:$V Iji ' n imkfiftmi i i.; $ik i s m h W' fk : -A i'A o s;i % jify <, EORGl AJ i-V Em| , ;: ;'JJJmf;. !WS< III' I tlnkuH tvio nSfa.*fflS & Li^ . ; 1 .11;. ft, VI Mi S .'0,.*:* 13`%M :ish.Ui1 '--V! M .i a^ECFORV' COMPA N, >kc. ! i: :;i;::; i i, ; *> ; lllj ;h iv i;|! r&i rMti,<.apili! i\'v ' ' f l < ! tf'v : ;iT, mm tip- i? him BALDWIN'S AND TELEGRAPH'S MACON GEORGIA VOLUME I ARCD No. 8 Containing- an alphabetical directory of all residents over sixteen, with detailed information concerning each; a numerical householders' directory and telephone street guide, a classified business directory with special listings for nationally advertised brands; a numerical telephone directory; a rural route directory and a miscellaneous directory containing interesting and useful information concern'ng local, state and national governments with vital statistics including residents of Bellevue, Cherokee Heights, Crumps Park, East Macon, Ingleside, Log Cabin Heights, Napier Heights, North Highlands, Payne Mills, Sou'h Macon, Stinsonville, Unionville, Vineville, Western Heights. AND A COMPLETE BUYERS' GUIDE, CIVIC SECTION AND PROFESSIONAL BLUE BOOK Issued with a special Householders' Supplement for presentation to a selected group of private homes, Chambers of Commerce, Boards of Trade, Merchants Associations, Selling Agents, Buyers, Government officials and newspapers throughout the United States This directory remains the property of Baldwin Directory Company and is leased to subscriber for a period of one year or until the next edition of the directory is published. Directory must be returned in good condition to publisher at the expiration of lease. Published Under the Personal Supervision of HEBEE PAGE of the Baldwin Directory Company Incorporated AND The Macon Telegraph --- Macon Evening News Home Office 125 MEETING STREET, CHARLESTON, SOUTH CAROLINA COPYRIGHT 1935 BY BALDWIN DIRECTORY CO., INC. INDEPENDENT AND PROGRESSIVE wBedaolrwdldwi'tsihnlaaDnrgyieresnctattioinordyneapCleonamdsseponacntiyap,tuiobInlni,cs.hc,eorpmuobfbilncisaithtyieordnirooefrcttdohiririseecsc,toiitrsyyind"itrnreoucstwto"ar.yy cIaotnsndnpeotchltie-cies are laid down with a view to serving the individual directory subscriber and the general public. It is a progressive company, constantly on the alert to improve its service. The ABC-D type of city directory was originated by the Baldwin Directory Company, Inc. While many publishers have been content to rest on their lomaruegreaetnlsmiz, aoitdsiseournninhsgaesltlhilneegdsaatmnhdee cwtyreep,dyeittoocfotdnhidereitcpiotroonrdsy.ucutsioedn tohfiratymyoedaerrsn acgioty, tdhiereBctaolrdywitno Nbdfouierrsewitcnhstepoesarsypheicsgroeshnr,evcsiecctrhenai.sdmeaIabrnleesrtshiinneovfpiftuuecbtdoulmircteom,sweearrsrcvieiitnc,eetm.fhoeerrpcpahasarttn,itcBsualaaldsrsswoiccnioandticioreenrcnstionargniedtshwiisnidlltiyvspitdeaunoadfl RBaolbdewrtinMDoirrteocntoBryalCdwo.i, nI,ncV. ice-President, 1935 POPULATION FOR GREATER MACON INCLUDING ADJACENT TERRITORY 72,381 This poptuelrartiitoonrysceocuvreereddbbyyaan Hacotuusael-toco-Hunotusoef Cpearnsvoansss ruensiddeirng in the Baldwin's ABCD plan. General Index Abbreviations Abbreviations for Communities Advertiser's Index Advertising Department Agriculture--Bibb County Alphabetical Directory Bibb County Board of Education Bibb County Government Bibb County History Blue Book Business Directory Buyers' Guide Cabinet (United States) Churches City Government Civic Section Classified Business Directory County Government Criss-Cross Telephone Directory Explanation Federal Government Federal Judges Georgia House of Representatives Georgia State Government Georgia State Senate Georgia Supreme Court Heads of Nation Honor Roll House of Representatives (Georgia) House of Representatives (U. S.) Householder's Directory Index to Display Space Page 108 107 4 43 24 113 83 82 9 101 617 43-100 34 51-68 81 69-83 G17 82 * 509 109 33-38 34 40 39 39 39 33 4 and 5 *-4 35 509 4 and 5 Page Introduction * 6 and 7 Legal Blue Book 101 Macon--"In the Heart of Georgia" 9-37 Macon City Government 81 Macon Population 2 Macon Rural Routes 721 Medical Blue Book 104 Miscellaneous Directory 33 Nationally Advertised Brands !_ dl7 Numerical Telephone Directory G87 Officials--Macon 81 Officials--Georgia 39-42 Officials--United States 35-38 Population of Macon 2. Preface 9 Resident Directory ill Rural Routes--Macon 721 Senate (Georgia) 39 Senate (United States) 34 State Government 39 Street Guide 509 Street Telephone Guide 509 Supreme Court (Georgia) 39 Supreme Court (United States) 34 Telephone Guide (Numerically) 687 Telephone Guide (By Streets) 509 Title Page i Trade Marked Merchandise Brands C17 United States Cabinet 34 United States House of Representatives 35 United States Senate 34 United States Supreme Court 34 Illustrations John L. Morris Pag9e Harry Stillwell Edwards, Poet 10 Ancient Ceremonial Indian Council House__10 Washington Memorial Library 11 Sidney Lanier 12 Tree under which Lanier wrote poems 13 Macon's City Hall 14 Royal Arch Industrial Building 15 Macon from the Air 15 Georgia Masonic Home 15 Apartment House lg Poplar Street Wesleyan College Bird's Eye View of Wesleyan Campus 18 View in Baconsfield Park 19 Women's Club House Baconsfield Park 19 Road Leading into Macon 20 Bibb County Court House I_21 City Auditorium __ __ 22 Macon Baseball Park Entrance Pag2e3 Golfing at Idle Tennis Court Hour Country Club____ 23 24 Centennial Stadium 24 Macon Hospital 23 Hopewell Sanitarium 25 Where Georgia Peaches are packed 23 Clothing Plant Adams Mfg Company 26 City Manufacturing Plant 26 Herbert Smart, Mayor of Macon 27 P. T. Anderson, Editor 20 Grandstand, Williams Field 29 Masonic Home, Home Economies, Sewing and Living Rooms 30 Macon Educational Institution . 