 Park O D Jr 4 Copeland H A Hames Luther C Henry Felton B Jr Jackson Marvin CONCORD RD (FAIR OAKS) -- Jones Jas Southwest from Atlanta rd, 1st King Essie A Mrs south of Austell Larrimore Clifford J Concord Apartments Manning Robt E apartments: Matthews Robt D 6-a Eldridge Sam M Mclnnes Norman M 6-b Vacant Moon Alonzo L 12-a Walters J R Moor Wilber Gt--736-W 12- b VacanMt orrison M Smith --836-M2 13- a BeaslyNJeowhtnonWJaJsrC 13-b McNeil Gomer T Shields Bess C Mrs --836-R2 PHONE eo OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. S. J. LINDSEY Owner 1. P. STEPHENS LUMBER CO. PHONE S40 MARIETTA CITY DIRECTORY 359 MAYES WARD & CO AMBULANCE nilABIE? EiM SERVICE rnUPSlL 541 A. D. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Concord rd--(Contd) Siegfries Jas Smith. Neval L Thomas Jas H @ Guice Jas H Holbrook Aurelian C --973-R Peek Thos F Vanous Marvin L CORYELL--South from 410 Roswell, 1st east of Atkinson 107 McAfee Mayo 108 Sands Eug 112 Daniel Homer 116 Smith Lorene COVINGTON--North from 913 Roswell to Washington av 106 Landers Thos A 107 Edwards C Frank 108 Landers T Harold 109 Brown Jas A 111 McClure Ernest 113 Holcomb Mayes K 114 Rainey Crillon E 119 Holcomb1 Marion --956-W 121 Spake Boyd P COVINGTON AV--North from nr end of Roswell, 1st east of Ayers 115 Gaines Joe A CRANFILL AV (FAIR OAKS) -- North from Concord rd, 1st west of Cochran Berry Martin M @--431-W Cranfill Jesse F --431-R CTJRRY AL--South from 120 Henderson 109 Pullin Albert 112 Curry Jos 113 Shaw Judge DARNELL RD (Fair Oaks)--East from Austell rd to Barber rd Carden Carl J Carney W Fred Evans Hugh T --1569-W Huggins John D McCay D Claude --1569-J Nichols David E --517-R DELK--South from 234 E Dixie av, 1st west of Manget 105 Vacant 106 Hunter Herbert H (g) 107 Holcombe Jas E 108 Vacant 111 Lindley Robt T 112 Black John A --195-XJ 114 Brown Thos --195-R 115 Powell Wm R 116 Russell Andrew O 117 Camp Harvey L 118 Brown Claude H --417-W ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Floivers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER 00. PHONE 140 360 BALDWIN'S 1944 ICE-COAL-PHONE I SOUTHLAND ICE CO. OFFICE SALES & SERVICE "Your Partner In Business'' OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 Delk--(Contd) 119 Hopkins Lawrence C 120 Fields Jasper B 121 Britt Alt R 126 Howard Andrew 128 Low Earl P DENMEADE--North from end of W Anderson, 1st west of Cleveland 102 Depot Susie 201 Clowdis Alonzo--1154-J 202 Jones Fannie 203 Vacant 204 Brown Hillard 205 White Chas DEPOT--West from 40 W Park Sq to Husk, 1st north of Whitlock av 200 New Marietta Hotel--488 204 Vacant 206 Black Beauty Salon--575 208 Vacant 210 Railway Express Agency--38 N C & St L RR tracks cross 300 Cobb County Marble Co--578 306 Boatner Lessie L Mrs--540 DE SOTO AV--North from Freyer dr, 3d east of Cherokee No houses iljiili DIXIE AV E--East from 726 Atlanta, 1st south of Clay 105 Hicks Pearl H 106 Skinners Cafe--9134 Skinner Jas H Butler begins 201 Cox Herbert A --1172-W 203 Cantrell Chas N 204 Anderson Harold G --310-W 205 Merritt Julius --417-J 208 Bishop Wm J --825-W 209 Hardage Chas T 211 Richards Paul R --310-J 212: 1 Goodwin Schuyler J--618-XM 2 Kemp Russell A 3 Dobbins Jos M 4 Earwood Harold J 215 Brantley John L --410-W 216 Haney Morris L 218 Smith John D--548-J 219 Garrison Sami J--548-W 220 Crow Trudie C Mrs --822-R 221 Greer Thos C Rev 222 Lowman Ruth S Mrs --1172-J 223 Worley Robt E 225 Wilson Leon L --762-J 226 Johnson Chas L --452 227 Jackson W Houson --465 228 Prince Fred P--762-M 229 Johnson Jas C 232 McAfee Evans H --410-R "Serving Cobb County Since 1900" Westinghouse Stoves and Appliances and Radios H. N. DuPRE Ranges Wholesale and Retail GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHOIE 840 Marietta city directory 361 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Dixie av E--(Contd) 233 Smith John D--977 234 Anderson Jas T Sycamore ends * . $ Delk begins 300 Delk Clarence T 301 Collum Clarence J Rev --522 303 Crowder Judson F 304 McEntyre Robt --1125-W 308 White Carl C --1125-R 309 Skelton Elija M --256-J 312 McCurdy Bessie Mrs 317 Roberts DC DIXIE AV W--West from \V Atlanta, 1st south of Hedges 100 Sockwell Wm C--826 103 Brooks Forrest C --759-W 104 Bishop John A --397 105 Sappington Joshua L 107 Wardlaw Doyle S--1136-W 108 Mitchell Beulah S Mrs--759-R 111 Rice Pierce V --1251 112 Pickens Eliz W Mrs -743 -ill Adams Horace B --135-W 118 Davis Rayford G--1136-J 119 Pitner Clarence --1107 121 Baxter Wm E 125 Eubanks Florida C Mrs 126: 1 Vacant Telephone 1098 2 Vacant 127: X Vacant 2 Vacant 128: 1 Vacant 2 Vacant 129: 1 Vacant 2 Vacant 130: 1 Vacant 2 Vacant 131: 1 Vacant 2 Vacant 132: 1 Vacant 2 Vacant 133: 1 Vacant 2 Vacant 134: 1 Vacant 2 Vacant 136: 1 Vacant 2 Shackelford Willis F 138: 1 Vacant 2 Vacant 142 Vacant REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) , Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 362 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, SIC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Dixie av W--(Contd) 144 Vacant 145 Vacant 146: 1 Vacant 2 Vacant 147: 1 Vacant 2 Vacant 149 Esmiol Julius M--866-J 150 Hood Jas B--262-J 151 Sims J Edgar 152 Yaw Harold T 153 Ramsbotham Allan J 154 Moore Roy H Jr 157 Griffin Donald A--866-W 158 Vacant 159 Goodspeed Merle W--262-M 160 Davis Lowry W--866-M 161 Hunt Elwood M--596-R 162 Vacant 164 Hatch Harold L--664-W 166 Richardson John J--664-R leg^GHTEmSIt S--262-R 170 Billstone Ralph A--262-W DOBBS E--East from 220 Church to Haynes 102 Marietta Hosp (side ent) 104 Vacant 106 Wilkins Edwin S Cherokee intersects 107 Ingram J Kemp--620-W Waddell intersects 201 Williams Joel S--740 203 Moor Mary D Mrs--&65-J 206 Shaw Oscar --674-W 207 Shaw Raymond M--837-J 209 Shaw Monto (h)--176-J DOBBS W--From Denmeade, east to Church, 1st south of Lemon 100 Southland Ice Co--1 104 Holeproof Hosiery Co whse 311 Fowler J M Co DURHAM--South from 1100 Whitlock av, 1st west of Hazel 109 Worley Thurston L --336-M 125 Reid Millie P Mrs 131 Kilgore John 133 Clackum Eug E --336-R Carnes ends 212 Reid Harvey E EDWARDS DR--North from 305 Mulberry to Pine 101 Robinson Jefferson 107 Turner Gartrell W 109 Harris Geo ELIZABETH--A community north of city limit reached via Church or Cherokee ffntpl " FiVIyI strictly modern A 1C1U WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 J. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 363 MAYES WARD & CO. A1SERVICECE PHONE 549 HOME OWNED -- HOME OPERATED NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. 8. ,T. LINDSEY Owner ELK--South from 118 Page, 1st east of Cherokee 101 Presbyterian Colored Mission 102 Wimpy Carrie 194 Turner Robt 106 Green Austin 107 Woodruff J C 108 Garrett Geo 109 Rogers Ethel 110 Robinson Clover 111 Freeman Henry ETOWAH DR--North from 115 Freyer dr to Moor's av, 1st east of Cherokee 208 Vacant 300 Sapp Jesse B 306 Dobbins Wm M 314 Hamrick Harvey L Waterman ends 401 Harbin Cellis W 403 Dingle Alvin A 405 Kakal August 407 Gray Jas A 408 Vacant 409 Sawyer Geo L 410 Brooks Clifford G 411 Ezzell Hugh 412 Thomas Ernest J 413 Vacant Hood John W--314-W 209 Flynt Jas R 213 McDaniel Wm L --9-55-W FAIRGROUND--South from 1008 Roswell, 1st east of South av 110 Barmore Fred C --443-J 112 Sams Columbus B --747-M Pierce begins 201 Vacant 202 Vacant 205 Covington Bertha B Mrs -- FAIRGROUND EXTD--North from Page, 1st east of Allgood rd 105 (1) Kemp Harry L (2) Humphries Elmer F 107 (1) Taylor L M (2) Tyson Ernest L 207 (1) Perkins Robt K (2) Vacant FAIR OAKS--A settlement on Atlanta rd, 1 mile bey city limit 296-J 207 O'Laughlin Wm P --747-XR 210 Hook Golson L (g) 211 Barfield Berry M FAIR OAKS AV (Fair Oaks)--South from Austell rd to Bingham, 1st west of Atlanta rd Summit begins Abercrombie Nolan --1240-J W. P. STEPHENS LUMBER CO. PHONL 364 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling PHONES: church 13 261 MARIETTA TRANSFER & SALVAGE CO. CASH FOE ALL SALVAGE PAPER, CLOTH, ETC. Fair Ooks av---(Contd) Anderson Roy C Allen Melvin H Bishop Reynolds G --993-R Brewer Lillie--993-M Hardage Cecil M--232-M Harris Norman J Harmon J Wilson Lutz Chas J Moore E Hammond Newton David Pair Jacie I-I Pair Ralph T Roed Isaac V Sams Geo F --339-W Turner Edw G Wyle R L FAIR RD 5--East from Garrison rd, 1st south of Hill Anderson Frey E Beam R Luther Ingram Jas L Pickins Raymond A Raines Wayne L Richards Raymond M Sears Edgar L 1ST--East from. Fairground, 1st south of Clay 604: 1 Bullock John W 2 Vacant 3 Bennett Dilmus T 4 Bridges Root A 5 Vacant 6 Eskew Bryant P 606: 1 Vacant 2 Vacant 3 Bishop Grover S 4 Harris Clyde 5 Vacant 6 Dews Robt P 608: 1 Pinckley Paul W 2 Vacant 3 Evans W J 4 Miller Quinton C 5 Vacant 6 Helms Roland 610: 1 Denney Iverson 2 Vacant 3 Cassel Henry V 4 Russell Harry F 0 Vacant 6 Payne Olin 701: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 703: 1 Vacant 2 Vacant SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA w. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 365 MAYES WARD & CO. SK PHONE 548 45 W. Park Sq. "The Exclusive Store for Men" Telephone 331 1st--(Contd) 3 Vacant 4 Vacant 705: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 707 1 Vacant 2 Vacant 3 Vacant 4 Vacant 709: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 711: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 801: 1 Huffman Aubrey D 2 Vacant 3 Vacant 4 Boling Emory M 803: 1 Nichols Marion R 2 Vacant 3 Vacant 4 Moore Robt C 805: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 7 Vacant 8 Vacant 806: 1 Vacant 2 Vacant 3 Conner Irene E Mrs 4 Rackley Harold L 5 Gaultney Harley H 6 Vacant 807: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 7 Vacant 8 Vacant 808: 1 Vacant 2 Foster Dallas B 3 Vacant 4 Vacant 5 Smith R Hoke 6 Vacant Moving Packing and Crating Hoads Insured | W "W" I A JP& g#' m | mm F(g U tfl 3 A gyi ffljj SWgt Hfl Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Niaht Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 841 366 BALDWIN'S 1944 ICE-COAL-PHONE 1 SO UTHLAND ICE CO. FRED LESS Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St, 1st--(Contd) 809: 1 Dorman Thos P 2 Eich Harris W 3 Vacant 4 Vacant 5 Vacant 6 Vacant 810: IVacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 7 Vacant 8 Vacant 811: 1 Harrington M 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 812: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 813: 1 Cox H Cecil 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 814; 1 Vacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 7 Vacant 8 Vacant 815: 1 Morgan Wm F 2 Godwin Thos 3 Vacant 4 Vacant 5 Vacant 6 Ledbetter Raymond E 816: 1 Vacant 2 Vacant 3 Vacant 4 Vacant 5 Vacant 6 Vacant 7 Vacant 8 Vacant 817: 1 Worley Arth L 2 Vacant WALTER W. HAZEL FINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA city directory 367 MAYES WARD & CO. ^SERVICE013 PHONE 549 Marietta's Most Complete Department Store "1 he Best - - for Less" 1st--(Contd) 3 Vacant 4 Vacant 5 Vacant 6 Tidwell Jas A 818: 1 Vacant 2 Kiser Vernon 3 Vacant 4 Vacant 5 Herman Floyd 6 Vacant 819: 1 Rose Bruce 2 Roe Jas F 3 Bullock Roy W 4 Vacant 5 Vacant 6 Taff W T 820: 1 Vacant 2 Leonard Jos H 3 Vacant 4 Vacant 5 Barnes Floy B 6 Vacant FIRST (RD 4)--See Latimer FOREST AV--East from 502 Cherokee to Cole 102 Hodges Jack M @--1079 104 Bonner Francis Mrs--1250 106 Walker John S @--67 107 Hodges McCormick D --47-J 108 Stringer Alice R Mrs --395-W 109 Ford Laurie 110 Howard Wm L 113 Daniell Geo E --627-W 114 Vacant 115 Coile Turner F--962-J 116 Hunt Armstrong --533-J 117 Tomlinson Wm S --533-W 118 Wilson Julian A 121 Fowler Jas M 202 Vacant 203 Vacant 206 Whorton Geo W --66S-W 208 Crummie John A --1132-M 209 Bayljss Alf R S --1190-J 217 Lindsey R S --1190-J Hunt intersects 301 Vacant 302 Smithweck Clinton--952-M 302% Badger L C 304 Cole DeWitt C Jr--952-J 307 Vacant 309 acant 310 Cordell John E--602-J FOREST AV N -- North from 121 Forest av to Page 105 Vacant 105-a Vacant 105-b Frennel Groover C 105-c Vacant ^EAJKJSSrjQp^ TtSc^jlr W0FF0H "^e Sure -- With Pure" ROY McCLESKEY, Agent GAS 0IL BUS. PHONE 148 RAECSC. EPHSSOONREIE22S4 W. P. STEPHENS LUMBER CO. PH0NO40 368 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Forest Av N--(Contd) 107 Brown Geo F Bev--405 109 Hunt E R 110 Northcutt Robb H--851 Vance cir begins 111 Head Richd G--1008-W 201 Vance Wm L (g)--338 203 Fay Walter D--595 205 Vacant 207 De Jarnette Wm L --612-J Vance cir ends 300 Ling Percy--1270 301 Woolbright Achsah C Mrs-- 863-J Worley Clarence --602-M 303 Barber Durant C --1035 305 Dunn Robt H--326-R 307 York Arth S--1190-W FORT--East from 211 Cole, 1st North of Lawrence 102 Vacant 103 Apartments: 1 Vacant 2 Rainey 3 Dyer Edna R 4 McGuthry Annie S 5 DuBerry Inez 6 Burse Jas L 7 Bates Clarence 8 Jefferson Wavis 9 Ransom Mary 10 Kemp Julius 104 Rogers Martin 106 Stephens Frank 107 Apartments: 1 Williams John H 2 Scott Beatrice 3 Bartlett Willie 4 Tilard Foy 5 Crawford Hattie L--1081-W 6 Grogan Edw 7 Zellars Beatrice 8 Vacant 10 Kemp Junious 108 Hunter Annie M 110 Thomas Thos 117 Powell Abron 118 Clay Jesse Lake ends 119 Roberson Edw 121 Boyton Patrick 123 Johnson Floyd 201 Randall Robt 203 Harris Chas 204 Broaden Clarence 205 Anderson Louise 206 Holloman Lizzie Rigsby intersects 301 Thompson Frank 306 Slade Horace 307 Digsby Wm 309 Thomas Lou E 311 Dodd Jas C 313 Garrett Will M * MARIETTA LUMBER CO. * "Building Materials A Plant for Every Purpose That Merit Good Will" Lumber--Bldg. Materials ^ Phone 357 Atlanta Road W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 369 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief' and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. Fort--(Contd) 513 Alexander Nemon 515 Wheeler Geo 519 White Floyd 604 Allen Alice 606 Bates Susie 607 Ballard Thos 608 Adams Henry E 609 Clark Walter Brooks ends 700 Payton Will 702 Blount Robt 706 Adams Morton 712 James John H 713 Washington Chas 714 Brunson Pink 4TH--North from 3d, 1st east of Fairground 708: 1 Vacant 2 Ford Arnold 3 Seymour John O 4 Casteel Gordon L 5 Thigpen Claude L 6 Vacant 710: 1 Vacant 2 Eubanks Claxton P 3 Headley Howard L 4 Lester H C 5 Long H Clyde 6 Vacant 712: 1 Vacant 2 Prewett Andrew J 3 Snell Fred C 4 Johns J Buel 5 Woodham Jessie M 6 All John H Jr 714: 1 Vacant 2 Hord General E 3 Tucker Ermal 4 Baxley Oscar B 5 Culver Lewis H 6 Vacant 800: 1 Vacant 2 McCauley Lee 3 Atkinson Harry L 4 Land Wm F 5 Vacant 6 Vacant 801: 1 Vacant 2 Thomas John W 3 Vacant 4 Woodruff Rylend W 5 Hall Ralph E 6 Johnson Clarence 802: 1 Vacant 2 Vacant HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAInut 4484 1110 First National Bank Bldg. Rome, Ga,, Office--Phon,e 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 370 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. 4th-- (Contd) 3 Thomas Walker K 4 Erwin Dennis L 5 Vacant 6 Pope Joel W 803: 1 Vacant 2 Vacant 3 Rackley Gerald D 4 Rackley Jas C 5 German Poley J 6 Vacant 804: 1 Davis Gordon J 2 Padgett Barney W 3 Mitchell Henry M 4 Cleckler DeForrest 5 Baine S A Douglas 6 Vacant 805: 1 Jones Duard A 2 Hare J Vance 3 William Carl L 4 Prater Milton 5 Simpson Dorsey T 6 McClure Felton 806: 1 Miolen Joan 2 Vacant 3 Sawyer Paul O 4 Franklin Elridge H 5 Vacant 6 Roberts Harley 807: 1 Smith Christine D Mrs 2 Hudgins Ralph N 3 Howard Ruel E 4 Bradberry Hubert F 5 Greene Thos E 6 Perrow Carl G 808: 1 Hefner Coy 2 Humphreys Alf C 3 Thompson Inzer J 4 Vacant 5 Morgan Jas T 6 Vacant 809: 1 Gazaway Clifford B 2 Wakefield W Crawford 3 Caswell Hulett M 4 Guthrie Riley W 5 McGowan Andrew J 6 Dunn Howard W 810: 1 Tarr Donald T 2 Montgomery Clint B 3 Taulman Dan C 4 Derick G Robt 5 Vacant 6 Manzek R Jean 811: 1 Fowler W H 2 Roberts John I 3 Everhart Clyde 4 Mull Glen A W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 371 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 "The Ring Leaders Since 1900" H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 4th-- (Contd) 5 West P R 6 Bennett Lawrence 813: 1 Glover Wm G 2 Chaffin Clyde C 3 Lanier Theo A 4 Vacant 5 Bailey Jas C 6 Smith Geo W 815: 1 Scarbrough Willie 2 Goss Phillips W 3 King J B 4 Shields Guy M 5 Gilley Tybee 6 Hulsey Leland PRANCES AV--East from 1000 Church to Cherokee 101 Roddenbery W Blair--591-W 102 Coryell H G--827 103 Roberts J G --662-W 104 Stephens Wm N --423 105 Tribble C L --205-W 107 Waters John H --406-W 108 Benson Ralph E --406-J 109 Sims Geo O 111 Brumby Richd G --751-J FRANKLIN--West from nr 424 Fairground, 1st south of Waterman 104 Stevenson Jessie N 106 Haley Jas 108 Haley Harrison 109 Dial Ellen 111 Vacant 113 Vacant 115 Mozley John W 117 Stevenson Milous 120 Waits Roland 124 Moore Guss W 125 Adams Fred 127 Woods Taylor 201 Grogan Jesse T --491-W South av intersects 300 Vacant 304 Martin Luther FRASIER CIR--Continuation from end qf Frasier 1300 A Vacant B Vacant 1301 A Vacant B Vacant 1302 A Vacant B Vacant 1303 A Vacant B Vacant 1304 A Vacant B Vacant CARTER CANDY COMPANY L. E. CARTER, President MANUFACTURERS OF HI-GRADE STAPLE CANDIES -- ROASTERS AND PACKERS OF SALTED PEANUTS 301 Husk Street Phone 1041 W. P. STEPHENS LUMBER CO. PHONE 840 372 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND `ICE CO. "Marietta's Finest. Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Frasier Cir--(Contd) 1305 A Vacant B Vacant 1306 A Vacant B Vacant 1307 A Vacant B Vacant 1308 A Vacant B Vacant 1309 A Vacant B Vacant 1310 A Vacant B Vacant 1311 A Vacant B Vacant 1312 A Vacant B Vacant 1313 A Vacant B Vacant 1314 A Vacant B Vacant 1315 A Vacant B Vacant 1316 A Vacant B Vacant 1317 A Vcant B Vacant 1318 A Vacant B Vacant 1320 A Vacant B Vacant 1322 A Vacant B Vacant 1324 A Vacant B Vacant FRASIER--East from Atlanta, 1st South of Waterman 109 James Albert C --778-J 112 Phillips Clifton E--778-W 115 Phillips Clara Mrs --902-J 118 Dobbins Danl --1581-J 119 Vacant 122 Bevers Frank C --902-M 204 Barr Jas W Alexander intersects 206 Watkins Ernest R--970-XM FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 373 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 furn Comiptlei te r Hoe me co. Furnishers In Marietta Since 1916" Frasier--(Could) 207 Richardson Edw T--970-R 209 Parker Delford F 210 Vacant 213 Kytle Alepand S --107S-W Summit &v ends 300 Benson Warren A (g) 302 Hill Chas G --252-M 304 Payne Thos G --1016-R 305 Curtis Wilber --1016-J 306 Harshbarger Carl J 308 Vacant 309 Barber Dan W--865-J 310 Lyle Otta G 311 Hill Chas A---1116-R 312 Copelan John D--1116-J 313 Furbinger Victor 314 Vacant 315 Vacant 316 Rocker Alvin G 405 Gantt Walter C 409 Wilson Carter E 413 Seagroves Bertie L 416 A Manning Walter D B Vacant 417 A Vacant B Vacant 505 1 Vacant 2 Vacant 513 Robinson Albert W : Mayes John L Dawson Guy Vacant Miller Howard W Black Wm W Booth John I Maris Albert P Weatherson John Bolte Henry P--1164- W Burton Howard --1192-W Vacant Morris Andrew W Vacant Gambert Jos L (fi) Paulk Max W Baird Earl D--171-J Moroge C J . Vacant : Vacant . Vacant : Vacant . Vacant ; Vacant . Vacant Vacant PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 374 BALDWIN'S 1944 CE- COAL - PHONE 1 SOUTHLAND ICE CO. KNOW THE| HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. Frasier-- (Contd) 1108 A Vacant R Vacant 1109 A Vacant B Vacant 1112 A King Lula B Mrs B Vacant 1113 A Vacant B Vacant 1200 A Vacant B Vacant 1201 A Vacant B Vacant 1202 A Vacant B Vacant 1203 A Vacant B Vacant 1204 A Vacant B Vacant 1205 A Vacant B Vacant 1206 A Vacant B Vacant 1209 A Vacant B Vacant 1210 A Hilton Jessie B Vacant FREYER DR--East from Cherokee, 1st south of Seminole dr 105 Vacant 108 Loudermilk Horace H --345 109 Pique Chas Mrs (g)--185 110 Shea D Eug --760-J 111 Cairnes Wade W --241-W 112 Bullard Edw G --586-W 113 Black J Walter 114 Matlock John J --819 115 Clark C Maynor Smith Henry C (g -1020-J 116 McKinney Wm E h--786 Etowah dr begins 200 MacIntyre Peter A --839 201 Gregory Paul A --136 203 Anderson Leila @--241-J 204 Richardson Wilber L --446-W 205 Schilling F E A Jr @--112 207 Lyon Merritt R --446-J 209 Swanson Geo E --622-R Chickasaw intersects 303 Triggs Albert J --622-M 304 Kennedy Wm P --1034 309 Northcutt Eug S --586-R PHONE 60 OLDEST -- LARGEST -- BEST < NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. a W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 375 MAYES WARD & CO AMBULANCE nUAIIP PIQ service rnunc 349 A. D. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Freyer Dr--(Contd) 310 Grove Bernice Mrs --1570 311 Grove Russell S --487 312 Brown Allen --456 314 Anderson Geo D --421 316 Woodward Wade ---579-W GARRISON DR--South i/2 blk. from Clay, thence east to Sycamore 111 Vacant 112 Eason Alsey H--911-W 116 Shaw Robt E 117 Garner Harry E --425-J 122 Vacant 124 Galyon Paul G 125 Coggins Knox W 128 Stall Newton A 130 McCray Robt 131 Bartley Robt H 132 Jackson Jas P 134 Vacant 136 Hurst Chas J GARRISON RD (RD 5)--West from Atlanta rd , 1st south of Hill Anderson Buford H Anderson Coatus E Anderson Harold T Anderson Mary J Mrs Austin Frank Benson Hoke S Beverly Gray N Burnell A Ford Canup JG Canup J OUie>--1263-J Carter Seaburn P --1170 Crain R Spencer --253 Hamman Gilbert R Hawkins Henry L--425-R Ledford Vaughn E Manning Jos C Myres Fredk --162 Norton W Cecil Pace Bennett B Richardson Judd N Voyles Cecil R--560-J GEORGE HAMILTON CT -- East from S Waddell, 2d North of Waterman 200 Apartments: 1 Underwood Doss M 2 Turner Sami R 3 Mason Lillie M Mrs 4 Orr Lucille H Mrs 5 Pavlosky Ralph C 6 Hartsfield Jesse F 7 Gallant Smith 8 Sexton Stanley G--154-M 9 McNamara Geo C 10 Thomas Willa N Mrs 201 Apartments: 1 Collins Paul 2 Williams John R--703-M 3 Anderson Harrison L--1576-J 4 Campbell Geo B Jr--1576-M PHONE "The Friendly Druggist" ATHERTON PHONE DRUG COMPANY 7 WALGREEN AGENCY W. P. STEPHENS LUMSER CD. PHONE 840 376 BALDWIN'S 1944 ICE-COAL-PHONE t SOUTHLAND ICE CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 Geo Hamilton ct--(Sontd) 5 Hendry Ralph A 6 McEntyre Wm L 7 Pine Ozier C--295-W 8 Moore Thos J--1247-W 9 Booth Donald C 10 Shaw Chas L 204 Apartments: 1 McClure Leland 2 Canup Geo D 3 Ludwiek Eliz S Mrs 4 Barfield Winston H 5 Creasman Jos E 6 Mitchell E Lee 7 Adams Henry 8 Adams Henry 205 Apartments : 1 Shaw Chas M 2 Lingerfelt Albert L 3 Langley Kate Mrs 4 Hunton Geo T 5 Prewett Gordon L 6 Hoskins John W 7 Abercrombie Jos Y 8 Pearson Lars 9 Hicks Dorsy 10 Dunn Carl 206 Apartments: 1 Prance Watson 2 Hardage Jessie B Mrs 3 Faucett Chas H 4 Gowder Floyd R 5 Chambers Jas L 6 Pavlovsky Jas W 7 Cordell W Henry 8 James Bessie W Mrs 9 Tritt Wm H 10 Patterson Jennings C Jr 208 Apartments: 1 Gloer M Rosa Mrs 2 McWilliams Wm L--847-J 3 Carruth Henry L 4 Gallant Augustus A 5 Leard Ethelyn 6 Bannister Rheba Mrs 7 Alexander Wm C 8 Boalch Ruby D Mrs 203-Apartments: 1 Lamb J C 2 Holder Jos H 3 Trammell Tolvin C 4 House Frank E 5 McCray Olive Mrs 6 Camp Jewell Mrs 7 Barnes John H 8 Townsend Luke T 9 Brand H Marshall 10 Brown Floyd E GLOVER--East from nr 200 Butler, 1st south of Hawkins 107 Wade Leila H 108 Texas Co The 111 Vacant 115 Chadwick Ernest B 116 Dye Arch J "Serving Cobb County Since 1900" Westinghouse jUI 1TM Hgj 51 |y|Ip' Stoves and Appliances and Radios ill! i#PI Wholesale and Retail Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA city directory 377 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Glover--(Contd) 117 Veitch Quillan R Delk ends 201 Browning Julia D gro 203 Neese Glen 204 Hendrix Sallie Mrs 205 Vacant 208 Vacant 209 Neese Edw I> 210 Davenport John W 211 Bridges Albert A 212 Davis Houston Manget ends 301 Pittman Jos J 305 Towns Wm C 309 Sanges Frank J 310 Vacant 311 Bruce Wm E 313 Fortner Earl H 315 Clayton Emma Mrs Bruce Sami H Browning Julia D Long John H Wilbur Jas E --1159 GLOVER PL (RD 5)--South from Hill, 1st west Atlanta rd Brooks Otis W Masters Carroll H McConnell Hubert G McKee Jas B Price J Gordon Telephone 1098 GOBER--East from 600 Cherokee to N Forest av 101 Brown Herman 102 Chalker Hattie Mrs 103 Arnold Wm H --953-M 106 Ballew Clyde W Ussry Harold A 107 Wilson Wm C --953-J 108 Wiley Geo T 109 Wilson E S 110 Ray Herman P 111 Hopkins Bertice D 113 Hoppe Laura B--495-W 119 Smith John J 127 Vacant 129 Vacant 133 Brumby Bolan GOSS--West from 421 Atlanta to Powder Springs, 1st south of Reynolds 202 Marietta Marble & Stone Wks 203 Vacant 207 Gordy Beulah B Mrs 208 Beck J Sami 209 Frasier Wilcie W GOSS W--West from Powder Springs 1st south of Reynolds 310 Gresham Nancy 312 Moss Freeman 314 Miller Robt L REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE---WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 378 BALDWIN'S 1944 BCE - COAL - PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, 10. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Goss W--(Contd) 316 Summerour Jas 318 Allen Alphonso 320 Rogers Jack restr 321 Brunson Wm Jones intersects 400 Milton Clyde 401 Daniels Herbert J 402 Milton Clarence 404 Hall Georgia A 406 Sanders Wilburn 413 Vacant 500 Hill Duril 502 Garner Wm 505 Jenkins Alice M 506 Clark Edw 507 Gresham Fredk 508 Kiser Willis GRAMLING--West from W Atlanta, 1st south of Dixie av 100 Hogg Robt D 103 Lewis T Oscar--341-W 104 Marr Ausbon L--984-W 107 Hibble Leonard A --1138-W 200 Hicks J F 201 Collins Jas R--1023 202 Moffitt T Franklin 208 King Jas C --9085 209 Swilling Aline A Mrs --341-R 211 Sanger Frank L --1264-R 214 Poirier Laurier A --1138-R 216 Vacant 218 Hartsfield T Everett -- 1575-W 219 Dunn D Albert --1575-R 301 Garner Lee 351 Barnes Carl P--292-J 411 Vacant 415 Leavell Geo A--346 427 Waldrop Clyde J Osborn Gilbert--553-J 501 1 Vacant 2 Vacant 502 1 Vacant 2 Vacant 503 1 Vacant 2 Vacant 504 1 Vacant 2 Vacant 506 1 Vacant 2 Vacant 508 1 Vacant 2 Vacant GRAY (Eliz)--East from Church extd to Cherokee extd ---- Barrett Thos E --576-R PHONE FIELD PHONE 1010 FURNITURE COMPANY 1010 "Find Your Furniture At Fields"--Ih the Hotel Field Building W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 379 MAYES WARD & CO. Asr PHONE 541 HOME OWNED -- HOME OPERATED NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- J Gray (Eliz)-- (Contd) Berry Jas E--963-J Brown John P Maddox Jas H Spratling Grover B 214 Dorris Wm 215 Miller Hubert 215 Gordon Lizzie 216 Williams Danl 217 Zachary Lithonia GREEN--South from 112 Roswell, 1st east of S Waddell 104 Brown Ernest W 106 Thompson Wm C 108 Groover Oliver F Wayland Intersects * # George Hamilton ct intersects 3! $ * Waddell pi ends 219 Skelton John R Jr GREER AV--East and West from 618 Wright, 1st south of Goss 115 Vacant 117 Jennings Wm Wright intersects 200 Warnes Romt 202 Mosley Fannie 204 Dobbs Hattie 208 Coleman Chas 209 Sorrels Len --117-J 211 Carter Lula 212 Ray Cliff 213 Appleby Laura 214 Seott Jessie GRIGGS--West from 711 Powder Springs, 1st south of Maple 108 Mathews Jason --1065-W 102 Lowery John V 111 Vacant 114 Conner Lester E 115 DuPre Marvin S (fi) 116 Webb J Homer 117 McTyre Luther D 118 Foster Wm K 122 Furr J Roy 123 Kilgore Noah 126 Bishop Robt H 127 Houze Glen W 130 Cheek Ed G 132 Rohner Fredk J GROGAN--East from end of South av, 1st south of Franklin 107 Grogan Eug 121 Drew Sami D 128 Vacant 309-a Felts Clay H Invest At Least 10% In War Bonds W. P. STEPHENS LUMBER CO. PHONE 840 380 BALDWIN'S 1944 ICE-COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling PHONES: chuiich 13 i 261 MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPEB, CLOTH, ETC. GBOVEK--South from Frasier to Franklin, 1st east of South av 400 Black Lester G 401 Barton Glen H 402 Reece Jas A --1353-J 403 Lee Roy E 404 Martin Geo N 405 Vacant 406 Clark Edw H --1353-XM 407 Hammond Homer E 408 Lambert W Parvin 409 Davidson Abram W 410 Fuss Hampton E 411 Vacant 412 Johns E Ralph --1353-R 413 Glrton Verne HANSELL E--East from Church to Haynes 104 Tritt Wim P 107 Dickson Ford--780-J Cherokee intersects * * * Waddell intersects 205 Marietta Cigar Factory 206 Vacant / 207 Casteel G Felton HANSELL W--West from Denmeade, 1st north of Mills 400-a Fortson Homer B 400-b Free Wm G Husk ends * * $ Poplar begins 500 Stewart Ralph 502 Vacant 504 Elrod J Guy--1567-J 508 Clackum Sibley C 509 Cheek Ellis M p 510 Vacant 511 Greenway Homer C 512 Hipps Nathan R ' 513 Lowe C Howard 514 Turner Lewis C 515 Dunn Elmer T 516 Spinks Thos H 517 Parris Wm G 518 White Marion J 519 Vacant 520 Hopkins Addison G 521 Dunn Glen C 522 Padgett Barron H 523 Powell H Greer 524 Newton Hoke S 525 Quarles Hubert--1363-W 526 Edwards E Eug 527 Murdock Geo E HAROLD--North from 205 Page to Mulberry, 1st east of Elk 102 Peters Ernest 104 Webb Nathan Johnson intersects SEARS, ROEBUCK &C0. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONF' ' MARIETTA CITY DIRECTORY 381 MAYES WARD & DO. DIRECTORS1" PHONE 549 Harold--(Contd) 200 Floyd Otis 202 Price Suzanna 204 Robinson Wesley 205 Poole John 206 Allen Geo Montgomery intersects 300 Butler Warren @ 304 Solomon Lena 305 Grimes Wm 306 Vacant 307 Kirth Bessie 308 Robertson Freddie 310 Sturkhall Algernon 313 Plolmes Nathan HAWKINS--East from 133 Butler, 1st south of Dixie av 103 a Hardwick Lesley A b Parham Duvall M 105 Mitchell Hope S 107 a Roberson Willie E b Ayers John K 108 McClure Paul R 109 Shirley Carl H--958-J Shirley Lilia Mrs nurse 111 a Teague John R b Putman Merrill B HAYNES--North from 111 Roswell to Lemon 109 White A Kenan Tucker intersects * * * Lawrence intersects 208 Zion Baptist Church 405 Garrett Lacy M 407 Duncan Earl G--414-R 500-Benson Ella N Mrs Sanges Searle G--512-W 501 Haynes Seaborn A--546-M 503 Pylant Fred--674-R 504 1 MeClung Hugh D 2 Burson Jag W 3 Holt Ralph E 4 Tindle A C Jr 505 Shaw Thos G--896-WT Dobbs ends 601 Vacant 602 Keith School--479 604 Griffith Eug E--896-R 605 Cannon Gerald B --896-J 606 McEntyre Chas M Rev--457-W HAZEL--South from 1014 Whitlock av, 1st west of Northcutt 110 Holland Asbury C 112 Moseley Chas M 114 Owenby Frank C--880-W Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PiOiE 840 382 BALDWIN'S 1944 ICE-COIL - PHONE 1 SOUTHLAND ICE CO. FRED LEGO Distributor -- GULP OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene mw Phone 81, Plant 129-33 Butler St Hazel-- (Contd) 131 Bagwell Henry R --682-W Bagwell Sign Service HEDGES--West from W Atlanta, 1st south of Cemetery 103 Carriker Wiley C--275-M 107 Driver ffm P--555-J 109 1 Sossomon Walter C 2 Horne Douglas B 111 1 Skelton Blake B--555-XM 2 Goddard Raymond H 113 1 Meister Robt G 2 Jennings Roy T 115 1 Vacant 2 Vacant 116 1 Vacant 2 Vacant 117 1 Vacant 2 Vacant 118 1 Martin Robt H 2 Johnson Louis H lie 1 Vacant 2 Vacant 122 1 Palmer John--555-R 2 Vacant 123 1 Vacant 2 Vacant 124 1 Vacant 2 Vacant 125 1 Vacant 2 Daniell John W 126 1 Vacant 2 Vacant 127 1 Vacant 2 Vacant 128 1 Vacant 2 Vacant 129 1 Vacant 2 Vacant 132 1 Vacant 2 Barton Robt J 133 1 Vacant 2 Gunter W Howell 135 1 Talley Wm E WALTEB W. HAZEL TAXiNG DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 383 MAYES WARD & CO. PHONE 549 H T9dMarietta,sMostCom^ / 8 I 8 Department Store fcJA U mJl3"The Best - - for Less" Hedges-- (Contd) 2 Vacant 142 1 Cates Wm E 2 Vacant 143 1 Vacant 2 Vacant 145 1 Vacant 2 Vacant 146 1 Vacant 2 Vacant 147 1 Vacant 2 Vacant 148 1 Vacant 2 Vacant 149 1 Vacant 2 Vacant 150 1 Vacant 2 Vacant 151 1 Vacant 2 Vacant 152 1 Vacant 2 Vacant 153 1 Vacant 2 Vacant 154 1 Vacant 2 Vacant 155 1 Vacant 2 Vacant 156 1 Vacant 2 Vacant 158 1 Edwards Jas B 2 Lackey Guy 159 1 Kress Theo G 2 Gill Nathl G 162 1 Huber James M--365-W 2 Burt C T HEIGHT--North rom 539 Washington av to Lawrence 100 Peeples Geo 104 Mooreland Frances 106 Broadnax Lucille 107 Berry Sarah M HENDERSON--West from 209 Cleveland av, 2d south of Whitlock av 100 Sanders T Albert 101 _ "Be Sure - With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 Ifolene W. P. STEPHENS LUMBER CO. PHONE 840 384 BALDWIN'S 1944 ICE -CCAL- PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Aye. Phone 1571 Henderson-- (Contd) 102 Folsom Homer R--1094 103 Schaffer Frank 105 Trulove G Vernon--857-W 106 Hicks Jos S--505-W 107 Hicks Geo M---139-J 108 Pettett Thos O 111 Hairston Addie D Mrs @--1261 112 Pilgrim Jas H --857-J 113 Hames Harry O --242-J 116 Florence Minnie J --505-J 117 Moreland John 118 Westbrooks John W 118% Westbrooks Homer 119 Robinson Susie 120 Moore Minnie --1578 122 Roberts Wm --117-W 123 Porter Katie 124 Lyman Elnora --362-J 125 McConnell Robt 128 Morris Minnie @--362-W 128% Wright Clifton @ 128% Taylor Robt L 129 Wimby Cora D HENRY (RD 5)--West from Atlanta rd, 1st south of Pearl Barron Jas B @--560-W Beaden T Gordon Blevins J Pair Blevins Oscar Florence Wm S Foster L Montgomery Guffin Raymond L --125-W Moon Henry S Moon Hubert L Pruitt Ferrell D @ Shipp GW Stanfield Mary L Mrs Watts Btenj M Watts Willie L White Harold F Whelchel Willie L @ HILL CT--North from Hillside dr 230 Haynes Dolly Mrs--1582-W 231 Browne Horace L--883-M 232 Vacant 233 Vacant 235 Newman Judith E Mrs 236 Barnes Albert H 237 Coy Jas T Jr 238 Shaw H W 239 Futch Wm O HILL (RD 5)--West from Atlanta rd to 1st south of Latimer Atkins Wm E--905-J Clay Fannie L Mrs--269-W Childers Carlo Cooper Glenn Corley Aubie Everette Kath Mrs Forrest Jas Griggs J Arth Jackson Jessie R A GENUINE FLINTKOT IS A SMART INVESTMENT MARIETTA LIMBER B LUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 P. STEPHENS LUMBER CO. MARIETTA CITY DIRECTORY 385 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 F. P. & "101" UNDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. Hill--(Contd) Marron Ralph M Marshell Orville Merritt Jack Monroe Edw Myers Gardner L Rabun J Elbert Rabun John E --269-J Reed Jas L Reeves Claude B Richardson Wm L Robertson Raymond R--553-M Sang'ster Chas C Sherrill Leo K Southern A Coy Southern Zettler Statan Lewis L Suddeth Benj F Turner W Monroe @--942-W Wilbur T Elbert White Garnett L --269-R White John L Wright Howard HILLSIDE AV--West from 349 Church to Campbell Hill 111 Vacant 112 Cahoun C M--752-W 113 Partain Lamar @--641-M 114 Hancock R J @--240 115 Dobbins Ruth W --293-J 116 Williams Earl D --367 117 Dodd Alvin B HILLSIDE DR--East from Victory dr, 1st south of Roswell 1508 Burke Arth J--891-R 1509 Gibson N Morris 1510 Henderson Louis W 1511 Talbot H Inman 1512 Thompson Dwight 1514 Chapman Elliott L 1515 Riddlecomb Robt--1582-M 1517 Vennes Grant R 1518 Pittard Cyrus D 1605 Clark Truman B--884-J 1606 May Edw W--1258-R 1608 Killinger Clarence E--1258-J 1610 Baker Claude M 1611 Wilson Fred S--883-R 1612 Harrington Alex B--1258-W 1613 Andree Albert L 1614 McGill John T 1615 Craig Richd N--1258-M 1618 Vacant 1619 Waddell Curtis 1620 Vacant 1621 Otey W Madison--884-M 1622 Dielschler Edwin J--884-W 1624 Fonda Allen R 1625 Mex Carl H--884-R 1627 Summerour H Clay HOLIDAY--North from 801 Lawrence 107 Frazier Chas Jr 108 Vacant HARVEY I. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 386 BALDWIN'S 1944 ICE-COAL-PHONE I SOUTHLAND ICE CO. LOANS ON HOMES--Saving's Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. Holiday-- (Contd) 109 Vacant 110 Waite Chas 111 Weems Alonzo 113 Addison Frank W 114 Miller Clara T 120 Fields Annie 121 Fowler Augustus S --544-J 122 Elliot Viola G 123 Willis Addie 124 Blake Wm 125 Clark Haywood Jr HOLLAND--Southwest from Keimesaw av, 1st north of Maple av 108 Howard Chas C --1151-R Awtry intersects 200 Price Ross V 202 Green Wm O --1580-J 204 Hames Jas J--1580-M 205 Price R Waymon --1580-W 206 Martin Wm W 207 Adams Lillie M Mrs 209 Cheek Jas L--1580-XR 211 Millwood H Fredk 213 Fowler Porter E 215 Wilson J Patterson--652-J 217 Vacant HUNT--North from 329 Lemon, 1st west of Cole 102 Btyant Edw W 106 Browden Harry 107 Vacant Forest av intersects 222 Rogers Harris J--583-J Page intersects 302 Vacant 305 Green's Barber Shop 307 Hunter Chas Johnson ends 403 Reid Frank @ Montgomery intersects 503 Roberts Rebecca 505 Gober Milton 508 Davenport Jos 508 Walton Rob't 509 Bates Lewis J 510 Vacant Mulberry intersects 600 Lollis Zennie 601 Holliman Octavia 602 Johnson Cleve 603 Hurley Sweetie 609 Vacant HUSK--North from 415 Whitlock av, 1st west of Denmeade 105 Stansell Jas C--267-W 107 Thomason Harry--267-R 109 Davenport Lillian M Mrs-- 784-J Miles intersects 301 Carter Candy Co--1041 303 Williams Maybelle G Mrs -- 470-W . P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 387 MAYES WARD & CO. AS^cNeCE PHONE 549 "The Ring Leaders Since 1900'' H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 Husk--(Contd) 305 Yoemans Agnes D Mrs--1567-R JOHNSON---East from 704 Cherokee to Hunt 108 Johnson Chas 110 Delk JJase 111 Bedford Georgia @--782-W 112 Vacant 115 Martin Eula @ 116 Harris Belle 118 Appleby Solon 119 Strickland Willie P 120 Jones Martin 121 Burton Jack Harold intersects 201 Triumph Holiness Church 202 Graves Osborne 203 Holliman Herbert 205 Vacant 206 Walton Fannie 207 Hayes Mamie 208 Hazel Prudence 209 Williams Ruth 210 Brown Ed 211 Holmes R J 211 % Holmes Robt J 212 Taylor Lizzie 213 Williams Oscar 213% Holmes Silvia 215 Moore Fred D 215% Johnson Emma L 216 Ragans Maggie 217 Smith Arth 218 Maddox Frances 219 Thurman Warren 220 Nelson Annie 221 Clements Ida 223 Williams Cliff 224 Vacant 225 Hargrove Nannie 226 Webb Paul 227 McCleskey Milton 228 Chiles Q T Rev 299 Head Henry JONES--South from 220 Reynolds to Maple, 1st west of Powder Springs 103 Suddreth Chas H Goss intersects 203 Young Alf 204 Gresham Annie 206 Jones Arth 207 Marietta Chapel (Methodist) 214 Towns Geo JONESVILLE--A settlement south of city limits reached via Atlanta rd JORDON RD 1--West from Rose la at City limits, 2d north of Lacy Croft Hienry Daniel Wm O Freeman Guy H Gravel Herbert L Sanders John H Victory trailer phi ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--'0. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CD. PHONE 840 388 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO, "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Jordon--(Contd) Verhine Annie R Wigginton Louise P JOYNER AV (FAIR OAKS)--South from Atlanta rd, 2d west of Atlanta rd Allen Wiley W Beasley Starling S Corn Ezra --547-J Dobbs Claude L --606-W Dobbs Missouri S Mrs Donald D F --874-W Foster Ralph O --85S-J Hagood Lowery T --874-R Hicks Jas R Howard Isaac J --547-W Howard Paul W --469-R Lloyd Iona Mrs Maloney Robt E --858-R Martin John M Martin Jos K Mayes Arth F --858-W Merritt Allen T Jr @--606-J McDonald Horace M --431-M McTyre Edwin H McTyre Geo W --973-J McTyre W Henry Osborne Robt L School Owens Laymon H Parker Geo R --469-J Parks Floyd B Mrs --547-M Reed Corbin D Rudeseal Lewis G --606-R Turner ffm R --606-M Vaughn Jas R Warren Jas T JOYNER LAKE RD (Fair Oaks)-- North from Austell rd, 1st west of Atlanta rd Daniell Silas N --179-M Daniell W Zackrias--179-R Davidson Frank K Foster L Wise KENNESAW AV--West from Church to Cleveland, thence northwest to city limits 100 Kinsman H L ---508-W 102 Owen Lola R --992 104 Brumby Chair Co The ofc--376 105 Crumbley Wm D--254-J 106 Brumby Chair Co N C & St L RR tracks cross sf; if; Cleveland ends 203 Ragan Gordon:--404-W 207 Kehoe Wm E --1290-W 208 Foster Nancy D Mrs--77-J Maple av begins 300 Kuhlman Herbert J--524-W 307 Latimer Thos E --524-J 302 Heck John A @--77-W 303 Ledsinger C L--187-J Petty J W--407 EfttEST C. BROilS .gent--SHELL OIL CO. Shell Gasoline--Golden Shell and Shell Penn Motor Oil . .ant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 140 MARIETTA CITY DIRECTORY 389 FUNERAL MAYES WARD & GO. DIRECTORS MME 949 BRUMBY FBR^ CoimT pleU te HfoE me co E. PARK SQUARE Furnishers In Marietta PHONE 198 Since 1916" Kennesaw-- (Contd) 304 Fuller Cora B' Mrs--776-W 305 Sibley Sami H--123 306 Brownfield LeRoy--519-J Miller Kingley Jr @--519-M 307 Hewitt Strafford R --687 309 Kappas Geo W --29 Reid C W Jr--187-M Wellons Frank B--775 310 Black Daisy W Mrs --264-W 321 Howell Mary D --608-J Holland begins 401 Ducan Lula J Mrs --308-W 403 Benson Harold @--264-J Goodson Clarence H--264-M Richett Mary T Mrs--824-R 405 Shaw Henry W--289-J 408 Brovin Lee L--1279-J Stewart av begins 500 Ellison Ella Mrs --289-W 501 Daniell Jas J --448 502 Reece Raymond E --742-W 503 McPherson Edw W --53 507 Brown Austin L--527-W Childress Susannah E Mrs --527-J Childress J H Jr--1151-J 509 Bozeman T W--1060-R Elder Hazel M Mrs --1060-M 511 Harrison Geo L --21 513 Hancock Sallie Mrs --467 531 Keeler Sarah Mrs --337 615 Hipsher Chas H--393-W 616 Burton L P Coal Co--496 617 Brown J D--1169-J 619 Squires R L --439-M 621 Snyder H C--119-J 625 Vacant 629 Benson Wm H --87-W 732 Castile Henry E --248-M KINGS CT--West from Butler 1 blk, thence south to Hawkins, 1st south of E Dixie av 102 a Vacant b Vacant 104 a Hensley Ford W b Johnson Howard W 108 a Wimpy Jas E b Wheeler Wright G 112 a Vacant b Scott Allen D 116 a Landrum Merrimae b Anthony John W 117 a Horn Elmer L b Allen Lyle O 120 a Harmon Oscar R b Murner Thos B PEERLESS FIH1T11E CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PH0ME 840 390 BALDWIN'S 1944 ICE-OIL - PHONE 1 SOUTHLAND ICE CO. KNOW THE! HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY T.TKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAM ASSOCIATION phone 83 J. J. DANIELL, Pres. P. G. SMITH. Sec'y and Treas. J, GLENN GILES, Atty. KIRKPATRICK RD--South from Whitlock av, 1st north of city limits Goggins Frank A Griffin Mary D Mrs Johnson Homer H 112 Hamilton Herbert C --1059-J 126 Norton Alfred T 128 Griffin Ernest W LACY--East from Rose la, 1st north of Radium 105 Barron W F --849-J 107 Duckett Lorene B 109 Hulsey R E --474-W 120 Harris Thos --1187 121 Vacant 124 Campbell G B @--251-W 133 Comer G W LAKE--North from 519 Lawrence to Fort 102 Strong Walter L 103 Ray Wiley 105 Myers Roy 107 Evans Jas H 108 Strickland Paul 109 Pace Sophie 110 Easley John R 111 Hill Albert 113 White Walter LAKEWOOD AV RD 5--South from Garrison rd at Hill Bellcour Frank H Brooks Gus A Hood Max L Langley Thos A McCurley W Keller--553-W Niece Wm C Shaw Hugh L. --553-R Wilber R Lee LAKEWOOD DR--South from Waterman, 1st west of Manget 300 a Sheppard Reymond 301 a Vacant b Vacant 303 a Hale Martin J 304 a Vacant b Vacant 307 a McArthur Thos A b Vacant 308 a Vacant b Laird Thos C 311 a Armstrong Burrel b Johnson Chas PHONE 60 OLDEST -- LARGEST -- BEST MU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. S. J. LINDSEY Owner 1. P. STEPHENS LUMBER CO. PHONE 141 MARIETTA CITY DIRECTORY 391 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 A. D. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Lakewood Dr--(Contd) 400 a Vacant W Richards Wm A 401 a Digby Walter b Wood Allison A 404 a Vacant b Davis Clyde W 405 Ballinger Geo W 408 a Vacant b Vacant 409 a Craig Jas P b Michael Goldenburg 412 a Vacant b Vacant 413 a Walker Vel T b Hale O G 417 a Vacant b Forry Wm A 420 a Vacant b Evans Wm H 426 a Vacant b Vacant 500 a Vacant 504 a Vacant b Vacant 508 a Carter Glenn J b Butler Hugh L 511 a Lankford Lyle G b Felder Idus D 512 Stumphf Ira b English Geo E LAKEWOOD--South from Roswell, 1st east of Coryell 106 Groover Wm L 108 Andrews Fred 113 Perry Ina 114 Summerour Danl 116 Harris Fronie LAWRENCE--East from 18 E Park Square, 1st north of Washington av 105 Tritt Shoe Repair Shop 106 Brumby Furn Co--store rm 107 Whorton Geo W 108 Rex Pool Rm 109 Hyde Homer Feed Store 110 Fowler's Place --restr--8119 112 Lawrence Street Barber Shop 114 Vacant 116 Vacant 118 Beasley Jas ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Flowers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER CO. PHONE 840 392 BALDWIN'S 1941 ICE-COAL-PHONE 1 SOUTHLAND I r. E CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St, Phone 1083 Lawrence-- (Contd) Lawrence Street Cafe 120 Hanley Co > undtkrs--657 120% Chamberlain Rodrick L phys Harper Alva R phys 121 Turner Chapel A M Church Waddell intersects 201 Cobb County Chamber of Com- merce County Agrl Agt County Dept Public Welfare Country Home Demonstration Agt State Dept Public Welfare Dist No 7 State Guard U S Dept Agriculture (Agrl Ad- justment Agcy) TJ S Dept Agriculture Soil Con- servation Survey 203 Strozier Ola T Mrs --219-W 204 Ferguson Lucy B Mrs 205 Little Rosser N 206 Arnett Eliz R Mrs--710-W 207 Scarborough Arth J Haynes intersects 301 Schilling Walter E @--368 302 Little Irma N Mrs @--128 303 Vacant 305 Mozley Nettie--229-R 306 Neal Mary S Mrs @--526 309 Moore E Lane @--244-W 309% Terry Jas--244-M 310 Kitchens Thos A --636 311 McCleskey D Homer --229-W 312 Noe Ray W--1086 318 McMillian Geo H--685-R 319 Wilder Edw A--930-J 320 Maddox Sami S --685-W 321 Conyers Mamie G Mrs 322 Squires Jessie B--820-J Ward Harvey T--508 323 Bishop Ina L Mrs --820-W 324 Kerley Hubert E @--359 400 Mell Herb C --193-J 401 Hamby Harry J--934-J Wade Leonard L--1080-W 404 Ward Esmer C --133 405 Vacant 406 Smith Edgar M --638 408 Hall Lelia Y Mrs @--167 411 Holcomb Jas P 411 % Smithwick Sami D--1032-M 501 Abercrombie Joe Y --1040-J 504 Vacant 505 Johnson Hoyt N --501-M 506 Frey Josie B--24-R 508 Culbertson Chas M--1040-W 509 Vacant 510 Vacant 511 Landrum Everett--501-J 513 Whitten J Edw 514 Stells J Earl--1080-J 515 Stells W Luther--1032-J 516 Hughes Eug D "Serving Cobb County Since 1900" Westinghouse ILl jjj^ 1 f p? Stoves and Appliances and Radios ^ " 0 * Wholesale and Retail Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 `Pharis Tires': Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 393 FUNERAL MAYES WARD & SO. DIRECTORS PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Lawrence-- (Contd) 518 Chatman Carl C 519 Rhodes Rotat, Lake begins 601 Dobbs Henry --651-R 602 Keyser Wm @ 604 Dore Prances 606 Grant Mary @ 607 Wright Festus B Rev 610 Hill John J 611 Haynes Napoleon 615 Tigner John --544-R 618 Vacant 619 Ellis John B Heights ends 700 Gresham Chas 701 Robinson Marie 702 Hamilton Fredk --666-R 703 Weddington Modester Holiday begins 704 Holmes Derry H --69 705 Robinson Alice 706 Jennings Leila @ 707 Hill Lula 709 Crawford Josephine 710 Gresham Oliver C 711 Vacant 714 Butler Estell 715 Fuller Fletcher Shepard begins 800 Porter Annie --1360-J 801 Curry John 805 Myres Bealar Telephone 1098 807 Johnson Reuben 809 Adams Aaron Brooks begins 905 Murphy Henry 909 Merritt Oscar 911 Dorris Willie - Black ends * * % Barnes ends 1101 Richardson Wm H Moore intersects 1105 Richardson Jas B Aviation av intersects 1203 Vacant LEMON---East from Church, 1st north of Hansell 102 Marietta Salvage Co--261 Cherokee intersects 103 Chalker Orlando J gro--363 105 Allison Clifton--788-W 107 Vacant 108 Vacant Waddell ends 200 McLemore Leonard H--457-M 201 Rich Jas W --457-R 202 Lyle Albert M 203 Whitfield Geo R 204 Schroder Edw M 205 Smith Emma M Mrs 206 Watts Cora S Mrs 207 Edwards L R Rev --539-J 209 Cox Robt B--160-R REFRiiElfiTI! EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE---WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 394 BALDWIN'S 1944 ICE-COAL-PHONE I SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, II. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Lemon-- (Contd) Haynes ends 300 Adair Brarton C 301 Brown Geo M --693-J 302 Dobbs Hoke S 303 Johnson Rufus J 309 Carter Jas C --788-J 310 Osborne Bessie C Mrs -- 788-R 311 Wallace S Frank ()- -457-J 313 Brooks Hollis F 316 Gresham Jas 317 Brown Mosey 318 McCray Wm 319 Kisea Robt 320 Gregory Lena 321 Cleveland Mary 321-a Head Clara 322 Blackwell Alf 323 Ferguson Herbert 324 Johnson Theo 325 Walden Dennis 326 1 Jefferson Eug 2 Booker Wm 3 Lovette Wm. 4 Cuthbert Benj 328 Humphries Wm @ 329 Holmes Wm H Hunt intersects 400 Keyes Lizzie 401 Hutchins John C 403 Strickland Letha 403-a Berts Scott 409 Grogan Cora 409-a Carter Lulla M Cole intersects 503 Apartments: 1 Williams Lillie M 2 Head Henry 3 Myers Carl--1127-J 4 Jones Frances 5 Peeples Geo 6 Bolden Addie H 7 Merriweather Ethel 8 Johnson Jas 504 Apartments: Shaw Fannie J Barton Johnny Freeman Ralph Rev Allen Tom Thomas Frances 6 Stephens Chas 7 Long Nancy 8 Anderson Frank 9 Devaughn Buford 10 Jones Jas 507 Apartments; 1 Bates Claude 2 McAfee Clifford 3 Hawkins Lula B 4 Weems Ruby 5 Ragland Julius 6 Allen Jack 7 Spears Wm H 8 Riley Chas W 9 Head Melvin JLA i C; * STRICTLY MODERN A 1C1U WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 W. P. STEPHENS LUMBER CO. PHONE 340 MARIETTA CITY DIRECTORY 395 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 HOME OWNED -- HOME OPERATED PHONE NO-WAY CLEANERS & LAUNDRY 60 "New Life To Lovely Garments" 513 Page Ave. Lemon--(Contd) 10 Hinton Wm J 11 Gay Rich B 12 Harper Mildred 13 Davis Will 14 Glover Henry 15 Bailey Earl 16 Phillips Mark S Fort Hill Homes rental ofc --1115 510 Apartments; 1 Porter Eliz 2 Miller Jas 3 McAfee Annie L 4 Dunson Albert 5 Wright Will 6 Christler Serlimer 7 Wright Jesse 8 Banks Adelle 511 Apartments: 1 Harper Chas 2 Harrison Rebecca 3 Kemp Dari 4 Jones Theophilus 5 Miller Robt 6 Bates Jim 7 Alexander Evelyn R --760-W 8 Fuster Willie M Lemon Street School S. J. LINDSEY Owner LINDLEY AV (RD 4)--North from Whitlock av, 1st west of Brown Channell Edwin G LOCUST--North from Polk, 1st west of Cleveland pi 101 Smithweck Maggie D --332-R 102 Gatewood Peyton--1185 103 Jones Nannie J Mrs --344-J 200 Tyson T Fredk 201 Dobbins Hubert C 202 Loggins Robt B --667-W 203 Hurst Gordon R--208-M 204 Davenport Arth L --208-R 205 Masburn John M--2081-J 206 Bell T Lamar 207 Brewer N Linton--667-R 208 Bradberry Josie M --208-W 209 Robert Nellie C Mrs -- 667-M 210 Pierce Ada C Mrs --667-J 211 James Josie Mrs 213 Spruell John MANGET--South from 312 Clay, 1st east of Sycamore 108 Mathis Zack R 300 a Sawyer Edna Mrs b Smith Jos R 301 Perkinson High School --794 a Tillman Robt W b Frasier John B Invest At Least 10% In War Bonds W. P. STEPHENS LUMBER CO, PHONE 840 396 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO . Packing -- Crating -- Storage -- Local & Long Distance Hauling PHONES: CHURCH 13 LEMON 261 MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPER, CLOTH, ETC. Manget-- (Contd) 304 a Vacant b Waggoner Carl C 305 a Womack Ashton B b Reinhart Cath 308 a Toward Richd C b Vacant 309 a Vacant b Badger Erwin G 310 a Vacant b Vacant 312 a Cole John L b Vacant 404 1 Moseley Robt G 2 Vacant 3 Vacant 4 Vacant. 406 1 Vacant 2 Vacant 3 Vacant 4 Vacant 408 1 Vacant 2 Vacant 3 Vacant 4 Vacant 412 1 Vacant 2 Vacant 3 Vacant 4 Vacant 416 1 Wood Paul G 2 Vacant 3 Vacant 4 Vacant 421 a Vacant b Vacant ' 504 1 Edmondson Geo E 2 Vacant 3 Vacant 4 Vacant 809 Hunter Frank P --1139-W 815 Spence Jolly L --1139-J 817 Spence Alf C 821 Lamanac Emmett H 823 Honea Teresa Mrs --681-J 825 Cowger Nelson W 827 Morgan Earl W 829 Booth Thos H 830 Mitchell Hubert H 831 Memorial Baptist Church MAPLE -- West from 621 Powder Springs, 1st south of W Goss 108 McGarity Jack SEARS, ROEBUCK &CO. Phones 1D68-1069 238 ATLANTA W. P. STEPHENS LUMBER CO, PHONE 840 MARIETTA CITY DIRECTORY 397 FUNERAL ilYES WARD & CO. DIRECTORS PHONE 549 45 W. Park Sq. "The Exclusive Store for Men" Telephone 331 Maple-- (Contd) 110 White Cornelius W 112 Heard Ernest 113 Favors Andrew 114 Benton Geo 115 Wheeler B'enj J 117 Bedford Viola 118 Knox Ida Jones ends 200 Ruth Robt 202 Lavette Chas 204 Richards Maybell 206 Jenkins Ella 207 Hummerour Chas 208 Burse Fannie 209 Richardson Eug 210 Etchison Booker T 211 MeCleskey Jas. 212 Baloek Alton 213 Shaw Carnel 214 Paden Edw 215 Hunter Comer 216 Foster John H 217 Sand Garfield 219 Harris Addie MAPLE AV--West from Kenesaw av, 1st north of Moon 102 Cox Robt D--432-M 115 Davenport Clarence E --218-J 200 Maple Avenue Methodist Ch 201 Williams Henry L --1290-R 202 Holbrook Tim W Rev--432-J 204 Reeves Ross N --926 205 Nelson John V --312 300 Gifford Jas E 301 Reeves Jones W Rev --243 302 Maddox Sami S 304 Maddox Wm A --254-W 305 Holcombe Luther G --455-M 306 Meek Bessie H --163-W 307 Akins T R--544-J Pylant Edw I 308 Adair Walter J--9-W 309 McLellan Kath M --477 310 Cook W Paul --652-W 312 Cox Raymond H --757 313 Pratt Bascomb D --1011 314 Hardin Roy--455-R 316 Meek Sarah E Mrs --15-R 318 McDaniel D' Orin--813-R McDaniel Wm W 320 Vacant 322 Watson Chas R 400 Farmer Wm F 401 Gantt Jesse N -9-J 403 Leming Geo L --881-W 404 McKinney Lucius S--867-W 405 Merrett Wilber M 408 Rohner Clarence E 1003-M 409 Watkins Ward W 410 Campbell Wm G 411 Bickers Harry M 412 Bass Virgil 413 Cash Ralph M--894-R 414 Milam Curtis L @--894-W Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 398 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. FRED LEGG Distributor -- GULF OIL COUP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil---Fuel Oil--Greases--Kerosene aPUF Phone 81, Plant 129-33 Butler St. ?* ***' Maple--(Contd) 415 McEntyre Chas M --1003-J 416 Minshew Clayton T 417 McEntyre John T --319-J 41S Hughes Millie R Mrs 420 McCurdy Wm M --867-J 422 Hibble Louis R --867-R 424 Schoof John 426 Carson Geo --89 MARBLE MILL (ELIZ)--Northwest from Church extd to bey L & N R R tracks Akins Jackson S Anderson Mack C Berry J I --633-R Bryant H Jackson Burnes J B Caldwell Cordelia E Mrs Callahan D Grady Casey Chas R Clark Connie Clayton Clarence M Cox Walter N --591-J Dobbs Johnnie A Mrs Etheridge Frank Frasure Cliff Gunter V M Hawkins W V Hombree John B Hudson O L --633-J Ivey J D Lawson Alf E Maddox Loma Mrs--1174-J Majors J Walter--408-M Millwood W T Pruitt J Alec Ravan J W Reece Geo R Richardson Dealie L Mrs Stancil Hulan Vann H Sellie Waldrop L Frank Wheeler Clifford A Wiggenton Lewis F MARGARET AV -- East from opp 1011 Church to Cherokee 108 Baskin T Edw --270-J 110 Medford Earl G @--808 MARK (ELIZ) -- Formerly Morrow, west from Rosa la, 1st south of Marble Hill Graham Martha Mrs --633-M Mab'rey Claude Stanley Clarence W Westbrook Holbert M MAXWELL--West from 314 Wright, 1st south of Henderson 101 Wilson Herman P --764-J 106 Cox Manley A 107 Turner Oscar E --1191-R 109 Jackson Thos G--1191-J 111 Vacant HITE! W. HAZEL PINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CG. PHONE 840 MARIETTA CITY DIRECTORY 399 AMBULANCE ||||||||F E4I| MAYES WARD & CO. service rnUllEi SrlSJ Marietta's Most Complete Department Store "The Best - - for Less ' Maxwell-- (Contd) t McDonald intersects 203 McGowan Hugh A --1191-W 219 McLain Jaa B --834-J McARTHUR DR -- East from Mc- Intosh av, 1st south of Page 520 a Wells Warner E b Vacant 521 a Jackson W A b Vacant 522 1 Vacant 2 Vacant 523 1 Vacant 2 Vacant 524 1 Vacant 2 Vacant 525 1 Vacant 2 Vacant 526 1 Vacant 2 Vacant 527 1 Vacant 2 Vacant 528 1 Vacant 2 Vacant 5291 1 Vacant 2 Vacant 530 1 Vacant 2 Vacant 531 1 Vacant 2 Vacant 532 1 Vacant 2 Vacant 533 1 Vacant 2 Vacant 534 1 Vacant 2 Vacant 535 1 Vacant 2 Sellers Sami M 536 1 Vacant 2 Vacant 538 1 Vacant 2 Vacant 539 a Vacant b Vacant 540 a Vacant WOFFORD OIL CO. "Be Sure -- With ROY McCLESKEYl APguernet " GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 400 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 McArthur-- (Contd) b Holt Chas M 541 a Vacant b Derrick Curtis 547 a Vacant b Yocum Geo D McCORD -- West from Winn, bet Whitlock av and Polk 201 Hope H Ewell--1027-R 203 Shaw Jas F Jr --918 205 Boatner Adrain K--964-J 206 Moore Morgan A --659-J 208 Pledger Ray B @--833 209 Teague Tracy T --124-W 211 Hardage. Ralph C 659-W 212 Cannon Sami A --412 213 Nelson Jas V Jr--124-R MCDONALD--South rom 512 Whitlock av, 1st west of Wright 107 Vacant 109 Brooks Clyde --411-M 110 Lewis Malcolm --1052 111 Barrett Geo W --737 112 Sprague John C--551-J 114 Collins Lee Roy --914 116 Dodd Forman B--9080 118 Stimson Lloyd K--764-W 120 Person Chas M H--1255 122 Barnett Jos C--435-W 124 Bean Robt L 125 Dobbs Evans P --298-J 126 Colquitt Alfred O--689-R Pomeroy ends 200 Davis Lucille --277-R 204 Cox Wm M --1294 208 Goodman Wm A --298-W 209 Satterfield Chas D--689-W 213 Brinkley Herman J --587 Maxwell av intersects 300 Orr Lilah J Mrs --277-W 303 Fowler Ralph W @--429 304 McCollum John D --1042-J 310 Bbatner W Glenn @ 316 Garner Henry McINTOSH AV--South from Page, 1st east of Cole 100 a Pilgrim Leonard P b McMichen Napoleon J 101 a Duckworth Robt K b Vacant 102 a Buckhautter Wm T b Ussery John B 103 a Vacant b Vacant 105 a Vacant W Vacant * MARIETTA LUMBER 68. * "Building Materials A Plant for Every Purpose j That Merit Good Will" Lumber--Bldg. Materials ^ Phone 357 Atlanta Road W. P. STEPHENS LUMBER @0. PHONE 840 MARIETTA CITY DIRECTORY 401 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO HOOFING TELEPHONE 688 108 GLOVER ST. McIntosh-- (Contd) 201 a Vacant b Vacant 202 a Vacant b Vacant 203 a Vacant b Vacant 204 a Vacant b Vacant 205 a Vacant b Vacant 206 a Vacant b Crowder Harry S 207 a Vacant b Covey Malcolm D McNEEL--South from Mills to Whitlock av, 1st west of W Park Square 207 Owenby Mfg Co--893 MERRITT--South from 1116 Roswell 1st east of Fairground 110 Hood Jas W 114 Woody B F Pierce ends 200 Crowe Wm E --116-J 201 LeCroy W Alton (f -116-M 204 Johnson Aubrey E 205 Scoggins R Alvin 209 a Coble Gus M b McClain Brown L 300 a Vacant b Vacant 301 a Vacant b Vacant 302 a Vacant b Vacant 303 a Vacant b Vacant 304 a Vacant b Vacant 305 a Vacant b Vacant 306 a Vacant V Vacant 307 307 a Vacant b Vacant 308 HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAInut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER C@. @ PHONE 84 402 BALDWIN'S 1944 ICE-COAL-PHONE I SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST, Merritt-- (Contd) b Vacant 309 a Vacant b. Vacant 310 a Wayland H T--886 b Vacant 311 a Vacant b Vacant 312 a Vacant 2 Vacant MILLER AV (FO) Hardy J D Hulsey Josephine Mrs Hulsey Wm J Keyes Jack W --736-J Mohon J A MILL--West from 101 Church to Husk, 2nd north of Whitlock av 200 Frey Noah S restr McCleskey Albert E billiards 201 Wilson Jos D jwlr 203 Barron Electric Co 205 Mill End Store The--1372 207 Richardson Bicycle Shop Louisville & Nashville Railroad pass depot--65 208 Nashville Chattanooga & S't Louis Railrodct pass depot--65 Railway Express Agcy Inc whse 209 Veacii Grocery Co--1037 N C & St L RK tracks cross 210 Nashville Chattanooga & St Louis RR frt depot--11 Louisville & Nashville Railroad frt depot--11 212 Oliphant Leonard R--470-J 301 Lovell J Elmer---110-J Williams Mary D Mrs--110-R MONTGOMERY--East from 900 Cherokee, 2nd north of Page 105% Worthy Martha 112 Henry Alvin 116 Reed R David--830-M 117 Wood Raymond Harold intersects 200 Allen Dock @ 202 Allens Cafe 203 Wilson Jas I 204 Minfrey Willie 205 Gregg Howard 206 Philson Fannie 207 Washington Edw 208 Warren John B 209 Riley Isaac 210 Clark Mary 211 Winkley Osborne --398-W 212 Vacant 213 Thornton Elsie 214 Vacant Meinert MARIETTA PHONE 35 florist GEORGIA I 310 ROSWELL ST. W. P. STEPHENS LUMBER 00, PHONE 840 marietta city directory 403 AMBULANCE MAYES WARD & 60. SERVICE PM0IE 549 "The Ring Leaders Since 1900" H. E. KERLEY-0. Di. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 Montgomery-- (Contd ) 215 Patterson Lovella @ 216 Vacant 217 Vacant 218 Sheats Cornelius 220 Jones Melvin M --830-J 221 Vacant 222 Williams Mose --398-J 223 Howard Jas 223% Scudders Clea 224 Gober Roy 225 Gober Katie 226 Willis Mose --830-W 227 Delk Geo 231 Hunter Lunch restr Hunt intersects 301 Minafield Harvey 303 Walkins Jessie @ 304 Hardin Lula 306 Wise Addie C 307 Vacant 308 Ramsey Milton 309 Vacant 311 McAfee Creasy tOl Blackmon Bertie L 402 Reed Louis N Louise's Beauty Shop 403 Wheeler Lillian 404 Williams Gertrude 405 Dodd Monroe J 406 Lester Jas North Cole begins 501 Vacant 502 Hodges Roy ( 503 Vacant 504 Gay Robt C 505 Peoples Arth @ 506 Vacant 507 Bell Clarence E 509 Shaw Pred 511 Hinton Wm H--101-W 515 Holsey Chapel t MOON--West from 103 Locust, 1st north of Polk 102 Smithweck G W --344-M 103 Veitch Marion O --332-W 104 Lee Jas W --885-M 105 Nunn Barney P 106 Hardage Ernest G --402-J 107 Smithweck John W --344-R 108 Allen J Eug--402-M 109 Martin Herbert L @--1299 115 Davenport Clarence E --218-J 117 Green Lee B--218-W 118 Greenway Lawson B @--321-J 119 Garner J John 121 Payne W Clayton 123 Boling Emory E--218-R MOORES AV--North from 1205 Roswell, 1st east of Barnes 107 Andrews Dorsey 108 Andrews Virgil B--352 109 Atkins Jas E 110 Pence Grady E SUITES CANDY SUMMIT L. E. CARTER, President MANUFACTURERS OF HI-GRADE STAPLE CANDIES -- ROASTERS AND PACKERS OF SALTED PEANUTS 301 Husk Street Phone 1041 W. P. STEPHENS LUMBER 60. PHONE 340 404 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Moores--(Contd) 111 Vacant 112 Vacant 114 Page Cecil --947-J 115 Elrod L --1286-W 116 Powell H Clifford --947-M 117 McKibben Roy J --1286-J 120 Chalker Steph A --947-R 121 Hollingshead B 123 Wallace Glenn 124 Clackum Chas L --1148-J 125 Jarrard Eston 126 Westbrooks John T 131 Frier Clyde E 232 Casey Jas H MORNINGSIDE DR--East from Allgood rd, 2d north of Page 600 1 Darden John W 2 Vacant 601 1 Vacant 2 Vacant 602 1 Broom Jas L 2 Adams S M Jr 603 1 Vacant 2 Vacant 604 1 Newsome Joe B 2 Vacant 605 1 Shealy Forrest H 2 Vacant 606 1 Manley Raymond T 2 Young Norb'ert M 607 1 Wilson Sami U 2 Vacant 608 1 2 Mintz Harold S 609 1 Vacant 2 Vacant 610 1 Peavey Ellis W 2 Gaughan Thos C 611 1 Vacant 2 Vacant 612 1 Vacant 2 613 1 Vacant 2 Vacant 614 1 Vacant 2 Howard Lamar 615 1 Vacant 2 Vacant FOREST 0. BROOMS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 I. P. STEPHENS LUMBER 00. P101E 840 marietta city directory 405 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 furniture co Complete Home Furnishers In Marietta Since 1916" Morningside--(Contd) 616 1 Vacant 2 Brock R H 617 1 Galoway Doyl H 2 Vacant MULBERRY--East from Harold, 1st north of Montgomery 101 Bentley Cleve 103 Dillard Minnie 104 Vacant 105 Garrett Artie 105% Vacant 106 Clements Paul 107 Jackson Sol 107% Soloman Jas 108 Strickland Homer 109 Copeland Clara 110 Vacant 111 Nelson Elmer 112 Daniel Willie M 113 Bates Emmett 14 Lester Hubert 115 Dew Drop Inn --9127 116 Tellars Joe 117 Maddox Nathl 118 Vacant 119 Parker Leon 121 Lester Clarence 122 Vacant 123 Reynolds Daisy 124 Vacant 125 Vacant 126 Hunley Theo 130 Garrett Willie 133 Jackson Caroline --83Q-R 135 Shaw Plorine Hunt intersects 204 Gober Jos 205 McConnell Ephiam 206 Strickland Mary 207 Green Fredk 208 Hollemon Mattie 209 Gober Levi 210 Church of God in Christ The 211 Padgett Walter @ 213 Beavers Plina 213(2) Scott Leslie 214 Clements Jas I 215 Young Narcissus 305 Wood Vinie N Cole intersects NELSON--West from Kennesaw av at city imit Cabrera P Homer Clackum L Clackum Nolan H Fowler Rubye T--428-R Hurst D Lemuel Spinks F L NEWTON (Eliz)--Northeast from intersects of Cherokee and Church Newton L Pauline Mrs PEERLESS FURNITURE W, 1. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 406 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW THE HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINOS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL. Pres. P, G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. NORTH AV (Eliz)--North from 120 Lacy, 1st east of Rose la 103 Brimer L Dewey 106 Tucker Emerson 107 Moss Robt E 108 Wilmoth L E 110 Dobbs John R 111 Ellison Walter E --474-J 112 Rickman T Clifton 113 Hester Clyde 114 Clackum Homer 115 Barmore W C 116 Morgan Geo W 118 Fraser Benson Church of God The White Loyd J NORTHCUTT--South from Whitlock av, 1st west of McDonald 105 Young- Henry K 119 Smith Clarence A --832 127 Lindsey Homer M --436-W OAK--West from 51S Cherokee to Church No houses OAK AV (Fair Oaks)--South from Barber rd, 1st west of Joyner Abercrombie T Everett Boozer Jas C Goss Marshall M Hardie Willie H Metcalf Claude F Purcell Boyd H Purcell Frank M OAKMONT DR--North from Whitlock av, 1st west of Winn 100 Fletcher E Truman --815 101 Brumby Robt E --975 102 Lemmon Wm P--427 103 Brown Chas M --600 104 Legg Joe P --1027-W 105 Torgersen Raymond A --798 OSBORNE (FO)--Westerly from Austell Rd in Fair Oaks Edwards Robb L Goss Frank C Luffman Jack B Turner G P OLIVER--See Lakewood av PAGE--East from 624 Cherokee, 1st north of Gober 106 Henry Robb' A 107 Anderson Chas 107-a Vacant 107-b Vacant 107-c Jennings Ludie M Carlisle W Howard @ 108 Brewer Ida Chambers Henry L 112 Smith Walter PHONE se OLDEST -- LARGEST -- BEST Nl-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- , 0"TMSEI W. P. STEPHENS LUMBER CO. PHONE 84 MARIETTA CITY DIRECTORY 407 MAYES WARD & CO AISERVK^ECE PHONE 549 A. D. LITTLE - AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Page--(Contd) 113 Terrell Pleas 114 Rogers Lillie 115 Williams Mary 116 Vacant 117 Maxwell Frances 118 Taylor Bertha K Elk begins 200 Vacant 201 Harris Roy 202 Robertson Joe 203 Vacant 204 Hudson Wilbur 205 Hood Cath 205-a Hamilton Isaac Harold begins 301 Oliver Clyde, 303 Crawford Wm 305 Miller Millard 307 Padgett John 307-a Newton Willie Mae 309 Head Chas 309-8, Vacant 311 Jones Pearlina 311-a Minniefoe Baswell 313 Owens Minnie, 315 Fergerson John 317 Graham Willis 321 Vacant 325 Union Chapel 327 Austin Herbert 329 Black Andrew C 401 Wright Ann Mrs --121 Hunt intersects # ** Cole intersects 504 Cole Bayard--134-W Cole Constance--134-R Jones Eug T--498-J 505 Boatner Florence B Mrs --202 509 Brown J W 510 Schuster H Fredk E Jr 511 Vacant 512 Hipps Gideon E 513 Nu-Way Clnrs & Lndry--60 Lindsey Sanford J --573-W 517 Gunnen Sallie 520 Orrell J Gordon 521 Collins Ellen M Mrs 523 Gibson Ray @ 524 Murphy Jack 526 Vacant 527 Bettis R C 528 Rumsey Howard L 530 Ricket R Douglas 531 Vacant 534 Vetter W Theo 535 Cranmer Chester E --1072 538 Vacant 539 Bryan Carl W 540 Vacant 600 Brewster Jos S 602 Mangum Chas R 603 Croop R W 604 White Napoleon 605 Mentz Albert W PHONE "The Friendly Druggist" ATHERTON PHONE * DRIG COMPANY 7 WALGREEN AGENCY W. P. STEPHENS LUMBER CO. PHONE 849 408 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND I P. E CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 Page-- (Contd) 665 Wilson Elbert G--164-W 700 Kratokvil Frank M--668-M 701 Plemel Frank J--668-R 703 Downey Lynn. C 705 Crowder Geo T 707 Bowling R E 711 White John R --573-R 712 Willauer A Osborne 713 Stoney John W Atkins Luke E Beavers Nellie M Mrs Brackett Willie Mrs Clackum D Clackum Ernest--668-J Georgia Power Sub Sta Loggins Kinney M Mulkey A F Raines Fired Rogers Henry Rev Rogers Vina 1126 Bettis Geo T --1262 Brantey Eliz B Mrs Casey Hilbert P Casey Julia B Mrs gro-- 269-W Davis Body Shop Davis Thos L Jr --1111 Dyson V Ray Freeman John Moore Noma Mrs--905-W Shaw Peter C --903-R Thomason Alf H %--683-J RADIUM--East from 200 Rose la, 1st north of Sessions 103 Holeprobf Hosiery Co commissary restr 105 Steel Homer T--461-M 107 Evans W L- -115S-M 108 Holeprobf Hosiery Co, side ent 109 Milam E Edw -461-R 111 WatSinsi R L--1158-J 113 Pettyjohn Don E--461-W 200 Kemp Ima Mrs--1158-W 201 Black John H 202 Jay Roland F--i6l-j 203 Bell W B 204 Brown Horace W--1158-W 205 HObbs Willard P RAMONA.--Eaii Irorii Mgbbd rd, 3d north bit Page 600 1 Vacant 2 Vacant 60i 1 Vacant 2 Vacant 603 1 Vacant 2 Vacant 604 1 Vacant 2 Vacant 605 1 Vacant 2 Vacant 606 1 Arnold Henry D 2 Vacant 607 1 Vacant 2 Vacant 608 1 Vacant 2 Vacant 609 1 Vacant .o f4i/. ^ WOFFORD OIL CO. "Be Sure -- With Pure" ROY MeCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. PH0NE140 416 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Ramona--(Contd) 2 Vacant 611 1 Vacant 2 Vacant 612 1 Vacant 2 Vacant 613 1 2 Vacant 614 1 Vacant 2 Vacant 615 1 Vacant 2 Vacant 616 1 Vacant 2 Singleton Dennis J 617 1 Morrison Wilbur C 2 Vacant RAILROAD AV--See Cleveland av REYNOLDS--West from W Atlanta, 1st north of Goss 107 Chapman Buck 109 Boring Oscar L 111 Young Ernest E 113 Hipps Mary 115 Foster Irene J Mrs 117 Hipps Clara --183-J Powder Springs intersects 207 Patterson Rolow W --695-R 209 Reece John T 211 Broadnax Hezekiah K 213 Mitchell Isaac 215 Rogers Benj 217 People Azzle L 219 Trout Eliz 220 Jackson Robt H Jones begins 300 Hazel Walter W 302 Head Geo 304 Wright Chas 306 Brunson Jas 308 Peoples Herbert --1195 310 Bryson Lem 312 Blakey Susie F 314 Vacant 316 O'Neal Amelia --1121 WTright intersects 400 Henry Peggie 406 Perry Steve 407 Reeves Willie F 408 Webb Leonard 409 Johnson Ruben 410 Daniel Gussie 411 White Lou 413 Head Peter 414 Merriweather Walter 415 Lee Gertrude 416 Peoples Nannie McDonald ends GENUINE FLINTKOTE ROOF IS A SMART INVESTMENT LUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD W. P. STEPHENS LUMBER CO. PHONE 340 MARIETTA CITY DIRECTORY 417 FUNERAL DUANE EJIQ MAYES WARD & CO. DIRECTORS rnUNE F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. Reynolds-- (Contd) 500 Maxwell Artie 504 Floyd Lawrence 506 Veal Gracie RIDGE AV--North and south from Polk, 1st west of Brown av No houses RIGSBY--North from 607 Lawrence, 1st east of Lake 102 Mints Carrie 104 Evanston Bradley 105 Burke Louisa 106 Bell Effie 108 Goolsby Barber & Beauty Shop Goolsby H Jefferson Fort intersects 204 Carter Florene 205 English Thos 207 Gilbert Wesly 208 Durham Chester 209 Davis Allen 210 Vacant 212 Christian Henry gro 213 Shaw Lizzie 215 Young Clarence 216 Vacant Lemon intersects 300 Bedford Joe M 306 Mosely Mattie 307 Phillips Irene 307% Vacant 309 Dobbs Ethel 310 Bedford Andy ROBESON CT--East from Cole, 1st north of Fort 406 1 Oliver Elmer 2 Jackson Jas 3 Evergin Jas F 4 Harris demon 5 Jefferson Eug 6 Black Bertha 7 Weems Jos 8 Gresham Newt F 408 1 Ham Jas 2 Lockhart Jos 3 Beaver Jas E 4 Harris Jas 5 Arnold Otis 6 Adkins Ludie 7 Carter Octave 8 Gregory Talmadge 410 1 Ferrell Mitchell 2 Hunt Oliver 3 Grogan Hugh 4 Tillman Edd 5 Bryant Albert 6 Lusther Jas 7 Lusther Solomon 8 Scott Clomer HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 418 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. ROGERS--North from 901 Roswell to Washington av 112 Caldwell Geo V @ 114 Preece Mrs ROOSEVELT CIR -- East from Cole, 1st south of Page 509 a Hall Roland A b Vacant 511 a Vacant b Hewin Clarence L 512 a Vacant b Vacant 514 a Forehand Gary C b Vacant 516 a Vacant b Jackson Frank 518 a Vacant b Vacant 519 a Vacant b Vacant 520 a Vacant b Vacant 521 a Vacant b Vacant 522 a Vacant b Vacant 523 a Vacant b Vacant 524 a Vacant b Walters Allen J 525 a Vacant b Vacant 526 a Vacant b Vacant 527 a Vacant b Vacant 528 a Vacant b Vacant 529 a Vacant b Vacant 530 a Vacant b Hilton Walker H 531 a Vacant b Vacant 532 a Sanders Rodney W Meinert MARIETTA * PHONE 35 florist GEORGIA 1 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 419 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 "The Ring Leaders Since 1900" H. E.KERLEY-0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 Roosevelt Cir--(Contd) b Vacant 533 a Vacant b Vacant 534 a Rogers Geo S b Vacant 535 a Vacant b Vacant 536 a Vacant b Vacant 537 a Vacant b Vacant 539 a Vacant b Vacant 542 a Vacant b Vacant 543 a Vacant b Vacant 544 a Vacant b Vacant 545 a Vacant b Vacant 546 a Vacant b Vacant 548 a Vacant b Vacant 55Q a Vacant b Vacant 600 a Davis Lallie J b Reese Melvin C 602 a Marston Wm G b Camp Sanford W 603 a Mauldin Wilber A b Vacant 604 a Vacant b McGrath Leo 605 a Vacant b McCray Geo H ROOT -- North from 25 N Park Square, bet Church and Cherokee 105 Root Street Berber Shop 107 Millwood's Lunch Rm 108 Pettibone Bros Mfg Co 110-12 Marietta Hosiery Co work rms Hansell intersects Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PHONE 840 420 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND `ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Root--(Contd) 211 Fylant & Cook 821 Sanders Claude L 823 Vacant ROSE LANE -- North from Keimesaw av, at intersection, of Sessions 100 N C & St L R R 106 Holeproof Hosiery Co sales ofc 107 Holeproof Hosiery Co box dept Sessions ends * * .