31 Entrance to Tatnall Square 32 President Franklin Delane Roosevelt 33 Walter F. George, U. S. Senator 33 Honor Roll --and-- Index to Display Space Page Acme Welding Co. Akerman, Chas. -- 101 Arlington Hotel 88 Atkinson, M. C. 101 Atlantic Ice & Coal Co. Atlantic Service Station 99 Baldwin Directory Co. 84 and 100 Auto-Banx Top Side Lines Hallie B. Bell 101 Bell's Pharmacy 99 Bibb Brokerage Corp. Bibb County Bibb Investment Co. Bibb Mattress Co. Board of Water Commissioners. Bon Art Studio 95 Boy Scouts of America. Brady's Place Broadway Trading Co. Bruce Terminix Co. _ Card BD Buck Ice & Coal Co. Builders Lumber Co. Top Lines Burghard-Connally, Front Cover Supp, Cards BD and 86 J. W. Burke Co., Cards BD, top lines, bottom side lines and 94 and 95 Calhoun & Thomas Carlisle & Bootle 101 Central City College 78 Central City Funeral Home Central Hotel 38 Chandler & Strickland Co., Back Cover Supp, and 39 Chapman's Garage, Front Cover Supp, Cards BD and 45 Chapman's Pharmacy Chichester's Tatnal Square 99 W. B. Childs, D. D. S., 104 Citizens and Southern Nat. Bank, Front Cover Supp and 46 City Bank & Trust Co Card BD and 48 City of Macon 81 Clark Memorials, Inc. R. L. Clarke Co. 88 Sol. C. Clemons Coggin & Mann 95 College Beauty Salon Cork & Cork 101 Crescent Laundry 91 Roy W. Crockett The Dannenberg Co. 85 Day's Doctors Business Bureau Page J. H. DuBose & Son Dun & Bradstreet, Inc. Dunlap Roofing Co Back Cover Supp Economy Shoe Repairs, French Dry H. W. Elkins Cleaners, Card BD Empire-Dixie Coal Co., Inside Front Cover Supp Empire Furniture Co. Bottom Lines Dr. A. England left Bottom Lines and 50 Eves Electric Co. Card BD and 86 Fairyland Dairy C. W. Farmer right Top Side Lines Feagin & Feagin 102 First Baptist Church 51 First National Bank & Trust Co., Back Cover Supp, Cards BD and 47 First Presbyterian Church 67 Flynn Printing Co., left and right Top Fried's Garage Lines Ga. Loan & Trust Co. Ga. Roofing & Supply Co., right Top Lines and 98 L. Thos. Pat Gillen 102 Gill Bakery A. E. Gilmore, Jr. W. D. Griffith Son Dr. Thos. H. Hall Harris Russell, Popper Weaver 102 Edward B. Harrold Co. A. S. Hatcher Co. Left Top Lines Hilbun's Hatcher & McCrary, Dr. J. C. Holley Inc.; Bottom Lines 105 A. T. Holt Co., Inc., right Top Lines and 97 Holt & Hanberry 95 Hotel Dempsey Hotel Lanier 89 Hutchings Funeral Home 86 Independent Funeral Home Independent Laundry 91 Jackmann Battery Co. Jackson & Jackson 102 Emmett L. Jackson Jacobs Pharmacy Jarrett Paint & Glass Co. Johnson Bros. left Top Lines and 88 Jones & Coney Cards BD and 96 Jones, Johnston, Russell, Sparks : 103 Dr. Frank F. Jones 106 Dr. A. P. Kemp 106 HONOR ROLL AND INDEX TO DISPLAY SPACE 5 Page C. D. Kenny Co. 84 Kernagham & Goodman, InC. 90 Kinnett-Odum Co. Kuhn Manufacturing Card BD and 92 Kyles Drug Store Leaptrot's Dry Cleaners Co Card BD Letter Shop, Inc., Top Lines, Card BD and 44 Arthur Lewis 103 Life & Casualty Ins. Co. Lowe Electric Co. McClure Office Equipment Co., left Bottom Lines, Cards BD and 94 J. W. McCook Lumber Co. R. A. McCord Motor Co. McKenney & Adams McNair Lumber & Supply Co., Cards BD, left Top Lines, line bottom every right page 49 Macon Auto Exchange Macon Cabinet Works, Inc.__Card BD and 50 Macon Coca-Cola Bottling Works, left Top Line, right Top Lines and 48 Macon Credit Bureau Macon Evening News & The Macon Tele- graph 93 Macon Federal Savings and Loan, Front Cover Supp, right side Top Lines Macon Gas Co. Macon Memorial Park, Inc. Macon Paper Co., Inc. Macon Shoe Co. Macon Trading & Investment Co., right Top Lines, Front Cover Supp and 90 Macon Transfer Co., left Top Lines, Cards BD Macon Typewriter & Office Supply Co. Martin, Martin & Snow 103 Masonic Home of Georgia 30 R. H. Matthews, Inc. 90 Melton Grocery Co. Meaders Mattress Co. Mercer University 79 Merriman School 49 B. F. Merritt Coal Co. Metro Studio Middle Georgia Lumber Co. Milady Cleaners Miller Brothers Card BD Card BD Miller & Lowrey 103 Millirons Plumbing & Heating Co., Card BD Monk's Garage Morgan & Morgan Ins. Agency, Cards BD and 89 Muecke & Sons Co., left Top Lines and 50 Mulberry Methodist Church Murphey, Taylor & Ellis, Front Cover Supp and 97 Murray Printing Co. 98 National Life & Accident Ins. Co. J. N. Neel Co. New York Life Ins. Co. Nehi Bottling Co. 48 Nottingham & Nottingham, Cards BD and 103 Oglethorpe Private Infirmary G. E. Paine Cards BD Palm Purchasing Co., Inc. Packer Adv. Corp. Parcel Delivery Co. Park & Strozier --__-- 104 Personal Finance Co. Pindar & Custer 104 Postal Telegraph-Cable Co. Ernest Redd, Jr. Dr. E. Roy Respess 105 Richardson Engraving Co. Riverside Cemetery Riverside Ice & Coal Co. Rivoli Riding Club 98 Frank Roberts 45 The Rotary Club 76 Ryals, Anderson & Anderson 104 St. Joseph Catholic Church 56 Salvation Army 77 Schall Paint Co., Front Cover Supp, left Top Lines, Cards BD and 94 Dr. M. R. Schuster 105 Sears-Roebuck Co. right Side Lines Sherwood Lumber Co. 92 Herbert Smart Clothing Co. Smith & Smith 104 Smith & Watson 96 Snow's Laundry & Dry Cleaners, Cards BD and 92 Steve M. Solomon, Jr. 45 Southern Bell Tel & Tel Co. Southern Printing & Publishing Co. 44 B. H. Spurlick 106 Sterchi Bros. Stores, Inc., lines top each right page, Front Cover Supp, Cards BD Bob Stevens Service Station Strong Shoe Store and 87 Sunshine Creamery Card BD T & T Packing Co. 94 Tatnal Square Dry Cleaners 99 Tatnal Square Service Station 99 Taylor Iron Works & Supply Co. Taylor Transfer Co., right Top Lines and 100 The Texas Co. The Reliable Outfitters R. S. Thorpe & Sons Tomlinson Paper Box Co., Top Lines and 49 Claude Trawick Coal Co., left Top Lines Reginald Trice Agt. Union Dry Goods Co. United Purchasing Co., Inc. Vanity Beauty Shop Cliff Walker Washburn Storage Co., Inc. Webb Coal Co. and 84 48 92 Cards BD Wesleyan College James White Williams Jewelry Co. Luther Williams & Sons Willingham Sash & Door Co., 99 Cards BD left Bottom Lines J. W. Wilson Electric Repair Shop, W. F. Wippler left Bottom Lines Yates Motor Co.,, lines bottom each left George F. Yetter page Card BD * INTRODUCTION Baldwin Directory Company, Inc., publisher of your city directory, takes pleasure in presenting the 1935 edition to the general public. A large force of trained enumerators and solicitors worked diligently in the preparation of this volume and we are confident that the result is an authentic and useful city directory. ?/ We have faith in the continued growth of your city and we believe that our directory will take its place as one of the vital instruments for the advancement of the community. Subsequent editions will be issued promptly and regularly. This volume is an example of the ABCD type of city directory as originated and developed by the Baldwin Directory Company, Inc. In the modern business world with its greatly changed sales and credit systems, the old type of directory has become completely obsolete. In adapting the directory to modern conditions the Baldwin organization is the pioneer. The excellent city directory which your city now has is the result of the progressive spirit of this company and its accurate interpretation of modern business requirements. SEVEN DIVISIONS OF THE BOOK The principal parts of the Baldwin directory are as follows: 4D 1. The Miscellaneous Directory contains a great deal of useful information concerning the national, state and local governments. In it are listed the names of members of congress and the stare legislature, city and county officials. 2. The Buyers' Guide, Civic Section and Professional Blue Book is made up of the advertisements of the leading business firms of the city, announcements of churches, clubs, lodges, associations and schools, and professional cards of public-spirited lawyers, physicians and dentists. The display spaces have been carefully grouped and indexed under headings which are descriptive of the business engaged in by each firm. The Buyers' Guide, when properly arranged and distributed, is of tremendous value in the building of business in the community. X INTRODUCTION 7 3. The Resident Directory contains most of the data concerning the individual. The wife's name is given in parentheses, and the number of dependents under 16 is shown as well as the ownership of homes. This is followed by position, place of employment and home address. 4. The Householders' Directory and Telephone Street Guide contains a complete directory of streets and avenues, properly located, gives the names of all householders arranged as they come upon the streets and avenues, indicates ownership of property, and gives the telephone number ?/ at each house. 5. The Business Directory and List of Nationally Advertised Brands contains the names of all business firms, professional people and non-profit organizations, properly classified. In this division are also listed the names of nationally advertised brands of merchandise, with the name of the local agents and distributors. 6. The Numerical Telephone Directory contains telephone numbers arranged in numerical sequence. SPECIAL A B C D FEATURES The following valuable information which appears in the ABCD type of directory is not to be found in the old-style city directory. Number of dependents under 16; Designation of home ownership; Telephone Numbers on Street Guide; Numerical Telephone Directory; Nationally Advertised Brands. In addition to these valuable features, the ABCD type of directory is more conservatively styled, printed on better paper and more beautifully bound arranged for more convenient use and contains a much more complete civic section. Directory stands are maintained in the business district for the use of the general public. THE HOUSEHOLDERS' SUPPLEMENT After including every conceivable feature which would tend to make the directory as useful and attractive as possible, the originators of the ABCD type of directory made one more bold stroke -- they established a guaranteed home circulation for all advertising matter by issuing the Householders' Supplement and delivering it to the homes of the community. Every advertisement which appears in a Baldwin directory also appears in the Householders' Supplement, making the Baldwin Directory "America's greatest dollar-for-dollar advertising medium" today. Baldwin Directory Co., Inc. X HOW MANY IN YOUR FAMILY? ALL WILL ENJOY READING THE MACON TELEGRAPH AND MACON EVENING NEWS -- THEY ARE FAMILY NEWSPAPERS. NEWS OF THE WORLD--BUSINESS, POLITICAL AND FINANCIAL FOR DAD NEWS OF FASHIONS, SOCIETY AND STORE NEWS FOR MOTHER . . . SPORTS AND SERIAL STORIES, TOO, FOR OLDER SONS AND DAUGHTERS. SPECIAL FEATURES FOR THE YOUNGSTERS, WITH DAILY COMIC STRIPS TO DELIGHT BOTH YOUNG AND OLD . . . AND 16 PAGES COLORED COMICS EVERY SUNDAY . . . YES, WE BELIEVE THAT YOU WILL AGREE ... Every Member of the Family Will Enjoy The Telegraph and Evening News They Are Truly Family NEWSpapers Macon Evening --AND-- News The Macon Telegraph Telephone 6500 MACON "IN THE HEART OF GEORGIA" BY JOHSNecYre.taMryORRIS Macon Chamber of Commerce Macon is located six miles from the On the heights of these lowlands still geographical center of the State of Geor- remain the conspicuous and very remark- gia on the Ocmulgee River and the fall able remains of the power and grandeur line--that point where the foothills of of the ancients of this part of America. the Piedmont merge into the Coastal These are known as Indian Mounds, the Plain. The city occupies remnants of a capital a group of hills overlook- town and settlement of ing the river. The eleva- vast artificial hills and tion ranges from 312 to terraces. It is not known 515 feet. how many races inhabited The city is situated in this mound city nor when Bibb County, and has a they came nor why nor population of 64,045. The how they departed. In population of Bibb County December of 1933 the is 77,042. Macon serves Smithsonian Institution, a large trade territory under the joint supervis- composed of much of Mid- ion of the Society of Geor- dle and South Georgia. In gia Archaeology, secured this territory are between CWA grants of money and 900,000 and 1,000,000 people. John JL. Morris sent an expert to Macon for careful archaeological Macon is served by five railway lines exploration. The mounds extend for and is the converging point for three more than twenty miles down the river main North and South highways. Pas- from Macon--village sites surround each senger buses and motor truck lines, to- area. The excavation of the Indian gether with two railway express con- Mounds has attracted widespread inter- cerns and daily air mail to Miami-, Chi- est. A vast number of relics of great cago, New York and intervening points, historical interest have been taken from operate from Macon. the mounds. Too, the discovery of a The largest overall plant in the South Council Chamber used by the Indians is located in Macon, which city boasts the has been characterized as one of the most largest green houses in Dixie. important archaeological discoveries in History the United States. The mounds are open Macon's history dates back to 1540, to inspection. when DeSoto crossed the Ocmulgee Riv- Shortly after 1800 the Government er at this point. It was here that the realized the importance of this point and first cannon was fired on American soil, and the first Christian baptism occurred, one of the priests in the Spaniard's party baptising a dying Indian in the Ocmulgee River. established Fort Benjamin Hawkins on the East side of the River. Fame of the fertile lands here spread and the trek of the pioneers began. Settlers from North Carolina were the first to arrive. 