* Radium begins 204 Holeproof Hosiery Co employ- ment ofc 205 Holeproof Hosiery Co office 206 Holeproof Hosiery Co training dept 208 Roselane Baptist Ch 210 Smith Rurie B 212 Vacant 214 Lee G Sherman--235-R 216 Brown Jas H 218 Butterworth W H 219 Williams Sami W -196-W 220 Peppers Charlie R 221 Black Austin 222 Barrett Roy L--196-J 223 Frasure John L 225 Butterworth Howell Lacy begins 300 Anderson Zeb 801 Gavin Edw M--251-J 820 Farmer T J ROSE LANE (ELIZ)--A continuation of Rose la bey city limits Anderson Mamie L Mrs Anderson Walter W Barnes Dollie Mrs Blackstocli W L Blancher LB Brown T N Bullock Thos Burnette Wm L @ Cantrell Ralph G Rev Carter Millard K Coffey G Monroe --61-M Clark Ernest M Coleman Claudia M Collins Carlyss W Dobbins Geo W Dobbs Lelia Dobson Prestone D Doss Leroy Doss Lillie P Mrs Drummond W C Durham Bessie Mrs Edwards Fuller Elrod Jas R Graham Leon Hillhouse MM Hogan Jos Holcombe L C Mrs--633-XW Hunicutt Wm F F0IEST 0. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 841 MARIETTA CITY DIRECTORY 421 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 phr"n Comipt letie r Hoe me co Furnishers In Marietta Since 1916" Rose Lane--(Contd) Hunter Ella Ivey Howard Keener J W Laird Robt E McCurley Oscar Minter Wm L Mt Calvary Baptist Ch Newton Roy E Orton Wm R Petty Jas W Petty Lawrence W --199-J Petty Mary Poore Chas Richardson N B Rucker G M Smith Herschell S Spear Chas C --61-R Stephens Walker D gro Tilley Jas D Thurmond Felton M Tucker Floy Mrs Tucker J W Watson Izora Mrs Wigley Jas W Wilson Marion E Rev --61-W Wisener C J Worley Sanford T --9121 ROSWELL -- Southeast from 118 Washington av to Coryell, thence east to city limits 100 Patterson Tate 108 Atkinson Mary --74 111 Five Points Service Sta 112 Hardeman Orilla Haynes begins * * * Anderson intersects * # * Green begins 200 Medford Walter 200-a Roach Quilan E --1243-M 201 Parker Chas R 204 Abbott Carl W--1165-M 206 1 Pitner Fred L 2 Shattles Jas W 207 Dobbs Hal D 208 Hays Berryhill H 209 Hattoway Mary 211 Tyson Marshall O--1243-J 212 Barnes Ida L --447-R 218 Keefe Fred W --'713 220 Groover Luther L --1066 Atkinson begins 300 Welch Emiy E Mrs --175-J 303 Camp Horace M--295-M 305 Church of Christ 306 Phillips John P--291 309 Brisendine Roxie P Mrs @-- 106-W 310 Meinert Josie C Mrs 310 y2 Meinert Florist--35 311 Lewis J Homer --728 313 Powell Lewis V --1009-R PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 422 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW TIIK HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY TAKE RENT COBB COUNTY FEDERAL SAVIN6S Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty, Roswell-- (Contd) 401 Roswell Street Gro--1089 402 Vacant 403 Happy's Service Sta 404 Pair Jas A 405 Church of Christ 410 Vacant 413 Gentry Geo M--1009-W Coryell begins * Sp .# Cole begins 500 Groover Jos D --598-J 506 Marietta Coca-Cola Btlg Co Inc --70 Lakewood av begins 600 Mashb'urn Olin E Marietta Credit Service--567 604 Wright Lillis L Mrs--443-R 606 Russell Zachariah T 608 Hollingshead John H Beaver begins 700 Honea Charley A 702 Barron Lenward H 706 Vacant 810 Groover Jas H--354-M rear Rice Lizzie 716 Allgood Addie W Mrs @--383-R 716% Gillam Roney N 722 Vacant 726 Jordan W Paul--617-W 728 Vacant 800 Clackum Thos W 804 Hamby Thos j --212-W South av begins 900 Keown Roy L 901 Wilson Jos E 903 Vacant 905 Reece Thurloe R 909 Vacant 913 Matthew Jos D Covington begins 1000 Brown Herbert W 1002 Morris Arnold M 1005 Vacant 1006 Wright John A 1008 Sams LeRoy 1009 Newton Walter T 1015 McConnell Clyde E gro--1075 Fairground begins *1* *5* 5' Black begins 1101 Vacant 1104 Scoggins Fronie B Mrs -- 747-J 1105 Vacant 1106 Wooten Hassie B Mrs 1107 Vacant 1110 Bentley Thos P --974-R 1114 LeCroy John T --787 1116 Vacant Barnes begins * * * Merritt begins 1200 Jay's Chapel 1201 Wright Claude L--859-J 1205 Pruitt Wade--102-R PHONE 68 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 423 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 A. D. LITTLE - AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 Roswell--(Contd) 1210 Vacant Moore begins * * * Park begins 1300 Vacant 1301 Spears Edw P 1303 Attaway Nannie M Mrs 1307 Randall Jas W 1309 Kerley Jas L --741-M 1310 Vacant 1311 Frey Jolin S --859-W Austin av begins 1400 Vacant 1401 McIntosh Rader E --859-M 1402 Brown Jas R 1403 Groover Hugh --52-J 1406 West Frank 1407 Vacant 1408 Vacant 1410 Muse Homer F 1412 Reece Forrest D 1414 Webb Rex L Ayers av begins 1501 Marler D C 1504 Roswell Street Baptist Church --1273 rear Farr Hoyt G Rev--1273 1505 Vacant 1506 Zane Frank E--754-M 1508 Luedtke Arth--754-J 1509 Schroeder Fred gro--795-J 1510 Vacant 112 Atl&nts St. 1511 Vinson Carlton J 1512 Reitz Arth 1513 Vacant 1514 Goetz John A--245-W 1515 Moon Darling J --696-W 1517 Moon Gro 1519 Moon Robt T @--872-W 1525 Abernathy Carl --723-W 1528 Roswell Street Baptist Ch 1607 Gaines Jas W --754-R 1611 Dickerson Theodosia D Mrs --1070-W 1801 Lutz Alford M 1805 Panter Danl W 1809 Green Lemma G Mrs 1813 Maxwell Benj G 1902 Vacant 1908 Kent Homer J 1912 Carter Wm L --52-R 1916 Poteete Robt L 1919 Wallace Jas W--1018 1920 Fortner Howard L 1924 Smallwood Lee 1926 Millwood Henry J Megarity Edw G Smith's Service Sta 2D--South from Clay, 1st east of Fairground 603 1 Freeman Geo W 2 Bell Parks M 3 Street Fred C ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Floivers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER C. PHONE 840 424 BALDWIN'S 1944 ICE-COAL PHONE 1 SOUTHLAND I C E CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1.083 2nd S--(Contd) 4 Gentry Wm W 5 Thomason John H 6 Conley David K 664 1 Miller Pledger 2 Connalley John M 3 Kendrick Robt L 4 feering Frank C 5 Courtneay Catlile Jr 6 Orton Lee 606 1 Smith Wm B 2 Adams Elgin C 8 Harfiriek Bewey A 4 Vacant 5 Thompson Robt R 6 Lenkeit Edwin A 606 1 Hand Aiding T 2 Adams Wm T 3 Lawrence R Edson 4 Campbell Jessie W 5 Breedlove Jim B 6 Johnston D Russell 607 1 Sloan Ralph M 2 Vacant 3 Elliott Wm B 4 LowO Wm C 5 Vacant 6 Cordie Andrew E 608 1 Patton J E 2 Freeman G R 3 Waites John L 4 Ayers Cleo A 5 Moore Wm T 6 Reynolds J D 609 1 Simpson J A 2 Vacant 3 Cain Wm E 4 Foust LeWis B 5 Strickland Wilber H 6 Prewett Earl D 610 1 Baldwin W E 2 Holcomb Warren J 3 Cherry C H 4 Young Glen W 5 Myers Glynn A 6 Howell J H 611 1 Richard W Clelhon 2 Vacant 3 Sutherland Louis 4 Burtchfield W D 5 Bogan Leslie E 8 Vacant 612 1 vacant 2 LeRoy H Alvin 3 Williams C Buford 4 Kendrick R C Jr 5 Bums L L "Serving Cobb County Since 1900" Westinghouse ||. N. DllPRE Stoves and Appliances and Radios m m m m "" Wholesale and Retail " Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER Ci. PHONE 84 MARIETTA CITY DIRECTORY 425 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Earl G. Bedford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. 2nd S--(Contd) 6 Gibson Clarence E 613 1 Hammond Richd M 2 Rudolph Wm J 3 Keener Irwin D 4 Agan Chas A 5 Rembert Davis M 6 Bisnon Oscar L 614 1 Harris B R 2 Allen Ralph L 3 McKinnon Marvin W 4 Bagwell Howell 5 Anderson Ira O 6 Payne Arvie E SEMINOLE DR--East from Cherokee, 1st north of Freyer dr 100 White Steve C @--294 101 Cook Fred E @--721 102 Overcash B Bruce @--681 103 Montgomery Geo F Jr @-- 771-W 104 Johnson Paul E @--773-M 105 Vacant 107 Vaughn Dwight 111 Vacant Etowah dr intersects 200 Morris Fred --504-J 201 Veach Grady A @--707 202 Montgomery Wallace M @-- 933 Telephone 1098 203 Thomas Geo @--299 204 Claiborne T Sterling--329-J 206 Vacant 208 Read Robt C--955-R 209 Dunnaway Wm H --773-R Chicksaw dr intersects 300 Vacant 303 Tribble L Revere --797-R 403 Eaton Wm A --492-R 405 BUrt Byron T SESSIONS -- West from 801 Church to Kennesaw av 202 Anderson S T--988-R 203 Jones Julius C --818-W 204 Runyan May Mrs @--166-J 205 Northcutt Geo T Jr--203-W 206 Groover Simpson- @---384-J 207 Underwood E D --403-J 207% Gifford Eug --- 433-M 208 Landers Linnie G M @--403-W 209 Swanson Mae Mrs @ Mann H S--818-J 210 Dawson Ida R Mrs --816-W 211 Bell Lula @ Caldwell A Jack--109 212 Gibson Gro Gibson Mary L Mrs --816-J Bishop Albert H--816-J 216 Copeland Paul C --650 Campbell Hill intersects 300 Hill's Gro--1015 Hill Clarence REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Qpp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOTJR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 426 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, 10. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Sessions-- (Contd) 302 Beaver Buford A 304 Young Mary Lou Mrs 308 Eubanks Marion 310 Vacant 310% Vacant 332 Clackum Roy A 355 McNeel Marble Co The--19 356 City Artesian Well No 8 SHEPARD--North from 115 Lawrence, 1st east of Holiday 104 Gholston Sami 108 Johnson Wm E @ 109 Glover Dave 110 Carter Harold G 111 Vacant 113 Coleman Clifford 6TH--Southwest from 1st 700 1 Howard Buford B 2 Dimsdale Ceb'orn O 3 Nix O M 4 Wiley Herbert C 702 1 Vacant 2 Haslett Geo T 3 Merrill E K 4 Wehunt Clyde A SOUTH AV--South from 804 Roswell, 1st west of Fairground 106 Boring Herman W --1269-J 107 Smith Walter W--1192-XM 108 Barfield John M 109 Jordan Claude M --1164-J 112 Price Wm C 113 Barfield David D @ 114 Brown Chas A 115 Barfield Harry C 118 Cantrell Clarence P--899-W 119 McAfee John A Jr --601-W 120 Prey Noah S --601-R 122 Vacant 123 Scott Weyman W 124 McAfee Howard D --653-J 125 DuPree Lula C Mrs 126 Hubbard Vanburen 130 Caldwell Biddie R Mrs @ 131 Wallace Byron C --115-W 138 Vacant 139 Spoke G Sami fir sander -- 115-J 207 Yarbrough Wm B --1192-J Waterman intersects 210 Vacant 211 Barfield H Hillard 300 Vacant 302 Cowart Carl J 303 Apartments 1 Vacant 2 Vacant 3 Hennigh Clifford E 4 Thornton Calloway L 304 Vacant llntpl STRICTLY MODERN noiei r leici weekly rates 200 Church St. Rates from $1.00 Phone 9116 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 427 mm ward & co. AMBULANCE SERVICE PHONE 49 HOME OWNED -- HOME OPERATED PHONE 60 NO-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments'' 513 Page Ave. S. J. LINDSEY Owner South av--(Contd) 305 Apartments 1 Stuart iVm D 2 Gilmer Edw C 3 Timmons John L 4 Mosley John W Franklin intersects 415 Saiey Green STEPHENS AV--North from Clay, 1st west Of Stokes av No houses STEWART AV--West from Kennesaw av, 1st north of Holland 103 Garrett Hoyt H 109 Morris Eliz E Mrs 111 Hann Claude E 200 Smith Vallaha Mrs 201 McGee Ralph H 202 Wilson Walter B --475-J 203 Fincher Lula --1257-M 204 Conroy Virgie L Conroy John W --266-W 206 Stanley Jas M--943-W 207 Harris Hugh W--372-W Hyde Horace L @ 208 Jordan Starling E --654-W 301 Langford Mana K Mrs 302 Hicks Jas L 303 Brown Jas H --353-R 304 Erasure Hunter 305 Hicks Lillie H Mrs --353-W j 306 Hardage Henry M --871-J 307 Durham Nathan J --654-J 309 Durham Elmer W 500 Lowery Jack E --871-W 507 Hulsey Albert J --353-M 508 Vacant 510 Vacant 514 Hilderbrand Almon L--639-W 515 Ellis Haughton D --871-R 517 Cornette Jas E --142-J 535 Frederick Walter G 550 Prewett John O --142-W 550 Pruitt John A --142-W SUMMIT--East from 210 Fairground, 1st south of Pierce 108 Hardage Frank R--252-J STOKES AV--North from Clay, 1st west of Manget 102 a Barber Frances C b Raines Harley H 500 a Gibson Carl J b Vacant 501 a Hiatt Herbert F b Vacarit 502 a Notgrass Jas B b Henderson Grady H Invest At Least YXT J 1P$ io% in Vv ar Donds W. P. STEPHENS LIMBER CO. PHONE 840 428 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling PifliPC. r&aVHEd- 215 14 CHURCH 10 102 LEMON net MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPEB, CLOTH, ETC. Stokes--(Contd) 504 a Vacant b Vacant SYCAMORE--South from 204 Clay, 1st east of Atlanta 105 Vacant 200 Vacant 201 McLarty Jas F 3RD CT-- 101 1 Wims John 2 Casto Theodore 3 Sinyard Lawrence G 4 Casteel Frank 102 1 Farmer Martin C 2 Daniel Oscar T 3 Holcombe Herman M 4 Huff John H 103 1 Ledbetter John E 2 Sykes Walter D 3 Daniel Geo F 4 Wofford Geo F 5 Humperley John H 6 Curtis J M 104 1 Vacant 2 Douthit Geo E 3 Cumby Robt 4 Landing Oscar D 5 Haywood G L 6 Vacant 3D--South from Clay, 2d east of Fairground 801 1 Vacant 2 Nicholson Jas W 3 Snipes Willie E 4 Ozbum Idus V 5 Barbaree Emery J 6 Vacant 603 1 Clements Phillip 2 Anthony Glenn B 3 Singleton Doyal L 4 Robinson Arth 5 Kelley Wm T 6 Vacant 605 1 Vacant 2 Wheeless Otis F 3 Adams Roy A 4 Moss Elmer 5 Gilstrap Geo W 6 Vacant 807 1 Vacant 2 Golden Walter B 3 Nance Lou T Jr , 4 Harrington W A 5 Howard Henry J 6 Vacant SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 429 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 45 W. Park Sq. "The Exclusive Store for Men" Telephone 331 3rd--(Contd) 701 1 Sasser Ossie L Mrs 2 Burton John P 3 Norton Fred 4 Partain Harry D 5 Dennis Geo R 6 Pope Win T 7 Duhle Warren C 8 Greene J L 703 1 Spence Louie D 2 Moore H C 3 Wellman Odell H 4 McGaha Garnett 5 Gray Edw 6 Beck Chas C 7 Rogers Geo H 8 Lockaby Wm W 705 1 Howe David H 2 Fox Jeanne 3 Shaw Richd M 4 Norton King C 5 Harmon Clifford E 6 Gillean J W 7 Nunn Robt M 8 Vacant 707 1 Lytell S W 2 Miller Edw F 3 Morrell Otto C 4 Snell Louie F 5 Williams Jas E 6 Gaines Sami A 7 Ried H H 8 Manley Theo G 709 Vacant Vacant Vacant Vacant Vacant Vacant Vacant 8 Vacant 711 Vacant Vacant Vacant Vacant Vacant 6 Vacant 7 Vacant 8 Vacant 801 1 Hitchcock Jas F 2 Crabtree Floyd N 3 Day K A 4 Hammond Leonard G 5 Robinson Bruce 6 Robertson Paul 803 1 Vacant 2 Vacant 3 Ward Jos M Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 430 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. GULF FRED LEGG Distributor -- GULF OIL CORP. Good Gull "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene GWF PAT-0^ Phone 81, Plant 129-33 Butler St. 3rd--(Contd) 4 Taylor Nolen J 5 Coyle Ernest H 6 Vacant 804 1 Gentry Kenneth 2 Edwards Larking B 3 Brown John R 4 Morris R T 805 1 Moore Jack D 2 Vacant 3 Erwin S Ottis 4 Mazy Jules 5 Parker Harry 6 Ballard L C 806 1 Yarbrough Jas B 2 Grantham Robt 3 Hillsman Thos 4 Cash Sandv D 807 1 Camp Geo W 2 Vacant 3 Smith V 4 Lee G 5 Lewis Fred C 6 Rex John T 808 1 Clarke Chas E 2 Palmer Walter P 3 McGraw Chas E 1 Norman F Jas 2 Spratlin Edgar B Jr 3 Jordon Steve W 4 Hughes Jos C 902 1 Lester L D 2 Kinney W L 3 Lanharn Wm C 4 Wagner Edw E 904 1 Heath W Barton 2 Simonds Claude 3 Scarbrough Edgar M 4 Lane R A 5 Roberts J F 6 Hughes W A 906 1 Tillson Jas E 2 Lawrence Starling J 3 Wells Walter C 4 Gooden Melvin C 5 Carney Geo 6 Morgan Robt L TOWER LANE (ELIZ)- -East from Rose la TOWER RD (Eliz) --West from Campbell Hill to L & N RR tracks Atkins G E Atkins Sarah Mrs Bishop Robt Burton Alma Mrs (H) WLTE W. HAZEL TiJTMU DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 431 MAYES WARD & CO AMBULANCE DU All C CAQ service r nUIV II A W" TTTJ^I Marietta's Most Complete m I IB Department Store U jL-A^9"The Best - - for Less'' Tower Rd--(Contd) Byrd Guy T Carter Clara M Mrs--1174-R Cauitt Marshell W Conner Geo W Dover Gordon L Irvin Maggie Evans John Groover Lewis C Hambree Fayette Henry John D Hunnicutt Clarence Laird W P Lindsey Geo S Nix W Simpson Parris T A --199-W Ray Thos W Riddings Troy F --1174-M Smith Elmer Summerall Clifton L Upshaw Erby Winters Clarence J TRAMMELL--West from opp 330 Powder Springs, 1st south of Henderson 106 McBride Sami J--1186 108 Lawler Loyd V--214-W 110 Roberts Esther L 112 Mahon Chas C 114 Baldwin Henry E 116 Smith Jerry B--189-M 119 Ridgeway Anna J Mrs --343-J 122 Shaw Emma I Mrs --111 123 Eargle Jas I--214-R 126 Jones Virgil M--570 127 Greer Eva J --189-R 129 Worley J Clements --73-W 130 Henderson John H--1084 131 Roberts R Pepper--374-J 132 Hill Robt H--709-W James Luther C--460 133 Pettett Dock A 135 King Lorraine Mrs--343-W 136 Payne A Jackson--237-R 138 Lively Hubert M--1036 139 Johnson Wm M --73-J 140 Dunn Wm H --493-J 141 Du Pre T Eug--873-J 142 Hinds Paul H--725-J TUCKER--East from 11 E Park Sq 1st north of Washington av 111 Brumby Furn Co side ent 112 City Jail 113 Shaw Monto & Son feeds--671 VANCE CIR--Northwest from 111 N Forest av to 207 same 106 Coggins R L --351 113 Tate Eliz Mrs --744-R 115 Dickson JoS S--385-M 117 Smith Elmore --744-W 119 Covington Edw D --1114-W 120 Couch J H--413-R 121 Brumby R E--1135-J WOFFORD OIL 00 `Be Sure -- With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 \ss/'. ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. PM 432 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Vance Cir--(Contd) 123 Butterworth Jack E--385-R 124 Branson Thos C --761 125 Vacant 127 Blanchard Scott D --326-W VICTORY DR--South from Roswell, 1st west of Aviation rd 202 McCronie Jas 204 Nelson Jas J--154-R 206 Ossler Richd--569-XJ 207 Hawkins Floyd W--154-XW 208 Henrick E Douglas--569-M 209 Dickie Roy N 210 Simpson Wm G--1576-R 211 Wings Jas S--569-R 213 Crown Teadwell R Jr--569-W 215 Chastain Clyde--154-R 408 Bittinger Bert C 410 Varriai Ralph W--891-J 412 Peterson Emil S--891-M 501 Victory Homes of Harriett Inc office 508 1 Vacant 2 Vacant 509 1 Overcash Walter D 2 Smith Allen 510 1 Burger Clarence 2 Trafton Roland M 511 1 Pitts Henry D 2 Vacant 512 1 Vacant 2 Smith Dessy D 516 1 Vacant 2 Young Buna L 518 1 Vacant 2 Vacant 520 1 Vacant 2 Vacant 601 1 Stoker Geo W 2 McCrary Wm D 602 1 Bhchana Manon 2 Vacant 603 1 Vacant 2 Vacant 1415 1 Vacant 2 Crist Vernon W 1418 1 Chandler Fred J 2 Glenn Earl VISTA CIR--Northwest from Victory dr, 1st south of S Park dr 513 A GENUINE FLINTKOTE R 9 IS A SMART INVESTMENT MARIETTA LUMBER CO. DUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD W. P. STEPHENS LUMBER CO. PHONE MARIETTA CITY DIRECTORY 433 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 ti F. P. & BOB" LINDLEY Consignees-- THE TEXAS COMPANY "Fire Chief" and "Shy Chief" Gasoline Texaco and Havoiine Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. Vista Cir--(Contd) 1 Vacant 2 Vacant 515 1 Vacant 2 Culley Thos M 517 1 Boland Arth C 2 Morgan Jas 519 1 Haynes Thos J 2 Warren Coy 521 1 Peeler Porter C 2 Miller Harlan 523 1 Garber C Leighton 2 Roswell Danl D W W LEE CT--East from Cole, 2d north of Fort 406 Apartments: 1 Bates Henry 2 Grady Robt L 3 White Roy 4 Woods Marion J 5 Horn Fred 6 Ballard Robt L 7 Jackson Thos E 8 Jackson Gilbert L 9 Collier Willie C 10 Nelson Durrell 408 Apartments: 1 Smith Wm T ' 2 Holmes Mary 3 Vacant 4 Daniels Willie 5 Blalock John 6 Davenport Louise 7 Towns Emma 8 Meyers Roy T 410 Apartments: 1 Powell Wm 2 Grogans Robt L 3 Sims Thos 4 Miller Sami 5 Bryant Susie 6 Henry Lila 7 McAfee Henry 8 Head Elmer 9 Bedford Edw W 10 Harris Lester WADDELL N--North from 201 Washington av, 1st east of Cherokee Hanley Co garage 200 Cash Lawrence W Tucker intersects * & Lawrence intersects 305 Lingerfelt J Sami 306 Vacant 307 Silk John--620-J Hansell intersects 400 Gidish Geo D HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAInut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 434 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVIN6S & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. Waddell--(Contd) 401 Stephens Veania W Mrs--780-J 403 Bennett W H--620-R 404 Wright Wm E--994-R 406 Chalker S C Dobbs intersects 504 Shaw J E--620-M WADDELL, PL--East from S Waddell, 1st north of Waterman 201 Apartments: 1 Byers Richd E--114-J 2 Mote Lawrence--945-J 3 Dixon Eug E 4 Coffey Geo W 5 Akin Wm C 6 Harris John T 7 Revel Bettis A 8 Holland Thos W 9 Waits Geo W--945-R 10 Goldstein Jas 205 Apartments: 1 Harris Norris W 2 Wallace Harold E 3 Hatcher Wm H 4 Johnson Henry M 5 Chandler L Dean 6 Evans Robt W 7 Hardage Chas H WADDELL S--South from 118 Washington av, 1st east of Atlanta 104 Benson Troy C 105-07 Clackum's Trans--781 rear Mitchell & Gentry live stock 106 Vacant 107 Vacant 107-a Landers Mattress Shop Anderson intersects 205 Groover Plennie M 206 Clackum Rosa M Mrs --79-W 209 Donehoo Clarence--1241-W 210 Haney Harley M @--79-J 212 Whitt Bedford L 212(2) McDowell Lawrence 214 Steele Thos F gro 215 Brooks Jas W Wayland begins 301 Moore John H 303 Mathis Howard 307 Apartments: 1 Hall Alice D Mrs--1598-J 2 Cunningham Lurton H 3 Camp Eva B1 Mrs--1568-J 4 Turner Claude--1598-W 5 Vacant 6 Wheat Theo--1254-J 7 Brock C Theo 8 Sockwell Wm. G 8 Crawford Robt B--1254-W 9 Fambrough Willard D 404 Miller Henry 10 Delk Wm S 406 Rogers Wm Meinert MARIETTA 1 PHONE 35 florist " GEORGIA 1 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 435 AMBULANCE nilAIlP C/IQ MAYES WARD & CO. service rHyilaL "The Ring Leaders Since 1900" H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 WALTHALL--North from Polk, 1st west of Camp 307 O'Dell Chas D --861-M 309 Cross Sherman S --861-J 311 Goebel Warren P --861-W 313 Collier Harry O --861-R WARD (Eliz)--East from Rose la, 1 blk Brown Ellender Mrs Doss Walter Hunnicutt Ernest N McPherson W Claude Moon Jas Palmer Walter L Rakestraw Hugh WASHINGTON AV--East from Park Square to Black, 1st south of Lawrence 100 Groover Hdw Co--54 102 Jack's Place 102% Bell Aircraft Local No 10 104 Washington Avenue Barber Shop 106 Bentley's Lunch Rm 108 Rice Furniture Co--1571 108% Gann Gordon B 110 Legion Theatre--982 110% Merritt Allen T Jr civ eng-- 1108 State Highway Dept 112 Mitchell O D Groc--976 114 Georgia Produce Co--272 115 County Court House side ent 117 County Board of Health--302 118 Brown Allen--190 119 County Jail--249 Waddell intersects 201 Hicks Cleve O--361-R 203 Hicks Dudley E--361-W 203-a Bishop Patterson H--360-J 205 Lester John E --745 207 White A Kenan --360-W Haynes intersects 300 Osborn Gober F 301 Medord Demsey B--983 306 Brittain Jas--1043-W 308 Cogburn Minnie D Mrs -- 1025-W 309 Galt Gertrude Mrs --180-J 309% Turner Jack A--259-R 310 a Hill Nancy Mrs --1168-W b Mabry Forrest R 311 Greer Edna B Mrs --180-W 312 Gober Alice 315 Wade Hirour B --45S-J 316 Miller Leo --48-W rear Evans Wm 317 Baker Jos F--1168-J 317% Vacant 319 Brand Jos R 320 Legg Ada S Mrs 321 Duke Wm G--259-W Alexander intersects Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PHONE 840 436 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Washington--(Contd) 400 Mayes Mary G Mrs --48-J 401 Bentley Oscar A --193-M 402 Weaver Jas W--458-M 403 Goldwasser Murray --1184-J 405 Cox Cleveland M Mrs--516 408 Cole Webster D @--440 409 Randolph Thos M--1025-R Cole intersects 500 Marietta National Cemetery -- 1277 Pumphrey Jonah C--1277 501 Robertson Ernest L --335-M 505 Crissey Clinton E 511 Cole L, Fletcher @--1028 517 McKenzie John W--1167-J 523 McManus Nolen 525 Jones Arth 529 Smith Margt 531 Phillips Hager 533 Harper Chas 535 Murphy Inez 537 Carter Thos 539 Cook Nath Height begins 605 Porter Elmo Rogers ends Hs # * Covington ends 800 Brown Chas H 802 Brown Earl E--447-W 803 Brown Hoke S @ Black intersects 943 Holcombe Wm S 945 Holcomb Wm S 1070-J 1208 Brown Manning 1210 Barber Jas F 1407 Rainey Hiram C Cabe Floyd C Chastain Arth J Hayes Paul C Hopkins Wendell Murdock Thos G WATERMAN -- East from 336 Atlanta to S Alexander, 1st north of Frasier 105 McElreath Addie P --392-J Waddell ends 201 Medford Annie 204 Gunter Jas A--1149 205 Clark Forrest L Jr 207 Clark Grace M Mrs --483-W 209 McBrayer John E--506-W 211 Rohner Fredk F 214 Waterman Street School--399 215 Bettis Willis R--767-J 219 Johnson Mathrews O--809-J Green ends 303 Coyle Ralph C--144-M 305 Butler Merrill J 309 Kemp Jessie V --1193 311 Abercrombie Wm B --1051-J 315 Dickerson Mack @--767-W FOREST 6. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 437 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 BRUMBY E. PpAaRrkK sSGqIuTAaRreK PHONE 198 furniture co. "Complete Home Furnishers In Marietta Since 1916' WATERMAN E--From S Alexander to Fairground 506 a Wagner Josef b Vacant 604 a Vacant b Benning Clement J 608 a Sherman Robt H b Vacant 612 a Hood Jas R b Vacant 616 a Erquitt Jas E b Deichmann Chas W 704 a Wisdom Woodrow W W Reed Jack L 800 Turner Etna P 802 Hooper John L --899-M 804 Howell Milton L --899-J 805 Yancey John C @ 806 Gifford Richd O --749-W 808 Mashburn Wyotte O 809 Turner John T 810 Lee Edw C 811 Turner Geo F --749-J 815 Turner Chas E --116-W WAVERLY WAY--West from 235 Atlanta, 1st south of Anderson 111 Hazel Walter W tailor 112 Marietta Elks Club No 1657 BPOE--9139 208 Delk's Garage 208% Hardage Frank auto repr WAYLAND--East from 214 S Waddell, 1st south of Roswell 200 Apartments: 1 Carrouth Harbyn O--831-J 2 Underwood Robt F 3 Edwards Sarah S Mrs 4 Sullivan Jas F 5 McBrayer Claude E 6 Clayton Ernest L 7 Strickland Corine S Mrs 8 McLemore Benj F--1566-R 9 Power Edna P Mrs--703-R 10 Hunter Edwin T--703-W 204 Clay Homes Admn Bldg--941 205 Rickenbacker Aircraft Training Sch--1177 206 Apartments: 1 Burton Glover 2 Harris Harold 3 Caldwell Jas W 4 Webb Robt J--1566-W 5 Townsend Thos L 6 Woodall Tommy 7 Cochran Clifton 8 Trout Robt G 9 Farmer Daisy Mrs 10 Carsley Noman W--703-J PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 438 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. KNOW THE HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. Wayland-- (Contd) 207 Apartments: 1 Pace J EdW--279-J 2 Prewett Herbert L 3 Hawkins Jos B 4 Bailey Lee N 5 Byers Cota J Mrs--1241-J 6 Bohanan Albert M 7 Greenway Rebecca L Mrs 8 Wood Melvin H 208 Apartments: 1 Spirily S B`--1561-W 2 Hardag-e Carl 3 Mashburn John H 4 Rogers Isaac B 5 Miller Geo W--1029-R 6 Priest Jasper S 7 Dickerson Wm I 8 Dobbins Junior--1029-XW WHITLOCK AV--West from S W Park Square to bey city limit 100 Crescent Furniture Co--499 100% Anderson Building Means Clara Osteo--453 Roberts J Guy lawyer--324 Thomason Harry optometrist-- 1160 U S Selectie Service Local Board No 1--1063 Interstate Life & Accident Ins Co 102 Peerless Furniture Co Inc--1173 103 Vacant 104 Anderson Motor Co used cars 105 Rich & Powell Barber Shop 109 Brumby Press--300 Cobb County Times--300 110-12 DuPre H N whol & ret gro --700 111 Nashville Chattanooga & St Louis Railroad Crossing Sta N C & St L R R tracks cross 300 Marietta Glass & Cabinet Shop --536 301-05 Lewis-N'oe Mtr Co--62 308 Vacant 310 First Congregational Christian Church 315 Brooks Service Sta Demmeade begins 400 Martin Luke R--436-J 403 Connor Kath A Mrs --82 406 Benson Regina R Mrs--784-W 408 Baker Warner L --908 412 Dosser Jas H--1062 415 DuPre Lelia B Mrs --290 DuPre R Banks--814 416 Anderson Jas T --271 417 Legg Fred V --342 Legg Christine S mus tchr 503 Vacant 406 Benson Regina R Mrs--784-W 408 Bhker Warner L @--908 412 Dosser Jas H--1062 415 DuPre Lelia B Mrs --290 PHONE 60 OLDEST -- LARGEST -- BEST NSI-WAY GLEANERS & LAUNDRY "Nev) Life To Lovely Garments" 513 Page Ave. s- W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 439 MAYES WARD & CO AS^cNeCE PHONE 549 A. D. LITTLE- AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Whitlock-- (Contd) DuPre R Banks--814 416 Anderson Jas T --271 417 Leg Fred V --342 Legg Christine S mus tchr 503 Vacant 504 Blair Eliz A Mrs --615 507 Apartments: 1-a Vacant 1-b Vacant 1 Little Jos R 3 Norton Wm F 5 Vacant 7 Bright John D 9 Owens Wm Z 10 Franklin Lee F--724-J 11 Vacant 13 Allen Roy J 15 Vacant Street contd 511 Anderson J Danl (h)--855-J 512 Welsh Geo V --411-J 515 Reid M Louise --855-W McDonald begins 601 Lynes Kate W Mrs --225 606 Little Adam D @--1039 615 Hutcheson Robt H --1129 617 Hagood Murl M --856 620 Glover Aimee L Mrs --25 Northcutt begins 810 Willingham Robt T --542 815 Pittard Max C @--1005 816 Sessions Lee M --260-W 823 Amorons Martin T--680 Cleburne av begins 900 Lawrence M McDonald @--322 909 Rambo Marie B Mrs --450 911 Dodd Lillie B Mrs --260-J 917 Scarr Frances J--792 Brown av begins 1001 Kelly Elbert M --381-W 1004 Elder John H --630 1005 Nash Richd R --381-J 1008 Irvin John T --588 1014 Hargis Robt B --682-R Hazel begins 1100 Waldrip Gaines T --1155 1214 Lassiter Marvel L --694-W 1215 Willis Cuma Mrs --485 1224 McNeel Morgan L Jr --702-J 1224-a McCarey Raymond L 1225 Cheney John P --694-J 1226 Vacant 1229 Harris G Elmer 1230 Benson Albert A --660 1234 Smith Glover --40 1235 Hedges Minnie L Mrs --347 1236 Dunphey Henry B--1584 WHITLOCK DR--South from Whitlock, 1st east of Hazel No houses WING AV--South from Victory dr, 1st south from S Park dr 606 ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Flowers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER CO. PHONE 840 440 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ire co. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1,083 Wing--(Contd) 1 Vacant 2 Vacant 610 1 Owen Albert L 2 Vacant 227 Addison Fred J --1272-W 229 American Lndry & Dry Clnrs-- 159 WITCHER--West from 1105 Church to Campbell WINN--North from Whitlock av, to Maple av 102 Reynolds J Dunklin --72 Channell Geo W --122-R Clackum Jas W Hardage L Eug Worley W Ladson Hillcrest Cemetery Marietta High Sch Polk intersects 302 Arnold John T WINTERS--South from Park Square to Bridges 104 Marietta Journal side ent 109 Darby I A & Co 111 Marietta Bowling Alley 113-15 Cobb County Rural Elec Membership Corp--948 117 Riddle John T vet--1119 Anderson intersects 201 B N Auto Parts Co--17 203 Sou Bell Tel & Teleg Co rear ent 210-12 City Fire Sta No 1--1162 214 Crain's Garage--350 WRIGHT--South from 416 Whitlock av, 1st west of Powder Springs 100 Dozier Geo L--785 113 Kirk Adrain F --656-M 115 Gilbert Leon A --441 118 Plage Jack H --518-R 19 Bagwell Jack M @--1082 120 Story H Paul --822-W 121 Nusarra E A --822-J Henderson ends 202 Clark Warren--725-W 203 Kncaid J Roy --649 Pomeroy begins 301 Dorley Irving J --656 302 Kinney Melville W --318-J 305 Brooks Chas O 307 Brooks Earl B--518-M 309 Shipp Ralph W @--502 312 Sanders Ernest --493-W 314 Sanders Thos M --318-W Maxwell av intersects 400 Jackson Robt --873-W 402 Landis Clarence --860-M 403 Mayes Chas M --435-J 404 Bass Neil 409 Green Howell P --286 "Serving Cobb County Since 1900" Westin6housc Stoves and H. N. DuPRE Appliances and Radios Ranges Wholesale and Retail GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER C. PHONE 840 MARIETTA CITY DIRECTORY 441 MAYES WARD & CO. FUNERAL DIRECTORS PHONE 549 Eari G. Bedford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Trammell ends 503 Harris John 505 Vacant 507 Allen Julia 509 Trout Otis D Reynolds intersects 607 Hines Katie @ 613 Dallas Sami L 618 McConnell Grace Telephone 1098 619 Sanctified Church Greer intersects 700 Wright Street Baptist Church 702 Johnson Rhoda 703 Stidwell Julius 705 Hunley Lucy Maple ends 801 Vacant REFRIGERATION EXCHAN6E 237-24o Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 442 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, 1C. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 TTntp] UlU1 STRICTLY MODERN X lt 5U WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 443 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 Invest At Least \X7 7 THfe 10% in W ar Bonds W. P. STEPHENS LUMBER CO. PHfoiE 840 444 BALDWIN'S 1944 ICE-COAL-PH01E 1 SOUTHLAND ICE CO. Packing' -- Crating -- Storage -- Local & Long Distance Hauling IPTHisAWNilFECity- CHU21R5CH -IfVlft LE1M0O2 N 4IM MARIETTA TRANSFER & SALVAGE CO. CASH FOK ALL SALVAGE PAPER, CLOTH, ETC. BALDWIN'S Marietta GEORGIA BUSINESS DIRECTORY 7 AND A LIST OF Nationally Advertised Brands 1944 Containing the names of all business firms, industrial plants and professional men and women, arranged in alphabetical order under their properly classified business headings; together with the names of nationally advertised brands and trade-marked articles with the name and address of the local distributor or agent. # Indicates Nationally Advertised Brands SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 340 MARIETTA CITY DIRECTORY 445 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Accountants--C P A RESPESS & RESPESS, 1305 First Natl Bk Bldg Atlanta HUNT HARVEY H CO, 1110 First Natl Bk Bldg Atlanta Accountants and Auditors BESHERS W HAROLD, Blair Bldg HUNT HARVEY H CO, 1110 First Natl Bk Bldg Atlanta RESPESS & RESPESS, 1305 First Natl Bk Bldg Atlanta Accounting Systems HUNT HARVEY II CO, 1110 First Natl Bk Bldg Atlanta RESPESS & RESPESS, 1305 First Natl Bk Bldg Atlanta Agricultural Implements AVERY--H N DuPre, 110-12 Whitlock INTERNATIONAL II N DuPre, 110-12 Whitlock OLIVER--H N DuPre, 110-12 Whitlock MODEL DRY CLEANERS, 117 Cherokee NU-WAY CLEANERS & LAUNDRY, 513 Page Ambulance Service DOBBINS ALBERT M FUNERAL SERV- ICE HOME, 306 Cherokee HANLEY CO, 120 Lawrence Hanley Company Funeral Directors AMBULANCE SERVICE DAY OR NIGHT Phone 567 WARD MAYES & CO, 408 Church Amusement--Places of Brumby Recreation Center Polk cor Winn Cobb Theatre 23 N Park Square Legion Theatre 110 Washington av Marietta Ball Park Polk cor Cleburne Strand Theatre 19 N Park Square Agricultural Impliments & Supplies DU PRE H N, 110-12 Whitlock Apartment Buildings Anderson Apartments 233 Atlanta Alterations--Clothing Benson Apartments 304 Cherokee AMERICAN LAUNDRY & DRY CLEAN- Blair Apartments 317 Atlanta ERS, 305 Church Cole Apartments 501 Church HAZEL WALTER W, 111 Waverly Way Colonial Apartments 504 Church Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 446 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. FRED LEii Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St. Architects Automobile Brake Service Nash Richd R 47 W Park Square McKINNEY TIRE & BATTERY SERV- ICE, 218 Church Armories Home Guard Armory 210 Winters Automobiles PONTIAC--Johnson's Pontiac Service Sta- Associations and Clubs tion 225 Atlanta (See also Societies) American Red Cross Cobb County Chapter Automobile Dealers--Commercial Cars 220 Powder Springs and Trucks Business Girls Club 31 N Park Square Anderson Motor Co 111 Powder Springs COBB COUNTY CHAMBER OF COM- Lewis-Noe Motor Co 301-05 Whitlock av MERCE, County Office Bldg 202 Law- rence Automobile Dealers--Passenger Cars Marietta Kiwanis Club 31 N Park Square ANDERSON MOTOR CO, 111 Powder Marietta Lions Club 31 N Park Square Springs Marietta Rotary Club 31 N Park Square JOHNSON'S PONTIAC SERVICE STATION, 225 Atlanta Automobile Accessories & Supplies--Retail Lewis-Noe Motor Co 301-05 Whitlock av COWAN AUTO SUPPLY, 29 N Park Square Automobile Dealers--Used Cars JOHNSON'S PONTIAC SERVICE STA- Anderson Motor Co 111 Powder Springs TION, 225 Atlanta JOHNSON'S PONTIAC SERVICE STA- McKINNEY TIRE & BATTERY SERV- TION, 225 Atlanta ICE, 218 Church Lewis-Noe Motor Co 301-05 Whitlock av McPherson tire shop, 219-21 church SMITH CARL TIRE CO, 222 Atlanta Automobile Electric Service WESTERN AUTO ASSOCIATE STORE, McKINNEY TIRE & BATTERY SERV- 15 E Park Square ICE, 218 Church Automobile Body & Fender Work Automobile Lubrication JOHNSON'S PONTIAC SERVICE STA- Davis Body Shop Powder Springs RD 4 TION, 225 Atlanta WALTER HAZEL FINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 447 AMBULANCE DII ft IIE CM MAYES WARD & CO. service rRIUNE, 0*131 Marietta's Most Complete Department Store SAUES uThe jBest - - for Less' Auto Lubrication--(Contcl) Mckinney tire & battery serv- McKINNEY TIRE & BATTERY SERV- ice, 218 Church ICE, 278 Church McPHERSON TIRE SHOP, 219-21 Church McPHERSON TIRE SHOP, 219-21 Church Automobile Parts CHEVROLET--Anderson Motor Co 111 Bakers--Retail Sunlite Bakery 117 Church Powder Spring's Banks OLDSMOBILE -- Anderson Motor Co 111 COBB EXCHANGE BANK, 22 N Park Sq Powder Springs FIRST NATIONAL BANK THE, 50-51 S Automobile Parts -- Retail Park Sq B N Auto Parts Co 201 Winters Barbers Conner's Auto Parts Atlanta rd Atlanta Street Barber Shop 113 Atlanta Auto Radiator Repairers Channell's Radiator Shop 400 Cherokee Floyd's Barber Shop Atlanta rd (FO) Goolsby Barber & Beauty Shop 108 Rigsby Green's Barber Shop 305 Hunt Automobile Repairers Crain's Garage 214 Winters Delk's Garage 208 Waverly Way Hardage Prank 208% Waverly Way Hunter's Barber Shop 211 Church Lawrence Street Barber Shop 112 Law- rence Lee's Barber Shop 41 W Park Sq Reece's Barber Shop 211 Cherokee Rich & Powell Barber Shop 105 Whitlock Automobile Road Service Washington Avenue Barber Shop 104 JOHNSON'S PONTIAC SERVICE STA- Washington av TION, 225 Atlanta McPHERSON TIRE SHOP, 219-21 Church Batteries ATLAS--Max C Pittard agt, 127 Butler Automobile Washing & Polishing FIP.ESTONE--McKinney Tire & Battery FIVE POINT SERVICE, 111 Roswell Service, 218 Church JOHNSON'S PONTIAC SERVICE STA- PURE--Johnson's Pontiac Service Station, TION, 225 Atlanta 225 Atlanta W0FF0II OIL 00. Be Sure -- With Pure' vmBzp-- "ROY McCLESKEY, Agent , Ca* GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER 00. PHONE 840 448 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Batteries-- (Contd) Victory Beauty Shop 47 W Park Sq PURE--Roy McCleskey, Agt, Church (Eliz) Beer WILLARD -- McKinney Tire & Battery ATLANTIC--Southland Ice Co 100 W Service, 218 Church Dobbs WIZARD--Western Auto Associate Store PABST BLUE RIBBON--Southland Ice 16 E Park Sq Co, 100 W Dobbs STEINERBRU--Southland Ice Co, 100 W Battery Dealers & Service Dobbs COWAN AUTO SUPPLY, 29 N Park Sq Mckinney tire & battery serv- Beer Distributors ice, 218 Church SOUTHLAND ICE CO, 100 W Dobbs McPHERSON TIRE SHOP, 219-21 Church WESTERN AUTO ASSOCIATE STORE, Beverages 16 E Park Sq COCA-COLA -- Marietta Coca-Cola Bot- tling Co Inc Battery Recharging FIVE POINT SERVICE, 111 Roswell Beverage Manufacturers Mckinney tire & battery serv- MARIETTA COCA-COLA BOTTLING CO ice, 218 Church INC, 506 Roswell McPHERSON TIRE SHOP, 219-21 Church Beauty Shops Bicycle Dealers and Repairers Artistic Beauty Shop The 44 W Park Sq COWAN AUTO SUPPLY, 29 N Park Sq Black Beauty Salon 206 Depot Richardson Bicycle Shop 207 Mills Evelyn's Beauty Shop 55 S Park Sq WESTERN AUTO ASSOCIATE STORE, HARRISON BEAUTY PARLOR 307-09 16 E Park Sq Church Louise Beauty Shoppe 111 Atlanta Louise's Beauty Shop 402 Montgomery Bicycles Marietta Beauty Shop 28 N Park Sq FIRESTONE -- McKinney Tire & Battery Rose Beauty Shoppe 205 Powder Springs Service, 218 Church * MARIETTA LUMBER CO. * "Building Materials A Plant for Every Purpose That Merit Good Will' Lumber--Bldg. Materials Phone 357 . Atlanta Road W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 449 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 F. P. & "BOB" L1NDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 68S 108 GLOVER ST. Billiard Parlors Hamilton Billiard Parlor 115 Atlanta McCleskey Albert E 200 Mill Rex Pool Room 108 Lawrence Blacksmiths Pylant & Cook 211 Root Booksellers BOOK STORE THE, 54 S Park Sq Bottlers--Carbonated Beverages MARIETTA COCA-COLA BOTTLING CO INC, 506 Roswell Brick & Tile Dealers MARIETTA LUMBER CO, Old Atlanta rd at Bell Aircraft Underpass STEPHENS W P LUMBER CO, 315 Church Builders' Hardware RUSSWIN--Stephens W P Lumber Co 315 Church Building Contractors S & W Construction Co Inc 110 Atlanta VICTORY HOMES OF MARIETTA INC, 501 Victory dr Bowling Alleys Building Materials & Supplies Marietta Bowling Alley 111 Winters MARIETTA LUMBER CO, Old Atlanta rd at Bell Aircraft Underpass Brick Dealers--Retail STEPHENS W P LUMBER CO, 315 FRANKLIN J W &' SONS, 1 mile off New Church Atlanta hwy MARIETTA LUMBER CO, Atlanta rd nr Building & Loan Associations Bell Aircraft Underpass COBB COUNTY FEDERAL SAVINGS & STEPHENS W P LUMBER CO, 315 LOAN ASSN OF MARIETTA 100 Church Cherokee MARIETTA FEDERAL SAVINGS & Brick Dealers--Wholesale LOAN ASSN, 112 Atlanta FRANKLIN J W & SONS, 1 mille off New Atlanta hwy Buildings -- Office and Public Anderson Building 100 Whitlock av Brick Manufacturers Blair Building 59 S Park Sq FRANKLIN J W & SONS, 1 mile off New COBB COUNTY COURT HOUSE, 7 E Atlanta hwy Park Sq HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 450 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN ASSOCIATION TELEPHONE 44 112 ATLANTA ST. Buildings--Office & Public--(Contd) Candies Manning Building 102 Atlanta ELMER--Florence's Inc, 21 N Park Sq MARIETTA CITY HALL 209 Atlanta HOLLINGSWORTH--Jones Pharmacy, 18 Mozley Building 64 S Park Sq N Park Sq Reynolds Building 47 W Park Sq MRS STEVENS--Florence's Inc, 21 N Park Sq Bus Lines WHITMAN--Jones Pharmacy, 18 N Park SMOKY MOUNTAIN STAGES 118 At- Square lanta SOUTHEASTERN GREYHOUND LINES, Candy Manufacturers 118 Atlanta CARTER CANDY CO, 301 Husk TENNESSEE COACH CO, 118 Atlanta WILLIAMS COACH CO, 118 Atlanta Cemeteries Confederate Cemetery Goss cor W Atlanta Bus Stations Marietta Cemetery W Atlanta nr Goss GREYHOUND BUS STATION, 118 At Marietta National Cemetery 500 Washing- lanta ton av Mountain View Park Cemetery Whitlock av Butter Dealers PURITY DAIRY, RD 4 Chair Manufacturers BRUMBY CHAIR CO THE, 106 Kenne- Buttermilk Dealers saw av PURITY DAIRY, RD 4 Chiropractors Cab Companies Morrison Taxi 310 Atlanta Stanford J Walter 517 Church Strait Cecil D 216 Atlanta Safety Cab Inc 200 Cherokee Churches -- Baptist Cabinets Austin Avenue Baptist Church 212 Aus- Anderson Antique Reproduction Cabinet tin av Shop Atlanta rd nr Hill Cole Street Baptist Church 417 Cole Lewis Cabinet Shop 113 V2 E Anderson Elizabeth Baptist Church Church (Eliz) Meinert MARIETTA PHONE 35 florist GEORGIA 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 451 MAYES WARD & CO. AMBULANCE SERVICE PHONE 549 "The Ring Leaders Since 1900" H. E. KERLEY-O. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 Churches--(Contd) FIRST BAPTIST CHURCH 300 Church Maloney Springs Primitive Baptist Church Austell rd (FO) Church of God The 114 Austin av Sanctified Church 619 Wright Triumph Holiness Church 201 Johnson Memorial Baptist Church 831 Manget Mt Calvary Baptist Church Rose la (Eliz) Churches -- Methodist Elizabeth Methodist Church Church (Eliz) FIRST METHODIST CHURCH, 200 At- Olive Springs (FO) Baptist Church Austell rd lanta Holsey Chapel 515 Montgomery Rose Lane Baptist Church 208 Rose la Roswell Street Baptist Church 1504 Ros- well Roswell Street Church 1528 Roswell Second Baptist Church 720 Atlanta Jay's Chapel 1200 Roswell Maple Avenue Methodist Church 200 Ma- ple av Marietta Chapel 207 Jones Turner Chapel A M 121 Lawrence Wright Street Baptist Church 700 Wright Union Chapel 325 Page Zion Baptist Church 208 Haynes Churches -- Presbyterian Churches--Catholic First Presbyterian Church 503 Church St Joseph's Catholic Church 607 Church Cigar Manufacturers Churches -- Congregational Marietta Cigar Factory 205 E Hansell First Congregational Christian Church 310 City Directories--Publishers Whitlock av BALDWIN DIRECTORY CO INC, 125 Churches -- Episcopal Meeting St., Charleston, S. C. St James Episcopal Church 401 Church Clergymen BROWN GEO F Baptist 107 N Forest av Churches -- Holiness Church of Christ 305 Roswell Church of Christ 405 Roswell Cantrell Ralph G (Holiness) Rose la (Eliz) Farr Hoyt G (Baptist) 1504 Roswell Church of God in Christ The 210 Mul- GAMBLE BEVERLY C (Methodist) 210 berry Atlanta CARTER CANDY COMPANY L. E. CARTER, President MANUFACTURERS OF HI-GRADE STAPLE CANDIES -- ROASTERS AND PACKERS OF SALTED PEANUTS 301 Husk Street Phone 1041 W. P. STEPHENS LUMBER CO. PHONE 840 452 BALDWTN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Clergymen-- (Contd) NU-WAY CLEANERS & LAUNDRY, 513 Glasure Alton H Rev (Presbyterian) 606 Page Church Hicks J J (Congregational) Clothing Alterations Holbrook Tim W (Methodist) 202 Maple av AMERICAN LAUNDRY & DRY CLEAN- Holland Jas A (Primitive Baptist) Austell ERS, 229 Winters rd (FO) HAZEL WALTER W 111 Waverly Way Kennamore M A (Primitive Baptist) Aus- MODEL DRY CLEANERS, 117 Cherokee tell rd (FO) NU-WAY CLEANERS & LAUNDRY, 118 Moon H C Rev (Baptist) Church (Eliz) Cherokee Powell Henry A (Holiness) 215 Clay Rasbury J B (Holiness) Men's Clothing Rogers Henry (Baptist) Page CURLEE--Johnny Walker Inc, 45 W Park Russell Amos O (Baptist) Square Savoy Jas (Episcopal) 322 Campbell Hill GRIFFON--Saul's Department Store, 59- Shelnutt D B (Methodist) Clarkdale Ga 61 S Park Square Speers Bayard C Jr (Methodist) 203 Ses- SCHOENEMAN--Johnny Walker Inc, 45 sions W Park Square Spence Rev (Holiness) North av (Eliz) Cleaning Solvents--Wholesale GULF OIL COUP, 129-33 Butler SHELL OIL CO, Atlanta rd RD 5 SINCLAIR REFINING CO, Butler nr Glover WOFFORD OIL CO, Church (Eliz) Clothing Dealers--Men's and Boys'-- Retail JOHNNY WALKER INC, 45 W Park Sq SAUL'S DEPARTMENT STORE, 59-61 S Park Square SEARS ROEBUCK & CO, 238 Atlanta Clothers Cleaners and Pressers Clothing Dealers--Women's and Misses'-- Retail AMERICAN LAUNDRY & DRY CLEAN- Cinderella Shop 49 W Park Square ERS, 229 Winters Grand Shop The 58 S Park Square HAZEL WALTER W, 111 Waverly Way Murray's Fashion Shop 63 S Park Square MODEL DRY CLEANERS, 117 Cherokee STYLE SHOP, 62 S Park Square FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 453 MAYES WARD & CO. DIRECTORS^ PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 furniture co. "Complete Home Furnishers In Marietta Since 1916" Coal Coal Stokers--Dealers DIXIE STAR EGG--Southland Ice Co 100 REECE JAS A ELECTRICAL APPLI- W Dobbs ANCE CO, 211 Cherokee GOLDEN GLOW--Georgia Coal Co 119 SOUTHLAND ICE CO, 100 W Dobbs Butler JELLICO--Georgia Coal Co, 119 Butler Coke Dealers L L--Cobb County Coal Co, 109 Cleveland SOUTHLAND ICE CO, 100 W Dobbs avenue PIONEER BLOCK--Southland Ice Co 100 Coats -- Women's W Dobbs BETTY ROSE--Style Shop 62 S Park Sq RED CLOVER EGG--Southland Ice Co, MARY LANE--Style Shop 62 S Park Sq 100 W Dobbs RED HEART--Cobb County Coal Co, 109 Concrete Products Manufacturers Cleveland av Branson Concrete Products Co 135 Butler SOUTHERN STAR -- Georgia Coal Co, 119 Butler Confectioners -- Retail SUN EGG--Southland Ice Co 100 W Dobbs O K Candy Co 104 Cherokee Coal Dealers--Retail Burton L P Coal Co 616 Kennesaw av COBB COUNTY COAL CO, 109 Cleve- land av GEORGIA COAL CO, 119 Butler SOUTHLAND ICE CO, 100 W Dobbs Confectioners -- Wholesale CARTER CANDY CO, 301 Husk Contractors--Building--General STEPHENS W P LUMBER CO, 315 Church VICTORY HOMES OF MARIETTA INC, 501 Victory dr Coal--Stokers Corsages -- Floral STOKOL--Southland Ice Co 100 W Dobbs COLONIAL COTTAGE GARDENS, 811 WINKLER--James A Reece Electrical Ap- Powder Springs pliance Co 211 Cherokee MEINERT FLORIST, 310 Roswell PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 454 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. KNOW THU HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY TAKE RENT COBB COUNTY FEOERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 .T. J. DANIELL. Pres. P. G. SMITH. Sec'v and Treas. J. GLENN GILES, Atty. Cosmetics Credit Bureaus CHEN-YU--Florence's Inc, 21 N Park Sq ASSOCIATED CREDIT BUREAUS OF ELIZABETH ARDEN--Jones Pharmacy AMERICA, 600 Roswell 18 N Park Square MARIETTA CREDIT SERVICE, 600 Ros- LENTHERIC--Jones Pharmacy, 18 N well Park Square MERCANTILE AGENCY THE, 101 Ma- LUCIEN LE LONG--Florence's Inc, 21 N rietta N W Atlanta Park Square MARIE EARLE--Florence's Inc, 21 N Park Square REVLON--Florence's Inc, 21 N Park Sq TUSSY--Jones Pharmacy, 18 N Park Sq Credit Reports MARIETTA CREDIT SERVICES, 600 Roswell MERCANTILE AGENCY THE, 101 Ma- rietta N W, Atlanta Ga Cost Analysis HUNT HARVEY H CO, 1110 First Natl Curtain and Drapery Cleaning Bk Bldg- Atlanta MODEL DRY CLEANERS, 117 Cherokee RESPESS & RESPESS, 1305 Firt Natl Bk Bldg Atlanta Cut Flowers COLONIAL COTTAGE GARDENS, 811 Cotton Buyers & Dealers Powder Springs DU PRE H N, 110 Whitlock av MEINERT FLORIST, 310 Roswell FOWLER J M CO, 108 Powder Springs Cotton Ginners & Balers Du Pre Cotton Gin 201 Cleveland av Dairies (See also Milk Dealers) McCleskey Lawrence M Canton rd (Eliz) Bearden T Gordon Henry RD 5 Fair Oaks Dairy Austell rd (FO) Cotton Warehouses DU PRE H N, 100 Cleveland PURITY DAIRY, RD 4 Creamery Products PURITY DAIRY, RD 4 Dancing Schools & Teachers Coppock Virginia 31 N Park Square PHONE 60 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNORY "New Life To Lovely Garments" 513 Page Ave. s- J 0^SEY W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 455 MAYES WARD & CO. PHONE 549 A. 0. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Dentists Carpenter J L 44 W Park Sq Hagood Geo F Jr 64 S Park Sq Reed R Glenn 47 W Park Sq Department Stores FLORENCE'S INC, 21 N Park Square Irving's 5 & 10c Store 38 W Park Sq KAPLAN'S DEPARTMENT STORE, 17- 18 E Park Square Mac W W Co 34-35 W Park Sq McLellan Stores Co 56-57 S Park Sq Miller's Inc 37 W Park Sq Najjar Department Store 40 W Park Sq SAUL'S DEPARTMENT STORE, 59-61 S Park Sq SEARS, ROEBUCK & CO, 238 Atlanta L'AIGLON--Florence's Inc, 21 N Park Sq Dressmakers Allgood Cynthia 300 Roswell Bliteh Hazel 716 Church Druggist--Retail Allen Drug Co 65 S Park Sq ATHERTON DRUG CO, 46 W Park Sq Hodges Drug Co 24 N Park Sq JONES PHARMACY, IS N Park Sq WILLIAMS DRUG CO, 39 W Park Sq Drug Sundries ATHERTON DRUG CO, 46 W Park Sq JONES PHARMACY, 18 N Park Sq WILLIAMS DRUG CO, 39 W Park Sq Diamonds -- Retail Dry Cleaners KERLEY H E, O DR, 26 N Park Square (See also Clothers Cleaners & Pressers) Diesel Fuels TEXAS CO THE, 108 Glover AMERICAN LAUNDRY & DRY CLEANERS, 305 Church MODEL DRY CLEANERS, 117 Cherokee Directory Publishers BALDWIN DIRECTORY CO INC, 125 Meeting, Charleston, S. C. NU-WAY CLEANERS & LAUNDRY, 513 Page Dry Goods--Retail Dressies--Women's Goldstein Philip 15 E Park Sq CARLYLE--Florence's Inc, 21 N Park Sq Hosiery Shop The 205 W Anderson ELLEN KAY--Style Shop, 61 S Park Sq Mill End Store The 205 Mill GEORGIANNA--Florence's Inc, 21 N Park Sq SAUL'S DEPARTMENT STORE, 59-61 S Park Sq PHONE "The Friendly Druggist" ATHERTON PHONE DRUG COMPANY 7 WALGREEN AGENCY W. P. STEPHENS LUMBER CO. PHONE 840 456 BALDWIN'S 1944 I0E-CO1L-PMOiE 1 SOUTHLAND I he CO. OFFICE SALES S SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 Dyers and Cleaners Embalmers AMERICAN LAUNDRY & DRY CLEAN- DOBBINS ALBERT M FUNERAL SERV- ERS, 305 Church ICE HOME, 306 Cherokee HANLEY CO, 120 Lawrence Electric Refrigerators WARD MAYES & CO, 408 Church WESTINGHOUSE--H N DuPre 110 Whit- lock av Eng Civil Merritt Allen T Jr 110% Washington av Electrical Appliances and Supplies BRUMBY FURNITURE CO, 12-14 E Park Employment Agencies Square U S Employment Service 118 Powder FIELD FURNITURE CO, 202 Church Springs Gamer Appliance Co 114 Cherokee JAMES A REECE ELECTRICAL APPLI- Express Companies ANCE CO, 211 Cherokee RAILWAY EXPRESS AGENCY INC, 210 Depot Electrical Contractors BARRON ELECTRIC CO 203 Mills JAMES A REECE ELECTRICAL APPLIANCE CO, 211 Cherokee Farm Implements AVERY--H N DuPre 110-12 Whitlock av OLIVER--H N DuPre 110-12 Whitlock av F. D, I. C. Members Electric Commercial & Ind. Equipment COBB EXCHANGE BANK, 22 N Park Sq FIRST NATIONAL BANK, THE, 50-51 S JAMES A REECE ELECTRICAL APPLI- Park Sq ANCE CO, 211 Cherokee Feed Dealers--Retail Electrical Fixtures Dunn Feed & Grocery Co, 203 Cherokee DU PRE H N, 110-12 Whitlock BARRON ELECTRIC CO, 203 Mills Hyde Homer L 109 Lawrence JAMES A REECE ELECTRICAL APPLI- Shaw Gilbert Feed Store 223-25 Powder ANCE CO, 211 Cherokee J Springs "Serving Cobb County Since 1900" Westinghouse ||( [)UPRE Stoves and Appliances and Radios Ranges Wholesale and Retail GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 457 MAYES WARD & CO ^YrectorsL PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Telephone 1098 Feed Dealers--(Contd) CONGOLEUM--Brumby Furniture Co SHAW MONTO & SON, 113 Tucker 12-14 E Park Sq NAIRN--Brumby Furniture Co 12-14 E Feed Dealers--Wholesale Park Sq DU PRE HARRY N, 110-12 Whitlock av Floor Coverings--Retail SHAW MONTO & SON, 113 Tucker COWAN AUTO SUPPLY, 29 N Park Sq Feed Manufacturers SHAW MONTO & SON, 113 Tucker FIELD FURNITURE CO, 202 Church PEERLESS FURNITURE CO, 102 Whit- lock av RICE FURNITURE CO, 108 Washington Feeds PURINA--H N DuPre 110-12 Whitlock av Flooring Dealers STEPHENS W P LUMBER CO, 315 Fertilizer Dealers--Retail DU PRE H N, 110-12 Whitlock Church Floral Telegraph Service COLONIAL COTTAGE GARDENS, 811 Finance Companies Powder Springs Peoples Loan & Finance Corp 110 Atlanta MEINERT FLORIST, 310 Roswell McKINNEY Fishing Tackle TIRE & BATTERY SERV- Florists--F T D Member MEINER*T FLORIST, 310 Roswell ICE, 218 Church Florists--Retail Flagstone Dealers COLONIAL COTTAGE GARDENS, 811 Powder Springs CLACKUM'S TRANSFER, 107 S Waddell Colonial Cottage Floor Coverings CHANNELL FURNITURE CO, 203 Powder Springs ARMSTRONG--Brumby Furniture Co 12-14 E Park Sq Gardens MRS. HOWELL TREZEVANT "The Beauty of Our Business Is FLOWERS" Telephone 484 811 Powder Springs 1EFRI6ERATI0N EXCHANGE 237-245 Pryor St., S. IV., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 458 BALDWIN'S 1944 ICE-COAL-PHONE t SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, INC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Florists-- (Contd) MEINERT FLORIST, 310 Roswell Florists--T D S Members COLONIAL COTTAGE GARDENS, 811 Powder Springs Florists--Wholesale MEINERT FLORIST, 310 Roswell Flour Dealers--Retail Birdsey Flour Mills 207 Church SHAW MONTO & SON 113 Tucker Flour Dealers--Wholesale SHAW7 MONTO & SON 113 Tucker Flour Manufacturers SHAW MONTO & SON 113 Tucker Founders--Iron & Steel Glover Machine Works Butler nr Glover Fruit Dealers--Retail City Curb Market 219 Atlanta Fuel Oil--Wholesale GULF OIL CORP, 129-33 Butler SHELL OIL CO, Atlanta rd RD 5 SINCLAIR REFINING CO, Butler nr Glover STANDARD OIL CO OF KENTUCKY 127 Butler WOFFORD OIL CO Church (Eliz) Funeral Chapels DOBBINS ALBERT M FUNERAL SERV- ICE HOME, 306 Cherokee WARD MAYES & CO 408 Church Funeral Designs--Floral COLONIAL COTTAGE GARDENS, 811 Powder Springs MEINERT FLORIST 310 Roswell Funeral Directors DOBBINS ALBERT M FUNERAL SERV- ICE HOME, 306 Cherokee HANEY CO, 120 Lawrence Hanley Company Funeral Directors Our Prices Are The Lowest Phone 657 WARD MAYES & CO 408 Church Funeral Homes DOBBINS ALBERT M FUNERAL SERV- ICE HOME, 306 Cherokee HANLEY & CO 120 Lawrence PHONE FIELD PHONE 1010 FURNITURE COMPANY 1010 "Find Your Furniture At Fields"--In the Hotel Field Building W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 459 AMBULANCE nUAUP CJO MAYES WARD & GO. SERVICE 1 HHHS UW PHONE i HOME OWNED -- HOME OPERATED NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. * '-gST* Funeral Homes--(Contd) FIELD FURNITURE CO, 202 Church WARD MAYES & CO 408 Church PEERLESS FURNITURE CO, 102 Whit- lock av Fur Cleaning and Glazing RICE FURNITURE CO, 108 Washington AMERICAN LAUNDRY & DRY CLEAN- SEARS, ROEBUCK & CO, 238 Atlanta ING, 229 Winters MODEL DRY CLEANERS 117 Cherokee Furniture Dealers--Used NU-WAY CLEANERS & LAUNDRY 513 FIELD FURNITURE CO, 202 Church Page RICE FURNITURE CO, 108 Washington Fur Storage Furniture Manufacturers AMERICAN LAUNDRY & DRY CLEAN- BRUMBY CHAIR CO THE, 106 Kenne- ING, 229 Winters saw av Mitchell Furniture Mfg Co 109 Butler Furnished Rooms (See also Boarding Houses) Furniture Repairers Baker Iva L Mrs 408 Whitlock av LEWIS H A CABINET SHOP 113% E Cogburn Minnie D Mrs 308 Washington av Anderson Galley Nannie M Mrs 511 Church Gault Tourist Homes & Dormitory, Chero- Garages kee rd (Eliz) Delk's Garage 208 Waverly Way Horne House 411 Church Mozley Nettie 305 Lawrence Gas Appliances White Home The 809 Church SCHILLING F E A INC, 33 N Park Sq Furniture Dealers--Retail Gas Companies BRUMBY FURNITURE CO, 12-13 E Park Square CHANNELL FURNITURE CO, 203 Pow- ATLANTA GAS LIGHT CO, GAS CO THE, 109 Church 109 Church der Springs COW'AN AUTO SUPPLY, 29 N Park Sq Gas Ranges CRESCENT FURNITURE CO, 100 Whit- ESTATE--Schilling F E A Inc, 33 N Park lock av Square Invest At Least 10% In War Bonds W. P. STEPHENS LUMBER CO. PHONE 840 460 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling 102 OC1 PHONES: church 13 LEMON MARIETTA TRANSFER & SALVAGE CO. CASH FOR ALL SALVAGE PAPER, CLOTH, ETC. Gasoline GOOD GULF--Fred V Legg distributor 129-33 Butler MARIETTA LUMBER CO, Old Atlanta rd at Bell Aircraft Underpass Stephens W P Lumber Co 315 Church GOOD GULF--McKinney Tire & Battery Service 218 Church Glassware SINCLAIR H-C--McPherson Tire Shop FOSTORIA--Florence's Inc, 21 N Park Sq 219-21 Church SINCLAIR H C--Sami A White agt, But- Glassware Dealers ler nr Glover FLORENCE'S INC, 21 N Park Square STANDARD--Max C PITTARD agt, 127 Butler Gloves--Women's SUPER-SHELL--Forrest C Brooks agt, VAN RAALTE--Florence's Inc, 21 N Park Atlanta rd RD 5 Square TEXACO FIRE CHIEF--F P & "Bob" Lindley consignees, 108 Glover TEXACO SKY CHIEF--F P & "Bob" Greeting Cards Office Sales & Service 114 Atlanta Lindley consignees, 108 Glover WOCO-PEP--Roy McCleskey Agt, Church Grocers--Retail (Eliz) A & P Food Stores 101-03 Church Benson & Ward 105 Church Gift Shops Big Star Food Stores 201 Cherokee Fletcher Studio & Gift Shop 107 W An- Brown J P Grocery Church (Eliz) derson FLORENCE'S INC, 21 N Park Sq Brown R R Atlanta rd Browning Julia D 201 Glover Caldwell & Ravan Church (Eliz) Glass Canty Willie 409 Cole LIBBY-OWENS-FORD--Stephens W P Lumber Co, 315 Church Casey Julia B Mrs Powder Springs RD 4 Cherokee Cash Grocery 610 Cherokee Christian Henry 212 Rigsby Glass Dealers--Plate & Window Cooper's Grocery 110 Black Cox's Market 109 Powder Springs Marietta Glass & Cabinet Shop 300 Whit- Dunn Feed & Grocery Co 203 Cherokee lock av DU PRE H N, 110-12 Whitlock SEARS, I Make any Purcliase of' $10 nr More ROEBUCK &CO. On Easy Terms /ff' Phones 1068-1069 238 ATLANTA W. P. STEPHENS LIMBER CO. PHONE S40 MARIETTA CITY DIRECTORY 461 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 45 W. Park Sq. "The Exclusive Store for Men" Telephone 331 Grocers---Retail--(Contd) W M Dunn Grocery Atlanta rd (FO) W Z Daniell Grocery Austell rd (FQ); East Side Grocery 305 Cole Frey John S 32 N Park Sq Gibson Grocery 212 Sessions Griggs Martin A 107 Church Hames Luther C Atlanta rd (FO) Hicks Grocery 726 Atlanta Hill's Grocery 300 Sessions Holbert Ernest H 701 Powder Springs Joe's Place Church (Eliz) Mitchell O D 112 Washington av McConnell Clyde E 1015 Roswell Moon Grocery 1517 Roswell Pettett Grocery 209 Powder Springs Piggly Wiggly Super Market 113 Church Polk Street Market 200 Polk Roswell Street Grocery 404 Roswell Sehroeder B red 1509 Roswell Scoggins Gro 622 Cherokee Smith Hersehell S Rose la (Eliz) Sorrels Len 209 Greer Steele Thos F 214 S Waddell Stephens Walker D. Rose la (Eliz) Thornton Gordon 604; Lawrence Trulove Geo C Church (Eliz) W R Turner Grocery Joyner av (FO) Worley Sanford T Rose la (Eliz) Worley Thos L Atlanta rd York B Franklin 318 Powder Springs Grocers--Wholesale Cash & Carry Grocery No 3 304 Atlanta DU PKE H N, 110 Whitlock av Veach Grocery Co 209 Mill Gun & Ammunition Dealers DU PRE H N, 110-12 Whitlock Haberdashers JOHNNY WALKER INC, 45 W Park Sq Halls City Auditorium 2d fir City Hall Masonic Temple 3d fir 209 Atlanta Hardware Dealers--Retail Groover Hardware Co 100 Washington av SCHILLING F E A INC, 33 N Park Sq Hat Cleaners and Blockers AMERICAN LAUNDRY & DRY CLEAN- ERS, 305 Church MODEL DRY CLEANERS, 117 Cherokee Nu-Way Cleaners & Laundry 513 Page Hats--Men's STETSON--Johnny Walker Inc, 15 W Park Square Hats--Women's BREWSTER--Florence's Inc, 21 N Park Square DOBBS--Style Shop, 62 S Park Sq. Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 462 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. FIE LEUd Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St. Hats--Women's--(Contd) WALKER JOHNNY INC, 45 W Park Sq GAGE--Florence's Inc, 21 N Park Square GAGE--Style Shop, 62 S Park Square Hosiery Dealers--Women's--Retail KNOX--Florence's Inc, 21 N Park Square COGGINS SHOE STORE, 52 S Park Sq MEADOW BROOK--Florence's Inc, 21 N FLORENCE'S INC, 21 N Park Sq Park Square Hosiery Shop The 205 W Anderson WEYMAN--Florence'^ Inc, 21 N Park Sq SAUL'S DEPT STORE, 60 S Park Sq Hauling Contractors Hosiery Manufacturers CliACKUM'S TRANSFER, 107 S Waddell HOLEPROOF HOSIERY CO, 250 Rose MARIETTA TRANSFER & SALVAGE Lane CO, 215 Church MARIETTA HOSIERY CO, 114 Church Heating- Systems Hospitals and Clinics CRANE--Schilling F E A Inc, 33 N Park Marietta Hospital 206-10 Cherokee Square Heating Systems--Dealers SCHILLING F E A INC, 33 N Park Sq Hotels FIELD HOTEL, 200 Church NEW MARIETTA HOTEL, 200 Depot Stonewall Hotel 10 E Park Square Home Financing COBB COUNTY FEDERAL SAVINGS & House Wiring LOAN ASSOCIATION OF MARIETTA, BARRON ELECTRIC CO, 203 Mill 100 Cherokee MARIETTA FEDERAL SAVINGS & LOAN ASSOCIATION, 112 Atlanta Household Furnishings BRUMBY FURNITURE CO, 12-13 E Side Square Homes and Orphanages Cobb County Home Fairground nr Clay SEARS, ROEBUCK & CO, 238 Atlanta Hosiery Dealers--Men's--Retail COGGINS SHOE STORE, 52 S Park Sq SAUL'S DEPT STORE, 60 S Park Sq Household Storage MARIETTA TRANSFER & SALVAGE CO, 215 Church WALTER W. HAZEL FINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 463 MAYES WARD & CO. AISERVICECE PHONE 549 Marietta's Most Complete Department Store SAUES "The Best - - for Less ? Ice Manufacturers and Dealers SOUTHLAND ICE CO, 100 W Dobbs SINCLAIR P-D--Saral A White agt, Butler nr Glover Ice Cream--Retail Insecticides--Wholesale Economy Ice Cream Co No 1 36 W Park Sq GULF OIL CORP, 129-33 Butler Economy Ice Cream Co No 2 123 Church SHELL OIL CO, Atlanta rd RD 5 Ice Cream Manufacturers Economy Ice Cream Co Atlanta rd SINCLAIR REFINING CO, Butler nr Glover STANDARD OIL CO OF KENTUCKY, 127 Butler Income Tax Service WOFFORD OIL CO, Church (Eliz) BESHERS W HAROLD, Blair Bldg Insulating- Material Dealers Industrial Oil and Lubricants MARIETTA LUMBER CO, Old Atlanta rd GULF OIL CORP, 129-33 Butler at Bell Aircraft Underpass SHELL OIL CO, Atlanta rd RD 5 STEPHENS W P LUMBER CO, 315 SINCLAIR REFINING CO, Butler nr Church Glover STANDARD OIL CO OF KENTUCKY, Insulation--Building 127 Butler TEXAS CO THE, 108 Glover GOLD BOND--Marietta Lumber Co, Old Atlanta rd at Bell Aircraft Underpass WOFFORD OIL CO, Church (Eliz) RED TOP--Stephens W P Lumber Co, 315 Church Infant's Wear--Retail FLORENCE'S INC, 21 N Park Square U S GYPSUM--Stephens W P Lumber Co 315 Church SAUL'S DEPT STORE, 60-61 S Park Sq Insecticides Insurance--Automobile GULF SPRAY--Fred V Legg distributor, GLENS-FALLS INDEMNITY CO, A D 129-33 Butler Little agent 112 Atlanta SHELL-TOX--Forrest C Brook, agt At- TRAVELERS THE, A. D. Little Agent 112 lanta rd RD 5 Atlanta CaU>0<' WOFFORD OIL CO. . "Be Sure -- With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. PHONE 840 464 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 Insurance--Casualty Insurance Agents & Companies--Fire HARTFORD ACCIDENT & INDEMNITY LITTLE A D AGENT, 112 Atlanta CO, Earl G Medford 215 Atlanta MEDFORD EARL G, 215 Atlanta TRAVELER THE, A D Little agent 112 Atlanta Insurance Agents & Companies--General IT S FIDELITY & GUARANTY, Earl G LITTLE A D AGENT, 112 Atlanta Medford, 215 Atlanta MEDFORD EARL G, 215 Atlanta MYERS FRED, 59 S Park Square Insurance--Fire Worley Thurston L 100 Cherokee AETNA--Earl G Medford, 215 Atlanta AGRICULTURAL--A D Little agent 112 Insurance Agents & Companies--Life Atlanta EQUITABLE LIFE ASSURANCE SOCIE- AMERICAN--Earl G Medford, 215 Atlanta TY OF THE US, 406 Whitlock ATLANTIC MUTUAL--Earl G Medford, Gulf Life Insurance Co 64 S Park Square 215 Atlanta Industrial Life & Health Ins Co 64 S Park HANOVER--A D Little Agent, 112 Atlanta Square HARTFORD--Earl G Medford, 215 At- Interstate Life & Accident Ins Co 100% lanta Whitlock av HOME--Earl G Medford, 215 Atlanta Life Insurance Co of Virginia 100% Cher- SOUTHERN MUTUAL--Earl G Medford, okee 215 Atlanta TRAVELERS THE--A D Little Agent 112 Investments Atlanta COBB COUNTY FEDERAL SAVINGS & LOAN ASSOCIATION OF MARIETTA, Insurance Agents & Companies-- Automobile 100 Cherokee MARIETTA FEDERAL SAVINGS & LOAN ASSOCIATION, 112 Atlanta LITTLE A D AGENT, 112 Atlanta MEDFORD EARL G, 215 Atlanta Jewelers--Retail Daniell's Jewelry Store 48 W Park Square Diamond Jewelry Co 23 N Park Square Insurance Agents & Companies--Casualty KERLEY H E, O DR, 26 N Park Square LITTLE A D AGENT, 112 Atlanta Wilson Jos D 201 Mill A GENUINE FLINTKOTE RGOF IS A SMART INVESTMENT MARIETTA LUMBER 60. LUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 465 MAYES WARD & CO. DIRECTORS1" PHONE 549 F. P. & "BOB" UNDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING 'TELEPHONE 688 108 GLOYER ST. Junk Dealers Lawyers MARIETTA TRANSFER AND SALVAGE Anderson Geo D 59 S Park Square CO, 215 Church , BLAIR & CARMICHAEL, 59 S Park Sq BLAIR LEON M, 59 S Park Square Kerosene --Wholesale Brown Chas M 20 N Park Sq GULF OIL CORP, 129-33 Butler CARMICHAEL JAS V, 59 S Park Square SHELL OIL CO, Atlanta rd RD 5 Cheney John P 102 Atlanta SINCLAIR REFINING CO, Butler nr Glover COMBS GORDON, 106 Atlanta Dobbs C Marion 64 S Park Square STANDARD OIL CO OF KENTUCKY, DORSEY JOHN T, 107 Atlanta 127 Butler Gann Gordon B 108% Washington av TEXAS CO THE, 108 Glover GROVE RUSSELL S, 116 Atlanta WOFFORD OIL CO, Church (Eliz) Latimer Thos E 102 Atlanta ROBERTS J GUY, 100% Whitlock av Kodak Films and Supplies Schroeder Hubert C 59 S Park Square JONES PHARMACY--18 N Park Square Walker Harold M 59 S Park Square WILLIAMS DRUG CO--39 W Park Sq Welsch Sami J 110 Church Labor Organizations Bell Aircraft Local No 10 (UAW-CIO) 102% Washington Leather Goods Dealers EASON SHOE SHOP, 108 Cherokee KERLEY H E, O DR, 26 N Park Square Ladies' Ready-to-Wear Libraries--Public FLORENCE'S INC, 21 N Park Sq Clarke Library 400 Church SAUL'S DEPARTMENT STORE, 59-61 S Park Sq Light and Power Companies Laundries AMERICAN LAUNDRY & DRY CLEAN- Cobb County Rural Electric Corp 113 Winters Membership ERS, 305 Church Excelsior Laundry 217 Church Lime, Plaster and Cement NU-WAY CLEANERS & LAUNDRY, 513 MARIETTA LUMBER CO, Old Atlanta rd Page at Bell Aircraft Underpass HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 466 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOU ASSOCIATION TELEPHONE 44 112 ATLANTA ST. Lime, Plaster & Cement--(Contd) Loans--Mortgage STEPHENS W P LUMBER CO, 315 COBB COUNTY FEDERAL SAVINGS & Church LOAN ASSOCIATION OP MARIETTA, 100 Cherokee Liquors--Retail COBB EXCHANGE BANK, 22 N Park Sq Main Liquor Store 42 W Park Square FIRST NATIONAL BANK THE, 50-51 S Marietta Liquor Store 25 N Park Square Park Square Stonewall Liquor Store 11 E Park Square MARIETTA FEDERAL SAVINGS & LOAN ASSOCIATION, 112 Atlanta Live Stock Dealers MEDFORD EARL G, 215 Atlanta Mitchell & Gentry rear 105-07 S Waddell Spears Prank Sales Stable 205 Cleveland Loans--Personal avenue COBB EXCHANGE BANK, 22 N Park Sq FIRST NATIONAL BANK THE, 50-51 S Loans--Commercial Park Square COBB EXCHANGE BANK, 22 N Park Sq FIRST NATIONAL Park Square BANK THE, 50-51 S Local and Long Distance Hauling CLACKUM'S TRANSFER, 107 S Waddell MARIETTA TRANSFER & SALVAGE Loans--Farms CO, 215 Church COBB EXCHANGE BANK, 22 N Park Sq Lubricants MARFAK--F P & "Bob" Lindley consig- nees, 108 Glover Loans--FHA FIRST NATIONAL BANK THE, 50-51 S Luggage Dealers Park Square SAUL'S DEPARTMENT STORE, 59-61 S Park Square Farm Loans--Federal Land Bank Lumber Dealers--Retail National Farm Loan Association 102 At- Carruth R J Good & Bad Lumber Atlanta lanta rd RD 5 Meinert MARIETTA PHONE 35 florist GEORGIA ' 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE S40 MARIETTA CITY DIRECTORY 467 MAYES WARD & CO. PHONE 549 "The Ring Leaders Since 1900'' H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE V TELEPHONE 86 Lumber Dealers, Retail--(Contd) Men's Furnishings MARIETTA LUMBER CO, Old Atlanta rd JOHNNY WALKER INC, 45 W Park Sq at Bell Aircraft Underpass SAUL'S DEPT STORE, 60-61 S Park Sq STEPHENS W P LUMBER CO, 315 Church Milk Dealers PURITY DAIRY, RD 4 Lumber Manufacturers Carruth R J Good & Bad Lumber Atlanta Milliners--Retail rd RD 5 FLORENCE'S INC, 21 N Park Sq STEPHENS W P LUMBER CO, 315 SAUL'S DEPARTMENT STORE, 59-61 S Church Park Square STYLE SHOP, 61 S Park Square Lumber--Wholesale Faudel Lumber Sales 306 Cleburne av Millwork Dealers STEPHENS W P LUMBER CO, 315 STEPHENS W P LUMBER CO, 315 Church Church Manufacturers Agents Millwork Manufacturers Power Clarence E 301 Cherokee STEPHENS W P LUMBER CO, 315 Church Marble and Granite Dealers McNEEL MARBLE CO THE, 355 Sessions Monuments & Monumental Work Mattress Manufacturers Landers Mattress Shop 107-a S Waddell Cobb County Marble Co 300 Depot Marietta Marble & Stone Works 202 Goss McNEEL MARBLE CO THE, 355 Sessions Memorial Manufacturers Cobb County Marble Co 300 Depot Morticians McNEEL MARBLE CO THE, 355 Sessions DOBBINS ALBERT M FUNERAL SERV- Memorials and Markers ICE HOME, 306 Cherokee HANLEY CO, 120 Lawrence McNEEL MARBLE CO THE, 355 Sessions WARD MAYES & CO, 408 Church Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S, 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PHONE 840 468 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO . "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. Mosoleums SINCLAIR PENN--Sami A White agt, McNEEL MARBLE CO THE, 355 Sessions Butler nr Glover TEXACO--F P & "Bob" Lindley Consig- Moth Proofing nees, 108 Glover MODEL DRY CLEANERS, 117 Cherokee TIOLENE--Roy McCleskey Agt, Church NU-WAY DRY CLEANERS & LAUNDRY, (Eliz) 513 Page Moving and Hauling , Motion Picture Theatres CLACKUM'S TRANSFER, 107 S Waddell COBB THEATRE, 23 N Park Square Legion Theatre 110 Washington av Music Teachers STRAND THEATRE INC, 19 N Park Sq Daniell Lila G (piano) 113 Forest av Leg'g Christine S Mrs (piano) 417 Whit- Motor Oil lock av ESSO--Max C Pittard agt, 127 Butler ESSOLUBE--Max C Pittard agt, 127 But- Neckwear--Men's ler WILSON BROS--Johnny Walker Inc, 45 GOLDEN SHELL--Forrest C Brooks agt, W Park Square Atlanta rd GULF PRIDE--Fred V Legg distributor, Newspapers 129-33 Butler Cobb County Times (weekly) 109 Whit- GULF PRIDE--McKinney Tire & Battery lock av Service, 218 Church Marietta Journal The (daily) 109 W An- HAVOLINE--F P & "Bob" Lindley Con- derson signees, 108 Glover MOBILOIL--Max C Pittard agt, 127 But- Nurserymen ler MEINERT FLORIST, 310 Roswell OPALINE--Sami A White agt, Butler nr Glover N urses--Graduate SHELL PENN--Forrest C Brooks, Atlan- Bozeman Eleanor A Mrs 509 Kennesaw ta rd RD 5 Brisendine Roxie P Mrs 309 Roswell SINCLAIR PENN--McPherson Tire Shop Crawford Ruth D 307 S Waddell Apt 8 219-21 Church Ferguson Lucy B 204 Lawrence FOREST 0. 1RO0KS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 469 MAYES WARD & CO. DIRECTORS1" PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 FURNITURE CO. "Complete Home Furnishers In Marietta Since 1916" Nurses, Graduate--(Contd) Morris Lucille R Mrs Church (Eliz) Musana Helen B 121 Wright Vanous Jean R Mrs Cranfill (FO) Wright Emma E 604 Roswell Thomason Harry 100% Whitlock av Osteopathic Physicians Means Clair A 100% Whitlock av Nurses--Practical Foster Mae W Mrs Henry RD 5 Lowman Ruth S Mrs 222 E Dixie av Outboard Motors Dealers McKinney Tire & Battery Service 218 Church Reece Mattie B Mrs Church (Eliz) Shirley Lilia S Mrs 109 Hawkins Webb Alice 209 S Waddell Packing and Crating CLACKUM'S TRANSFER, 107 S Waddell Webb Alice 106 E Dobbs Paint and Varnish DU PONT--Stephens W P Lumber Co, 315 Office Equipment and Supplies Church OFFICE SALES & SERVICE, 114 Atlanta LOWE BROS--Marietta Lumber Co, Old Oil and Lubricants--Dealers GULF OIL CORP, 129-33 Butler SHELL OIL CO, Atlanta rd RD 5 SINCLAIR REFINING CO, Butler nr Glover Atlanta rd at Bell Aircraft Underpass PITTSBURGH--Schilling F E A Inc, 33 N Park Square WESTCOTE--Western Auto Associate Store, 16 E Park Square STANDARD OIL CO OF KENTUCKY, Paint and Varnish Dealers 127 Butler COWAN AUTO SUPPLY, 29 N Park Sq TEXAS CO THE, 108 Glover WOFFORD OIL CO Church (Eliz) MARIETTA LUMBER CO, Old Atlanta rd at Bell Aircraft Underpass SCHILLING F E A INC, 33 N Park Sq Optical Goods Sherwin-Williams Co 114 Powder Springs KERLEY H E, O DR, 26 N Park Square STEPHENS W P LUMBER CO, 315 Church Optometrist KERLEY H E, O DR, 26 N Park Square Parks and Playgrounds LESTER ROBT L, 59 S Park Square Glover Park E Park Square cor Atlanta PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 470 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. KNOW THE HAPPINESS AND INDEPENDENCE OF OWNING YOUK OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL. Pres. P. G. SMITH. Sec'v and Treas. J. GLENN GILES, Atty. Parks, Playgrounds--(Contd) Pottery--Retail Kennesaw Mountain National Park end FRANKLIN J W & SONS, 1 mile off New Kennesaw av Atlanta hwy Lewis Playground Campbell Hill nr Hill- side av Poultry and Game Breeders Marietta Hatchery 205 Church Photographers Loudermilk Studio 20 N Park Square Power and Light Companies Cobb County Rural Electric Assn Member- Physicians and Surgeons ship Corp 113 Winters Allen Geo O 64 S Park Square Chamberlain Rodrick L 120% Lawrence Prescription Druggist Donehoo Clarence A 64 S Park Square FOWLER A HERBERT 206-10 Cherokee FOWLER RALPH W 206-210 Cherokee Gober W Mayes 220 Church ATHERTON DRUG CO, 46 W Park Sq JONES PHARMACY 18 N Park Square WILLIAMS DRUG CO, 39 W Park Square HAGOOD GEO F 206-210 Cherokee Printers--Book and Job HAGOOD MURL M 206-10 Cherokee Cox Printing Co 108 Atlanta WELCH LEONARD L 206-10 Cherokee Marietta Publishing Co The 109 W An- derson Plumbers--Gas and Steamfitters Mayes Charlie M 215 Church Produce Dealers--Retail SCHILLING F E A INC, 33 N Park Sq Georgia Produce Co 114 Washington av Plumbing Fixtures Publishers--Book CRANE--Schilling F E A INC, 33 N Park Kennesaw Publishing Co 201 McCord Square Publishers--City Directory Potted Plants BALDWIN DIRECTORY CO INC, 125 Meeting St., Charleston, S. C. COLONIAL COTTAGE GARDENS 811 Powder Springs Publishers--N ewspaper MEINERT FLORIST 310 Roswell Brumby Press Inc 109 Whitlock av PHONE 60 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- J\f^SEY W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 471 MAYES WARD & CO AMBULANCE DU All C Ej|0 service raiUSiE 349 A. D. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. Publishers, Newspaper--(Contd) WESTERN AUTO ASSOCIATE STORE, Marietta Publishing Co Inc 109 W Ander- 16 E Park Square son Railroads Radio Sets Louisville & Nashville Railroad passenger MOTOROLA--McPherson Tire Shop 219- sta 208 Mill frt depot 210 same 21 Church Nashville Chattanooga & St Louis Railroad PHILCO--Brumby Furniture Co 12-14 E passenger sta 208 Mill ft depot 210 same Park Square PHILCO--McKinney Tire & Battery Serv- Regalia Dealers ice 218 Church Pettibone Bros Mfg Co 108 Root RCA--Brumby Furniture Co 12-14 E Park Square Real Estate STROMBERG-CARLSON--James A Reece MEDFORD EARL G, 215 Atlanta Electrical Appliance Co 211 Cherokee Stokes & Co 119 Atlanta TRUETONE -- Western Auto Associate VICTORY HOMES OF MARIETTA INC, Store 16 E Park Square 501 Victory dr ZENITH--Brumby Furniture Co 12-14 E Side Square Rental Agents VICTORY HOMES OF MARIETTA INC, Radio Sets and Supplies 501 Victory dr COWAN AUTO SUPPLY, 29 N Park Sq FIELD FURNITURE CO, 202 Church Restaurants and Lunch Rooms JAMES A REECE ELECTRICAL APPLI- Allen's Cafe 202 Montgomery ANCE CO, 211 Cherokee Cherokee Street Lunch 104 Cherokee MARIETTA RADIO CO, 116 Cherokee Chester's Cafe 119 Church McKinney tire & battery serv- City Cafe 43 W Park Square ice, 218 Church Dew Drop Inn 115 Mulberry mcpherson tire shop, 219-21 church Dixie Cafe 30 N Park Square PEERLESS FURNITURE CO, 102 Whit- Fowler's Place 110 Lawrence lock av Frey Noah S 200 Mill RICE FURNITURE CO, 108 Washington Honea's Cafe Atlanta rd avenue Hunter's Lunch 231 Montgomery ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Flowers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER CO. PHONE 840 472 BALDWIN'S 1944 ICE-COAL-PHONE I SOUTHLAND I C. E CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 Restaurants-- (Contd) Rug Cleaning Jack's Place 102 Washington av AMERICAN LAUNDRY & DRY CLEAN- Kidd's Cafe Atlanta rd ERS, 229 Winters Lawrence Street Cafe 118 Lawrence Liberty Bell The 925 Atlanta NU-WAY CLEANERS & LAUNDRY, 513 Page Marietta Cafe 9 E Park Square Millwood H Fred 107 Root Rugs and Carpets Model Cafe 112 Cherokee ALEXANDER SMITH--Brumby Furniture New Marietta Hotel Coffee Shop 200 Depot Co, 12-14 E Park Square Petty Lawrence W Rose la (Eliz) BIGELOW-SANFORD--Brumby Furniture Rogers Jack 320 W Goss Co, 12-14 E Park Square Sanders Cafe 624 Cherokee Skinner's Cafe 160 Dixie av Rugs & Carpets Dealers Rocker Manufacturers BRUMBY FURNITURE CO, 12-13 E Side Square BRUMBY CHAIR CO THE, 106 Kenne- saw av Safe Deposit Boxes Roofing BIRD--Stephens W P Lumber Co 315 Church COBB EXCHANGE BANK, 22 N Park Sq FIRST NATIONAL BANK THE, 50 S Park Square FLINTKOTE--Marietta Lumber Co, Old Sand & Gravel Dealers Atlanta rd at Bell Aircraft Underpass CLACKUM'S TRANSFER 107 S Waddell TEXACO--F P & "Bob" Lindley Consig- MARIETTA LUMBER CO, Old Atlanta rd nees 108 Glover at Bell Aircraft Underpass Roofing Dealers STEPHENS W P LUMBER CO, 315 Church MARIETTA LUMBER CO, Old Atlanta rd at Bell Aircraft Underpass Savings & Loan Associations STEPHENS W P LUMBER CO, 315 Church COBB COUNTY FEDERAL SAVINGS & LOAN ASSN OF MARIETTA 100 Cher- TEXAS CO THE, 108 Glover okee "Serving Cobb County Since 1900" Westing-house IJ |U| f|%, g D D) |C Stoves and Appliances and Radios Ranges Wholesale and Retail GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 473 MAYES WARD & CO FUNERAL &UHHC EWfl directors rnmt 349 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Telephone 1098 Sav. & Loan Assns--(Contcl) Happy's Service Station 403 Roswell MARIETTA FEDERAL SAVINGS & Hardage C B Service Station 301 Church LOAN ASSOCIATION 112 Atlanta Hardage Service Station 309 Cherokee Hartsfield Everett Service Sta 915 Atlanta School Supplies Marble Inn Church (Eliz) OFFICE SALES & SERVICE, 114 Atlanta Marietta Service Station 235 Atlanta Payne Service Sta 1400 Cherokee Schools--Public Red & White Service Station No 3 At- Elizabeth School Canton rd (Eliz) lanta rd Keith School 602 Haynes Richards Service Station Church (Eliz) Lemon Street School Lemon nr Rigsby SMITH CARL TIRE CO 222 Atlanta Marietta High School Winn cor Polk Smith's Service Station Roswell nr Atlan- Osborne Robt L School Joyner av (PO) ta-Marietta Hwy Perkinson High School Lemon nr Rigsby Thomas Paul E Service Station Atlanta rd Waterman Street School 214 Waterman Wilber Fred Service Station Atlanta rd Screens--Door and Window Sheet Metal Works STEPHENS W P LUMBER CO, 315 SCHILLING F E A INC, 33 N Park Sq Church Shirts--Men's ARROW--Johnny Walker Inc, 45 W Park Seeds--Retail Square Reeve's Seed Store 213 Church MARLBORO--Saul's Department Store, Service Stations 59-61 S Park Square Atlanta Street Tire & Battery Service 310 Atlanta Shoe Dealers--Retail Brooks Service Station 315 Whitlock av COGGANS SHOE STORE 52 S Park Sq Cherokee Certified Service Station 400 DU PRE HARRY N 110 Whitlock av Cherokee Marietta Bargain House 106 Cherokee Church Street Service Station Church SAUL'S DEPT STORE 60-61 S. Park Sq (Eliz) Fair Oaks Service Station Atlanta rd (FO) Shoe Rebuilders FIVE POINT SERVICE 111 Roswell Connally Shoe Shop 201 Church Gulf Service Station 303 Atlanta EASON SHOE SHOP, 108 Cherokee REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 474 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, IN, M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 Shoe Rebuilders--(Contd) Marietta Shoe Shop 102 Atlanta Tritt Shoe Repair Shop 105 Lawrence Sign Painters and Manufacturers Bagwell Sign Service 131 Hazel Societies Shoes--Children's BPOE No 1657 112 Waverly Way COGGINS SHOE STORE, 52 S Park Sq Cherokee Chapter No 13 RAM 3d fir 209 POLL PARROTT--Saul's Department Atlanta Store 59-61 S Park Square Constantine Commandery No 26 K T 3d WEATHERBIRD--Coggans Shoe Store 52 fly 209 Atlanta S Park Square Glover Camp No 1245 WOW 3d fir 209 Atlanta Shoes--Men Kennesaw Council No 10 D of A 3d fir 209 ENDICOTT-JOHNSON H N DuPre 110-12 Atlanta Whitlock av Kennesaw Lodge No 33 P & A M 3d fir FLORSHEIM--Coggan's Shoe Store 52 S 209 Atlanta Park Square Marietta Chapter No 208 OES 3d fir 209 JARMAN--Johnny Walker Inc, 45 W Park Atlanta Square Marietta Council JOUAM 3d fir 209 At- NUNN-BUSH Johnny Walker Inc, 45 W Park Square STAR BRAND--Saul's Department Store, 59-61 S Park Square lanta Marietta Council No 74 R & S M 3d fir 209 Atlanta Orr Horace Post American Legion 31 N Park Square Shoes--Women's MODERN AIRE--Coggans Shoe Store, 52 S Park Square Soft Drinks Darby I A & Co 109 Winters QUEEN QUALITY--Coggans Shoe Store, 52 S Park Square Sporting Goods--Dealers STAR BRAND--Saul's Department Store, COWAN AUTO SUPPLY, 29 N Park Sq 59-61 S Park Square SCHILLING F E A INC, 33 N Park Sq VELVET STEP--Coggans S Park Square Shoe Store, 52 v. Stationers--Retail OFFICE SALES & SERVICE, 114 Atlanta Hotel Field STRICTLY M0DEKN WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 W, P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 415 ambulance nil A M C Oi MAYES WARD & CO. service rnuiiEi 0*15 PHONE 60 HOME OWNED -- HOME OPERATED NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s J-ownerSEY Steel Fencing Surgical Supplies TENN APPALACHIAN--Stephens W P ATHERTON DBUG CO, 46 W Park Sq Lumber Co 315 Church JONES PHABMACY 18 N Park Sq WILLIAMS DBUG CO 39 W Parq Square Stoker Coal BLACK STAB--Southland Coal Co 100 W Tailors Dobbs HAZEL WALTEB W, 111 Waverly Way DIXIE STAB--Southland Ice Co 100 W Dobbs Tax Consultants BED HEABT--Cobb County Coal Co, 109 BESHEBS W HABOLD, Blair Bldg Cleveland av HUNT HABVEY H CO, 1110 First Natl Bk Bldg Atlanta Stoker Coal Dealers BESPESS & BESPESS, 1305 First Natl COBB COUNTY COAL CO, 109 Cleveland Bk Bldg Atlanta avenue GEOBGIA COAL CO 119 Butler Taxi Service Morrison Cab Co 310 Atlanta Storage Co Safety Cab Inc 200 Cherokee MABIETTA TBANSFEB AND SALVAGE CO, 215 Church Telegraph Companies Stove & Bange Dealers WESTEBN UNION TELEGBAPH CO, CHANNELL FUBNITUBE CO, 203 Pow- 110 Powder Springs der Springs CBESCENT FUBNITUBE CO 100 Whit- Telephone Companies lock av DU PBE H N, 110-12 Whitlock FIELD FURNITURE CO 202 Church SOUTHERN BELL TELEPHONE & TELEGRAPH CO, 208 Powder Springs PEEBLESS FUBNITUBE CO, 102 Whit- lock av Theatres--Motion Pictures Surety Bonds COBIB THEATRE 23% N Park Square GLENS-FALLS INDEMNITY CO--A D Legion Theatre 110 Washington Litle Agent 112 Atlanta STRAND THEATRE, 19 N Park Square Invest At Least \\T 7 1 10% in Vv 9x Bonds W. P. STEPHENS LUMBER CO. PHONE 846 476 BALDWIN'S 19 ICE-Om-PHOHE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling 1PIIANFQ- 215 CHURCH iw 102 LEMON OC1 MARIETTA TRANSFER & SALVAGE CO. CASH FOR ALL SALVAGE PAPER, CLOTH, ETC. Tire Dealers--Wholesale FIRESTONE--McKinney Tire & Battery STANDARD OIL OF KENTUCKY, 127 Service, 218 Church Butler GOODRICH--Cowan Auto Supply, 29 N WOFFORD OIL CO Church (Eliz) Park Square GOODYEAR--McPherson Tire Shop, 219- Tire Dealers and Repairers 21 Church COWAN AUTO SUPPLY, 29 N Park Sq PHARIS--H N DuPre 110-12 Whitlock av Dunlop Tire & Rubber Corp 203 Church YALE--Johnson's Pontiac Service Station FIVE POINT SERVICE 111 Roswell 225 Atlanta Mckinney tire & battery service YALE--Roy McCleskey, Agt, Chrureh 218 Church (Eliz) McPHERSON tire SHOP, 219-21 Church SMITH CARL TIRE CO, 222 Atlanta Tractor Fuel--Wholesale WESTERN AUTO ASSOCIATE STORE, GULF OIL CORP 129-33 Butler 15 E Park Square SHELL OIL CO Atlanta rd RD 5 SINCLAIR REFINING CO Butler nr Tire Recapping Glover Mckinney tire & battery service STANDARD OIL CO OF KENTUCKY 218 Church 127 Butler McPherson tire shop, 219-21 church SMITH CARL TIRE CO, 222 Atlanta Trailer Camps VICTORY TRAILER PARKS Atlanta rd Tire Vulcanizing U S 41 Mckinney tire & battery service 218 Church Training Schools McPHERSON TIRE SHOP, 219-21 Church Rickenbacker Aircraft Training School 205 SMITH CARL TIRE CO, 222 Atlanta Wayland Tires and Tubes Transfer Companies ATLAS--Max C Pittard agt, 127 Butler CLACKUM'S TRANSFER 107 S Waddell DAVIS DE LUXE--Western Auto Asso- MARIETTA TRANSFER AND SALVAGE ciate Store, 16 E Park Square CO, 215 Church SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 848 MARIETTA CITY DIRECTORY 477 MAYES WARD & CO FUNERAL DIRECTORS PHONE 549 Transportation--Freight--Motor Veterinarians CLACKUM'S TRANSFER 107 S Waddell Riddle John T 117 Winters MARIETTA TRANSFER AND SALVAGE CO, 215 Church Watches and Clocks--Retail KERLEY H E, O DR, 26 N Park Square Typewriter Machines--Dealers and Service Watch and Jewelry Repairers OFFICE SALES & SERVICE 114 Atlanta KERLEY H E, O DR, 26 N Park Square Undertakers W'ater Heaters DOBBINS ALBERT M FUNERAL SERV- STOKOL--Southland Ice Co, 100 W Dobbs ICE HOME 306 Cherokee HANLEY CO 120 Lawrence Water Heaters--Dealers WARD MAYES & CO 408 Church SOUTHLAND ICE CO 100 W Dobbs Underwear--Men's Water Systems WILSON BROS--Johnny Walker Inc 45 W FAIRBANKS-MORSE--Barron Electric Park Square Co, 203 Mill Underwear--Women's Water Systems--Dealers ARTEMIS--Style Shop 62 S Park Square BARRON ELECTRIC CO 203 Mill DORIS DODSON--Florence's Inc, 21 N Park Square KAYLON--Florence's Inc, 21 N Park Sq Weather Strip Dealers KAYSER--Saul's Department Store, 59-61 STEPHENS W P LUMBER CO 315 S Park Square Church UAROS--Florence's Inc, 21 N Park Sq VANITY--Florence's Inc, 21 N Park Sq YOLANDE--Florence's Inc, 21 N Park Sq 'Wedding Decorations--Floral Upholsterers Jones Dennis W 202 Polk COLONIAL COTTAGE GARDENS 811 Powder Springs MEINERT FLORIST 310 Roswell Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 849 478 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling DUANECrllvllbw* 215 10 CHURCH 10 102 LEMON Ofil MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPER, CLOTH, ETC. BALDWIN'S Marietta GEORGIA NUMERICAL TELEPHONE DIRECTORY 1944 Containing a list of telephone subscribers arranged in numerical sequence. The information listed was obtained by a house-to-house canvass and is offered for the convenience of subscribers to the City Directory. Since telephone numbers change rapidly, it is suggested that persons using this list refer to the latest additions of the regular telephone directory issued by the local telephone company in order to verify the information contained herein. SEARS, ROEBUCK &C0. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 479 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 45 W. Park Sq. "The Exclusive Store for Men" Telephone 331 1 Southland Ice Co 2 Same 4 Allen Drug Co 5 Same 6 Atherton Drug Co 8 Georgia 9-J Gantt JCoNa1l Co 9-W Adair J W 10-W Crosby Virginia V 11 L & N R R and N C & St L R R frt depot 13 Marietta Trans & Sal- vage Co Marietta Storage Co 14 Glover Machine Wks 15-R Meek Sarah E 17 E N Auto Parts Co 18 Marietta Publishing Co Marietta Journal The 21 Harrison G L 22 Leavell J F 24-R Frey J B 25 Glover Aimee L Mrs 26 Donehoo C A phys 28 Law Mary E Mrs 29 Kappas G W 30-J Benson R P 30-R Mitchell C F 30-W Clay W E 31 Harris W L 33 Anderson Mtr Co 35 Meinert Florist 36 Mayes M W 37-J Power C E 37-W Upshaw Marjorie 38 Railway Express Agcy 39 Safety Cab Inc 40 Smith Glover 41 Hodges Drug Co 42 Same 44 Marietta Federal Sav- 74 Atkinson Mary ings & Loan Assn 45 Cowan Auto Supply 77-J Foster Nancy D Mrs 77-W Heck J A 474848-W Miller Leo 78 Jones D 79-J Haney W H M(uJ J phol) 79-W Claekum Rosa M 49 Williams Drug Co 51 Harris Lula M Mrs 52-J Groover Hugh Mrs Claekum Trans 81 Gulf Gil Corp 52-M Harris J W 82 Connor Kath A Mrs 52- 83 Cobb County R Federal 53 McPherson E W 5354 Groover Hardware Co Savings Assn of M& aW Lrioeattna 84 Gober W Mayes phys 55 Anderson Mtr Co 86 Kerley H E Dobbins J S 87-W Benson W H 56 Schilling H O 89 Carson Geo 57 Cash & Carry Gro No 3 90 Cinderella Shop 58 Atherton L H 93 Fowler J M Co Atherton's Greenhouse 94 Carpenter J L dentist 59 Horne N J 96 Coggins Shoe Store 60 Nu Way Clnrs & Lndry 97 Hardage C B Service (plant) 61-J Frasure J H Sta 98 N'atl Farm Loan Assn 61-M Coffey G M 99 Reeves Seed Store 61-R Spears C C 100 Gann G B 61-W Wilson M E 62 Lewis-Noe Mtr Co 101102- 64 Brown C M 102-R Pruitt Wade 65 L & N R R and N C & 103 Griggs M A gro S't L R R passenger 104 Welch L L phys depot 66 Page R W 105106- 67 Walker J S 69 Holmes D H 70 Marietta Coca Mrs Cola 108 Strait C D chiro 108-J Galt Gertrude Mrs Btlg Co Inc 72 Reynolds J D dentist 109 Caldwell A J 110-J Lovell J E 73-J Johnson W M 73-W Worley J C 110-R Williams Mary D Mrs Moving 9 Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 480 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. FiED LEGG Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St. Ill Shaw Emma I Mrs 141- 177-M Hagood G R F Jr 113 Barron Electric Co 142- 177-R Shell P E W 114- J143BVeiycetrosryRBEeauty Shop 179-J White J E 115- J144S-MpakCeoyGle SR C 179-M Daniell S N 115- W 146 KWaaplllaanc'es BDeCpt Store 179-R Daniell W Z 116- J147 CWroawtkeinWs WE W III 179- 116-M LeCroy W A 148 Church Street Service 180- 116-R Camp J T Sta 181 Hagood G F phys 116- W TWuorfnfeorrdCOEil Co 183-J Hipps Clara 117- J150 SMorordeelsl DLreyn Clnrs 183- 117-W Roberts Wm 153 Spears, P L 184- 119- J154S-JnyCdhearstHainC Clyde J 184- 120- J154D-MobSbienxstoWn SG G 185- 121 Wright Ann Mrs 154-R Nelson J J 186- 122-R Channell Geo W 154-XW Hawkins F W 186- 123 Sibley S H 155 Hardin Eliz R Mrs 187- 124-R Nelson J V 159 American Lndry & Dry 187-M Reid C W Jr 124- W TeaCgulnersT T 189-M Smith J B 125- W 160-RGrCifofixn RHeBlen C 189-R Greer E J 127 Miller's Inc 160-W West H G 191 Perkinson W H 128 Little Irma N Mrs 161 Excelsior Lndry 192 Grand Shop The 129 Farm Security Admn 162 Myers Fredk 193-J Mell H C 131 Johnson's Pontiac Ser- 163- 193- W vice Sta 164- 194- J 132-J Richards Service Sta 164- 195- W 132-R Harrison H M 165- 195- J 132-M Matlock O E 132-W McClure G E 133 Ward E C 165166166-W Garner J S 196- W 196-W Williams J S W 198 Brumby Furn Co 134-R Cole Constance 167 Hall Lelia Y Mrs 199-J Petty L W 134- W 169 BCroulembByayGardetchen D 199-W Parris T A 135- W 171- Adams H B Barron Pauline 172- 136 Gregory P A 172-M B'arrett L P 200 Atlanta Gas J Light Co 201 Same J 202 Boatner Florence B 138 Keith Grace P Mrs Winkles Verna B Mrs 139- J 172-HRicGksrizGzleMLeon 203-J Moor A F 140- J 172-LWiviWngislbtounr DH AW 203- 140- W 174 WMiallianigerhaGm SEliz W Mrs 204- 141- W 175- Lee W W 204-W Dobbs W AJ 142- J 176-Cornette J E | 205-J Clotfelter MJ E WALTER W, HAZEL TAiG DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER 0. PHONE 840 marietta city directory 481 MAYES WARD & CO. AS^cNeCE PHONE 549 Marietta's Most Complete Department Store SALES "The Best - - for Less ' 205- W 235- Tribble C L 264-J Benson HaroR ld 206- J 236- Landers N M 264-M Goodson C HJ 206-W Auer P K 237- 208-M Hurst G R 238 Welsh Lois 208-R Davenport A L 240 Hancock R J 208-W B`radberry Josie M 241-J Anderson Leila Mrs 241- 208-XJ Mashburn J M 242- 209 Allen G O pbys 242-R McCulloch Margt 210 First Natl Bk 243 Reeves J W Rev 264-W Black DaisyR W Mrs 265 Skelton J R Jr 266-W Conroy J W 269-J Rabun J E 269-M Clay FannieW L Mrs 269-R White G L J 269270- 211 Same 241-W Moore E L 212-W Hamby T J 245-W Goetz J A 213 Brumby Anne F Mrs 246 Fowler R W phys 270-W McCamey R L 271 Anderson J T 272 Georgia Produce Co 214-J Hardage Hugh 248-M Castile H E 275-J Reed Dessie L Mrs 214-R Eargle J I ,248-W Tibbitts J E 275- 214-W Lawler L W ,251 Gavin Ei M 276- 215 Brumby Marie M Mrt!? 251- 276- W 216-R Mitchell May 252- 277- J 217 Fowler A H phys 252-M Hill C G 277-W Orr Lilah J Mrs 218-J Davenport C E 253 Crain R S 279-J Pace J E 218-R Boling E E 254-J Crumbley W D 281 Baxter Eliz R Mrs 218- W 254-W MGardedenoxLWB A 284-J Brown J W 219- W 255 MorSritsoeztiteer LOeliala TC MMrrss 284- 220 Dunlop Tire & Rubber 256- 285- J Corp 257- 285-W Spang G J M 221-W Mozley J E 257-R Lee W G 286 Green H P 224 McClesky Roy 257-XM Downen D E 287 Saul's Dept Store 225 Lynes Kate W Mrs 258 Schilling F E A Inc 288- 227 Evelyn's Beauty Shop 259-R Turner J A 289- 229-R Mozley Nettie 259- 289-W Ellison EllaW Mrs 229- W 260- McCleskey D H 290 DuPre Lelia BJ Mrs 230- J 260-W HSeasrsdiaognes JL MM 291 Phillips J P 230-W Mims E C 261 Marietta Trans & Sal- 292- 231 Tate Jennie Mrs vage Co 293- 232-J Reed C L Marietta Storage Co 232-M Hardage C M 262-J Flood J B 232-R Gantt C E 262-M Goodspeed M W 232- W 262-R GEilal toEn WS O Jr 293-M Kuykendall W H 293-R Carney J W 293-W Norton Bertha Mrs 233- W 262- Schaeffer Nellie 294 White S C W 234 Hagood Geo F Jr 263- 295-M Camp H M J dentist 263-W Hicks R S 295-W Pine O C WOFFORD OIL 00 `Be Sure -- With Pure' ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES EES. PHONE 224 Tioiene W. P. STEPHENS LUMBER CO. PHONE 840 482 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 296-J Covington Ber-tha D Mrs 297 Daniell's Jewelry Store 298-J Dobbs Evan P 298-W Goodman W A 299 Thomas Geo 300 Brumby Press Inc Cobb County Times 303 Marietta Hospital 304 Boston Nancy S Mrs 305 Jones Pharm 306 Same 307 Reed R G dentist 330-W Kay P C 331 Walker Johnny Inc 332-R Smithweck Maggie D Mrs 332-W Veitch M O 335336336-R Clackum, E E 337 Keeler Sarah Mrs 338 Vance Wm L 339340341- 359 Kerley H E 360 Bishop P H 360- 361 Hicks. C O 361- 361- W 362- M 362-W Morris Minnie 363 Chalker O J 364-J Guest A A 364- W 365- W 366- R 308-W Duncan Lula J Mrs 310-J Richards P R 310-W Anderson H G 341-W Lewis T O 342 Legg F V 343-J Ridgway Anna J Mrs Mrs 366-W Williams C P 367 Williams E D 312 Nelson J V 343- 368 Schilling W EW 313 State Dept of Public 344- 369 DuPre H N J Welfare 344-M Smithweck G W 371 Rogers L Olivia Mrs 314315- W 344-RHSomoditJhwWeck J W J 344-WHasJsaeclklsWon WZ T 372-J Smith K E 372-W Harris H W 316- J 345 LDooubdbeinrms iClk MH H 374-J Roberts P R 316- W 346 LHeaavdealwl aGy AJ H 375 Marler J E 317- J 347 Headmgeess CMiPnnie L Mrs 376 Brumby Chair Co The 318- J 348- Kinney M W 377 Same W 318- WSSacahnsdeWrs THM 378 Pettett Grocery 319- J 349- McEntyre J T 379 City Board ofM Light & 320- J 349-RMoMorarHr MC C Water Wks pump 321- J 350 CGrraeienn'swaGyarLagBe Stcl 321-W Kirby T J 322 Lawrence M M 351 Coggins R L 352 Andrews V B! 380381- 323 Gamer Appliance Co 353-M Hulsey A J 381-W Kelley E M 324 Roberts J Guy 353-R Brown J H 382 Baird F E 325 Allen Geo O phys 353- 383- W 326-R Dunn R H 354- Mrs M 326-W Blanchard S D Groover Jas H 384- 327 McKinney Tire & Bat- 355 McPherson Tire Shop 384- tery Service 356 Combs G M 385- 328 Myers Fred 356 Combs Gordon M law- 385- 329- J Clayiebrorne T S 386- 330- J 357 MReaaridettPaauLliunme beSr MCors 386-M Allen H B * MARIETTA LUMBER CO. "Building Materials A Plant for Every Purpose l# That Merit Good Will" Lumber--Bldg. Materials w Phone 357 Atlanta Road W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 483 MAYES WARD & CO. ^DIRECTORS1 PHONE 549 F. P. & "BOB" LINDLEY ! Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO HOOFING TELEPHONE 688 108 GLOVER ST. 387 Medford Louella M Mrs 417-J Merritt J A 448 Daniell J J 388 Lester Robt L optom- 417-W Brown C H etrist 418 Gulf Service Sta 389-J Hayes E M 419 Cox's Market 389-M Hill J C 421 Anderson G D 389-W Miller T C 423 Stephens W N 390 Northeutt Lizzie W 424-J Collins J 449 450 RBoamokboStMoraerieThBe1 Mrs 451 Y W C A 452 Johnson C L 453 Means C A osteo 454- Mrs 424- 391 Bailey Lucy 425- 392- J 425-M WMaclElalcreatWh AHddie P 393- W 425-R HaHwijtihsohrenre CH HL 395-W Stringer Alice Mrs 427 Lemmon W P 397 Bishop J A 428-R Fowler R T 398-J Williams Mcse 429 Fowler R W 398-W Winkley Osborne 431-W Berry M M 399 Waterman Street Sch 431-M McDonald H M 400 Marietta Radio Co 431-J McCoy A C 401 Massey J E 431- 402-J Hardagj E G 432- 402- M 432- Allen J E 403- J 433- Underwood E D 403- W 435-J MLayaensdeCrs MN M 404- W 435- Ragan Gordon 405 Brown G F Rev 436- 406-J Benson R E 436-W Lindsey 406-W Waters J H 437 Dobbins Albert M Fu- 407 Petty J W neral Service Home 408-J Cox W N 439-J Murray C F 408-M Majors J W 439-M Squires R L 408409- J X 443409-WCoJWlGe DreiWloglobgnsDos nMBJ1AHC 409- W 441 GilbWeretinLmaAn C A 410- R 442-R DMecaAnfeWe EHH 455- W 455-M Holcombe LJ G 455-R Hardin Roy 456 Brown Allen 457-J Wallace S F 457-M McLemore L H 457-R Rich J W 457- 458- 458-M Weaver J W 459 Hicks Gro R 461-J Jay R F 461-M Steel H T J M 461-R Milam E E M 461- 462- W 463- J 464 Kennedy C P 465 Jackson W H 466 Reeser P D 467 Hancock Sallie Mrs 469-J Parker G R 469-M Patterson R D 469-R Howard P W 469- 470- 410- W 442- Brantley J L 411- J 443- Welsh Geo V 411-M Brooks Clyde 443-R Wright Lillis L Mrs 412 Cannon S A 444 Hagood G F phys 413- R 446-J LCyounchMJRH 414- R 446- Duncan E G 470G Mrs W J 471- 472 Sullivan J G 473 Griggs H P 474-J Ellison W E W 416 Industria Life & Health 447- 474-W Hulsey R ER Ins Co 447-W Brown E E 475 McEntyre C M HARVEY H. HUT COMPANY Auditors Accountants Tax Consultants. Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 841 484 BALDWIN'S 1944 ICE - COIL - PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 ASSOCIATION 112 ATLANTA ST. 475-J Wilson W B . 508- 540 Boatner LessiW e L Mrs 476 Strand Theatre i 509- 541-W SWalley F FM 477 McLellan Kate M Mrs 511-J Patton J H Rev 542 Willingham R T 478-J Gault Claude 511- 544-J Fowler A SW 478-M Tumlin J S Mrs 544-R Tingner J 479 Keith Sch 512- 545 York B F gro W 480-J Knight W L 514 Florence Mary A Mrs 546- 480-M Warwick Barron 515 Artistic Beauty Shop 547- 480-R Sharp E I The 547-M Parks Floy B Mrs 480-W Black J J 516 Cox Cleveland M Mrs 547-R Wehunt C A 482 Harrison Beautv Par- 517-J York Vesta M Mrs 547- lor 517- 548- R 483-R Manning O B 518- 548-W Garrison S M J 483-W Clark Grace M Mrs 518- 549 Ward Mayes &R Co 485 Willis Cuma Mrs 519- 550 Carpenter J LJ 486 Benson & Ward gros 519-M Miller Kingsly Jr 551-J Sprague J C 487 Grove R S 520 Welsh S J 552 Stephens W P 488 New Marietta Hotel 521-R Bray Jennie G Mrs 553-J Osborn G G 489-J Pettett C L 521-W Garris J D 553-M Robertson R R 489-M Phillips H J 522 Collum C J 553-R Shaw H L 489-R Manous H M 524-J Latimer T E 553- 489-W Faucett O L 524-W Kuhlman H J 554- 491- W 525 HunGt rBogGan J T 554- 492- R 526 NeaElaMtonaryWS AMrs 555 -J Driver W P 493- J 527-J CDhuimldnresWs SHusannah 555- 493-W Sanders E R E Mrs 555-W Coyle Clara M Mrs 495-W Hoppe Laura B Mrs 527-W Brown A L 555-XM Skelton B B 496 Burton L P Coal Co 528 Dobbs C M 556 Marietta Hatchery 497 S & W Const Co Inc 529 Cobb County Coal Co 657 Hanley & Co 498-J Jones E T 530-J Butler Margt W Mrs 558- 499 Crescent Fum Co 530- 559- W 501-J Landrum E M 531- 559- J 501-M Johnson H N1 531-W Hamilton S M 560- 502 Shipp R W 533-J Hunt Armstrong 560-W Barron J B 503 First Methodist Ch 533-W Tomlinson W S 561 Jolley F L 504- J 535-J CMutoisrrisLaFmrepdrine Mrs 563-J Lester R L 505- J 535-W FMloadrednocxe MMiWnnie J 563-R Knox W H Mrs 536 Marietta Glass & Cab- 563-W Mitchell Emma D 506- W iMnectBSrhaoyper J E Mrs 507- W 538- Dudley Gertrude 564 Style Shop J Mrs 539- 566-J Darby I H J Meinert MARIETTA 1 PHONE 35 florist GE0R6IA 1 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 485 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 "The Ring Leaders Since 1900" H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 566-W Groover R S 598-J Groover J D 567 Marietta Credit Ser- 599 Strang A R vice 600 Brown C M 568- J 601-R FWreoyrleNy TS L 569- M 601- Henrick E D 569-R Wingo J S 602- 569-W Crown T R Jr 602-M Worley C G 569-XJ Ossler Richd 605 Rose Beauty Shoppe 571-W Faudel E C 604-J Fowler J L 572 Latimer T E 604-M George W E 573-J 573- Willauer A R O 660066--MJ MWTeuhrrirntieettr JAWRTRJr 574- J 606-R ERbuedneesreaLl LE G 574-W Hicks C H 575 Black Beauty Salon 606-W Dobbs C L 608 Atlanta Street Tire & 576-M Runyan C P 576-R Barrett T C Battery Service Morrison Cab Co 576-W Brown J P Gro 608-J Howell Mary D 577 Loudermilk Studio 578 Cobb County Marble 610 Frey J S gro 611 Atlanta Absent Co 612-J deJarnette W L 579-J Gantt G W 613 Williams Ethel A Mrs 579-W Woodward Wade 614-J Redd W A 580 Cortelyou 583- A VJ 661154-MBlRaDioragEveilrsiszCAHCMJ rs 584- J 617- Means C A 586-R Northcutt E S 618- 586-W Bullard E G 620-J Silk John 587 Brinkley H J 620-M Shaw J E 588 Irvin J T 620-R Bennett W H 589-J Lance E T 620-W Ingram J K 590 Cox Prntg Co 591-M Gatlin Otie K Mrs 622-M Triggs A J 622-R Swanson G E 591-R Weber C J 623 Lewis J W 591592- W W 662255--J FHRrooewyddeelMlnbGCeregorWgiaB'D Mrs 593 St James Episcopal S Mrs 626- Ch 626- 595 Fay W D 627- 628- 629- 630 Elder J H 631-J 631 R Berry Wylie J E W P W 631-W Reynolds S J Fannie Mrs 633-J Hudson O L 633-M Graham Martha Mrs 833-R Berry J I 633- Mrs 634- 634-W Gilbert Annie 635 McNeel E E 636 Kitchens T A 637 Ward H A 638 Smith E M 639-W Hilderbrand A L 640 Marietta Marble & Stone Wks 641-M Partain Lamar 643 Maddox A L 644 Fowler A H phys 664487-JAMtlacnWtailliJaomusrnW X Wal L 649 Kincaid J R 650 Copeland P C 651- 652- 652- 653- 654- 654- 655- W 655-R Mabry H N 655-XM Haskins AJ G 655- W 656- W 596-R Hunt E M 628- 656-M Kirk A F R CARTER CANDY COMPANY L. E. CARTER, President MANUFACTURERS OF HI-GRADE STAPLE CANDIES -- ROASTERS AND PACKERS OF SALTED PEANUTS 301 Husk Street Phone 1041 W. P. STEPHENS LUMBER CO. PHONE 340 486 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. r`Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. 658 McLellan Stores Co 686 Blair L M 724- 659-J Moore M A 687 Hewitt S R 725- 659-W Hardage R C 688 Texas Co The 725-W Clarke W H 660 Benson A A 689-R Colquitt A O 727-W Huffman H R 662-W Roberts J G 689-W Satterfield C D 728 Lewis J H 661- W H69a0wkGinaslleJy HNannie M Mrs 730 Reynolds W M 662- R S6h9ip1pSiAnclLair Refining Co 731 Marietta Service Sta 664-R Richardson J J 693-J Brown G M 732 Read J S 664-W Hatch H L 693- 733-J WilliamsM on J C 666- R H6a9m4-ilton P D 733-M JohnsonJ E H 667- J Pi6e9r4c-e Ada C 734 Brown J EW 667-M 667-R BRroebweertrsoNn1 Nellie L C 695695-M Fain Frank 735 Kile J B J 736-J Keyes J W 667- W L6o9g5g-RinsPaRtteBrson R W 736-M Hunt Mae B Mrs 668- J C6la9c5k- um E 736-W Moor WW G 668-M Kratokvil F M 696- 737 Barrett G W W 668-R Plemel P J 697 Beck F L 738- 668- W S6m99i-tRh TAbNbott Julia Mrs 739- 669- W W69h9o-WrtonTuGrnWer Leila L Mrs 739-R Manhardt L F 671 Shaw Monto & Son 702- 739-XW SmithJ B C 672-J Cogburn E J 703- 740 Williams JJ S 672- W U70n3d-eMrwWooidlliaWmsL J R 741- 673- J Pe7n0d3l-eRy PDowHer Edna P Mrs 742- 673- W S7m08i-th W F 743 Pickens ElF iz W Mrs 674- R P7y0l9a-nt Fred 744-R Tate EliJ z S Mrs 674-W Shaw Oscar 709- 744-W Smith EW 675 Wing Gertrude Mrs 710- 745 Lester J EW Dr 676-J Nelson C B 711 Stanford J W chiro 746-J Knott G E 676-W Hardy W C 712 Caldwell & Ravan gro 746-W Dunn F M 677 Bushong C V 713 Keefe F W 746- 678 Kemp W E 714-J Pearson G S 747- 679 Standard Oil Co of Ky 714-M Underwood C C Mrs 680 Amorous M F 714-W Ivey Jane L Mrs 747-M Sams C B 681 Overcash B B 715 Holeproof Hosiery Co 749-J Turner G F 681- J H7o1n8eaFoTwerlesraJMMrsJr 749-W Gifford R O 682- R H7a1r9giSsunRlitBe Bakery 750 Hardage Service Sta 682- W B72a0gwAedllaiHr GR E 751- 683- J Th72o1maCsooonk AF HE 752- 684 Rohner F F 722 Northcutt G H 753- 685-R McMillian G H 723- 753-M AtchisonW R F 685-W Maddox S S 724- 753-R Robb M J J FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA city directory 48? MflfES wimp & co. visas,1 phowe mi BRUMBY E. PARK SQUARE PHONE 198 fbrb Coimtplejteb Hoe me e. Furnishers In Marietta Since 1916" 753- W 779 Stephens T JoEhnson W P814 DuPra R B 754- J 780-J StephensLVuedatnkiea MArrsth 815 Fletchea E T 754-M Zane F E 781 Clackum's Trans 816-J Bishop A H 754-R Gaines J W 755 Marietta Beauty Shop 756-J S'immons O D 782-W Bedford Georgia Gibson Mary L Mrs gro 783 Fridell Jesse 816- 784-J Davenport Lillian M 817- 756-W Anderson T W Mrs 818- 757 Cox R H 758 U S Post Office 784-W Benson Regina R 818-W Jones J C Mrs 819 Matlock J J 759- R 785 Dozier G LMitchell Beula8h20S-J Squires J B Mrs 760- 786 McKinney W E J 787 LeCroy J TShea D E 820-W Bishop Ina L Mrs 821 Diamond Jewelry Co 760-W Alexander Evelyn R 788-J Carter J C 822-J Musana E A 761 Branson T C 762-J Wilson L L 788-R Osborne Bessie C Mrs 822-W Story H P 824- 762-M Prince F P 762763764765764765765-M Dobbs R L 484 Colonial Cottage 788-W Allison Clifton W 789 Carruth R JRoberts L C J 791 Custer B LHicks J F J 792 Scarr F J Wilson H P J 793-J HadawayHoPwaErd C E W 793-W Hairston SJtimMson L K J 794 Perkinson HoigwharSdchC E 825826 Sockwell W C 827 Coryell H G 830-J Jones M M 830-M Reed R D 830-R Jackson Caroline 830- 795-J Schroder Fred Gar- 795-W Brooks F C 831832 Smith C A dens 796 Williams Mattie A 833 Pledger R B Trezevant W H Mrs 767-W Dickerson M C 797-R Tribble L R 768 Piggly Wiggly Super 798 Torgerson R A Mkt gro 799 Shaw Gilbert Feed 769-W Dobbins Louise G Store Mrs 804 Western Union Teleg 770 Economy Ice Cream Co 771-W Montgomery G F Jr Co 807 Branson Concrete 773-M Johnson P E 773-R Dunaway W H Products Co 808 Medford E G 775 Wellons F B 809-J Johnston M O 776-W Fuller Cora B Mrs 809-W Whitehead Ruth S 777 Cherokee Certified 810 Suhr R C 834835836836-M4 Blair H D 836-R2 Shields B C 836-R4 Hardy J D 836-W1 Dunn W M gro 836837839 MacIntyre P A 840 Stephens W P Lb'r Co 846-J Hemp S' S Service Sta 811-W Southern A F 848 Marietta Hosiery Co 778-J James A C 812 McFarland C W 849 Kaplan Benj 778-W Phillips C E 813-R McDaniel D O 849-J Barron W F PEERLESS FURNITURE CO, 10. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER 00. PHONE 840 488 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW THU HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH. Sec'v and Treas. J. GLENN GILES, Atty. 850 U S Employment Ser-t 873- vice War Manpower 874- Comn 874-R Hagood L T 851 Northcutt R H 874-W Donald D F 852 Glasure A H Rev 877-J Sutton J C 853 Roberts Mae B Mrs 877-R Jackson J M 854 Roberts L E 877-XM Eskew W R 855-J Anderson J D 880- 855-W Reid M Louise 881- 856 Hagood M M pbys 882- 857-J Pilgrim J H 882- 857- W 8T8r3u-love G V 858- J F8o8s3t-er R O 858-R Maloney R E 884- 858- W 8M84a-yMesOAteyF W M 859- J W88r4i-gRhtMCexLC H 859- M 8M84c-Intosh R L 860- M 8L8a5n- dis C W 861- J C88ro5s-Ms SLeSe J W 861-M O'Dell Chas L 886 Wayland H T 861-R Collier H O 887-J Holland Bryce 861- W8G87o-eMbelCaWsonPR H 862- W8C87u-rRetoDnenWsonC JJrI 863Mrs 865- J W887o-oWlbriSghhotuAp cFhsaPh C 891-J Varrial R W J 8B9a1r-bMerPDeteWrson E S 866- J 8E9s1m-RiolBJurkMe A J 866-M Davis L W 892 War Housing Center 866- W89G3riOffwinenDbyA Mfg Co 867- J 8M94c-CRurCdyashWRMM 867-R Hibble L R 894- 867-W McKinney L S 895- 869-J Ferguson J E 895- 889-R Summerour J M 896- 869-W Pratt Fannie K Mrs 896-R Griffith E E 871-R Ellis H D 896-W Shaw T G 871- W89L9o-JweHroywJellE M L 872- M89E9u-MstaHceooJpeFr J L 872-R O'Bannon Bennett 899-W Cantrell C P 872- W901MoGoonbeRr WT M phys 873- J9D02u-PJ rPehTilliEps Clara Mrs 902- W 903- J 905-J Atkins. Wm E 905-W Moore Noma Mrs 906 Smithweck T M 907-R Beasley W L 908 Baker W L 909-R ScogginsW Fred 911-W Eason AW H 913-J Perry O J P 914 Collins L RW 915 Edwards EM lla 916-R King C R H 916-W Reece LJ 917 Louise B'eauty Shoppe 918 Shaw J F 919-J Neese C W D 922-J Hall A FJ 922-R Crow Trudie Mrs 926 Reeves R N 929-J Sanger C O 929-R Killian E F Jr 929- 930- 933 Montgomery W M 934- 935- 936 Tumlin W L 938 A&P Food Stores 941 Marietta Housing Au- thority CW lay Homes 942- J 943- W 943-W Stanley J J M 945-J Mote Lawrence 945-R Waits G W 946 Burgess R. L 947-J Page C E 947-M Powell C H 947-R Chalker S A PHONE 60 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 489 AMBULANCE Ml ABIE CJA MAYES WARD & CO. SERVICE rnUilc 5W A. D. LITTLE --A0EIT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. 