10 MACON In 1823 the settlement was in- was built here in 1851 under corporated by the Legislature an appropriation of $80,000 and was named by the North by the Legislature. During Carolinians in honor of Na- the War Between the States, thaniel Macon, then a promin- the building was used as a ent statesman of North Caro- Confederate Hospital and the lina. Macon soon became an institution was moved to Fort important point on the stage Valley, Georgia, being re-es- coach line from New York to tablished here in 1865. Also New Orleans. The first steam- during the War Between the boat came up the river in 1827 States the Confederate Gov- and from that time on Macon ernment established an arsen- became the cotton concentra- al in Macon. During Sher- tion point for Middle Georgia, man's March to the Sea, the the bags, later bales, of cotton being carried down the river Harry StilTlwoeeltl Edwards capital of Georgia, then located in Milledgeville, and now to the sea. in Atlanta, was temporarily moved to In 1826 Macon had eight hundred peo- Macon. During the World War, Camp ple, thirty-two stores and was receiving Wheeler, named in honor of General Joe cotton from sixteen counties. By 1831 Wheeler, hero of the War Between the there were two hundred homes. In 1835, States, was established in Macon. the State Legislature passed a bill making possible the building of the first rail- Educational Facilities Macon and Bibb County schools are road in Georgia and in 1838 the first operated under a politics-free Board of train ran between Macon and Forsyth, Education. The system is used as a mod- twenty-five miles away. el throughout the State. In the city and Georgia's first great political conven- county are forty-eight modern grammar tion was held in Macon in 1840 for the schools and three well-planned high purpose of ratifying Harrison for Presi- school plants. Free bus service is main- dent and Tyler for Vice-President. Four- tained for those children in the county teen thousand people attended this con- who live too far from the educational vention. institutions. Separate high schools are The Georgia Academy for the Blind provided for girls and boys. There are Ancient Ceremonial or Council House of the Protomuskhogean Indians "IN THE HEART OF GEORGIA" 11 Main Entrance to Washington Memorial Library 405 teachers employed in the system, with 17,154 students enrolled. School property is valued at $2,469,185.46. Macon is the location of the oldest chartered college in the world for women--Wesleyan College, chartered in 1836. The college hds among her souvenirs of the past a bit of old parchment laced with faded blue ribbon, so highly prized that it is kept in one of the fireproof vaults on the campus, while a photograph of it is shown proudly to visitors. It is the first diploma ever granted to a woman by a college chartered for the higher education of women. The diploma was granted to Miss Catharine E. Brewer by Wesleyan College (then known as the Georgia Female College) in 1840. She was one of a class of eleven young ladies, the first in alphabetical order. She later became Mrs. Benson, mother of the late Admiral William S. Benson, ranking admiral in the World War. A beautiful copy of Raphael's "Madonna of the Chair" hangs in the college parlor, the gift of Admiral Benson in memory of his mother. The birth of the new college was at- 12 MACON Sidney Lanier tended by the most colorful events, a storm of prejudice from narrow-minded people of the day, an Indian uprising, the departure of the militia for war with Mexico, a financial panic when cotton dropped from 16 cents to 4 cents a pound. The generally accepted opinion in the days before Wesleyan was founded was that "all a young lady needed to know was how to weave clothes for her family or to paint a daisy in water colors," that "females could never muster studies long familiar to males," and that it was "unwomanly" for a girl to be educated beyond the ability to read the New Testament. Against such sentiment far-sighted men of the day fought. Duncan G. Campbell, a young lawyer, introduced a bill in the Legislature as early as 1825 for establishing a college for women, but it was defeated in the Senate. Again in 1836, the subject was debated, and in December of that year, Alexander H. Stephens, then a young attorney, with fiery eloquence, wrested the charter from the State Legislature. He is said to have declared, at the close of his career as a statesman, that he considered his achievement in behalf of woman's education in Georgia, the most worthwhile thing he had done. The thirteen-year-old city of Macon raised $20,000 at a public meeting to begin the building, and surrendered the scheme to the guardianship of the Georgia Annual Conference of the Methodist Church, who accepted the offer, appointed trustees, and sent out an agent to solicit subscriptions. George Foster "IN THE HEART OF GEORGIA" 13 Pierce, later a Bishop of the Methodist Church, was the first president of the college, a man of sound business sense, great spiritual power and vision, as well as an excellent writer. "Georgia Illustrated", a musty, yellowpaged volume of Georgia sketches, recently added to Wesleyan's library by James H. Porter, trustee, gives a description of the first building, written by Bishop Pierce: "The college building is located on a commanding eminence, midway between the city of Macon and the village of Vineville. The city is spread out on the plain below; the surrounding hills are crowned with private mansions of the most tasteful architecture On the western side is Vineville with its quiet dwellings and the majestic pine forest nearby; on the north the ruins of old Fort Hawkins. Blockhouses and the relics of ancient fortifications are remaining, to connect its present peaceful habitations with the stir and clangor of martial troops and deadly strife. "The college edifice is an imposing structure, one hundred and sixty feet long and sixty feet wide, rising four stories high in the center, and crowned with a cupola. It has wings three stories high, surrounded with a parapet. The front view is relieved from monotony by a recess of twelve feet over which a roof projects, supported by four massive pillars. There are 56 rooms in the building. A portion of the basement is occupied by the Steward's family and by some other officers of the Institution; the remainder appropriated as recitation rooms. The chapel is on the second floor. It is forty feet wide, extending in length across the whole breadth of the building. In the dormitories are spacious rooms, generally 18 feet square, with large win- dows and high ceilings. The plan is to put four young ladies in a room, with the furniture provided by the occupants. "The yard immediately around the col- lege has been graded to a level, extend- ing over a lot of four acres. The whole Tree Under Which Many of Sidney Lanier's Poems Were Written 14 MACON enclosure is well adapted for tasteful ornament, and affords the young ladies ample space for exercise and recreation." The War Between the States followed all too soon after the college was established. Wesleyan girls of the '60's remember it vividly, though they did not see the worst, of course. One of them, a member of the class of 1867, wrote to the college about it: "In 1863 the rooming section of the college was full to capacity, in some instances five occupying one room Some of the girls were refugees To keep the college going, several refined and cultured families had room and board in the college. Among them were the father and sister of our own Georgia poet, Sidney Lanier. On occasional visits of Lanier to them, the girls would gather in groups to hear the sweet music of the flute of which he was master. Mr. Day and his daughter, Miss Mary, whom Lanier married, also boarded there. "The number of pupils decreased, and in 1867 only five of the large class which began its career in 1863 graduated. During the war, families refugeed from their homes; churches, schools and colleges were deserted, some left in destruction's wake. Wesleyan held her own, President Bonnell standing firmly at the helm and successfully leading her through the conflict." In 1861, a surprisingly short time after the War between the North and the South, a northern man, George I. Seney, of Brooklyn, N. Y., gave to Wesleyan her first large gift, $125,000, to be used for enlargement and endowment. "If my friends should ask," said Mr. Seney, "Why I do not give this money to my own people, say to them: they are my people; we are one people." *r m* Macon's Beautiful City Hall "IN THE HEART OF GEORGIA tjy Itoyal Arch Industrial Building Macon From the Air Georgia Masonic Home 16 MACON Until 1927, when Mr. B. N. Duke of first state to provide for the higher edu- North Carolina gave an equal amount, cation of women. this was the largest gift Wesleyan had Mercer University, a Baptist Institu- ever received. tion for men, celebrated its Centennial A few years ago the friends of the col- in 1933. Mercer's law school has been lege saw that the old buildings and cam- given an "A" rating by the American pus were too small for the students who Bar Association. In addition to offering thronged the gates. The "majestic for- courses in all university subjects, Mer- est" described by Bishop Pierce, had long cer has a theological seminary. Mount since given place to houses around and de Sales Academy, a Catholic prepara- beyond the "village of Vineville", and the tory school for girls, together with a four-acre yard around the college no long- Catholic parochial school for boys, are er "afforded the young ladies ample room located in Macon. The Georgia Acad- for recreation and exercise". It was de- emy for the Blind is also located here. cided, therefore, to build the new Wesley- Macon has three business colleges. Here an on a campus of 170 acres at Rivoli, also are two good colleges for colored in the immediate suburbs of Macon. people--Central City College and Beda In place of the one building 160 feet Etta College. long and 60 feet wide, there are now City Planning twelve modern and well-equipped build- Macon's founders showed unusual ings, finished in the Georgian style of foresight in laying out the city's plan. architecture. The prototype of the din- All of its downtown streets are excep- ing hall is found in Washington's home tionally wide, reducing traffic problems at Mount Vern- to the minimum. on, that of the In the down- library in The t o w n section, Hermitage, the parks, green the historical o 1 d year 'round, oc- home built upon cupy the center the Savannah of these streets. River in 1830. In all five hun- Wesleyan holds dred acres are a high place in the academic devoted to parks and play- world today, and is recognized by every out- grounds. Macon has the distinction of standing agency. Approaching the hun- owning a $1,250,000 Municipal Auditori- dredth anniver- um, which has sary of her the largest cop- founding, Wesleyan College stands as a mon- per - covered dome in the world. The city ument to the also owns an far-sighted wisdom of the State of Georgia, the An Apartment House in Macon impressive stadium, which has a seating "IN THE HEART OF GEORGIA" Poplar Street capacity of eleven thousand. A municipally-owned water plant of twenty-two million gallons daily of water, which is more than ninety-nine per cent pure, pumps the supply from the Ocmulgee River. An excellent airport is also municipally owned. An imposing new baseball plant has been erected in Central Park, municipally owned. Many of the world's most famous race horses train at Central City Park each year and Downie Brothers Circus has winter quarters in this area. The boyhood