948 Cobb County Rural Elec 977 Smith J D 1027-R Hope H E 999999999999999999999999999999999999777777767767666666555555555555555555434823130351343002997645483532300920------------------------M-R--BR--WMDMJDCFWXJrioueMoHuaSRrMCpuAPotsmfWhSoMikontartrccirtAlelbiertrCenhbeeenyoelyBlvolaremosfbCfoHeryllDaaDeRddlobn'PrpuGeskeeseWCmutoNrlEWCpiobsRnAsthGrlHtJiiiJcIaoHpCLEICrfWWCLWhW R M J W X J PJ J M J oTW W W J R R M J euJ R rlpb-lic 1111111111111111111111111000000000000000000100010990999999999991112222111111111000000009990898888889877855543612020669599844339352303848889----------------WR--W---JJBR--TWJHMWFPSSMFMJJTPMWWRWJBGOMralamiirMShiCoaoeRliPwMPrxmtaMKCelgBMoAmlBRlGirotiB'MBuhoaaOlddtfeteamseoakcoetfhnornryoiaRneirfnarrSwiclgtEhetwsasodrhrdpnnadGnlFichrBeeewbrttirsrCeneosntrteeeMicpaluLrdrMcurnoernMBeRGtlneBBsHoeJMeaPrsyCHJrsyphNDronEtArrirnAenoTWcrhtoAehrBoolveCDRHWWMICluMMWJCoBSWFnaaGTennKCriCaionrEenLCDnleilvMrjotmionCRtyTrrleccorIctJilalTjyainteLCCiplRLBoPWlbaMestMSarNolDEopctiEiidereleohMndyWbrkntrdoTisyeJEhaernMyeMAdlniJmTeneMwnKaMsuRiaSGTrJAlWliEeTCrsMbWSleaeeityrLeloeollhcAsDiDKrEPWslCrkuMsAWDeCedEWlseaaRrCrM11111L111W11i11111111111111111M111lo1110011010000000000000i000000r000000000606000n660656n65545s45544444433334r3334364232225802095t5427143s33197267530420o0829--9-7------------WR-nGGJD---M-JJJOGBLWWWLCJVBLKRXJWPCareooMrfiiAMeaHaeBWooeAboefwevtMSsgJMoiarrintlCobbvlbsLoeaoscnealtolbbtiecpnveebeebeesahlteezunsiaoeeheDlyrerelltrreoLtelnegrrlralhMCdcrMyARbAomsceonsAscgteGCJrHyerrbfGieLFDowaaolWoJKrLbraDSWlBmJlntSDomPenWGHniscCsoMAnLnRroCodbabPoLsiJTClCnyiHncWirmaePepoeJsCC&WorWAoJnMdFR M YJ R mBi-in- 976 Mitchell O D Gro 1026 Gillenwater J R 1068 Sears Roebuck & Co PHONE "The Friendly Druggist" ATHERTON PHONE fa DRUG COMPANY 7 WALGREEN AGENCY W. P. STEPHENS LUMBER CO. PHONE 840 490 BALDWIN'S 1944 ICE -COAL - PHONE 1 SOUTHLAND ICE CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 1069 Same 1111 Davis T L. 1151-R Howard C C 1070 Holcomb W S 1112 Ferguson Lucy B Mrs 1151- 1070-J Holcombe W S 1113-J Hill H A 1152- 1070-W Dickerson Theodosia 1113- 1152-W Allgood W E J D Mrs 1114- 1154-J Clowdis W Alonzo 1072 Cranmer C Jp 1115 Fort Hill Homes 1155 Waldrip G T 1073-W Kytle AS 1116- 1157 Garrett L MR 1075 McConnell C E gro 1117- 1158-R Brown HR W 1077 Atlanta Constitution 1118- 1159 Wilbur J EJ Bureau 1119 Riddle J T vet 1158-J Watkins R L 1078 Collins N H 1121 O'Neal Amelia 1158-M Evans W L 1079 Hodges J M 1122-J Holcomb Harrel 1158-W Kemp Ima Mrs 1080-J Stells J C 1124-J Bell J H 1162 City Fire Station 1080- W11W24a-de L L 1163 Same W 1081- W11C2r5a-wford Hattie L 1164-J Jordan CR M 1082 B'agwell J M 1084 Henderson J H 11251126- 11641165- W J 1086 Noe R W 1126- 1166 Victory HomW es of Mari- 1088-J Durham G B 1127- etta IncJ 1089 Roswell St Gro 1128 Shepherd A H 1167- 1092 Reece M H 1129 Hutchenson R H 1168- 1094 Folsom H R 1130 American Red Cross 1168- 1095-M4 Vickers W L Cobb County Chap- 1169- 1095-M2 Roosevelt Clifford ter 1170 Carter S P Woody W P 1132-M Crumrine J A 1172-J Lowman Ruth S Mrs 1098 Medford Earl G 1133 Payne W F nurse 1100 Cobb Exchange Bk 1135- 1172-W Cox H AJ 1101 Same 1103-J Register H E 11361136- 1173 Peerless FuJ rn Co 1174-J Maddox LW oma Mrs 1103-M Goodson W E 1137- 1174-M Ridings TJ F 1103-R Turner Sallie Mrs 1138- 1174-R Carter CR lara M Mrs 1103-W Chandler S A 1138- 1174-W Grant WW W 1104 Stokes & Co 1139- 1175 Cowan J RJ 1106-J McKinney May S 1139-W Hunter F P 1177 Rickenbacker Aircraft Mrs 1142-J Brown E E Training Sch 1106-W Coleman Carrie M 1144 East Side Gro 1178- Mrs 1107 Pitner Clarence 1145-J Carter C G 1148-J Clackum C L 11791179-M Wade J L 1108 Merritt Allen T Jr civ 1149 Gunter J A 1180 Hames L G Gro eng 1150 Nu Way Clnrs & Lndry 1184-J Goldwasses Murray 1109-R Taft W H 1151-J Childress J H Jr 1183-R Jackson M C "Serving Cobb County Since 1900" Westinghouse |U| P|| |f% | f Q! * r* pT Stoves and Appliances and Radios * H Wholesale and Retail Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER 00. PHONE 840 Marietta city directory 49i FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. Telephone 1098 1185 Gatewood P C 1186 McBride S J 1187 Harris R T 1188-W Martin B K 1190-J Lindsey R S 11901191 Jackson T G 1191- 126312641266-J Renshaw T J 1266-M Livingston E G 1266W 1267- York A S . 1267-R Carter C L R 1268 Shell OilTCuroner O E 1561- W 1562- R 1562-R Green Sami Jr 1564 Neary W E 1565-J Underwood AlicW e Mrs J 1565- 1566- 11111111119999932122----WXKMemBSpumrtJoietnshsHiWeoVwWardW J 11111222227767730292---WJJRLioBGnsAgowudrreildPnelilygesYorSMcnHEatyrrcFbeGWCerootJwuBgahnapHWtistAB1111555566666777----MR 1194 Cobb County Chamber Ch 1567- Scoggins Yoemans Mrs H R Agnes D 1111111111111111111111111222222212222222222222222266556559565655454644554442157838158050803341047173------------------MRWRMRWBJWHJWJJPJRBPWeeeioaMCNWTAcMHrohtCRinHCDMsetoayrpiibianarohxosatnfarosslanoearetanePyeaorunilorokerrgLwscaiCnGpecinrrn-ehEtCnhVrefoFrgoHgLooJTJMmRTrAmQ-MorWaTSeLtdhHmdonObreuNGdCbncEieHDJoRteieerieecrsAAMBetDAMW J J J aBrrMMys rrEss 111111111111111111111111333332223223322222222222747995655995688988878877207493333003068538513659-------------------XWWRRJMWWWJJWMBRRRJWMJJCPMuoliRPMRBSaaaJWlWFCxmQKRElWSGorotreieerlcoertiCloeahoelyueirpWhiueEfKorrlactuncwhbnanllheotyfe&plneiealiotRbrfselnradsrnbealdriaMKeeHlmenABkrbJJecFCyAEsDLRNMAieLresybWSliRLanEnALAlnaneeRJtairHLROnoOcrHLrtnnmrlscRiHErhSLyugiCseAereiKeCbebocCLrrBoJehmeTMorrmanChrtLbeMaeeeiluMe-ElJrasrNsMo1111111111111111111111111lr555555555555555555555555a5s88888888888777877877686n665753342201186056010968099----------:-----WJMJRMMWMWRMNJDWMWRGuiaLBrGoEhcSoBKCHsnHBPMoEfyeirahvieptiaorrnmaeauvrdeneaeihmFpemwcycsardyRpenlhotunSenlpeioyesMBennerssbHosocRnMRAesWeindoHArRinHAlJmtnMlDnauWWEiLiGbrOcBorMLeLJTceelSlhBRyGCtMooMbrbsrs Mrs 1400 Bell Aircraft Corp 1588 Aircraft Apt office REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp, Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New' and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER G@. PHONE 840 492 BALDWIN'S 1944 ICE - COAL - PHONE 1 so,ucTEHcLoAND VICTORY HOMES OF MARIETTA, INC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 1590 Sherwin-Williams Co 9103 Dixie Cafe 9127 Dew Drop Inn 1594 Thomas P E Service 9105 Marietta Cafe 9130 Marietta Country Club Sta 9108 Stonewall Hotel 9132 Hartsfield Everett Ser- 1594-J Harris J T 9110 Chester's Cafe vice Sta 1597- M S9t1e1v6enFsieMldJ Hotel 9134 Skinner's Cafe 1598- J Ha9l1l1A8liPceayOneMrSservice Sta 9135 Conner's Auto Parts 1598-W Turner Claude 9119 Fowler's Place 9139 Elks Club 2004 Alexander J M 9121 Worley S T gro 9158 Reece's Barber Shop Purity Dairy 9124 Red & White Service 2211 Groover J E 9080 Dodd P B Sta No 3 2671 Federal Communica- 9085 King J C 9125 Holbert E H tions Comn Monitor- 9102 Liberty Bell Cafe The 9126 Marietta Country Club ing Sta PHONE FIELD PHONE 1010 FURNITURE COMPANY 1010 "Find Your Furniture At Fields''--In the Hotel Field Building W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 493 MAYES WARD & CO. ASSCI PHONE 549 W. P. STEPHENS LUMBER CO. PHONE 841 " BALDWIN'S!^4 ICE-COAL- PHONE t soiucteh^ni> Packing -- Crating -- Storage -- Local & Long Distance Hauling PHONES: church 13 i MARIETTA TRANSFER & SALVAGE CO. CASH FOR ALL SALVAGE PAPER, CLOTH, ETC. BALDWIN'S Marietta GEORGIA * RURAL ROUTE DIRECTORY 1944 CONTAINING THE NAMES OF RURAL RESIDENTS SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 495 MAYES WARD & CO ZSrAsL PHONE 549 ROUTE ONE Abernathy Gee Mrs Abernathy Marie Ackard Kay Mrs Algood Herbert Algood Lillian Mrs Algood Murl Alien Bessie. M Mrs Allen Hannah Allen S L Anderson Jack Anderson Kath Anderson Mack Anderson Stella Anderson Willie L Annadale E W Annadale E W Mrs Annadale H J Annadale T C Annadale T C Mrs Annadale W Clark Arnold Bertha M Arnold S'ylvesta A sherry Guy Atkin Henderson Atkin Howard Atkin Sarah Atkins Emma Atkins J S Baker Claude Baker Frank Baker Homer Baker J W Baker Minnie Baker Sally Baker W D Mrs Banks J D Banks Mary Banks Robt M Barger Jas Barger Jos Barger Minnie Barnes Elbert Barnes Harold Barrow Johnnie Barnes Ruby Mrs Barret T E Bates Carl B'ates David Bates Durell Bates Emitt Bates Henry Bates Ida Bates Lee Bates Mary Bates Ruby Baxter Cecil Baxter Frances Baxter J F Baxter Julian Baxter Leoman Bearden Annie Bearden Bertha Bearden C A Mrs Bearden Clint C Bearden Cora Mrs Bearden Corene Bearden- Dixie Mrs Bearden Irene Bearden Jeff Bearden Lorine Bearden W P Bell J H Belle Bessie Belle Rosie Belle Walter Bennett L E Berry Gladys Berry J I Berry Maude Beshers Edw Bettis I L Bettis Marie Bettis R A Bettis Ray Bettis Ruth Mrs E'lack Annab'ella M Black Clyde A Black Donald V Black Edna M Black John J Black Lloyd E Black Ralph T Black Ralph T Jr Blackwell Frances Blackwell Irene Blackwell L Loyd Blackwell J L Mrs Blackwell J T Blackwell John S Blackwell Jos Blackwell Kath Blackwell Ralph Blalock Barbara Blalock Clara B Blalock Robt Mrs Blaylock Jas Blaylock Jeff Blaylock K E Booth Alex Bowen C C Bowen Emma M Bowen Nancy Mrs Boyd Bessie Mrs Boyd Florine Boyd G H Boyd Jane Boyd S E Brackett Carl Brackett Harold Brackett Rudie Mrs Brasill Ada B'rasill Ellen Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 496 BALDWIN'S 1944 ICE - COAL-PHONE i SOUTHLAND ICE CO. FRED LEM Distributor -- GULF OIL COUP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St, RT. 1 Cont'd. Brasill Herbert Brasill J N Brasill Leila P Brasill Lila M Mrs Brasill Lola Brasill Nettie L Brasill Noel Brasill Odean Brasill R H Brasill R H Mrs Brasill Robt Brasill Sarah Brasill V D Brock Gussie Mrs Brock Lina Brock Roberts Brookshire Ethel Brookshire H F Brookshire Hubert Brookshire J G Brookshire Kath Brookshire Lucile Brookshire Randall Brookshire Wm Brown Audrey Brown Cath Brown Cecil Brown D B Brown Ethel Brown Eug Brown Freddie Brown G Frank Brown Geo D Brown Geo D Mrs Brown Harry Brown Herbert Brown J P Brown J T Brown J W Brown Jas R Brown Jessie M Brown Kittie Brown Mamie Mrs Brown Manning Brown Martha Brown Mary F Brown Maude Brown Nancy Brown Odell Brown Rose Brown Roy Brown Ruby Brown Rufus F Brown Sarah Brown Shirley Brown Wm Brown, Wm I Bruce R B Bruce R B Mrs Bruce Ruth B'ruce Willie Bryan Kermit Bryant Amos E Bryant H E Bryant H J Bryant H J Mrs Bryant Jas H Bryant Sarah Bryant Winona Bullard Henry Burnett W L Burns Burns EJ thBe1 l Burns Kenneth Burns Thurman Burrell Bass Burrell Clarence Burrell Mamie Mrs Burrell Mildred Butterworth Irene Butterworth J B Byers Joe J Callahan D G Callahan D G Mrs Cameron R R Cameron R R Mrs Cameron Sally Cantrell Annie B` Cantrell Betty J Cantrell Dean Cantrell Dora Mrs Cantrell Earl Cantrell Esther Cantrell Gladys Cantrell Henderson Cantrell J R Mrs Cantrell Jewell Cantrell Jim Cantrell Ralph Cantrell Ralph Mrs Cantrell W C Cantrell W M Cantrell W M Mrs Cantrell Wade Cantrell Wade Mrs Carlile Chas C Carlile Edw Carlile Hazel Mrs Carlile Jack Carlile Jerry Carlile Jessie M Carlile John R Carlile Martha J Carlile Robt T Carlile Susan Mrs Carlile Wm L Carter C H Carter C H Mrs Carter Calvin Carter Chas Carter Clara M Carter Enez WALTER HAZEL tailoring DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 497 AMBULANCE MlAUr EJt MAYES WARD & CO. SERVICE rillPilE 5W3! Marietta's Most Complete Department Store SAULS "The Best - - for Less RT. 1 Cont'd. Carter Eunice Carter Evelyn Carter G R Carter J W Carter J Luther Carter Jessie M Mrs Carter Lucile Mrs Carter Mabel Carter May K Carter Ora M Mrs Carter Perry Carter Rebecca Castleberry Fred R Castleberry Gladys Castile Amanda Mrs Castile C Ray Castile H E Castile Lucile Mrs Cavitt Cath Cavitt Jas Cavitt Marshal Cavitt Ruth Cavitt Virgie Mrs Chambers Adrian Chambers B A Chambers Jerome Chambers Pierson Chambers Rupert Champion Lewis L Chance J H Chance J H Mrs Chance Verlin Chance Verlin Mrs Chapman Beulah Chapman Harry J Chapman Leroy Chapman Nellie J Chastain Billy Chastain Cassie Chastain Ethel Chastain Frank Chastain Harold Chastain J W Chastain Jimmy Chastain Kate Chastain Lottie Chastain Richd Chastain Robt Chastain Troy Chastain W D Chathal A L Chathei Annette Chatman Delman Chathal Margt Mrs Chathei Richd Claekum Dora Mrs Clackum Etta Mrs Claekum J E Clackum Richd Clark Alice M Clark Huey L Clark Lonia Mrs Clark Ruth E Clark Vonia L Clayton Clarence M Clayton Don Clayton Julie N Clayton Ollie Mrs Clement Charlie Clement Ethel Clement Jas Leo Clement Leola Mrs Coffee Geo M Coffee Geo M Mrs Coffee Pauline Collins Mary L Collins Myrtle Conger Harold Conger Mildred Conger Ora Conger Ruth Conger S A Cook D C Cook Ethel Mrs Cook Louise Cox Margt Cox W N Cox Walter Crowe D L Crowe D L Mrs Crowe J M Crowe Robt L Crowe Ruby A Crowe S I Darby A C Darby Albert Darby Hazel Darby Helen Darby Ruth Darby Roy Darby Willie Davenport A F Davenport Billie Davenport Jimmy Davenport Johnie Davenport Laura B Davenport N G Dennington Emmett Dennington F H Dennington Irene Mrs Deward Thos R Dickson A L Mrs Dickson C B Dickson C B Jr Dickson Gus Dickson Marthalyn Dickson Mary J Dobbins G W Dobbins Herbert Dobbins Howard Dobbins Marvin Dobbins Thos H WOFFORD OIL CO Be Sure -- With Pure' TAiiBp--~~ ROY McCLESKEY, Agent *s Cal'*" GAS OIL BUS. PHONE 148 ACCESSORIES KES. PHONE 224 W. P. STEPHENS LUMBER CO. PHONE 840 498 BALDWIN'S 1944 ICE-COAL-PHONE 1 SO UTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. RT. 1 Cont'd. Dobbins Virginia Dobbs Betty Dobbs Bill Dobbs Earnest Dobbs Hazel Dobbs Kim Dobbs Laura B Dobbs Lilly Dobbs Robt Dobbs Virginia Dobson Cora L Dobson Dollie M Dobson Ella M Dobson Geo W Dobson Inez Dobson J C Dobson Jimmie F Dobson Lunie Dobson Ronald Dobson Preston Doss Authur Doss Betty Doss B'onnie Doss G E Mrs Doss Guy Doss Jack Doss Lesfoy Doss Lillie M Doss Mab'le Doss May Doss SVsie Doss Walter Dover F C Dover G C Dover G L Duckett Bessie Duckett Howard C Duckett Roy Duffee Mary S Mrs Duffee S J Dunn Bettie A Dunn Charlie Dunn Clayton Dunn Don Dunn Dora Dunn Dorothy Dunn Flora Dunn Fred Dunn G P Dunn Ganette Dunn Hoyt Dunn Jas E Dunn L L Dunn Lenord Dunn Lucile Dunn Mary D Dunn Mildred Dunn Minnie Dunn Ora B Mrs Dunn R O Dunn Ralph Dunn Roy L Dunn Sarah Dunn Willie, V Eller B F Eller Carl Eller Dora L Eller Glover Eller Ruby Ellis Alma J Ellis Bernice L Ellis E A Ellis Grace Ellis Jas Ellis Robt B Ellis Thelma Ellis W B Ellis W L Ellison B D Ellison Dewey Ellison Dorothy Phone 1571 Ellison Flora Ellison G S Ellison Georgia Ellison H V Ellison Hazel Ellison Lois Ellison Mildred Ellison Roy Emerson Emma J Emerson Hazel Emerson Mildred Emerson Thearson Emerson Wm H Evans Alice Evans Bell Evans Ethel Evans Otis Farmers Billy A Farmers Emily S Farmer's Emogene Farmers Langford Farmers Laura J Mrs Farmers M A Farmers Sara L Fitts M W Fitts Paul Fitts Ruth Fleming Bobby J Fleming Charlie Fleming Fannie Fleming J E Fleming Rosie M Florence Ellen Florence Henry Ford Arnold Ford Carman Ford Dollie A Ford Doris Ford Jos Foster Ethel Mrs Foster Flora A GENUINE FLINTKOTE ROOF IS A SMART INVESTMENT MARIETTA LUMBER CO. LUMBER--BUILBING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 499 FUNERAL DIIAUE CAO MAYES WARD & CO. directors rmint 349 ' F. P. & "BOB" UNDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. Foster Frank Foster Henry Foster Ida G Foster Lenoard Foster Olen L Foster Wm H Foster Wendell Frasure B H Frasure B'arbara Frasure Bobbie Frasure Bonnie Frasure Dorothy Frasure Ethelaen Frasure J D Frasure J H Frasure Jimmie Frasure Margt Frasure Myrtiee Frasure Patricia Frasure Sarah Ftasure Viola Frasure Worth Freeman Bessie Freeman Flora Freeman Frensco Freeman Ida M Freeman Inez Freeman J J Freeman Jas Freeman John J Freeman Lamar Freeman N J Freeman Odell Frey Florence Frey Icie Frey Icie Frey Lanette Frey M L Frey V H Gaddis E N Gardener Lizzie Garrett D E Garrett Dane Garrett Iriene Garrett Mary Mrs Garrett Rader Mrs Garrett Robt Gault Allen Gault Claude Gault Laura Gee Bernice Gee Bruce Gee J G Mrs Gee John Gee Shirley A Gilbert Evlin Gilbert Mary L Gilbert Onie Mrs Gilbert Sallie Gilbert W E Gilbert W M Givens Betty Givens Billy Givens Jack Givens Jerry Givens Lewis Givens Lounie D Givens Mayes Glover Agnes Mrs Glover Herbert Glover J C Glover Lera Glover Louise Glover Rosa Mrs Glover Virgil Goodman R M Goodson Jene Goodson Lillian Goodson R E Goodson Wayne Graham Cecil iGraham Leon Mrs Graham W A Gray E C Gray E May Mrs Gray Elfrey M Mrs Green A J Green Carl Green Carol A Green Dock P Green Geo Green Kath Green L R Green Minnie B Green Peggy Griffith Arron Griffith J K Griffith J K Mrs Griffith Lem o Griffith Maude Mrs Griffith Pearce Griffith Pearl Griffith W N Grimes R T Grogan Elmer Grogan H L Grogan Lizzie Grogan R G Groover Laura E Grover Maggie Mrs Grover Oliver Grover Sarah K Guffin Lois Mrs Guffin W T Gunn Emma M Gunn Gary L Gunn Willie Gunnin B C Gunnin J C HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7324 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 500 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 RT. 1 Cont'd. Gunnin J M Gunnin Minnie Gunter C B Gunter Lamar Gunter Louise Gunter Mattie Gunter Victor M Gunter Willie Halcomb Belle Halcomb Howard Halcomb Irene Halcomb L C Halcomb Myrtle Hall Carl W Hall Joanne Hall Junmil Hamby Babe Hamby Bill H Hamby Dazel Hamby Ersie Hamby Bred Hamby G H Hamby Geraldine Hamby Gladys Hamby Junior Hamby M C Hamby Mabel Hamby Myrtle Hamby Ollie Hamby Robt Hames C P Hames Leila Mrs ASSOCIATION 112 ATLANTA ST. Hames Maybell Haymes Nell Harbin Duff Harbin Earnestine Harbin Thos L Hardage Dora Hardage Eliz Mrs Hardage Hugh Hardage Hugh Mrs Hardage Myrtie J Hardage R O Hardage Rufus W Hardage Warren Harper Dona Harper Edna Harper Hazel Harper Mae Harper W A Harris B H Mrs Harris E W Mrs Harris Hugh M Harris Hugh M Mrs Harris Margt Harris Robt Hartsfield G J Hawkins Bobby Hawkins Daisy Hawkins H C Hawkins Herbert V Hawkins J O Hawkins Louise Hawkins Mamie Hawkins Sam J Hawkins Sue Hawkins W V Hayes H M Mrs Hayes Rose B Mrs Hembree Elsie Hembree F A Hembree Felton Hembree John B Hembree Patricia A Hembree Willie M Hendon Alva L Hendon Bobby M Henson Chas M Hendon E W Hendon Emmett Jr Hendon Jack Hendon Kaylor W Hendon Lena M Hendon Ruth Mrs Hendon Virgil Hill Cay Hill Flonie Hill Homar Hill Lithonia Hill Mabel Hill Pariese Hill R E Hill Ruby Hillhouse Dona Mrs Hillhouse Earl Hillhouse Richd Hitt Billy Hitt Forest EINERT MARIETTA PHONE 35 FLORIST GEORGIA 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 501 WES WARD & CO *HBaS* PHONE 549 "The Ring Leaders Since 1900'' KT. 1 Coat'd. Hitt Helen Hitt Horace Hitt J M Hitt Mary Honea Arth Honea Bessie Honea Charlie Honea Earlie Honea Earlie Mrs Honea Jas W Honea Lawrence Honea Lee Honea Marvene Honea Nellie Honea Oscar Honea R W Hopkins Geo Hopkins Geo Mrs Howard Daniel Howard Effie Howard Fred Howard Horace Howard Nancie Howard Rand Hudson O L Hudson O L Mrs Hughes Billie Hughes Edmond Hughes Florence Hughes H D Hughes Hattie B Hughes Jas H. E. KERLEY -0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 Hughes Leonard Hughes Louise Hughes Lucy S Hughes Mary F Hughes Minnie Hughes R M Hughes Ralph Hughes Ruby Hughes Sarah J Hughes T C Hughes Willie G Hulsey B H Mrs Hulsey Calvin T Hulsey Carol Hulsey Cecil Hulsey Geanette Hulsey H F Hulsey Hoyt Hulsey Maudie Hulsey Minnie Hulsey Osha Hulsey R B Hulsey Woodrow W Hunt Joe I Hunt Joe I Mrs Hurst Bruce Hurst Claude Hurst D L Hurst Frank Hurst Grace Hurst Hattie Hurst Jeanette Hurst Lee Hurst Pearl Hutson Clara A Hutson Claude T Hutson Rachael Ingram Evelyn Ingram J B` Ingram Jessie Ivey C C Ivey C C Mrs Ivey Chas D Ivey Howard Ivey J D Ivey J D Mrs Ivey John W Ivey Lucile Ivey Mamie Jackson Alf Jackson Emma Mrs Jackson Erose Jackson Freddie Jackson Hershel Jackson Lillie M Jackson Reuben James Ann James Bessie Mrs James Edwin Janies Harold James J Homer James J H Mrs James Sarah Jay Roland Jay T G Jenkins Ella Mrs Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation -- Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PHONE 840 502 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. '`Marietta's Finest Cleaners" ;e Cleaners MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. RT. 1 Cont'd. Jenkins Gertrude Jenkins Herbert Jenkins Jas L Jenkins W J Jenkins Wm J Jr Johnson Bertha Johnson F J Mrs Johnson Geo Johnson Lular S Jordon Mattie Mrs Jordon Nolia Jordon W C Keener Carl Keener J W Keener Louise Keener Margie Keheley Edgar Keheley Exil Mrs Kemp A M Kemp A M Mrs Kemp Dorothy Kemp Edna Kemp Eutonia Kemp Geo O Kemp H D Kemp Irene Mrs Kemp J G Kemp John G Kemp Lizzie Kemp Mildred Kemp Norris Kendrick Albert Kendrick Cecil Kendall E H Kendall E H Mrs Kendrick Hubert Kendrick J C Kendrick Laura Kendall Willie N Kendall Y C Kilgore Amos Kilgore Thos King C H King Claude King Ruby King Virginia Mrs Kirk Anna P Mrs Kirk Demsey Kirk F M Mrs Kirk G M Kirk G W Kirk J W Mrs Kirk Mary Mrs Kirk Mollie Kirk Pearl M Kirk Rosie Lee Kirk W M Kirk Wynema Kirkendall A C Kirkendall Alta Kirkendall Cath Kirkendall H T Mrs Kirkendall Hutson T Kirkendall Isabelle Kirkendall Sadie Kirkendall Wilborne Knight J B Knight J B Mrs Kurtz Clarence Kurtz Clarence Mrs Kurtz E E Kurtz E E Mrs Lance E T Lance E T Mrs Lance Ebbie Lance Mary Lance Sarah Landers Barbara A Landers Bertie Landers Evelyn Landers Herman L Landers Houston Landers Mary J Landers Rosa Landers Willie Landrune L L Mrs Landrum Ruth Latimer Sara P Latimer W M Latimer W M Mrs Lawson A E Lawson A E Mrs Lawson Bud Lawson Bud Mrs Lawson Gene Lawson Gordon Lawson Kath Lawson L C FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W, P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 503 FUNERAL RIMES WARD & CO. DIRECTORS PHONE 541 BRUMBY E. PARK SQUARE PHONE 198 fihhCiomtpu leteh Hoe me co Furnishers In Marietta Since 1916" RT. 1 Cont'd. Lawson L C Mrs Lawson Lee Lawson Oscar Leathers Claud Leathers Claudette Leathers Larry Ledford Gilbert Ledford Jas A Ledford L R Mrs Ledford Luther R Ledford Raymond Lewis E C Lewis Eva Mrs Lewis Frank D Lewis H A Lewis May Lewis Ralph Lewis Rufus Little Dessie Little Donald Little Joel Little L F Little L F Mrs Little Luster Little Mattie Mrs Long B C Long J B Long Lamar Mrs Long Lawrence Looper A H Looper A H Jr Looper Annie L Looper Billie E Looper Connie Mrs Looper Eliz Looper Grady L Looper J A Looper Paul Looper Ruth Looper Walter E Lovinggood Evelyn Lovinggood H R Lovinggood H R Jr Lovinggood Lucille Lovinggood Margaretta Mabry Claude Mabry Claude Mrs Maddox Annie Maddox J Aton Maddox Lem Major J W Major J W Mrs Manning Hazel Mrs Mark Carrie L Mark Edw H Mark G L Mark G L Mrs Marr Ada Mrs Marr Alta Marr Guy Marr J W Marr M C Marr Patricia Marr Pauline Marr T H Marr W L Mrs Martin Beatrice Martin C M Martin Claude Martin Dave Martin Fannie Martin Glenda Martin J C Martin John Martin Katie Mrs Martin Louise Martin T H Mrs Matthew Ada Mrs Matthew Chandler Matthew Eva Matthew Florence Matthew G D Matthew Jas Matthew Jean Matthew Ruth Matthew W C Maxwell Eva A Maxwell Martha A Maxwell Tom McCleskey Jas McCleskey Pearl McClure Dale McClure Emma L McClure G E McClure Jean McClure Lemmie McClure Lestie McClure Lois Mrs PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 841 504 BALDWIN'S 19W ICE-COAL-PHONE I SOUTHLAND ICE CO. KNOW THEI HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY LIKE RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH, Sec'y and Treas. J. GLENN GILES, Atty. RT. 1 Cont'd. McClure Minnie Mrs McClure Opal McClure Paul McClure Paul M McClure R V McClure S J McCollum Annie McCollum H R McCollum Herman McCollum Sarah McCoy J M McCoy J M Mrs McCoy Mattie Mrs McCoy W C McCurley Cordia McCurly D O McCurley Lee McCurley Sarah McCurley W P McCurley Willie D McGaritz Cath McGariety Gordon MeGariety J O McGarity W M McGee Alvin McGee Hershel McGee Mary L Mrs McKinney Arth McKinney Carolyn McKinney Clyde McKinney Dewey McKinney J R McKinney Viola McTaggart B L McTaggart Del McTaggret J D McTaggaret Roda Mrs Mealer Hubert Mealer Margt Mealer Sam Medford A S Medford Clyde Medford Glynn Medford Jas Medford N A Medford R D Medford R D Mrs Merritt Harshel Merritt Julia Merritt Ray Miller Amonda Miller Eula Miller Hayward Miller Hugh Miller Iayuna Miller Laura Miller Louise Miller Ora Miller Sam Miller Ulysses S Milligan Jaunita Milligan Lela Mrs Millwood Annie Millwood Henrie Millwood Gillie Mrs Millwood W T Mines Albert Mines Harold Mines Jas W Mines Lucy Mines M C Mines Pat Minter Bobby Minter Doyle Minter Gerald Minter Gladys Minter Irene Mrs Minter Jas R Minter John T Minter W L Mitchell F F Mitchell Lucy Mrs Moore A L Moore Allen P Moore Christine Moon D C Moore Dorothy Moon J C Moon Jane Moon Joe Mrs Moon Nellie Moore Rose Mrs Morgan Dorothy Morgan Geo W Morgan Geo Jr Morgan Mary Morgan Neva Mrs Motes Amanda Mrs PHONE 60 ! OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Aye. S. J. LINDSEY Owner w. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 505 MAYES WARD & CO AMBULANCE DUARIE EAO service music sW A. D. LITTLE-AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 KT. 1 Cont'd. Motes Aron Motes Eler Motes Lillin Myers Eulalia Mrs Myers Jack Neary Creseell N'eary Don Neary Geo Neary Lola R Neary Martin Neary Mary A Neary W E New Henry New J W New Myrtle New Walter Newton Agnes Newton Annie R Newton Clarence Newton D C Newton Dewey Newton Geo L Newton Helen Newton Marie Newton Nell Newton Pauline Newton Richd L Newton S C Newton W F Nichols A E Nichols Ella Nichols Ray Nicholson J C Nicholson J W Mrs Nicholson Wilma Nicholson Wyelene Nix Fred Nix Geo O'Bryant D E O'Bryant Geanette O'Bryant Irene O'Bryant Lee Oliver Samantha E Oliver Samantha E Mrs Oliver W E Mrs Orr Emma P Mrs Orr Geanette Orr Henry Osborne E W Owenby Charlotte Owenby Jas D Owenby Landie A Owenby Ruby Owenby W G Owenby W M Owenby W T Owens Geo Owings Florence Mrs Pace Corene Pace Ruby Payne J I Payne Jack Payne Maude Payne Walter Peppers Charlie R 112 Atlanta St. Peppers Lois Person Geo Person Geo Mrs Perry H D Petty Lester Petty Mary Phillips Alice Phillips Annie M Phillips Estelle Phillips Weldon Pickering J G Prance Edna M Mrs Prance Lee Prance Watson Breast Sam Preast Walter Price Betty Price J W Price Johnnie R Price Ruth Mrs Quarles J E Quarles John T Quarles Wm Mrs Queen Carrie Queen Edna Queen Effie Mrs Queen Nellie Queen Will M Ragsdale Carrie Ragsdale Edith Ragsdale, R E Ragsdale Thelma Raines Fred ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Floivers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHENS LUMBER CO. PHONE 840 506 BALDWIN'S 19*4 ICE-COAL-PHONE 1 SOUTHLAND I P. E CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1083 RT. 1 Coat'd. Raines H V Raines Herbert Raines Laurie Raines Syble Rakestraw Hug'll Rakestraw Nina Ravan Bertha Ravan Horace Ravan J W Redd Billie Redd Carl W Redd Florence Redd Joe Redd Thad Redding Andrew Redding Jas Redding Jessie Redding John Redding Mammie Redding Rose Reece Edd Reece J E Reece J W Reece M L Mrs Reece Ralph Reece W L Reece W O Reece Winnie Reeves Clayton Reeves E P Reeves Huey Reeves Johnie Reeves Tommie Reid C H Reid C H Mrs Reid Clarence H Reid Inez Reynolds Alice Reynolds Homer Reynolds John C Reynolds Mary Reynolds Wm Rhodes Belle Mrs Rich B1 P Rich Betty J Rich Estell Rich Lois Rich Mary Rich Sue Richard W D Richardson Ernest Richardson Hubert Richardson Jas E Richardson N B Richardson Russ Richardson Russ Mrs Rickman Eug Rickman Jackielee Rickman Jessie Rickman M V Roach Curtis Roach Doyal Roach Fannie Roach Richd Roberson Betty J Roberson Harold L Roberson K B Roberson Loyd Roberson Maggie Roberts Carl Roberts Carl E Jr Roberts Edw W Roberts Fannie M Roberts Grace Roberts Gus Roberts H G Roberts Howard Roberts Hugh C Roberts Irene Roberts J R Roberts Jane Roberts John W Roberts Lena Roberts Mabel Roberts Mattie Mrs Roberts Ollie Mrs Roberts Richd Roberts Ruth Rogers Edna M Rogers Frankie Rogers Heyward Rogers Irene Rogers J B Rogers J P Mrs Rogers Jerry Rogers Laura J Rogers Linda Rogers Matt R `Serving Cobb County Since 1900" Westinghouse Stoves and Appliances and Radios H. N. DuPRE Ranges Wholesale and Retail GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 507 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 54$ Earl G. Medford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. KT. 1 Gont'd. Rogers Oscar Rogers Pauline Rogers Roy Rogers Vera M Roland Carter Roper Loyd C Roper Loyd C Mrs Rucker G M Runyan C P Runyan I A Runyan Mary P Russell Frank Russell Gleen Russell Grady Russell Grady Mrs Russell J W Sanders Cassie Sanders Claude Sanders Grace S'anders J L Sanders Joe Sargent R F Satterfield Carl E Sawyers Agnes Sawyers Jessie A Sawyers Blake Sawyers Irene Sawyers J C Sawyers Jas Sawyers Margt Sawyers Tom Scott B F S'cott Hugh Scott Kath Scott Pearl Mrs Seagers R J Sellers Claude Sellers Frank Sellers Jas Sellers W V Setser Jas W Sewell Geo Mrs Sewell Lester Shaw T P Shaw T P Mrs Smith Bertie Smith Carrie M Smith Elmer Smith Geo Smith Jas D Smith Jessie M Smith M H Smith M H Mrs Smith Melvin L Smith Thurman S Spratling G B Stephens Bertie Mrs Stephens Dorothy Stephens Dover Stephens Emmitt Stephens Gladys Mrs Stephens Hugh L Stephens J A Stephens Malvin Stephens Minnie Mrs Telephone 1098 Stephens Nettie Stephens P S Stephens R P Stephens R P Mrs Stephens Robt Stephen Thos E Stephens W A Stephens Windford Stewart Barbara Stewart Dallas Stewart Francis Stewart Grace Mrs Stewart Luther Stewart Pauline Strickland Betty Strickand Clarence Strickland Frances Strickland G C Strickland Lillian Strickland Louise Strickland Lucile Mrs Strickland Minnie Strickland Robt Strickland Wm Strickland Wallace Strickland Walter Sullivan Charlie Sullivan Eug Sullivan Hershel Sullivan Howard Sullivan J B' Sullivan Ruth Tarpley J F REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 508 BALDWIN'S ICE - COAL - PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, IRC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 RT. 1 Cont'd. Tarpley Ora Mrs Tatum Charlie C Tatum Grace Tatum Ruth E Tatum Walter Teague B F Teague B F Mrs Teague Mildred Teague Clinton Teague Mayza Teague Robt Thomason Jas F Thompson Jessie Thompson Loyd Thompson Mae Thompson Wm Mrs Thurmond F M Thurmond Mary Thurmond Ollie Tompkin A D Tompkin Fannie S Tompkin Fred Tompkin Gertie M I Townsend C H Townsend Chas H Towery Howard Towery Howard Mrs Townsend J E Townsend J S Mrs Townsend Joe Townsend Thos A Trout Ed Trout Eliz Trout Evelyn Trout Fannie L Trout Jim Trout Leonard Trout Lois Trout Vera M Trulove G C Trulove G C Mrs Tucker Clifford Tucker Emerson Tucker Estelle Tucker Gordon Tucker J R Tucker J R Mrs Tucker N S Tucker Nellie Turner Angie Mrs Turner Charlie W Turner Eug Turner F E Turner Glenna Turner Kath Turner Thelma Turner W A Turner W A Mrs Turner W M Turner W M Mrs Turner Worth F Underwood C C Underwood Cecil G Underwood E A Mrs Underwood Edmond Underwood Eleanor Underwood Ellie Underwood Ethel Underwood Essie Underwood J E Underwood J E Mrs Underwood Mae Upshaw J P Upshaw J P Mrs Upshaw Jakie Upshaw Mary J Verhine A R Mrs Vicker Bobby Vicker Jerry Vicker W L Vicker Willie L Waldrop Ann Mrs Waldrop Eliz Waldrop L F Waldrop L F Mrs Waldrop Ann Mrs Waldrop Randolph Waldrop Sara Mrs Walker Annie Walker Cleo Walker H W Walker Irene Walker Mamie Mrs Walker Woodrow Wallace A G Mrs Wallace Clark Wallace Lillian Watkins Billy Hotel STRICTLY MODERN Field WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 W. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 509 MAYES WARD & CO AMBULANCE DU All C CAQ service rauim sw* HOME OWNED -- HOME OPERATED PHONE 60 NI-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- J 0TMSEY J{T. 1 Cont'd. Watkins Bob Watkins H C Watkins Jennida Watkins Jerry Watkins Josephine Watkins Katie Mrs Watkins Lamar Watkins Minnie Mrs Watkins Richd Watkins W E Watkins Windell Wayman Billy Wayman W H Webb Charlotte Webb F H Westbrook Betty J Westbrook Joyce Westbrook Vera Wheeler Clifford Wheeler Jimmie Wheeler Louise White Donald Whitfield Henry Whitfield Ola Mrs Whitlock Betty J Whitlock Cecil Whitlock Harold Whitlock Nellie Mrs Whitlock W T Wigington Charlie Wigington Jas Wigington G R Wigingtoin Jaunita Wigington Martha Mrs Wilber A J Wilbur Earl Wilbur Eug Wilbur G M Wilbur G M Mrs Wilbur Herbert Wilbur Herbert Mrs Wilber J E Mrs Wilber John E Wilbur Lavonia Mrs Wilbur Margt Wilber Rosa B Williams W A Mrs Wilson Agnes Wilson Billy Wilson Callie Mrs Wilson Dorothy Wilson Ethel Mrs Wilson Fannie M Wilson G L Wilson Geo Wilson Jos Wilson Joe D Wilson Joe Mrs Wilson Lawrence Wilson Lena Wilson Luther W Wilson Roy Wilson Vallie L Mrs Wilson W L Wood Agnes Wood Alfred W Wood Babe Wood Jack Woodraff Eva L Woodraff J D Woody Bobby Woody Edith Woody Inez Woody John Woody Mary Woody N'ancy Woody P C Woody Paul Woody W P Wooten Anne Wooten Ben H Wooten Ben H Mrs Wooten Mary J Worley Beatrice Worley Eug Worley Fannie Worley Joyce Worley John W Worley M T Worley Mary Worley Nellie Worley Virginia Wright Charlie L Wright Hubert Wright Lilia Wright Loyd J Wright L J Mrs Wright Thurman Invest At Least \\T 7 T") 10% in Vv ar bonds W. P. STEPHENS LUMBER CO. PHONE 840 510 BALDWIN'S 1944 ICE-COAL- PHONE 1 aofcTf htr Packing -- Crating -- Storage -- Local & Long Distance Hauling pimuEC. riliy. 215 *<$ CHURCH IO 102 LEMON oci MARIETTA TRANSFER & SALVAGE CO. CASH FOK ALL SALVAGE PAPER, CLOTH, ETC. RT. 1 Coat'd. Young J T Young Kath Young Sarah ROUTE TWO Addison Carolyn Addison Jack Addison Jean Addison Reba Addison Stella Addison W P Aenchbacher H N Aenchbacher Hubert L Aenchbacher Lillie M Allen L N Allen Mattie L Allen Vera P Allen Wayne H Arnold Dollie B Arnold Lela B Arnold Lena M Arnold Louis Arnold Mattie M Arnold Preston Arnold Sherman Atkins Annie L Mrs Atkins C M Atkins Cecil Atkins Ernest W Atkins Ethel Atkins Flora M Atkins Francis Atkins Harold Atkins Hazel Atkins J A Atkins J H Atkins Robt L Ayers Betty Ayers Gereldine Ayers J W Ayers Jessie Mrs Ayers Jewell Ayers Mary J Ayers W J Ayers Wm Ball R L Baldwin C A Baldwin G P Mrs Baldwin Minnie, Bannister C D Dr Bannister Earl Bannister Edna Mrs Bannister Ernest W Bannister Florence Mrs Bannister Glover Bannister Guy Bannister J Howard Bannister Jimmie Bannister Louise Bannister Lueile Bannister Lndia Mrs Bannister Ray Bannister Robt Bannister Roy Bannister Syble Barfield W Hansel Barfield W H Mrs Barrett Lillian Barrett Lillie Barrett Melvin Barrett Odie Barrett Velna Barrett W D Beavers Alice Beavers Clay Beavers Clifford Beavers Eula Beavers M J Beavers Nellie Beavers Pierce Beavers W J Bell Annie R Bell Fred W Bell Sarah P Berrong Claude J Berrong Maudie Mrs Berrong Paul Bettis Betty Bettis Dora B Bettis John A Bettis J ohn T Bettis Mary L Bettis Robt A Bishop Elder Bishop Joe M Bishop John Bishop Lamont Bishop Martha J SEARS, ROEBUCK &C0. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 511 MAYES WARD & CO ^)irectorsL PHONE 549 RT. 2 Cont'd. Bishop Ruth Mrs Blackmon J H Blackmon J H Mrs Blackwell Alton Blackwell Billie Blackwell D G Mrs Blackwell Dorothy Mrs Blackwell Isabell Blackwell Lizzie Mrs Blackwell Margt Blackwell Marion Blackwell Maude Mrs Blackwell Roy Blackwell T S Blackwell W T Boker Robt L Booth A M Booth Donald C Booth Doyal R Booth Nannie Brackett Dorothy Brackett Georgia Brackett Jean Brackett Jeanette Brackett Luther S Bf-ackett Mae Brackett Margt Brackett Sarah M Brackett Will J Brackett Willie Mrs Braswell Harold Braswell J P Braswell Monteza Mrs Britt A R Britt Sadie Mrs Brooks Edna Brooks George Brooks H A Bl-ooks Mary Brooks Ruffa M Brooks Susie Brooks Tom Brooks Tom Jr Brown Agnes P Brown Bobby Brown Claud D Brown Clayton R Brown Dorothy Brown Edna M Brown Evelyn Bi-own Fred J Brown Hiram H Brown Inez Brown J C Mrs Brown Jenette Brown Joe S Brown J S Jr Brown Lawrence L Brown Mary L Brown Minnie Brown Nettie Mrs Brown Ollie Brown Pearl Bi-own Robt L Brown Roy Brown Sylvia Brown W S Brown Willia Brown Willie M Bryant Amos Bryant Cecil Bryant Clifford Bryant Irene Mrs Bryant Jas Bryant Jas Mrs Bryant John T Bhrch Henry Burnett Emma Burnett Emogean Burnett Euleo M Burton Andrew J Burton Ella Mrs Burton Francis Burton J E Burton Jas F Burtz Barbara Burtz Bobbie J BUrtz Cicero M Burtz Essie L Burtz Ray Byrd Charlie F Byrd Guy Byrd Miles M Byrd Rutte Mrs Cagle Betty L Cagle Clarence Cagle Dewell Cagle Hoyt C Moving Packing and Crating Loads Insured g% | M Wf | | ||fl f vLAvUU m W TP Mi M ETfc I KM 1% 2! I ELK Sand & Gravel * HExacualivnagtianngd Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 512 BALDWIN'S 194^ ICE - COAL - PHONE 1 SO UTHLAND ICE CO. FRED LEGG Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gull Pride Motor Oil--Fuel Oil--Greases--Kerosene Phone 81, Plant 129-33 Butler St. RT. 2 Cont'd. Cagle Jerry Cagle Mary L Mrs Cagle Raymond Caldwell Callie Caldwell Jas L Caldwell Jolm R Caldwell Lee Caldwell May B Callahan. Evlyen Callahan Fannie Callahan R L Callahan Riehd Cameron Henry Carlisle Billie Carlisle Chas Carlisle Claude E Carlisle Corrine Mrs Carlisle Dorothy Mrs Carlisle Ed J Carlisle Ed Jr Carlisle F Eug Carlisle Harold Carlisle Hazel Mrs Carlisle J Harrison Carlisle Kenneth Carlisle Lesta Mrs Carlisle Nellie Carlisle Ray Carlisle Roy C Catree Carlton Cartee Ed Cartee Harold L Cartee Jack Cartee Nora Cartee Ollie Cartee Ruby Casey R P Casteel Billie Casteel Eliz Casteel Estell Casteel G Lee Casteel G L Jr Casteel Irene Casteel Jack Casteel June Casteel Lou E Casteel R W Casteel R W Jr Castell Adell Mrs Castell Barney Castell Barbara A Castell Denver Castell Ernest Castell G B Castell Leila Mrs Cearley Bertha Cearley Everett Cearley Henry Cearley Leroy Cearley T J Chandler Agnes B Chandler Geo C Chandler Homer H Chandler Nelson Chastain B A Chastain Bertha Chastain Blanche Chastain Eidie Mrs Chastain Everett Chastain J N Chastain Myra Childress Annie Childress Mark Childress Nettie P Mrs Childress Roy W Chumley A L Chumley A L Mrs Chumley Addie L Chumley Billie Chumley Canard Chumley D G Chumley J F Chumley J F Mrs Chumley J F Jr Chumley Jack Chumley Joe Chumley Roberta Clackum Doris Clackum Dorothy Clackum Fletcher Clackum J D Clackum J D Jr Blackum Jas L Clackum Joe Clackum Martha Clackum Maudie Clarke Daniel Clarke Fred WALTER W. HAZEL FINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 513 MAYES WARD & CO. A1SERYICECE PHONE 549 Marietta's Most Complete Department Store SAULS uThe Best - - for Less RT. 2 Cont'd. Clarke Ida M Clarke Kines Clarke Mary E Clarke Mattie L Clayton Eliz Mrs Clayton Eva R Clayton L F Mrs Clayton Wayne Coffey Betty L Coffey Carolyn Coffey Gladys Coffey Hubert H Coffey Kath Coffin Bertie B Coffin Herbert M Coffin Mamie Coffin Warren A Cogburn B'illy Cogburn Cecil Cogburn Cecil Jr Cogburn Jean Cogburn Martha E Cogburn Nora Mrs Cogburn Sarah F Collett Clara M Mrs Collett Durnie Collett L C Collett L C Mrs Collett Neston Collie Belle Mrs Collie Homer Collie Walter Cordell Albert Cordell Ethel Mrs Cordell J K Cordell L, U Cordell Robt Cordell Ruby L Covington F Cowart Allen Cowart Charley Cowart Christine Cowart Frank Cowart Jake Cowart Jake Mrs Cowart Janie Crowe J W Crowe Tommie L Mrs Croy Clyde Croy Earl Croy H T Croy Mattie Mrs Croy Modena Mrs Custer B L Custer B L Mrs Daniel Genena Daniel Parnell Mrs Daniel W Clyde Davis A E Davis A E Mrs Davis Alice Davis Allen Davis Ann Mrs Davis Cecil Davis Clyde Davis E E Davis E K Davis Edw Davis Elsye Davis Eug Davis Evelyn Davis F A Davis Francis Davis H L Davis Hazel Davis Herbert E Davis Irene Davis Jesse G Davis Joanna Davis Joe B Davis Joe B Mrs Davis Kath Davis N M Davis O D Davis Pierce Davis Reba D Davis Rosa Davis W A Dawson Howard R Dawson Joe E Dawson Lena Mrs Day E G Day J R Mrs Day W C Dean Coy Dean Dorothy Dean J W Dean J W Jr WOFFORD OIL CO Be Sure -- With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. PHONE 840 514 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. BICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 RT. 2 Cont'd. Dean Joe Dean Joe Mrs Dean Lloyd Dean Mollie Mrs Dean Noman Dean Robt Deaner Annie Deaner Emma M Deaner Guy Deaner Leona Dickerson Annie H Dickerson Bertha Dickerson Edith Dickerson Harold Dickerson J D Dickerson Madeline Dickerson Ralph Dinsmore Cleveland Dinsmore L U Mrs Dinsmore Lorine Dinsmore Luther Dobb Bose Dobb Dora Dobb Eva Dobbs Carrie M Dobbs Clarance G Dobbs Clarance Mrs Dobbs Cliff R Dobbs Faustine Dbbbs J D Dobbs Mary L Dobbs Nellie Mrs Dobbs Norma J Dobbs Thelma J Dobbs W P Dobson Billie Dobson Marrim Dobson Paul Dobson W D Dobson W D Mrs Dodgen Carolyn Dodgen Charley Dodgen CleO Dodgen D'orsey Dodgen Mabry Dodgen Robt Dodgen Roy U Duckett Eva Duckett Grace Duckett Hi R Duckett J W Duckett Preston Duncan Edwin Duncan Francis Duncan Marie Duncan Robt O Dunn Fannie Dunn G W Dunn Glenn Dunn H H Mrs Dunn Mae Mrs Dunn Martha Mrs Dunn Nancy J Mrs Elder W E Elder W E Mrs Elder Billie Elliott Estelle Mrs Elliott G C Elliott Joel C Elliott Nelma Elliott Nera Mrs Elliott Roy S Elliott Vivian Ellis Ellen Ellis Ernest C Ellis Jack Ellis R D Ellis Thelma Emerson Geo Emerson Mary Etchison Sonny Evans Haynes G Mrs Ferguson Jos B Ferguson Susan H Mrs Fortner Floyd Fortner Lucile Fortner Tarrielie Towler Raymond E Fowler P^aymond E Mrs Frey Audrey Frey Betty Frey Blaun Mrs Frey Henry W Frey Jane Mrs Frey Julian Frey Martha J Frey Wm J Frey Zora Mrs * MARIETTA LUMBER CO. * "Building Materials A Plant for Every Purpose . That Merit Good Will" Lumber--Bldg. Materials ^ Phone 357 Atlanta Road W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 515 FUNERAL DUAHE EJH MAYES WARD & CO. directors rnuim F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. RT. 2 Cont'd. Fricks Clema Fricks Colee Fricks Daisy if Mrs Fricks Ella E Mrs Fricks Glennie Fricks Homer L Fricks Hoyt W Fricks Hoyt W Jr Fricks Louise Fricks Preston H Fricks Ruth C Mrs Fricks W T Fricks Wm C Fricks Wm C Mrs Fricks Willie C Gable Chessie Gable Joe E Gasaway Alma Mrs Gasaway Henry L Gasaway H L Mrs Gasaway Herschel Gasaway Inez Mrs Gasaway Lawson Gasaway Robt A Gasaway W C Gatis Dorothy Gatis Geo A Gatis Geo A Mrs Gibbs J L Gibbs Luther W Gibbs L W Mrs Gibbs Margt Gibbs Mary K Gillham J T Glover Ida W Mrs Glover John Goodson A H Goodson Lemma Goodson Lillie Mrs Goodson Ona R Goodson Ray Gramling J A Gramling Jesse Gramling Lawrence Gramling Louise Granley Eug Gray Inman Green Mary L Green Oliver Greene Ellen Mrs Greene W I Grimes Hilbert Grooner Allen R Grooner Allen R Mrs Grooner Joe E Grooner Joe E Mrs Gunter C D Gunter Nancis Haggood Deward Haggood Jean Haggood Rosa Hamby Ambrose B Hamby Etha Mrs Hamby Francis Hamby Hazel Hamby J D Hamby Janette Hamby Lura Mrs Hamby Maymond Hamby R L Hamby W Ruben Hamby Wallace Hames Artice Hames Bessie Hames Dewey Hames G W Mrs Hames M E Hamilton Annie B Hamilton Eunous A Hamilton J B Hamilton Lucy Hamilton Rutte Hanks L J Sr Hardema.n Agnes Harp J C Harp J C Mrs Harp John C Jr Mrs Harp Kenneth Harp M Alfred Harp Margt C Harp Rachel R Harp Virginia A Harper Betty J Harper Clara M Mrs Harper Gene Harper L A Harper R Floyd (Harris Bessie; L HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7824 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 516 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 RX. 2 Cont'd. Harris Jim. Harshaw Betty J Harshaw Christine Harshaw E L Jr Harshaw J Harry Harshaw Lee Harshaw Louis Harshaw Mattie Harshaw Milton Harshaw Robt L Harshaw Stake Harshaw Viola Hawkins Noah S Hawkins Noah S Mrs Heard Daisy M Heard Jas F Heard Ruby Mrs Heath Clyde Heath Emma M Mrs Heath Eug Heath Grace Mrs Heath J B Heath Jennie Mrs Heath Kath N Heath Leland D Heath Nora Mrs Hembree Andrew Hembree Oliver Hembree Ruby Mrs Hendrix Earl Hendrix Evelyn Hendrix Mildred ASSOCIATION 112 ATLANTA ST. Hendrix Virginia Hendrix W L Hendrix W L Mrs Henry Dealie Mrs Henry Hattie Henry Hayden R Hester Christine Hester Jas Hester Pauline Hester R E Hicks Florence A Hicks Francis A Mrs Hicks J W Hicks Nancy E Hill Jas F Hill Josephine Holcombe Earnest Holcombe Emma L Mrs Holcombe Etta Mrs Holcombe Florence Holcombe Floyd J Holcombe Gladys Holcombe Henry G Holcombe J A Holcombe J R Holcombe J S Holcombe Joe Holcombe L Inez Holcombe Lois S Holcombe Mamie Mrs Holcombe Mattie Mrs Holcombe Robt Holcombe Ruben Holcombe S F Holcombe Turie Mrs Holcombe Vera M Hood Annie B Hood Bertha Mrs Hood Betty R Hood Don Hood E L Hood Edgar H Hood Jas W Hood John B Hood Lela Mrs Hood Rosa Mrs Hood Walter Horton A B Horton A B Mrs Horton Glenn Horton Jake Horton Jane Horton Lucile Horton Luella Horton Nellie Horton Pearl Horton Ralph Horton Ralph Mrs Horton Ruby Horton Solonon E Horton Virgil Houston Clifford Houston Francis Houston J N Holcombe Roy Houston Jeff Meinert florist MARIETTA * PHONE 35 * a Gv EO mRaGm IA 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 517 AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 `The Ring Leaders Since 1900" B'ALUODVSE H. E.KERLE Y-0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 R.T. 2 Cont'd. Houston Lena M Houston Mary L Howard Clay Howard Daniel Howard Eva M Mrs Howard Evelyn Howard Evie Howard Horace Howard Julian Howard Littleton Howard Loyde Howard Margt Howard Martha L Howard Nellie Howard Paul C Howard Ray Howard Richd Howard Rowe Huddleston D W Huddleston Ida B Huddleston John D Huddleston Margarie . Huddleston S T Hunt Hugh L Hunt John D Hunt John G Hunt Kath Mrs Hunt W B Mrs Hunt Walker Mrs Hunt Zuta L Hunton Aline Hunton E B Hunton Emma L Hunton E.ug Hunton Eula Mrs Hunton F H Hunton Gladys Hunton Harold L Hunton Jas Hunton Jo Hunton Lilia M Hunton Mary Mrs Hunton N C Mrs Hunton W C Hunton W H Mrs Jamerson D B Jamerson D B Mrs James Clifford M Janard Frank Jay Callie Mrs Johnson Blanche Johnson Douglas Johnson Harry B Johnson Michael Johnson O Ralph Johnson Ollie J Johnson Pauline Johnson Pearl B Mrs Jones Florence Mrs Jones L V Jones Lloyd Jones Minnie B Kalf A H Kalf Mae Mrs Keheley Billy Keheley Collie Mrs Keheley Earnest E Keheley J W Keheley Jack Keheley Mary A Keheley Mazie Keheley Odene Keheley Robt L Keheley W M Kemp Agnes Mrs Kemp Emma Mrs Kemp Jack Kemp John J Kemp John M Kemp John P Keys Clarence E Keys Eliz Keys J W Mrs Keys Jessie W King Aude King B B King Betty A King Betty J King Claude King Effie King Essie M Mrs King Forest L King Harold L King Julia A Mrs King Kenneth L King Louise King Lula Mrs King Maud M Mrs CARTER CANDY COMPANY L. E. GARTER, President MANUFACTURERS OF HI-GRADE STAPLE CANDIES ROASTERS AND PACKERS OF SALTED PEANUTS 301 Husk Street Phone 1041 W. P. STEPHENS LUMBER CO. PHONE 840 518 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. RT. 2 Cont'd. King Myrtle Mrs King Norris L King R E King Robt King Robt L King Rubye King Thelma King W L King Walt Lancaster F J Lancaster F J Mrs Lane W T Mrs Lane Annie S Lane Garrett R Mrs Lassiter Aubry Lassiter Betty J Lassiter Evie Mrs Lassiter L N Lassiter L N Jr Lassiter Margt Lassiter W C Lecroy Dora Lecroy Joe S Lecroy Kath Lecroy Margt Lecroy Martha J Lecroy Nordie Mrs Lecroy T H Ledford Henry Lindley Mary C Mrs Little D L Long Arth Long Cecil Long Geo Long Henry R Long John Long Nellie Mrs Lonin O P Long Pauline Mrs Long Ralph Long Thos R Long W H Lowery Doris Lowery Hazel Mrs Lowery Hulene Lowery Hugh Mabry Alice Mrs Mabry Beatrice Mrs Mabry Billy Maddox C J Mabry Edna Mabry Everett Mabry Gladys Mrs Mabry Gustie Mrs Mabry Harley E Mabry Haygood Mabry Jack Mabry Jonnie F Mabry Mamie Mrs Mabry N N Mabry Rebecca Mabry Rosa Mrs Mabry S A Mabry Sarah A Mabry Ward Mabry Wm H Maddox Maggie Mrs Maloney Fred Maloney Frona Mrs Maloney H D Maloney Louise Maloney Poley Martin Canie Mrs Martin John Martin Pat M Martin Walter L Mathis Howard Mathis Inez Mathis Jennie Mrs Mathis W P Mayo R H Mayo Ruth Mrs McBurnett Everett McBurnett Hugh McBurnett J G McBurnett J G Mrs McBurnett Jas G Jr McBurnett Jas McClain Chas W McClain Kath Mrs McClesky Emma McClesky Jas L McClesky Milton L McClesky W Earl McClesky W E Mrs McClure B'eulah Mrs McClure Birdie McClure C Eug FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 J. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 519 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 BRUMBY E. PARK SQUARE PHONE 198 F,BU ComTplP ete I HoE me c Furnishers In Marietta Since 1916" RT. 2 Cont'd. McClure Clyde McClure Eug C McClure Helen McClure Hugh L McClure J C McClure John C McClure Lana Mrs McClure Lanier McClure Margt McClure Pearl Mrs McClure Ruby L Mrs McClure Telly J McCord Jas B McCord Lowery McCord Nettie Mrs McCord Virginia McCord Will A McGarity Annie Mrs McGarity W M McGarity H W McGarity Jas A McGarity Mildred Mrs McGarity Ruby McGhee Clara Mrs McGhee W R McKinley Henry McManous Jos O McManous Mary A McManous Wm R McMichael Bob' McPherson A A McPherson Era McPherson Evelyn McPherson L M McPherson Mertice Mrs McPherson Mildred McPherson Sarah McTaggart Annie G McTaggart Charlie McTaggart Chas McTaggart Francis Merritt Lottie Mrs Merritt Tommie Merritt W H Milsap Clyde Milsap Mamie Mrs Milsap Willie Milsap Willie Jr Mitchell Arthur D Mitchell Betty Mitchell Beulah Mitchell Max Mitchell Opal Mitchell Pearl Mrs Mitchell Sallie Mrs Mitchell W D Montgomery Maggie Montgomery Mose Moon Annie Mrs Moon Carolyn Moon D' C Moon Evelyn Moon G C Moon George Moon Gleen Moon Henry G Moon J D Moon L B Moon Nita B Moon Wm R Morris Bobby L Morris David Morris E B Morris Lucile Mrs Morris Martha J Morris Oscar Morton Sadie Mrs Mt View School Mulkey A F Mulkey F J Mulkey Frank Mulkey Mary Mulligan Effie Mrs Mulligan Herschel Mulligan Sidney Mulligan T Walter Neal Bobby H Neal Gertrude M Neal Lonnie E Neal L Ernest Jr Neal Nancy Neal Norman M Newton Edna E Newton Eula Mrs Newton Hubert A Newton John A Newton M Louise Newton R U PEERLESS FURNITURE CO., INC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 520 BALDWIN'S 19M ICE-COAL-PHONE 1 SOUTHLAND ICE CO. KNOW THEI HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY T.TKF RENT COBB COUNTY FEDERAL SAVINGS Phone 83 & LOAN ASSOCIATION Phone 83 J. J. DANIELL, Pres. P. G. SMITH. Sec'y and Treas. J. GLENN GTT.fs, Atty. RT. 2 Cont'd. Newton R U Mrs Newton Robt C Newton Waynon Nickelson Clay Nickelson Cliff Nickelson E U Nickelson Harold Nickelson Hugh Nickelson J T Nickelson Lillie Mrs Nix D E Jr Nix David E Nix E C Nix Edna Mrs Nix Ethel D Mrs Noggle Howard Noggle, Marjorie Noggle R p Noggle R P Mrs Norris Cecil Owens Erie Owens Fannie Owens W A Pace Ronnie Pace G R Pace G R Mrs Parker Edw Parker Emma L Parker Horace H Perry Earl Perry Hershel Perry J m Perry Jos Perry Mack Perry Ruby Mrs Perry W Hj Petlett Crawford Petlett Edw Petlett Georgia Petlett Jasper N Petlett Mary F Pettitt Ralph Philips Carl W Philips Mary L Philips Willie Pickelsimn Charlie Pickelsimn Hattie Pickelsimn Letha Pickelsimn Milton Pickelsimn Ralph Pippin Bobby Pippin Clarence Pippin Clarence Mrs Fopham E1 O Popham Earl Popham Ethel Popham Jas Popham Louise Popham Minnie Popham Raymond Popham Sarah Poss Alice Mrs Poss Ann Poss Carl Poss M N Poss Mary Lo Poss Opal Poss Virgil Power Barbara Powell Gladys Powell Gladys Mrs Power I C Powell J C Powell Kath Power Lottie Mrs Powell Marion Power Patrica Price B W Price C F Price Cecil G Pricei Francis Mrs Price Frank R Price G D Price Hoyt Price J G Prince Jimmie L Price Lillian Price Linda Price Myrtle Mrs Price Ruby Pruitt C T Pruitt Charlie F Pruitt Hazel C Pruitt Herbert C Pruitt Susie C Mrs Queen Geo Queen Gleen Queen Irene PHONE 60 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. S. J. LINDSEY Owner w. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 521 MAYES WARD & CO PHONE 549 A. I. LITTLE- AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. RT. 2 Cont'd. Queen Ned Mrs Queen Ruth Mrs Raines Fred Raines Mary B Rainwater Clay C Rainwater Ruth Mrs Randolph Clara M Randolph Charlie Randolph Dora Randolph Eston Randolph Howard Randolph 'Olin Reece Bill Reece E A Reece Earl Reece Francis Reece Jas A Reece Lucile Mrs Reece Lula Mrs Reece Mack Reece Nell Mrs Reece Sarah Mrs Reece W D Rich B F Rich Betty J Rich Earmon Rich Emmett Jr Rich Estell Rich Etta Rich Lois Rich Melba Rich N E Rich Nora Rich Virgil V Roberts Emmett E Roberts Lelbia Roberts Linda Mrs Robinson Edmon Robinson Elbert Robinson Ella M Robinson H W Robinson John M Robinson Roxie Robinson W H Mrs Roper Alta Mrs Roper C T Roper Christine Roper Clifford R Roper Etta Roper Francis Roper Fred Roper Gleen Roper Janell Roper Louise Roper Nancy Roper P B Russell Geo Russel, Mary Russell N A Russell Roy Rush Thos N Russell W Hubert Rush Welborne L Samples Geo C Samples Geo Mrs Sammuels Alma Sammuels Cecil Sammuels J A Mrs Sammuels Nella Sanders Ben Mrs Sanders C L Sanders C L Mrs Sanders Dhn Mrs Sanders Marjorie Mrs Sandy Plaino Ch Sappington Florence Satterfield J W Satterfield John W Satterfield Jonnie Mrs Satterfield Otis H Satterfield Wm H Mrs Sauls Hattie Mrs Sauls J H Sauls J H Mrs Scoggins H S Scoggins Mamie Self Elifford Sewell C O Sewell Jennie M Sharp Cliff Sharp G H Sharp L E Shaw Eliz Mrs Shaw John T Simpson Annie B Sims Cash Sims Francis Simpson Gartha PHONE (g "The Friendly Druggist" ATHERTON DRUG COMPANY WALGREEN AGENCY PHONE 7 W. P. STEPHENS LUMBER CO. PHONE 840 522 BALDWIN'S 19W ICE-COAL- PHONE 1 SOUTHLAND ICE CO. OFFICE SALES & SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1,083 CT. 2 Cont'd. Simpson J D Simpson L E Simpson Mary E Simpson Nellie M Sims Nellie Mrs Simpson P B Simpson W B Smith Chas Smith Dewy Smith Dewy Mrs Smith Dosey Smith F C Smith Hillard Smith Jas C Smith Joe E Smith Lela Smith Lizzie Mrs Smith Margrea Smith Martin D Smith Nolan Smith Roy Smith W O Southern Flora M Southern Lillie Southern Margt Southern Virgil Staton Mary L Mrs Staton Olin Steed Kathleen Steinhaues L J Steinhauer May Stell Ella Mrs Stell Gladys Stell Hettie Stell Joe L Stell Wm L Stell Willie B Mrs Stidham A N Mrs Stidham Arth U Stidham Dolley Stidham Flora Stidham Mack E Stidham Mack E Mrs Stidham Sue Stones Belle Stones Fannie Mrs Stones John C S troupe Alvin Stroupe Eugene Stroupe Margie Stroupe Odell Stroupe Ozell Stroupe Roy Stroupe Roy Mrs Stroupe Ruby Stroupe Sennie Mrs Sullivan A O Sullivan Alf H Sullivan Alice; Sullivan B1 A. Sullivan Bud Sullivan C E Sullivan Ethel Sullivan Jas P Sullivan Pearl Mrs Sullivan Ralph Sullivan Sam P Summerous Bill Summerous C H Summerous Chas Summerous H G Summerous J H Summerous Margt Summerous Ozza Mrs Summerous Shirley Swanay Amos Swaney Carlyon Swaney Estelle Swaney Maggie Tatum Horace Tatum Lorene Mrs Thomas Amos Thomas Charlcie Thomas Chas J Thomas Cleo Thomas Edna Thomas G S Thomas G S Mrs Thomas Hattie Thomas J J Thomas Lula Mrs Thompson Ada Thomas Carl Thompson Fannie F Thompson J M Thompson Lewis Thompson Mack L Thompson Minnie B "Serving Cobb County Since 1900" Westinghouse U 1^ FIbiPRF Stoves and Appliances and Radios Wholesale and Retail "" Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 1. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 5553 FUNERAL MAYES WARD & CO. DIRECTORS PHONE 549 Earl G. Medford INSURANCE LOANS -- REAL ESTATE 215 Atlanta St. KT. 2 Cont'd. Thompson Ollie Tritt Harvey E Tritt Jas E Tritt Lizzie Mrs Tritt W E Tritt W E Mrs Troutt Audry Troutt D O Troutt Ena Mrs Troutt Eug Troutt Frank Troutt Jess Tucker Ben H Tucker Bennie Tucker Cath Tucker Walter Turner J C Mrs Turner John C Upshaw Geo T Usher G D Usher John T Usher Lucy Usher M W Usher Willie C Waldrip Bonnie Waldrip Eula Mrs Waldrip G W Waldrip Ida B Waldrip Norris Waldrip Ruby Waldrip Wm E Waldrop A H Waldrop A H Jr Waldrop Chas Waldrop Clyde Waldrop Colene Waldrop Eva Waldrop Etna Mrs Waldrop Eulala Waldrop Frank Waldrop Irene Waldrop J A Mrs Waldrop Jas Waldrop Marie Waldrop Ray Waldrop Wm Billie Waldrop Wm R Walker Ella J Walker Harley Walker Hugh M Walker Jonnie C Walker Leila Walker Velma Mrs Walker Virginia Watkins Geo W Watkins Mary Watkins Mildred Watkins Odell Watkins Ola Webster Clarence Webster Daisy Webster Eula Webster Hollis Webster Ollin Webster Rub'y Telephone 1098 Webster Virgil O Wheeler Doyle Wheeler Ella R Wheeler F P Wheeler Maude Mrs Wheeler Sarah White Ella White J Rae White J Rae Mrs White John Whitlock Clarence Whitlock J U Whitlock Jessie Whitlock Millard Whitlock Nellie Mrs Whitlock Nolen Wigley Edw C Wigley Geanette Wigley Henry C Wigley Henry H Wigley Kate V Wigley Nanie R Wigley Ruby L Williams Irvin L Williams Mary L Wilson Elbert G Wilson Elbert Jr Wilson Imogene Wilson Kath Wingfield Ben F Wingfield Estie B Mrs Wingfield Franklin Wingfield Martha M REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOUR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 524 BALDWIN'S 19W ICE - COAL - PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, INC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 KT. Z Cont'd. Wingfield Ruby L Wingfield Vera M Wofford G W Mrs ROUTE THREE Abercrombie Betty Abercrombie Bill Abercrombie Geo W Abercrombie Joan Abercrombie Lillie B' Abercrombie Mary Abercrombie Robt Allen P H Anderson Andrew H Anderson Betty J Anderson Bobbie J Anderson Chas H Mrs Anderson Edw L Anderson J E Anderson Jasper L Anderson Lee Anderson Lillie Anderson Lillie Mrs Anderson Margt L Anderson Mayzelle Mrs Anderson Ophelia Mrs Anderson Robt L Anderson T W Mrs Anderson Truman W Anderson Vaudie M Mrs Anderson Vera I Mrs Anderson W D Anderson W H Anderson W P Atkins Betty J Atkins Dorothy L Atkins Eva L Atkins Prances Atkins Hattie C Atkins Joe H Atkins Lillie R Atkins Rosa E Mrs Atkins Ruth Atkins Sara A Arnold Lela B Arnold Mattie M Arnold Preston Arnold Therman L Arrowood Earl Arrowood Gladys Mrs Arrowood Jerry Arrowood Marvin Arrowood Mildred Mrs Arrowood Ruth Arrowood T A Arrowood Wm M Beardon Eugene B Babb C' A Babb C A Mrs Babb Ollie J Mrs Babb Geo L Bailey Bill Mrs Bailey Cleveland B Bailey Frances Mrs Ball Chas A Ball Clifford E Ball Edna Mrs Ball Prances E Mrs Ball Jas A Mrs Ballew Carl Ballew David R Ballew Franklin A Ballew J C B'allew Lizzie Mrs Ballew Louise Mrs Ballew Theo Barfield Annie D Mrs Barfield Claud C Barfield Davis C Barfield Gertrude Mrs Barfield Gloria M Barfield H M Barfield Harry M Barfield Howard A Barfield Hoyt L Barfield Jas W Barfield Maggie Mrs Barfield Maude E Mrs Barfield N H Mrs Barfield N Herb Barfield Rewonda A Barfield Rex Barfield W H Barfield W H Mrs Barmore Harry Barmore Flossie Mrs Barron Helen V Barron Millard P PHONE FIELD PHONE 1010 FURNITURE COMPANY 1010 "Find Your Furniture At Fields"--In the Hotel Field Building t. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 525 MAYES WARD & CO AMBULANCE DllfIME CM service rnUllE PHONE 60 HOME OWNED -- HOME OPERATED NU-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. s- TMEr BT. 3 Cont'd. Barron Myrtle L Barron Ruth C Barron Wm P Beardon Bartley Beardon Bobby E Beardon Broughton B'eardon Grady Beardon J C Beardon Viola Mrs Beardon W B Beaty Alvin Beaty Forrest Beaty Georgia Beaty Harry Beaver J E Beaver Bertha F Beaver Claudie L Mrs Beavers Lola Estell Beaver Marion Beaver Ruth Bellah A Marvin Bellah Allie M Bellah Alma Mrs Bellah Emily B'ellah Ellanor Bellah Millard Bellah Richd Bennett H A Bennett H A Mrs Bentley Alice R Mrs Bentley Emma T Mrs Bentley G R Bentley Geo E Bentley Jimmie Bentley Jas W Bentley Mary R Mrs Bentley Rebecca Bentley Robt E Biddy Billy J Biddy Carolyn J Biddy John W Biddy Zelma Bivins Bessie M Mrs Bivins Wm H B'ishop B H Bishop Bennie S Bishop Clarence C Bishop W N Bishop Dona J Bishop Della G Bishop Edw D Bishop Deander A Bishop Louise Bishop Margt A Bishop Mary E Mrs Bishop Neil Bishop N'elle K Mrs Bishop Velma F Bishop W N Mrs Bishop Wm M Bishop Wayne M Black Amanda Mrs Black Hubert E Black J M Mrs Black Jas H Black Jessie L Mrs Black Jessie T Black Jim M Black Mary P Mrs Black Ray G Black Raymond F Black Ruby I Black T W Black T W Mrs Black Tom Blackwell Annie L Mrs Blackwell J B Blackwell Mae H Mrs Blackwell S L Mrs Bellah A Marvin Jr Bloodworth Forrest H Bloodworth Mersia B Mrs B'ond Wm H Bond Margt B Mrs Bond Martha Bond Mary B Mrs Booth Jewell Mrs Bowlen David P Bowlen'Nora Mrs Bowlen Polly B'owles Ella Bowles Fannie Mrs Bowlen W B Bowlen Walter Boyd Bertha K Boyd Nancy A Boyd Wm H Boyd Wm H Jr Invest At Least 10% In War Bonds W. P. STEPHENS LUMBER CO. PHONE 840 526 BALDWIN'S 44 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating PIQUES: Storage -- Local & Long Distance Hauling 215 fA cChHUuRrcChH 1IV3 102 LEMON MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPEB, CLOTH, ETC. RT. 3 Cont'd. Bray Mattie B Mrs Breeden Chester Breeden Estelle Mrs Breeden Geo R Breeden J L Breeden Jas R Breeden Jessie M Breeden Leroy B Breeden Louis Breeden Rosa B Breeden Russell G Breeden Tinnie J Breeden Wiltha Brock Allie Mrs Brock Effie M Brock Hugh B Brock Jas M Brock Jas W Btooks Adeline Mrs Brooks C A Brooks Clarence Brooks Denward Brooks Homer C Brooks John C Brooks Luther Brooks Mina M Mrs Brooks Mary Brooks R R Jr Brooks Richd R Brooks Russell Brown Carl Brown Charlotte J Brown Clint W Brown Doyle C Brown E L Mrs Brown E T Brown Evelyn W Mrs Brown Glenn T Brown Ilia Mrs Brown J P Brown J P Mrs Brown Jewell P Brown Marvin L Brown Mildred Brown R C Brown Ralph E Brown Ruben Brown Sally E Mrs Brown Steve W Brown Winnie Mrs Brumby Eliz Mrs Brumby Otis A Brumby Otis A Jr Bryant A M Bryant Betty J Bryant B obby L Bryant E Mrs Bryant Edd Bryant Edw Bryant Elmer Bryant J E Bryant Katherine J Bryant Lillie Mrs Bryant Mary D Bryant Thelma Buckhannon Cicero V BUckhannon Hazel Buckhannon Homer L Buckhannon Ida B Buckhannon Jas M Buckhannon Linda Buice Dorothy Buice Geo A Buice Nora Burnette Carl C Burnette Edw E Burnette Harold D Burnette Nellie B Mrs Burton Dorothy Mrs Burton Emmit Butler J D Butler J D Mrs Butler R T Byrd B'ertha L Byrd Stephen D Cabe V R Mrs Caddis Shirley A Cagle Alonzo L Cagle Bobby G Cagle Catherine E Mrs Cagle Earl L Cagle Euna Cagle Eula V Cagle Eula Mrs Cagle Freeman Jr Cagle Hazel M Cagle Joyce V Cagle Lena SEARS, ROEBUCK &CO. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PIQUE 840 marietta city directory 527 MAYES WARD & CO DIRECTORS1" PHONE 549 RT. 3 Cont'd. Cagle Lewis N Cagle Louie L Cagle Merle L Mrs Cagle; Doyle D Cagle Velvie Cagle Wyndell W Camp A Mrs Camp Albert Camp Bownie Camp Patsy Camp Peggy Campbell Wm P Mrs Campbell Martha L Mrs Campbell Joyce F Cargile Thomas J Carney Ed Carney Ed Mrs Carroll Chas C Carter Addie L Mrs Carroll Billie E Mrs Carter Delia Mrs Carter Florence Mrs Carter Harley J Carter Jas C Carter Carlton Carter Carrie Mrs Carter Shirley E Carter Wm L Castleberry X D Mrs Chadwick Clay Chadwick Donald Chadwick Edna Mrs Chadwick F B Cobb Andrew H Chadwick Fermn Broughton Cobb Glenn P Champion L H Cobb Mattie C Mrs Champion L H Mrs Cobb Virginia C Chance Frances L Coleman Virlyn Chance Wm D Cochran Beatrice Mrs Chance Wm J Cochran Faustine Chastain Carrie L Cochran John Chastain Edwin M Cochran Kathryn Chastain Lester Mrs Cochran Martha L Chastain Louise B Mrs Cochran Marjorie Chastain T B Cochran W J Mrs Chester J S Conley Dorothy H Mrs Chester Emoline C Mrs Conley Jas H Capt Chumley Equillar H Mrs Cooley Albert Chumley Joe B Cooley Dorothy Church Alice Mrs Cooley Eliz Church J C Mrs Church J Colquitt Church Turlyne R Mrs Clarke B'essie L Mrs Clark Bunt Clark Chas T Clark Chas W Clark Easter Ozelle Mrs Clark Frances M Clark John Clark Paul B Clark Thaddeus B Clark Virginia C Mrs Clayton Emma Cooley Emma L Cooley John J Cooley John J Jr Cooley Mary L Cooley Robt Cooley Rosa M Cooley Ruth Cook Brenda J Cook Cornie M Mrs Cook H L Mrs Cook Hannibal L Cook Helen Cook Jesse L Cook Jesse L Jr Clayton Wm. Floyd Cook Leila F Cobb Andrew C Copeland Cora E Moving @ Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 841 538 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. FRED LEGG Distributor -- GULF OIL CORF. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene film Phone 81, Plant 129-33 Butler St. RT. 3 Cont'd. Copeland I P Copeland Thelma A Corn Bobbie Corn Harold G Corn Homer Com Jas Corn Kate Mrs Creasman Henry Creasman J H Creasman Joe Creasman Katherine Mrs Creasman Neal Creel Dana A Creel Dana S Creel Mary V Mrs Crider Emaline B Crider J R Mrs Crider Nancy E Crider S S Mrs Crider S Sanford Crisler Geo A Crisler Larry D Crisler Velma C Mrs Crisler Virlyn Crowe Glen Crowe Larry K Crowe M Mrs Crowe Marion Crowe Tommy L Curb'o T N Curbo Bertha Mrs Curtis J B Mrs Curtis Murry Mrs Dairdson Ruby Mrs Daniel Annie P Mrs Daniel Billie S Daniel Ellene A Daniel Joe B -- Daniel J B Mrs Daniel J Claude Daniel M E Daniel M E Mrs Daniel Marion V Daniel Martha F Daniel Shirley J Dodd O E Davenport Artie M Mrs Davenport Bertha Davenport Clifford P Davenport Catherine L Davenport Glenn L Davenport Grace E Mrs Davenport Harold S Davenport Janelle M Davenport Jas W Davenport J W Mrs Davenport Leonard P Davenport Melvin Y Davenport Pauline Davenport Roy H Davenport Sonny Day Betty H Day Bonnie Day Daisy N Day Glyndon Day Herbert Day Hugh D Day J C Day John T Day Johnnie L Mrs Day H Mrs Day Mary V Mrs Day Margt Y Day Wilma Davis Allen C Davis Betty C Davis Brenda J Davis C O Davis Caroline P Davis Chas Q Davis Chas W Davis Cornelia S Davis Culver O Jr Davis Dorothy E Davis Douglas N Davis Edna Mrs Davis Grace Inez Davis Gary Davis Hubert J Davis Houston T Davis Linda A Davis Mary G Mrs Davis Melba J Davis Sara L Davis Viola Mrs Davis Walter H Dean Annetta Dean Leola Mrs WALTER W. HAZEL TATMV DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 529 AMBULANCE EIUIUIC EAO MAYES WARD & 60. service rnUNE 3*15 Marietta's Most Complete Department Store SAUES "The Best - - for Less RT. 3 Cont'd. Dean Lucile A Dean Mary A Dean N C Mrs Dean Norris C Dean Ollie B Dean Willie Dean Willie S Delk Robt D Delk R D Mrs Denby Dick Denby Florence H Denby G R Denby G R Mrs Denny Barrett Dettemer Minnie Mrs Deward W Deward W Mrs Deward Ed A Deward Pearl Mrs Dickerson Annie L Dickerson Billie Dickerson Chas1 J Dickerson D C Dickerson Donald D Dickerson Donnie D Dickerson Doris M Dickerson Edd Dickerson Edd Mrs Dickerson Edna M Dickerson Edna M Mrs Dickerson Jack A Dickerson Jas J Dickerson Jas R Duncan Moses jDickerson Louise D Dunn Ada L Mrs Dickerson Luther B Dunn Charlotte A Dickerson Ernestine Dunn D D Mrs Dickerson Nellie C Mrs Dunn Emma V Mrs Dickerson O L Mrs Dunn H A Dickerson Paul H Dunn Henry A Dickerson Robt L Dunn Hugh D Dickerson Robt L Mrs Durham Allene L Mrs Diemer Eloise Durham Homer D Diemer Fred J Durham Patricia A Diemer Fred J Jr Durham Thos R Diemer Jack Eaverson Arthur E Diemer Mary Eaverson Leona Mrs Diemer Mary W Mrs Dills Park J Dills Zuma A Mrs Fldridge F W Eldridge Mary C Mrs Ellers Berta L Mrs Ellers Billie Dobbins Beulah Mrs Ellers Billie Mrs Dobbins John E Dobbins Virginia filers Ed D Ellers Lola M F Mrs Ellers Sara Dobbins Wade S Ellers Wm E Dobbins Wade S (B'uck) Jr Ellis Bobbie L Dobbs Wade I Dodel O E Dowda Bill Ellis R L Ellis R L Mrs Ellis Ruby L Eskew B P Mrs Dowda Fred W Eskew Bertha P Mrs Dowda Florence Mrs Dowda Monterey Doyle Edw J Eskew Blyant P Eskew E Lane Mrs Ethridge David T Eskew Laurence T Doyle E J Mrs Ethridge Ethel M Doyle Sulser Ethridge Opal T Doyle Mary J Ethridge Shirley A Farner Jas Duncan Maggie Mrs Farner Minnie lump CaA^ WOFFORD OIL CO "Be Sure -- With Pure" ROY McCLESKEY, Agent GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 Tioiene] u'^ANY.'V W. P. STEPHENS LUMBER CO. PHONE 840 530 BALDWIN'S 1W ICE - COAL - PHONE 1 SO UTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 KT. 3 Cont'd. Ferguson J Ferguson JoAnn Ferguson Lee R Ferguson L R Mrs Ferguson Sara Finley Gertrude Ford Amanda Mrs Ford Taylor lortner Albert F Fortner Addie Mrs Fortner Ben H Fortner Beatrice L Fortner Chas B Fortner Euphomia F Fortner Eliz Fortner Elen D Mrs Fortner E L Fortner Fannie M Fortner Flora Mrs Fortner H L Fortner Howard L Fortner Hazel Fortner Jas L Fortner Jas F Fortner Jack P Fortner Levi F Fortner M K Mrs Fortner Pearl M Mrs Fortner Pairlee Mrs Fortner Thos J Fortner Thos E Foster Ernest Mrs Foster Sarah B Fouts Velvie L Franklin Barney E Franklin B E Mrs Franklin B H Franklin B H Mrs Franklin Bonnie A Franklin Clara S Franklin Floyd Franklin Floyd Jr Franklin Hazel C Franklin Howard W Franklin J W Mrs Franklin J W Franklin J E Mrs Franklin Jas F Franklin Lamar H Franklin Lamar H Jr Franklin LeVert W Franklin Louise C Franklin Nell C Franklin Virginia S Franklin Wm H Freeman C B Freeman Doris Mrs Freeman Nettie O Frey Geneva Mrs Frey Marvin D Frey M D Mrs Frey Moultrie Frey Robt Frisby Claud Frisby Hoyt Frisby Pearl Mrs Frostig Marcus Fuller C C Mrs Fuller J E Mrs Fuller Jas E Fuller T G Fuller Troy Gaddis Alice C Gaddis Herman E Gaddis Paul Gaddis Paul Jr Gaddis Pearl C Mrs Gaddis Ruth Gaddis Willie PI Gantt Barbara J Gantt Billie R Gantt Cleo Gantt Emma Gantt Georgia L Gantt Horace C Gantt Juanita Gantt Mary R Gantt Max C Gantt Norma L Gantt Paul R Gantt Ralph M Gantt Rossie L Mrs Gantt Thelma D Mrs Gantt Wm G Gantt W M Mrs Garland Darrell C Garland Jas O Garland Leland C Garland Alvia Mrs Garland Weyman J Garner Clara E Garner Clara M Mrs Garner Jos T Garner Wm M Garrett Chas S Garrett Eva M Garrett Floyd M Garrett Jas W Garrett Jas W Jr Garrett Jas P Garrett Jerry F Garrett John L Garrett Katie E Mrs Garrett Larry J Garrett Myrtle V Garrett Virginia Gasaway Alvin Gasaway Bertha Mrs Gasaway Edna Gasaway Louise Gasaway Vivian A GENUINE FLINTKOTE R0OF IS A SMART INVESTMENT MARIETTA LUMBER CO. LUMBER--BUILDING MATERIALS "BUILDING MATERIALS THAT MERIT GOOD WILL" PHONE 357 ATLANTA ROAD W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 531 MAYES WARD & CO. DIRECTORS^ PRONE 549 F. P. & "BOB" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. RT. 3 Cont'd. Gates Rosie Gazaway Ada E Mrs Gazaway Clifton H Gazaway Ernest J Gazaway Isabella D Mrs Gazaway J Wesley Gazaway Jas C Gazaway Mary R Gazaway Rich H Gazaway Ruth Gibson K P Gilbert J A Mrs Gilbert John A Gilstrap John Mrs Gilstrap Matilda R Mrs Gillham Wm D Gunter Billie L Gunter Bobbie J Gunter Glennice Gunter Glynn Gunter Grace Gunter Harrison Gunter H B Gunter Herbert Gunter Hubert Gunter Jack Gunter J B Gunter Jill Gunter Maggie B Mrs Gunter S W Gunter S W Mrs Gunter V M Gunter Waymon L Gwin E T Mrs Godfrey Georgia Mrs Godfrey J M Goodson Hazel Mrs Goodson Hugh Goodson Jo R Goodson Joyce Gosa Fannie M Gosa Wm H Grant Guy L Grant Hazei Grant Howard W Grant Viola Mrs Gravel Harvey Gravel Hubert Gravel Junior Gravel Nannie Griffetn Bessie Mrs Grirfeth John W Green Betty J Green Curtess V Greer E J Greer E J Mrs Green Eliz M Green Geraldine Green J R Mrs Green Ralph M Green Ruth M Mrs Green Z S Mrs Gwin Claire E Gwin Gena E Gwin Miles H Gwin Mildred S Hamby Ben H Hamby Carl E ,, Hamby Fred Hamby Joe Hamby K Mrs Hamby Sarah Hammond H E Hamrick Arthur W Hamrick Arphie M Hamrick A W Mrs Hamrick Betty Hamrick Chas H Hamrick Evia L Hamrick Elvia Mrs Hamrick Florene Hamrick Janie Hamrick Lillian Hamrick L V Mrs Hamrick Maude Mrs Hamrick Otes T Hamrick Vernon O Haney Andrew N Haney Cliff Haney Jennie Mrs Haney John L Haney Lois Mrs Haney Louise F Haney Mattie I Mrs Haney Opal Haney Troufe 1-Ia.rdy G F Harris Benj R Harris Emily C Mrs Harris John R Harper Fannie I Harper Irene Mrs Harper Jas L Harper Polly F Harper Tom E Hartsfield Evie I Hartsfield Jas M Harwell Carl C Harwell C B Mrs Harwell Carl B Jr Hasty Amy Mrs Hasty Clyde Hasty Grace Hasty Harold E Hasty John G Hasty Oscar Hatcher Evelyn Mrs Hatcher Michael Hatcher Norman S Hearle Irene B Hearle Perce H Heath J B HARVEY 1. MONT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7334 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 841 533 BALDWIN'S 1944 ICE -COAL- PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Savings Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOIR TELEPHONE 44 RT. 3 Cont'd. Heath J B Jr Heath Jas E Heath Jennie V Heath Killer M Helms D G Helms Ruby Mrs Hemphill Arth H Hemphill Floyd H Hemphill Fucila M Hemphill Jewell A Henderson C C Mrs Henson Carl T Henderson Chas C Henderson Chas W Henson Chester F Henley Cora G Mrs Henson Dortha L Henson Effie Mrs Henley Hilda K Henley J B Henson Lee T Henson Lucille Mrs Henson Mattie F Henson Robt L Henson Ruby M Henderson Shirley A Herring- Mary L Mrs Herring W A Mrs Hester Grace M Hester Irma V Hester Jim E Hester Lawrence A Hester Lemar Hester Lena Hester Lewis A Hester Paul A Hester Sterlin J Hester Walter A Hester Walker H ASSOCIATION 112 ATLANTA ST. Hatcher Eliz Hatfield Eunice H Hatcher Eve Hatfield