home of Sidney Lanier, the South's great poet, still stands in Macon. The famous author, Harry Stillwell Edwards, probably best known by his "Eneas Africanus," lives here. MACON There are several healthful mineral wells in the neighborhood of Macon. Modern theatres, hotels and three excellent golf courses, together with 3 lake parks and other resorts, make Macon interesting for visitors. Industries Approximately one hundred and fifty manufacturing plants are located here, the annual production being valued at $20,000,000. The city is a railroad shop center with three lines doing their repair work locally. Conditions in Macon are consistently favorable to high yields from capital in industry. Sales managers find in the more than twenty million people who live in the Southeastern States a responsive and unsatiated market. Traffic managers trace to Macon the geographical, economic and service center of that market. Production men delight in Macon's reserves of hydro-electric power, its natural gas, its ready access to every raw material of the South, its unfailing supply of high-grade labor and its high-grade climate. Each year Macon's trade territory produces about one-third of the State's manufactured products. Of Georgia's annual agricultural production, twothirds is grown and marketed from this section. The State's greatest supplies of Entrance to Wesleyan College timber and its most extensive deposits of ceramic clays are in this territory. From the farms, mills and mines, the products of this great storehouse of the South are cleared through Macon in the course of concentration, distribution and refinement, with the greatest economy of transportation and time. This economy is reflected in material prices. The cost of living in Macon, as well as the general cost of manufacture, is, therefore, well under the average of those in any industrial city. From these figures compiled by the National Industrial Conference Board, the cost of living in Macon is e s t i m a ted to be sixteen per cent below the national average. Trained labor is plentiful. Moreover, apt Birds-Eye View of Wesleyan Campus "IN THE HEART OF GEORGIA" View in Baconsfield Park and capable workers are available from the reservoirs of labor which have been created by advancing agricultural methods, in practically unlimited quantities. These men and women are of efficient and energetic old American stock. They have a friendly and intelligent attitude of mind which is a product of generations. Macon's industries are diversified. The markets of some of them are strictly local; others serve markets of sectional, state and regional character; still others sell in markets that are national and even international. With some of these industries low cost access to these markets--the advantages of paved highways, splendid railroad facilities, nearby Women's Club House at Baconsfield Park MACON * One of Many Beautiful Drives Leading Into Macon deep water transportation--was the primary consideration. Others, in selecting Macon, were primarily influenced by its proximity to raw materials, its supply of labor, or the economy of manufacture growing out of the general industrial services available here. All have found in Macon a focal point of these advantages. Macon's industries number approximately 150. The number of classifications is fifty. They are classied as follows : Agricultural Implements, Automob, le Tops, Bakery Products, Barrels, Bedding, Bottlers, Boxes, Crates, Brick and Hollow Tile, Stone Tile, Candy, Canned Food Products, Cigars, Cement Products, Coffee Roasters, Commercial Hat- "IN THE HEART OF GEORGIA" 21 chery, Cotton Seed Oil Products, Cotton Compresses, Creameries, Dental Supplies, Drugs, Electricity, Engraving Plates, Excavating Machinery, Feed Mills, Fertilizer Plants, Foundry and Machine Shops, Floor and Wall Tile, Flour and Grist Mills, Furniture and Fixtures, Gin Machinery, Granite and Marble, Handles, Ice, Ice Cream, Incinerators, Insecticides, Kaolin and Fuller's Earth Products, Leather Goods, Lumber, Optical Goods, Paint, Paper Boxes and Fillers, Potteries, Printing and Publishing, Proprietary Medicines, Railroad Repair Shops, Rayon Underwear, Sausage, Sewer Pipe, Sheet Metal Products, Shuttle Blocks, Textile Mills, Timber Treating Plants, Work Garments, Clothing Factories. Civic Organizations Macon has four hospitals, three private and one municipal. Complete facilities, including X-ray equipment, are available. Training schools for nurses are operated by three institutions. Number of beds available--300. An unusually effective County Health Department is operated in connection with the hospitals. Clinical service and public health control of the most advanced type maintain a public health condition in Macon comparable to any to be found in any other American community of its size. There aire one hundred and fifteen churches of various denominations to be found in Macon. The city can boast of its civic clubs and commercial organizations. One of the leading institutions of this nature is the Macon Junior Chamber of Commerce, composed of lively, wide-awake young business men between the ages of 18 and 36, which was organized in 1925, for the purpose of bringing together the young business men of the community and to promote the welfare and advancement of the city of Macon. Since that time this organization has been looked upon as one of the leading civic institutions of the city. The Junior Chamber counts among its successful projects the following: In 1927 it built and still operates the only municipal golf course. It sponsored the Southeastern Aeronautical Exposition in 1928 and in the same year built the Bibb County Court House on Mulberry Street 22 MACON hangar at Miller Field. It sponsored the Southeastern Sands Green Golf Tournament in 1930, as well as Sousa's Band. Later it sent a sponsor to Lakehurst, N J., to christen the dirigible "Macon" in honor of the city. In 1933 the Chamber opened the Curiosity Shop for the unemployed, built tennis courts at Tatnall Square Park and donated them to the city. It purchased land in East Macon and 40 acres lanta. Main line to Florida. Main line to Savannah. Main line to Birmingham. Main