H Earl Hatfield J W Mrs Hatcher Marion F Hatfield Mary F Hatcher Peggy Hatfield Rosa K Mrs Hayes Alfred E Hayes Bessie J Haygood Eug-enia E Mrs Hayes Mabel Mrs Hayes Mary R Hayes Minnie M Hayes Paul C Haygood Wm C Hill Annie L Mrs Hill Annie M Hill Andy W Hill Beverly M Hill Billie ' Hill Bunk Hill Dorothy Hill Dorothy Mrs Hill Douglas E Hill Earl R Hill Edw D Hill Edw D Jr Hill Elzora Mrs Hill Ollie H Mrs Hill Herschel S Hill Howard Hill Israel E Hill Leon H Hill Leonia Hill Lillie M Hill Linda L Hill Mae Hill Margt A Hill Marion E Hill R J Mrs Hill Robt J Hill Ruby L Hill Sara E Mrs Hill Sarah D Hill Thos D Hill Willie M Hite Betty L Hite Clifford Hite Daisy K Hite Earl H Hite John M Hite Julian Hite Wm E Harper Nancy A Hintson Nomica L Hintson Nomica V Hintson Robt F Hipps Bertie Mrs Hipps Henry L Hodgins Barbara F Hodgins Bobby Hodgins Gilsa' D Hadg'ns Gladys Hodgins Herman Hodgins Walter H Holcombe Clara L Holcombe Emaline E Holcombe Frank S Holcombe Grady R Holcombe Howard Holcombe R Mrs Holcombe Lee S Holcombe Linda L Holcombe Marion J Holcombe Mary E Holcombe Mary G Holcombe Melvin B Holcombe Myrtle B Mrs Holcombs O C Holcombe O C Mrs Meinert MARIETTA 1 PHONE 35 florist GEORGIA 1 310 ROSWELL ST. W. P. STEPHENS LUMBER 0. PHONE 840 marietta city directory 533 HAYES WARD & CO. A*KeCE PHONE 549 "The Ring Leaders Since 1900" 1. E. KERLEY-0. DR. Jewelry -- Diamonds -- Optical Goods 26 N. PARK SQUARE TELEPHONE 86 RT. 3 Cont'd. Holcombe Ollie M Mrs Holcombe Polly Holcombe Ruby I Holcombe Stella P Holcombe Virgil M Jr Holcombe Virginia M Holcombe V M Holcombe Wm Holcombe Wm Mrs Holt Cecil O Holt Vada L Mrs Holt Wm E Honea Teresa Honea W P Mrs Hopkins Amy S Hopkins E A Hopkins E A Mrs Hopkins Everette A Hopkins Nettie M Horne Marvin Z Hubbard Bertis Hubbard Paye Hubbard Thurston T Hurlow Bertie Hudson Floyd Hudlow Warren L Humphries Prances Mrs Humphries Janet Humphries Wm G Hunt Rozella Hutchins Fannie M Htuchins Jerry Hutchins Jerry Jr Hutchins Maude J Hutchins Sara Hyde Allene Hyde Carrie L Hyde Chas E Hyde Clifford Hyde Donald Hyde Edna Mrs Hyde Homer T Hyde Howard T Hyde Jas A Hyde J C Hyde J C Mrs Hyde Jim B Hyde Martha L Mrs Hyde Raymond Hyde Vernon E Hyde Walter D Hyde Wm H Ingram Robt Jacobs Prances D Mrs Jacobs J L Jenkins Bessie F Mrs Jenkins Horace M Jevons R A Jackson Bular Mrs Jackson John J Johnson Alfred E Johnson Billy Bob Johnson Emma L Mrs Johnson Eliz H Mrs Johnson Prances L Johnson Fred Johnson J J Johnson Jack Johnson Jewell Mrs Johnson John H Johnson John H Jr Johnson Johnnie J Johnson Lucile Johnson Loyce J Johnson Lizzie Mrs Johnson Mattie P Mrs Johnson Ruth Mrs Jones C Ed Tones Donald Jones Edd Mrs Jones Elmer B Jones Ivalyne Jones Jeff Y Jones John W Jones Lanier Jones Ola Mrs Jones Pearl Mrs Jones Vonclle M Jones W C Joyner Marvin Joyner Rachel Mrs Lancaster Beatrice Lancaster L Y Lancaster Lottie B Lancaster Mary Mrs Lancaster Marshell Lancaster Pauline Lassiter H C Mrs Lazenby John D Kelly Tom C Mrs Kemp Barbara L Kemp Edna M Mrs Kemp Hoit Wm Kemp Jule K Kemp Joan L Kemp Laura J Kemp Lois Kemp Patricia A Kemp Willia J King Evelyn P King Lester R King Marquerite E King Nellie F Mrs King Marguerite E King Minnie E Mrs King Nellie G Mrs Lazenby Edna L Lazenby Laura J Mrs Lazenby Lena Q Mrs Lazenby Wm I Ledbetter A V/ Victory trailer park ACCOMODATIONS FOR 300 HOUSE TRAILERS Hot and Cold Showers -- Laundry Room -- Modern Sanitation Plenty of Power and Light LOCATED ON OLD ATLANTA ROAD--U. S. 41 1 MILE FROM CITY LIMITS W. P. STEPHENS LUMBER CO. PHONE 840 534 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. "Marietta's Finest Cleaners" MODEL DRY CLEANERS QUALITY AND SERVICE Phone 150 117 Cherokee St. KT. 3 Cont'd. Ledbetter Lilia M Ledbetter Mae B Ledbetter Velmar Ledford Barbara Ledford Earldene Ledford Eliz Ledford James Ledford J Earl Ledford Rhocta. Ledford Edie Lester J H Jr Lester J H Jr Mrs Lester Eliz C Liddle H D Liddle Susie Lindsey C E Mrs Lindsey Cliff E Lindsey Corrie M Lindsey Jackson C Lindsey Maxine Little J C Loudermilk A P Loudermilk Albert Loudermilk Aubrey Loudermilk Belle Mrs Loudermilk Coy L Loudermilk Dan A Loudermilk Dorothy D Loudermilk Elmore W Loudermilk Estelle N Loudermilk Helen Loudermilk Ludia M Mrs Loudermilk Manuel Loudermilk Ruby K Mrs Loudermilk Terry Loudermilk Vernon L Long J H Long J h Mrs Lovinggood Edwin Lovinggood Marjorie Lutz A M Lutz A M Mrs Lutz Billy Lutz Bobby Lutz B L Lutz Gertrude Lutz Lurella M Lutz Mildred H Lutz Milton L Mackey Cliff Mackey Mamie Madison Jas Manders Kathryn M Manders James W Mann Mary T Manders Willie M Mrs Marler Betty G Marler. Emma K ,, Marler H S Marler Louie Marler James E Marler Louise Marler Minnie Mrs Marler Tom Matthews C W Mathis Ernest V Mathis J W Matthews James S Mathis Patsey R Matthews Rubv H Matthews T W McClain Billie M McClain C O McClain Ola V McClartz Clara L McClartz Irene Mrs McClartz James E McClartz J W McClartz J W Mrs McClartz M A McClartz M A Jr McClartz Virginia McClure Centby G McClure Edgar McClure Ella Mrs McClure F A McClure Floyd E McClure Jack McClure Joyce N McClure Mary F McClure Nara P Mrs McClure Nellie F McClure Vance H McClure W E McClure W L McCollum Barbara S McCollum Betty J McCollum Flora M Mrs McCollum Hubert McCollum Ira McCollum J H McCollum Johnnie A McCollum Johnnie Wm McCollum Levi E McCollum Maxine McCollum Mozele McCollum Nellie L McCollum Sara B McConnell Annie McConnell Bud McConnell Evelyn McConnell Fannie M McConnell Georgia McConnell Lila H McConnell Louise McConnell Paul McConnell Pauline McDoris Benton McDoris Bessie Mrs McDoris Delovis McDoris Howard FOREST C. BROOKS Agent--SHELL OIL CO. Super Shell Gasoline--Golden Shell and Shell Penn Motor Oil Bulk Plant--Atlanta Road Phone 1268 W. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 535 MATES WARD & CO. FJH5&L PHONE 548 BRUMBY E. PARK SQUARE PHONE 198 fbrmtiire co. Complete Home Furnishers In Marietta Since 1916" RT. 3 Cont'd. McDoris John B McDorls Ralph McDaniel S M Mrs McGinnis Addie McGarity Bessie McGariety E G McGaritz Evelener McGaritz Frankie McMichael Fred McGinnis Georgia L Mrs McGinnis J M McGaritz Orlando McGarietz Pearl Mrs McGaritz Willie McMicheal Dorothy McMicheal Lucile Medley D C Medley Minnie G Medley O E Mrs Meeks James B Merrett Frances Merrett Jeanette Merrett John L Merrett J T Merrett Marie Mrs Merrett Nettie Merrett Olin Milwood B J Milwood B J Mrs Millwood H J Millwood H J Mrs Metcalf Gladys E Mitcalf June E Mitcalf Kenneth L Mitcalf Warren L Mitchell Dorris Mitchell Hubert H Mitchell Ruby Mrs Mohon S C Moody A P Moody David A Moody Katherine Moody Ola C Mrs Moon J Bernard Moon Carie Moon D C Moon Dora J Moon Fannie E Moon Fannie Mrs Moon Geo Moon Helen F Moon Herman A Moon Howard C Moon Howard C Mrs Moon John E Moon John R Moon Joyace Moon Juanita I Moon L G Moon Leila M Mrs Moon Nina B Moon Nellie Moon R A Moon Rebecca A Moon Reynold Wm Moon Sarah L Moon T M Mrs Moore Camilla N Moore Dick Moore Ethel N Mrs Moore V A Moore Victor A Moreland W P Morgan Bertha M Morgan Eva Morgan Francis Morgan Geo Z Morgan Leonard Morgan Mannie M Mrs Morgan Marilda I Mrs Morgan R L Morgan Robt Morris E E Mrs Morrill Annie A Morrill H L Jr Morrill H L Jr Mrs Morrill Jane McClain J P Nash Richard R Naegle C F Neese Ed Neese Mary S Mrs Neese Wm Nelson Marion L Nelson M H Nelson Mattie P Nelson Raymond C Nelson Virginia E Newton R A Newton R A Mrs O'Beirne E N O'Beirne E N Mrs Q'Beirne E S Mrs Onbey Bertha J Onbey Billie Onbey Teddie M Agnio Clyde B Ognio Eliz M Ognio Fortunato Ognio Nellie M Mrs Ognio Wm Ray Osborn Carrie M Osborne Jannie T Osborn Jas R Padgett Carline Padgett Christine Padgett Floyd Padgett L W Palmer Chas Palmer Lindie Mrs Palmer Ralph PEERLESS FtJHiTlRE CO., IRC. 102 Whitlock Avenue Tel 1173 W. P. STEPHENS LUMBER CO. PHONE 840 536 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. KNOW THE) HAPPINESS AND INDEPENDENCE OF OWNING YOUR OWN HOME -- PAY T.TKE RENT COBB COUNTY FEOERAL SAVINGS Phone 83 & LOAN ASSOCIATION J. J. DANIELL. Pres. P, G. SMITH. Sec'v and Treas. Phone ss KT. 3 Cont'd. Palmer Ralph Jr Pannell Barbara H Pannell Billie J Pannell Frances Pannell H L Pannell H L Mrs Pannell Hugh L Pannell Jeanett Pannell Pauline Pascal W E Patron A J Pate Jim Peabody Annie B Mrs Peabody Harvey M Peabody W H Perkins Chas H Perkins John R Perkins Jerusha Mrs Perkins Jim H Phillips Alberta Phillips Grady Pirkle Perry W Pirkle Thomas N Pirkle Vesta C Mrs Pitts Cecil E Pittman Geneva Pitts Henery Pittman Joe Pittman Joe Mrs Pitts Nina F Pittman Sidney Pitts W H Pitts Wm H Poss Doyle Poss Eva Eliz Poss Glenn F Poss H D Poss W T Posey Bessie Mrs Posey Louis M Poteete Edith R Mrs Poteete Robb L Power C A Power Carolyn Power Chas T Power C Hugh Power Imogene Power J M Power Mary Power Mary R Mrs Power Martha Power Nellie L Preston Flora Preston J A Pruitt Berma L Pruitt Ellen B Pruitt Julius A Pruitt Juno W Pruitt Mary A Mrs Pruitt Nellie A Mrs Puckett Ed Puckett Ed L Quarles Imogene Quarles James H Quarles M C Jr Quarles Milvin C Ragland Dora M Ragland Emma G Ragland Fred D Ragland John H Ragland Boise Ramsey W B Ramsey Louise Mrs Ramsey Luddia O Ransom Angie Ransom Billie J Ransom Frances E Ransom Virginia A Ransom Wm A Ransom Wynema Ray Albert H Ray Alene F Ray Bessie Eliz Ray Bobby Ray Chas L Ray Clavarn P Ray Doyce H Ray Esther Ray Grady T Ray Geo L Ray Geo L Mrs Ray Gyalia J Ray Harold Ray Homer Z Ray Hurshell Ray John L Ray Jr Ray Jewell E Ray Mary L Ray Myra J Ray Onah M Ray Patricia Ray Ray C Ray Roff G Ray Rosa Ray Sandra C Ray G T Mrs Ray Vera F Mrs Ray Verlyn L Reed Edward E Reed James L Reed Lee C Reed Mary C Reed Paulette Richardson J D Roach James L Roach Mary C Roper Charlie E Roper Chas H Roper Dorothy S Roper E H PHONE 60 OLDEST -- LARGEST -- BEST NU-WAY CLEANERS & LAUNDRY New Life To Lovely Garments" 513 Page Aye. S. J. LINDSEY Owner W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 537 MAYES WARD & CO. Acr PHONE 549 A. D. LITTLE- AGENT FIRE AND AUTOMOBILE INSURANCE--SURETY BONDS-- LOANS--REAL ESTATE Phone 44 112 Atlanta St. KT. 3 Cont'd. Roper Evelyn Roper James E Roper Ruby E Mrs Roper Sarah E Roper Thelma J Rucker Emma Mrs Rucker J S Sanders Birtie Sanders E J Sanders Eugene Sanders Frances Sanders Hurlow Sanders Mary T Sanders Zvonnah Sanford E S Sanford Jack Mrs Sanford Luna Sanges Edna Mrs Sanges F J Sanges Frank E Sanges Goe C Santer Jacob Santer Sarah E Mrs Sauls F H Mrs Sauls H P Mrs Sauls J D Mrs Sauls John D Sauls Mary E Rowe James W Scarbrough Jim Scarbrough Ruth Scarbrough W D Seabolt Bertha L Seabolt Birda M Seabolt Callie J Seabolt E W Seabolt Emma R Seabolt Flandy C Mrs Seabolt Hazel H Seabolt Monnie J Seabolt Ruby L Seabolt Wm H Sears A P Sears A P Mrs Sewell Edgar Sewell H L Sewell J H Sewell Lois Sewell Ruby Shirley Bertha M Shirley Edna Shirley Edna Mrs Shirley Elaine Shirley Jack Shirley James L Shirley J C Shirley Jim Shirley Leonard Shirley Lewis C Shirley Lilia Shirley W L Simalton C W Simalton Irene Simalton Myrthia J Simalton Samual Simalton Wiley Simalton Wyrthia Skinner Billie Skinner Chas E Skinner Eva C Skinner Frances Skinner Howard F Skinner Lassie Skinner Lois Skinner Lucille Skinner Mildred F Skinner Ray Skinner Ruby M Skinner Woody D Skinned Woody D Jr Smallwood Julia P Mrs Smallwood Leon E Smith Allen Smith Alvin Smith Billie Smith Calvin B Smith Charlotte E Smith Dovie L Mrs Smith E B Smith E B Mrs Smith Eliz I Smith F A Smith Fannie M Mrs Smith Glenn C Smith Harold W Smith R Hoke Smith Jack Smith James A Smith John R Smith Lydia M Mrs Smith Margie M Smith Martin D Smith Marvin A Smith Olin H Smith Ollie M Smith Richard Smith Sittie M Mrs Smith Thos R Snelson Charles Snelson Dock Snelson Glenn Mrs Snelson Ida B Snelson Ira A Snelson Jr Snelson Newton G Snelson Roosevelt Snelson Rozzie A Southern Arthur G Southern Martha G Spilmon Marguerite Spilman M E Mrs ATHERTON'S GREENHOUSES THE BEST IN FLOWERS AND DESIGNING We Telegraph Flowers Everywhere 1300 Cherokee St. Phone 58 W. P. STEPHEHS LUMBER CO. PHONE 840 538 BALDWIN'S 1941 ICE - COIL - PHONE 1 SOUTHLAND ICE CO. OFFICE SALES 1 SERVICE "Your Partner In Business" OFFICE MACHINES, EQUIPMENT AND SUPPLIES SCHOOL SUPPLIES 114 Atlanta St. Phone 1,083 RT. 3 Cont'd. Spilman J H Spinks A A Spinks A B Spinks A C Spinks A C Mrs Spinks Amanda L Spinks Annie M Spinks Brenda A Spinks Carl Spinks Carolyn J Spinks Eliz Mrs Spinks Gladys Spinks Helen Mrs Spinks Hershel M Spinks Hugh A Spinks J T Spinks Josephine Mrs Spinks Lena A Spinks Louise Spinks Mattie S Spinks Maude Mrs Spinks Raymond K Spinks Ruby Spinks Sandra L Spinks Vivian M Spinks A M Spinks Wm A Standridge Charles W Standridge James W Standridge Sarah L Standridge Steve Wm Standridge Winnie L Mrs Standridge W S Mrs Standridge Wm Chester Staton Dillard H Stanton Eva Mrs Stanton Gilbert C Staton Irene Stanton Josephine Staton W T Stephens Lynn C Mrs Stephens Shirley E Stroupe Betty L Stroupe Carlos Stroupe Carolyn J Stroupe Clyde Stroupe Esther L Stroupe Eugene Stroupe Ivalyene Stroupe J D Mrs Stroupe Joyce A Stroupe Lucile Stubblefield Bobby J Stubblefield Clara G Stubblefield Dorothy G Stubblefield Edgar Stubblefield Elbert P Stubblefield E O Stubblefield Frances Stubblefield Herbert Stubblefield Matron L Summerour Fannie Summerour Hattie P Summerour Paul Summerour R F Summerour Vera Teague Bobbie J Teague Ernest Teague Lynette Teague Mary Mrs Terrell Elsie E Thackson Daisy M Thackston Donald H Thackston Ella M Mrs Thackston Jas R Thackston Mary L Thackston R Carl Thomas Doris Thomas E J Thomas Essie L Thomas Frankie M Thomas Iris Thomas Louise Thomas Mary B Mrs Thomas R Ed Thompson Ada E Thompson Andrew Thompson Dorothy Thompson E F Mrs Thompson Eliz Thompson Emma J Thompson M J Thompson M J Mrs Tinsley Cora Tinsley Joe T Tinsley Louise Tinsley Mary S Towns Clyde Towns H G Towns H G Mrs Towns James M Towns Mary R Towns Ollie Mrs Towns Ralph Towns W C Towns Wm C Turner M N Turner Marcus N Jr Turner Marie Turner Mildred O Turner Ollie Mrs Turner Regina Turner Ruby Turner Sara W Turner Wilma Tuttle Dick Tuttle Harry M Tuttle Richard M Tuttle Thelma M Mrs Varner Evelyn Varner Frances "Serving Cobb County Since 1900" Westinghouse 1J| |U| 1H| 11 fpl jjf^ H? Stoves and Appliances and Radios I^Ih Wholesale and Retail fflt EL Ranges GROCERIES, FEEDS, FERTILIZERS, FARM SUPPLIES Phone 700 "Pharis Tires" Phone 701 W. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 539 MAYES WflBD & CO. rSt RHODE 548 Earl G. Bedford INSURANCE -- LOANS -- REAL ESTATE 215 Atlanta St. RT. 3 Cont'd. Varner J L Varner J L Mrs Varner Lowell J Varner Paul Varner Roy P Waits Edna Waits Florence Waits Hubert Waits Margt Mrs Waits Martha Waits Opal Waits Wm L Waldron Albert T Waldron Frances Waldron Henry W Waldron Marie G Waldron Sami Waldron Wm F Waldron Wm S Waldrop Agnes Waldrop Ann Mrs Waldrop Dorothy Mrs Waldrop Eliza Waldrop Geo C Waldrop Joyce H Waldrop Ralph Waldrop Randolph Walker D O Walker Maude Mrs Wallace Annie Mrs Wallace Eliza Mrs Wallace G W Wallace J W Wallace W H Mrs Walters Geo D Walters Mary E Webb Alton Webb Bessie Webb Deward W Webb Elsie S Webb Joan Webb L H Jr Webb Lena Webb Luther H Webster Olin D Webb Ronald Webb Roselan Wheeling' Albert B Wheeling Cecil Wheeling Doris Wheeling Ellen Wheeling Frances L Wheeling Frank Wheeling Fred Wheeling Hazel Wheeling Horace Wheeling John Wheeling Johnnie Wheeling Lillian Wheeling Mary Wheeling Robb Wheeling Rosa Wheeling Wm E Whitfield Helen Whitfield J T Sr Whitfield John T Whitfield Lealer Whitfield Wilder Whitley Mannie O Whitley Otto Whitley W G Whitmore Allie Mrs Whitmore Barney Whitmore Billy Whitmore Bonnie Whitmore Ellen Whitmore Ernest F W'hitmore Jas G Whitmore John Whitmore Kate Telephone 1098 [Whitmore Lucy Mrs Whitmore Roe E Whitmore Wm M Whitten Florrey H Whitten Robb L Wilbur Jas T Wilbur Mattie L Wilkie C M Wilkie H G Wilkie Julia Wilkie Lougenia Williams Billie G Williams Buford Williams Dixie H Williams Gladys Mrs Williams Jo A Williams Mamie Williams Marie Williams Robb Williams Sarah Williams Young Williams Young Jr Wi! mouth Geo W Wilmouth Lester P Wilmouth Walter Wilson Ernestine Wilson Saltie M Wilson Raymond B Wilson W A Wolfe Bernice Wolfe Jerome H Wolfe Mary C Wood Alton Wood Donald Wood Eunice Wood Jas Wood Lawrence Wood Mark P Wood Sandra D Woodall Cassie Mrs Woodall Geo N REFRIGERATION EXCHANGE 237-245 Pryor St., S. W., Opp. Commercial High (Formerly of Marietta, Ga.) Repair and Maintenance On All Types of Commercial Refrigerators 24-HOTJR SERVICE--WA. 0296 New and Used Equipment Suitable for Dairies, Restaurants, Hotels and Markets W. P. STEPHENS LUMBER CO. PHONE 840 540 BALDWIN'S 1944 ICE-COAL-PHONE 1 SOUTHLAND ICE CO. VICTORY HOMES OF MARIETTA, INC. M. LEWIS, Rental Manager HOUSES AND DUPLEX APARTMENTS Rental Office on Victory Drive -- Phone 1166 BT. 3 Cont'd. WWTroiogdhatll Georgia Mrs Thos A Mrs Wylie Ammie Wylie H L Wylie Harvey L Wylie Jennice A Wylie L C Wylie Luther Taney Mary Eliz Mrs ROUTE FOUR Abercrombie L L Abercrombie Lula Adams Felton Adams Oilie L Aenehbacker Cecil W Aenehbacker Kath Aenehbacker Mary L Mrs Aenehbacker Winifred Aikman Ira Aikrnan Jas L Aldridge Mary F Mrs Alexander Bernard Alexander Beulah Mrs Alexander Blond Mrs Alexander Bobby J Alexander C A Alexander C A Mrs Alexander D B Alexander Frances Alexander Hazel Alexander Ida M Alexander J M Alexander Mary Q Alexander Thos D Alexander Thos H Allen Edd Allen Marie Allen Marion Alphabet Ineth Anderson J T Jr Andrews Venie Mrs Arrowood Alvie L Arrowood Alvie L Jr Arrowood Bessie Mrs Austin J C Mrs Baker Frances E Mrs Baker Trenholm Bailey Mattie L Bailey Mary L Bailey Erlene Bailey Amanda Ballard Ruby L Ballew Eliz J Mrs Barrett Chas R Barrett Claude E Barrett Donald G Barrett Earnest Barrett Ed Barrett Florence N Barrett Forest A Barrett Frances L Mrs Barrett J H Barrett J H Mrs Barrett Jimmie L Barrett Raymond L Barrett Vinnie Mrs Barfield A D Barfield Betty Barfield Cora Mrs Barfield Hazel Barnes Bill L Barnes Clide Jr Barnes Essie Mrs Barnes Harold Barnes Henry Barnes Jack Barnes John D Barnes Laura B Barnes Lucy Mrs Barnes Marvin Barnes Narvey R Barnes Olin R Barnes Paul J Mrs Barnes Roscoe B Barnes Sallie Barnwell Earl Barnwell Earl Jr Barnwell Marvine Barnwell Romona Barnswell Rosa Mrs Baswell B E Mrs Baswell Margie Mrs Bates Amos A Bates Amos H Bates Bertha M Bates Donald R Bates Ethel I Bearden Beatrice Bearden Bobby E Bearden Miley G Beasley Flora C Beasley Fred Beasley Harold E Beasley Howard Beasley Irene Beasley Martha F Beasley Mimmie Mrs Beasley Sarah Beasley Tommy Beasley Wm T Beaty Bartow Bell Marian Mrs Bell Wm H Benson A A Benson Nellie B Mrs Beshers B S Bettis Charlie Bettis Clara M Bettis Ether Bettis Hoyt H Hotel STRICTLY MODERN Field WEEKLY RATES 200 Church St. Rates from $1.00 Phone 9116 W. P. STEPHENS LUMBER CO. PHONE 840 Marietta city directory 541 me AMBULANCE MAYES WARD & CO. SERVICE PHONE 549 PHONE 60 HOME OWNED -- HOME OPERATED ND-WAY CLEANERS & LAUNDRY "New Life To Lovely Garments" 513 Page Ave. * ' "3"* RT. 4 Cont'd. Bettis Hugh L Bettis J T C Bettis Jas R Bettis Myrtle Bettis Ruby Bettis Tolley Black Lana O Black Odell Mrs Blair Haney V Blair Haney V Mrs Blair Haney V Jr Bohannon Mildred Mrs Bolton E H Jr Bolton Ernest H Bolton Margt Bolton Patsy L Bolton Una L Mrs Bolton Virginia Bond G S Bond Mildred Bond Ruby Booth Alma H Booth Edith Booth Edna T Mrs Booth Prances Booth G L Booth Harry Booth Jessie H Mrs Bottoms Harold Bottoms Harlan Bottoms Horace Bottoms June Bottoms Laura Mrs Bowlen Mary Mrs Bowman D J Bowman D J Mrs Bowman Daniel J Jr Bowman E P Bowman H V Brackett Adel Mrs Brackett Mary H Brackett O J Brackett Wade Brady Eula Brady Hazel Brady Jimmie L Brady Johnny Brady L M Brady Leon Brady Linda L Brady Richd Bramlett Alton Bramlett Christine Bramlett Don Bramlett G L Bramlett Hugh L Bramlett Inez P Mrs Bramlett Kenneth E Bramlett Lamar Bramlett Lamar Mrs Bramlett Minnie Mrs Bramlett Ray G Bramlett Troy Bramlett Wayne Bray Alice E Bray Annie L Bray John L Bray John T Bray Mary L Bray Wm H Brinkley Chas P Brinkley Claudio Mrs Brinkley P P Brinkley Fred Mrs Brinkley Fred S Brinkley Guy L Brittain W K Broadnaz Clarence Broadnaz John H Broadnaz Leatha Mrs Broadnaz Willie M Brooks A Jackson Brooks Arie E Mrs Brooks Atlas J Brooks Atlas J Mrs Brooks Chas A Brooks Don Prooks Emma Brooks Prank Mrs Brooks Frank Jr Brooks Guy Mrs Brooks Guy E Brookshire H F Brooks Mary J Brooks Ocala Brookshire Ophar Brookshire Randle Brookshire Verna Brooks Sonja L Brooks Tommy A Mrs Brooks W P Sr Brown A L Brown Amanda Brown Andrew Brown Barbara Brown Doris Brown Ethelene Brown Harold Brown H S Brown H S Mrs Brown Jerry Brown Jewell Brown John M Brown Joyce Brown Kath Mrs Brown Kenneth H Brown Leon J Brown Lillie P Brown Lucille Mrs Brown Mariand Brown Myra J Invest At Least 10% In W ar Bonds W. P. STEPHENS LUMBER CO. PHONE 840 542 BALDWIN'S 1944 ICE - COAL - PHONE 1 SOUTHLAND ICE CO. Packing -- Crating -- Storage -- Local & Long Distance Hauling rPnUUAiIlL IFOC.' 215 CHURCH n iw 102 LEMON MARIETTA TRANSFER & SALVAGE CO. CASH FOB ALL SALVAGE PAPER, CLOTH, ETC. BT. 4 Cont'd. Brown Rilla Brown Roland Brown Shirley Brown T R Brown Veolia Mrs Brown Vonnie L Bryan Cliff F Bryan Ella Mrs Bryan Joyce Bryan Mary J Bryan Nellie Mrs Bryant Andrew W Bullard Calvin Mrs Bullard Herbert Burge Ed Burge Ethel Burge Homer Burge Martha Burge Mary Burge Miles Burge Miles Jr Burge Minnie Burge Wm Burroughs G D Burroughs G D Mrs Burroughs Mabel Burroughs Mary Butler Audrey Butler Frances Butler Geo Butler Helon Butler Herbert Butler Lottie Mrs Butler Mary Butler Ollie R Butler Raymond Butler Wm F Butler W P Caldwell E E Caldwell Helon M Calton Deloris E Calton Dorothy Calon Roy E Calton Roye Calton Shirley I Camp J M Camp Marion C Camp Paul A Jr Camp Pauline Mrs Camp Ruth Mrs Cantrell A D Cantrell A D Mrs Cantrell Artis R Cantrell A R Mrs Cantrell Eug Cantrell Guy Cantrell Patsy Cantrell Raymond Cantrell Roy Carlile Ilonzo Carlile Cliff Carlile Clinton Carlile Emmalene Carlile Ford Carlile Ruby E Mrs Carnes Donald Carnes Edna D Mrs Carnes G C Carnes Geo L Carnes I Frances Carnes Ida W Mrs Carnes J D Carnes Martha J Carnes Melba Mrs Carnes Ollie Mrs Carnes Sarah L Carr J S Mrs Carruth Bessie Mrs Carruth C K Carruth H B Carruth Isabel Mrs Carruth Joan Carruth Kenneth C Carson Frank Carson Jesse Carson Louella Mrs Carson Louise Carter Stella Casey Bobby Casey Dorothy V Casey E T Casey E T Mrs Casey E Charlotte Casey Eljz Casey Eug Casey Forrest Casey Hazel Casey Hubert P Casey Loyd C Mrs Masey Millard Casey Norris Casey Ora O Mrs Casey Robt H Casey Vera Mrs Casey W T Casteel Audry Casteel Betty G Casteel Doyle Casteel Era Castle Geo Casteel Georgia M Casteel Gladis Casteel Harold Casteel Howard Casteel Frank Casteel Merrell H Casteel O J Chaffin Bobby R Chaffin Edgar Chaffin Grady L Chaffin Hubert W SEARS, ROEBUCK &C0. Phones 1068-1069 238 ATLANTA W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 543 MAYES WARD & CO ]DIRECTORSL ME 549 KT. 4 Coat'd. Chaffin Jessie E Chaffin Margt Chaffin Njna B Mrs Chaffin Ruth Chaffin Walter Chalker Eunice V Mrs Chalker Herbert L Chalker Lois A Chalker Nolen F Chance Herbert Chance Nervie J Chance RubyChance T B Chance T B Mrs Chance Thos B Chance W E Chandler Addie Mrs Channell Annie M Chandler Betty A Chandler C F Chandler Clara M Channell E G Chandler Fred Channell G W Chandler Lem Channell Ruth Mrs Chandler Stella M Chandler Virginia Mrs Chandler W L Chapman Charlie Chapman Eljz Chapman Etta V Mrs Chapman F A Mrs Chapman Frances Chapman Jas B Chapman Lou E Mrs Chapman Mary I Chapman Mary L Chapman Nelson Chalman Thos L Chastain Alfred D Chastain Alvin D Chastain Annie R Mrs Chastain Billie Chastain C H Chastain Claud H Chastain Gay Chastain Gene Chastajn Howard Chastain Ida B Chastain John Chastain Mary Mrs Chastain Nina L Chastain Roscoe Chastain S T Chastain S T Mrs Chastain Sara E Chastain Thelmon Chastain Walter Chatham A L Chatham Annette Chatham Margt Mrs Chatham O'Leta Chatham Richd Clackum Davjd Clackum Eunice O Mrs Clackum J W Clark Alice Mrs Clark Bud Clark Bunt Clark Clyde Clark Coleman Clark Effie Mrs Clark J M Clark Junior Clark Melvin Clark Meriam Clark Rora Mrs Clark Ruth Clark T W Clark Thos Clay Albert L Clay Annie Clay Bobby Clay Dennis Clay Herbert Clay Mildred Mrs Clay Robt Clay Willis Clayton Cleo Clayton E H Clayton Etta Mrs Clayton Hansell Clement Florie E Mrs Clement H K Clotfelter C T Clotfelter Era N Mrs Cobb Eddie Cobb Douglass Cobb Howard V Cobb Howard V Mrs Coker Beatrice Coker Fannie Coker Ida Mrs Coker W L Colbert R C Col dwell E E Cole Ella Mae Cole Margt Cole Marjorie Cole Ora Cole Eollie W Mrs Collins Carol Collins Johnnie Collins Johnnie Jr Coltrane A J Mrs Coltrane Mae Mrs Cook Charlie J Cook Chas Cook Cliff C Cook David E Moving Packing and Crating Loads Insured CLACKUM'S TRANSFER Sand & Gravel Hauling and Excavating Contractors Flagstone 107 S. Waddell PHONE 781 Night Ph. 79-W W. P. STEPHENS LUMBER CO. PHONE 840 544 BALDWIN'S 1944 ICE - COM - PHONE 1 SOUTHLAND ICE CO. FHEI Lie Distributor -- GULF OIL CORP. Good Gulf "No-Nox" Gasoline--Gulf Pride Motor Oil--Fuel Oil--Greases--Kerosene cun Phone 81, Plant 129-33 Butler St. RT. 4 Confd. Cook Edw Cook Elbert Cook Essie Mrs Cook Georgia Cook H B Cook Harold Cock Harry L Cook J C Cook Jas Cook Jas D Cook John E Cook Laura Mrs Cook Marion A Cook Martha Mrs Cook Marvin A Cook Nell Cook R M Cook Wayne Cook Yvonne Corn Billy Corn Harold A Corn Jesse H Corn Jesse H Mrs Corn Katie Corn Loyd T Corn Wm T Corley Jas T Cox Alice Mrs Cox C M Cox Jim Cox Onnie Mrs Cox R P Cox R P Mrs Cox Robt A Crider A R Crider Chas Crider Larry Crider O R Crjder Willie M Mrs Crook Annie L Mrs Crook Jerry C Crook Roberta Mrs Crook Sami J Crowder Hugh Mrs Crawford Betty J Crawford Estelle Crawford G A Crawford John G Crawford Lillian Crawford Mabell Crawford Mary L Crawford Nancy L Crawford Olie Mrs Crawford Robt G Crawford Robt L Crawford Ruth Mrs Crawford Vinie Mrs Cunningham A H Cunningham A J Cunningham A J Mrs Cunningham Amanda Mrs Cunningham Carolyn Cunningham Fred Cunningham Helon Mrs Cunningham Howard Cunningham J A Cunningham Mae Mrs Cunningiiam Mollie Mrs Cunningham Oma Mrs Cunningham Robt A Cunningham Taft Cunningham W T Daniel Betty J Dan|el E A Daniel Eug Daniel Francis Daniel Jim Daniel Monroe Daniel Sally Mrs Daniel Silas N Daniell Gertrude Mrs Daniell R E Danjell Randolph E Daves Dorothy J Daves Irene Mrs Davis Thos M Davis Clara Mrs Davis Gorvis Davis Paul Davis Paul Jr Davis Sarah Mrs Davis Thos L Davis Tom Davis Tommy Jr Davis Tommy Jr Mrs Davjdson Clyde Davidson Dorothy Davidson Eliz Davidson Frank K Davidson Gladys N Davidson John S Davidson Louise Dean Nellie Dean Pearl P Mrs Dean Roy Dean Thelma Dean W C Deaver Ada Mrs Deaver Ida Mrs Deaver Janie Deaver Lodell Deaver Louise Deaver Marcel Deaver Ora Mrs Deaver Pearl Deaver R M Deaver Ray Deaver T M Deaver W P Decker Gjlbert Decker Mary I Mrs WALTER W. HAZEL FINE TAILORING DRY CLEANING -- EXPERT ALTERATION SERVICE LADIES TAILORING A SPECIALTY 111 Waverly Way Marietta W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 545 AMBULANCE DLBUfelC E/IQ MAYES WARD & CO. service r if USi Marietta's Most Complete Department Store SAUES "The Best - - for Less * RT. 4 Cont'd. Delk Arth Delk Jas E Delk Maggie Mrs Denmon Joe J Denmon Katie Mrs D(ensmore Anthony Densmore Laura Dickerson Eva Mrs Dickerson John W Dinsmore Cliff Dinsmore Elliot Dinsmore Mary Dinsmore Mildred Dinsmore Pomp Dinsmore Queenie Dinsmore Sweetie Dinsmore Turcy Dobbs Bertha Mrs Dobbs Hal Dobbs Rollo D Dorris Arth Dorris Bessie Mrs Dorris Charlie Dorris Ed Dorris Helen Dorris Lucile Dorris Mamie Dorris Nora Dorris William Drusiller Mrs Duncan Betty Duncan Charlie Duncan Dorothy Duncan Ellen Duncan Geneva Mrs Duncan Jean Duncan Laura Mrs Duncan Lula B Mrs Duncan R W Mrs Duncan Silas Duncan Virginia Duncan W G Dunphey Eleanor M Mrs Diincan W I Mrs iDunphey Henry B Jr Dunstan Albert E Dunstan Mary O Mrs Duvall Fay Duvall LaTrelle Duvall Marvin J Duvall Shirley Dyson Betty A Dyson Clarence G Dyson Dean C Dyson Louise Mrs Dyson Marveen Mrs Dyson Minie S Dyson Myrtle L Mrs Dyson T G Mrs Dyson Tulon V Dyson Varnie R Dyson V Randolph Earwood Addie P Earwopd Coline Earwood Corine Mrs Earwood E S Earwood Ennis Earwood Wm F Earwood W E Mrs Edwards J W Edwards Jas I Edwards Lena M Edwards Mamie L Edwards Mittie Mrs Elrod Annie R Elrod Billy Elrod Clara Mrs Elrod Douglass Elrod L S Sr Elrod L S Mrs Elrod Lawson Jr Elrod Ralph Elrod Ralph Jr Elrod Virginia Elrod Willis Emondson M C Evans Betty S Fambrough Donald Fambrough Ella Mrs Fambrough H C Fambrough Odell Farmer Pauline Mrs Farmer W M Rev Felton Chas H Ferrell H G Ferrell H G Mrs Ferrell Ray Ferrell Ruth Finley Carl Finley J M Finley Louise Mrs Fleming Arth Fleming Eug Fleming Sam Fleming Weaver Flynn Laura Mrs Flynn W B Fowler Annie Mrs Fowler C W Fowler Effie Francis Hilda V Franklin John W Franklin Nell C Mrs Frasure Alice Mrs Frasure J P Frasure Katie Lee Frasure Sue Freeman Annie J Freeman Annie L Freeman Cicero Freeman Jas A WiBP WOFFORD OIL CO :Be Sure -- With Pure' ROY McCLE' SKEY, Agent " GAS OIL BUS. PHONE 148 ACCESSORIES RES. PHONE 224 W. P. STEPHENS LUMBER CO. PHONE 840 546 BALDWIN'S 1944 ICE-COAL-PHONE 1 SO UTHLAND ICE CO. RICE FURNITURE CO. WE BUY, SELL AND EXCHANGE NEW AND USED FURNITURE -- EASY TERMS Get Our Prices Before Buying Or Selling 108 Washington Ave. Phone 1571 KT. 4 Cont'd. Freeman Thos A Friddell Bettjr Friddell Cleo Friddell Henry R Furr Ann Furr Ernest Furr Huelon Furr Mary B Mrs Furr Wm R Gaines Corinne E Mrs Gaines Harry E Gaines Nancy R Gaines Neal Gaines Raymond Gaines Sailie V Mrs Gaines Virginia A Gaines Wm P Gann Betty Gann Cath Gann J H Gann Nellie Sue Gann Seob Garmon A C Garmon A C Jr Garmon Hazel Mrs Garmon Mary E Mrs Garmon Mary H Garner Carrie Mrs Garner Chas Garner Claudia Garner Cliff Garner Ed Garner Edith Garner Evelyn Garner Florence Garner Frankie Garner Geo Garner Gordon Garner Tommy Garrett Annie Garrett Carl E Garrett Chas B Garrett Ed Garrett Ernest H Garrett Floyd Garrett Floyd Jr Garrett H H Garrett Jack Garrett Jas Garrett Jas R Garrett John M Garrett Lillian Mrs Garrett Mae Garrett Magdalene Garrett Marjie Garrett Mary Mrs Garrett Maurice Garrett Nancy Mrs Garrett Reid L Garrett Rosa Garrett Wesley D Garrett Win M Gianoly Sidney Mrs Gibson Billie Gibson Claude Gibson Hazel Gibson Howard Gibson Huey I> Gibson Jas Gibson Lillian Gibson Mary L Gibson Nora Mrs Gilbert Ethel Gilbert Frank Gilbert Hattie Mrs Gilbert T J Gillham Billie Gillham Marrie Mrs Gillham Wm P Gillham Wm P Jr Gilmer Annie Gilmer Betty J Gilmer Eva Mrs Gilmer Jack Goggins Annie M Goggins B G Goggins B G Mrs Goggins Dorothy Goggins Frank Goggins Glenn E Goggins Glenn L Goggins Lula Mrs Goggins Mae Mrs Goggins Patsy J Goggins Shirley Garman A C Garman Vivian Mrs Goss C C Goss Dorothy S Goss Frank C Goss Jas M Goss Richd V Goss Ruby E Gourley Alma Gourley Jas Gourley Oline Gourley Paul Gourley Richd Gourley Theodore GLoowwddeerr Charlie Eula E Mrs Gowder S M Green Carrie Mrs Greer Clint V Green Ed Mrs Green Geo C Green Joe Green Leila Mrs Green Green OMaEr-yMLrsMrs Greer O T * MARIETTA LUMBER CO. * "Building Materials A Plant for Every Purpose That Merit Good Will" Lumber--Bldg. Materials ^ Phone 357 Atlanta Road W. P. STEPHENS LUMBER CO. PHONE 840 marietta city directory 547 MAYES WARD & CO. DIRECTORS PHONE 549 F. P. I "101" LINDLEY Consignees--THE TEXAS COMPANY "Fire Chief" and "Sky Chief" Gasoline Texaco and Havoline Oils "Marfak" Lubricants TEXACO ROOFING TELEPHONE 688 108 GLOVER ST. RT. 4 Cont'd. Green Ola Green Pauline Mrs Green Sallie Mrs Gresham Will Griffin Coy L Griffin Geneva Griffin Lucille Griffin Mae Griffin Mamie Griffin Mary Griffjn Molinda Mrs Griffin Roy Lee Grogan Edith Grogan Ernest W Grogan Harvey Grogan Herman Grogan Inez Grogan Marie Grogan Missouri C Mrs Grogan Nelle Grogan Ruth Grogan Wm A Grogan W H Guinn Etta C Guinn Frank A Guinn Frank A Jr Guinn Helen I Guinn Hubert G Gullatt Edna Gullatt Jas C Gullatt John E Gullatt John T Rev Haas Chas Hague H E Hague H E Hambljn F V Hamblin Flora M Mrs Hamblin J M Hamblin Wayne Hamilton Annie B Mrs Hamilton Aubrey D Hamilton Betty Hamilton Bobby C Hamilton Bisie Mrs Hamilton C A Hamilton H F Hamilton Herbert C Hamilton Martha Hamilton W M Hamilton W M Mrs Hammond Geo Hammond Ida Haney Betty J Haney Faye Haney Jim Haney Lois Haney Louise Haney Mae Haney Ruth Haney Thos Hardage Durham Jr Hardage Evie J Mrs Hardage Harold Hardage Harold C Hardage Kay Hardage L E Hardage Lucius Sr Hardage Marcus Hardage Margt Mrs Hardage Mary J Hardage Vera Mrs Hardy Glenn Hardy Opal Mrs Harp John C Jr Mrs Harris Buddy Harris Ella Mrs Harris Floy Mrs Harris Gareth S Harris Geo E Harris Hazel J Mrs Harris Hugh L Mrs Harrison Jos S Harris Mary L Harris Robt Harrison Virginia M Mrs Hart Chas M Jr Hart Chas M Jr Mrs Hart Elaine Hart Jackey Hatfield A C Mrs Hatfield W L Hayes Hattie Heard Alma Head Bertha Head Clara B Head Emma Head Henry Head Henry Jr Head Levi Head Lilie M Head Louise Head Lncy Head Melby Head Robt Head Ruth Head Thos Hedges C E Hedges Eliz Hedges Emma Hembree Eunice Henson Blanche L Henson Earl Henson Eug J Henson G B Henson June D Henson K F Henson Kabus J Henson Karen D Henson Omie Mrs Hice Eug Hice Geraldine HARVEY H. HUNT COMPANY Auditors Accountants Tax Consultants Atlanta Office--Phone WAlnut 4484 1110 First National Bank Bldg. Rome, Ga., Office--Phone 7334 Griffin Bldg. W. P. STEPHENS LUMBER CO. PHONE 840 548 BALDWIN'S 1941 ICE - COM - PHONE 1 SOUTHLAND ICE CO. LOANS ON HOMES--Saving's Insured up to $5000 MARIETTA FEDERAL SAVINGS & LOAN TELEPHONE 44 RT. 4 Cont'd. Hice J T Hioe Luther Hice Thos W Hicks Ada E Mrs Hicks Agnes C Mrs Hicks Bobby N Hicks Cash C Hicks J Newt Hicks J N Jr Hicks John A Hicks John A Jr Hicks Johnny E Hicks Louether Mrs Hicks Maggie L Hicks Martha S Hicks Mary N Hicks Sara Caroline Hitt Annie B Hitt Emma Mrs Hitt Joean Hitt Margurite Mrs Hitt R R Hitt W C Hilderbrand Claudia Hilderbrand Eva Mae Hilderbrand Horace Hilderbrand Jessie L Hilderbrand M S Hilderbrand Mary Mrs Hilderbrand Oletha Mrs Hilderbrand Ruby Mrs Hilderbrand Sylvester Hilderbrand W M Mrs Hill Harold Hill Paul Hill Stella Mrs Hill W A Hines Bat Hines Jenny ASSOCIATION 112 ATLANTA ST. Hines Moses Hines Ruth Holbrook Ann Holbrook Bertie L Mrs Holbrook Betty J Holbrook Chas E Holbrook Cora Mrs Holbrook Dorothy Mrs Holbrook Eddie R Holbrook Edgar W Holbrook Faye Holbrook Guy Holbrook Herschel H Holbrook Norris R Holbrook Eug T Holcomb Dorothy M Mrs Holden Jas G Holden Joyce A Holden Mary L Mrs Hopkins Beulah M Mrs Hopkins J F Howard G H Howard J W Howard Peggy Howard W S Mrs Howell E W Huiel Bessie E Huiel Howard L Huiel Lillian Mrs Huiell Lillie M Huiel Lily M Huiel Mary F Huiel Mittie Mrs Huiel Paul E Huiel R L Hubbard Mildred Hurst Earl Hurst Ernest Hurst Evelyn Hurst J C Hurst John G Hurst John G Jr Hurst Myrtic Mrs Hurst Rosa Mrs Hurst Sarah Ingram Eliz Mrs Ingram J L Irvin A A Jr Irvin Alexander A Irvin Chas E Irwin Daisy Mrs Irvin Everett E Irvin Jack Trvin Lucy M Mrs Irvin Mary A Irvin Mary M Mrs Irwin Mattie E Irwin Milton H Jr Irwin Rosie L Irwin Violet Jackson Ernest Jackson Eliz Jackson Jerry Jackson Joe L Jackson Lillie B Jackson Parazee Jackson Ruth Jackson Sweetie M Tacobs E C Jacobs W T Jarrett Dolly F Mrs Jarrett Harry H Jarrett John N Jarrett Mary Mrs Jarmon Susie P Mrs Jenkins Inez Mrs Jennings Willie Mrs Jett Kenney R Jett Louise D Mrs Jett Nathan J Johnson Barbara A Johnson Chas L Meinert MARIETTA 1 PHONE 35 florist GEORGIA 1 310 ROSWELL ST. W. P. STEPHENS LUMBER CO. PHONE 840 MARIETTA CITY DIRECTORY 549 AMBULANCE DUANE1 EJIQ MAYES WARD & CO. SERVICE rfflUSlE "The Ring Leaders Since 1900" B