line to Athens. (Direct service to mid-west.) Southern Railway: Main line to Atlanta. Main line to Brunswick and Jacksonville. (Direct service to North and East.) Georgia, Southern and Florida Railway (Branch of Southern) : Main line to Florida. The City Auditorium in Macon on the Ocmulgee River, where the Indian mounds are located, and donated this land to the city. During 1934-35 it promoted a drive for funds with which to build a national park on the Indian mound site. It was the organizer of the Macon Civic Diamond Ball League in 1934 and joint sponsor of the Stribling Memorial that year. The Chamber originated and sponsored the selection of an outstanding person each year as Macon's Leading Citizen, which was begun in 1931. Transportation Facilities Macon has thirty-two passenger trains daily. Her five railroads are Central of Georgia, Southern, MD&S, Georgia, GS&F. Central of Georgia: Main line to At- Macon, Dublin and Savannah Railway. Georgia Railway: To Augusta. First-class terminal facilities are maintained by these roads, including a full and complete switching service. By all-rail service Macon shippers obtain regular seventh morning delivery to New York, with commensurate service to other points. By rail and water this service is speeded up to fourth morning delivery. There are twenty-six busses daily, over five bus lines. Daily air mail, and air express service are available at Miller Field, Macon's excellent Municipal Airport. It is fully lighted and equipped and is a regular stop for Eastern Air Transport airmail planes. Through this means Macon ob- "IN THE HEART OF GEORGIA" 23 Entrance to Macon Baseball Park Golfing; All Year 'Round at Idle Hour Country Club 24 MACON tains overnight letter service to Chicago and New York; letters posted at the close of Macon's business day are delivered in those points on the following morning. Commensurate service is afforded by airmail connections to other points. One of Many Tennis Courts Banks Citizens and Southern National Bank of Macon (branch of Citizens & Southern National Bank of Savannah) : Capital, $5,000,000.00; Deposits, $65,073,486.64; Surplus and Undivided Profits, $2,619,46054. City Bank and Trust Company: Capital, $110,000.00; Deposits, $904,293.57; Surplus and Undivided Profits, $62,675.26. First National Bank and Trust Company (affiliate of First National Bank of Atlanta) : Capi-, tal, $500,000.00; Deposits, $6,014, 378.35; Surplus and Undivided Profits, $163,795.34. Regional Agricultural Credit Corporation Bank (R. F. C.) : Serves the States of Georgia and Florida. Agriculture Middle Georgia lands offer an excellent opportunity for the farmer who wishes to trade winter weather for long growing seasons. Practically every known crop, except citrus fruits, may be produced in this fertile section. Cotton and corn were for years the staple crops, but Bibb County's present diversification may be seen from the following statistics taken from the latest report of Georgia's Commissioner of Agriculture : Macon, County Seat; incorporated, 1823; County area, 277 square miles; taxable property, $48,686,375; grows practically all farm products, including cotton, grain, truck, peaches and pecans, hogs and poultry, and is a large manufacturing center, especially in clays and textile; cotton, 4,068 bales, 10.000 to 20,000 acres; oats, 2,000 to 3.000 acres; Irish potatoes, 50 to 100 acres; sweet potatoes, 1,500 to 2,000 acres; peanuts, less than 500 acres; hay, 5,000 to 7,500 acres; watermelons, 100 to 200 cars; peach trees, 200,000 to 500,000 trees; pecan trees, 25,000 to Centennial Stadium 50,00 trees; farm horses, 100 to 200; farm mules 1,000 to 2,000; swine, 5,000 to 7,000; milk cows, 3,000 to 4,000; other cattle on farms, 1,000 to 2,000; "IN THE HEART OF GEORGIA" 25 chickens, 30,000 to 40,000; corn, 15,000 to 25,000 acres; wheat, less than 100 acres. Macon is the center of the famous Georgia peach belt and is surrounded by sixteen million bearing peach trees. Hatcheries ; Bibb is the only County in Georgia having two hatcheries. These are Paul Hearn Hatchery and Billy Morgan Hatchery. Paul Hearn Hatchery is located at Tuft Springs; 25 acres of this hatch- ery is under water; it is made up of five ponds, all of which contain 2,000,000 bass; one and one - half million gallons of water flow into this hatchery daily. Billy Morgan Hatchery is located about three - quarters of a mile from Tuft Springs at the old A. T. Main Building at Macon Hospital Small Brick Plant Sites A wide variety of plant sites is available in Macon. Sites which are located close to the present industrial settlements, others with particular advantages of trackage, and still others offering perfect privacy and isolation for those who would prefer to construct their own mill villages. Those plants which particularly require large qua ntities of pure water and good drainage with any other several advantages will find Company. This hatchery comprises 78 acres, 50 acres of which is under water. It will produce between four and five million blue gill bream per year. Besides the hatchery, it is planned many ideal lo- cations in Macon. Hopewell Sanitarium for Tubercular Patients 26 MACON Where Georgia Peaches Are Packed Clay Manufacturing Plant "IN THE HEART OF GEORGIA" 27 to erect a beautiful park, also a barbecue pit and band stand. Taxation Summing up the labor situation in Macon, there is to be found here labor equal in quality and character to any in The State of Georgia levies an ad- the South, in quantities not available at valorem tax of four mills. This tax is any other point in the South, for em- collected by the counties concurrently with their own levies, on the basis of the county's assessed valuation. The effect of this is to vary the actual state tax rate from county to county in accordance with the pre- ployment under climatic conditions essentially the same as those of other cities in the Piedmont area no longer put to the compulsion of defense, and it is of proved efficiency. Costs of Living vailing practice of each Not only is a practical- county in making its as- ly inexhaustible supply sessment ; that is, of labor available, but whether the county's ba- this productive territory sis of assessing prop- turns through the city in erty is low, medium or channels of trade food- high as a percentage of stuffs, lumber, ceramic the property's true value. clays, cotton and other This method of assess- materials for home con- ment of state taxes not sumption, for manufac- only affects the true state tax rate, but likewise the MHaeyrobrerotf SMmaacrotn ture and for distribution. The entire re- actual county rate. sources of this most productive section Bibb County has a tax rate of twenty of Georgia are available to Macon at mills. To this is to be added the State's prices which have not begun to soar ei- tax of four mills, for computation of the ther from high transportation charges or total tax outside the city of Macon the from several middlemen's profits. The total being twenty-four mills. The city cost of living in Macon is, therefore, tax rate is fifteen mills, the legal limit even appreciably lower than that of most as set by our city charter. other Southern cities. Rents and retail In considering the actual state, county prices are uniformly lower and this con- and city rate as levied, it is important dition enables the high grade of labor to know the present and historical at- available here to work happily on a scale titude of a locality toward industry. of wages that would offer less than ade- That in Macon and Bibb County is, and quate compensation elsewhere. always has been, favorable. Assess- Average house rent paid by industrial ments are customarily and knowingly families is $10.00 to $20.00 per month. levied at from twenty-five to forty per- Average rent paid in the highest class cent of an industry's true property residential section is $30.00 to $50.00. value, as a matter of fixed policy. Accommodations are ample in all classes. Climate and Efficiency Cotton mill operatives and mill villages Weather reports disclose that the Ma- pay an average of 50 cents per room per con area boasts a climate most favorable week, water and lights included. for industrial enterprises. Heat pros- Power Service trations are absolutely unknown. Atten- Macon's power service is secured from tion is directed to the weather chart the Georgia Power Company, having the shown elsewhere in this survey. District Office and two sub-stations here. 28 MACON A very unusual scope of protection is af- Water Analysis forded Macon by the complete system Grs. per gal. of lines converging here. A primary Organic and Volatile matter .548 hydro-plant is located at Jackson, Geor- Silica .373 gia, forty miles away. Iron Oxide .146 Other lines feed into Macon, guaranteeing positive uninterrupted service against almost Calcium Sulphate (Scale forming) .128 Calcium Carbonate (Scale forming) .490 Magnesium Carbonate every conceivable contin- (Scale forming) .378 gency from the Alabama, Tennessee and Carolina power sources. All rates as listed are gross with Sodium Sulphate (Scale forming) Sodium Chloride, (Salt) Total Solids .491 .385 2.839 10 per cent discount for prompt payment in every case. Radio Station WMAZ, 1,000 Water Rates Minimum per month, inside city .60 Minimum per month, outside city 1.00 watts, latest type Class B Transmitter, operates on a frequency of 1,180 Gallons Per Month 1 to 90,000 .20 90.000 to 180,000 .20 kilocycles. Southeastern 180.000 to 300,000 .18 Broadcasting Company, 300.000 to 450,000 .15 operators. Studios, Bankers Health and Life P. T.EAdintodrerson 450.000 to 600,000 .12 600.000 to 3,000,000 .11 3,000,000 to 4,000,000 .10 Insurance Company; Transmitter, Log 4,000,000 to 6,000,000 .08 Cabin Boulevard. Consistent coverage Over 6,000,000 gallons per month .06 of area from 50 to 70 miles of Macon. Highways All main county highways paved. The Dixie and National Highways (both paved) run through the city, as does U. S. Transcontinental Route No. 80. Hotels Eight with total of 1,150 rooms. The excellence of Macon's hotel facilities, coupled with an unusual number of assembly halls, including an) auditorium with a seating capacity of 4,500 people, and the fact that Macon is within six miles of the geographical center of the State, has earned for the city an enviable reputation as a convention city. Water Supply Source of supply is the Ocmulgee Power Rates Retail Rate "A-2" First 25 KWH, per month Per KWH 7.22c Next 35 KWH, per month 5.55c Next 140 KWH, per month 3.33c Over 200 KWH, per month 1.67c Rate "A-2" reduced 5% per year until 1937 when Rate A-3 applies. Rate A-3 applicable for all customers increasing their consumption after one year of use on Rate A-2 with net bills on rate A-2 acting as the minimums. Rate "A-3" First 15 KWH or less per month Next 50 KWH, per month Next 135 KWH, per month Next 500 KWH, per month Over 700 KWH, per month Per KWH 1.11c 5.00c 2.22c 1.39c 1.11c River. As the following analysis shows, General Retail Service this water is exceptionally soft and pure. The municipal system has a capacity of twenty-two million gallons, daily of which ten million gallons are now consumed. Rate "B" First 30 KWH per month Next 170 KWH per month Next 800 KWH per month Per KWH 7.22c 0.66c 5.55c "IN THE HEART OF GEORGIA" 29 Next 1,000 KWH per month 4.44c Over 2,000 KWH per month 3.33c Optional retail power rates including light- ing at option of customer. Wholesale power rates for service taken from wholesale distribution lines including incidental lighting-- Rate "P-9." Rate "B-3" DEMAND CHARGE: $1.66 per KW of maximum demand per month. Plus an ENERGY CHARGE as follows: Per KWH First 1,000 KWH per month Next 4,000 KWH per month All over 5,000 KWH per month 4.44c 2.22c 1.11c Rate "C-l" DEMAND CHARGE: $5.55 per month per meter, Plus an ENERGY CHARGE as follows: Per KWH First 100 hours use of lighting demand 6.66c All additional energy used 3.33c Optional large lighting rate-- Rate "B-2" DEMAND CHARGE: $2.22 per KW of maximum demand per month. Plus an ENERGY CHARGE as follows: Per KWH DEMAND CHARGE: $1.11 per KW of maximum demand per month, Plus an ENERGY CHARGE as follows: Per KWH First 20,000 KWH per month Next 30,000 KWH per month Next 150,000 KWH per month Over 200,000 KWH per month Minimum Demand 50 KW Optional Wholesale power rate-- 1.44c 1.11c 0.777c 0.666c Rate ` C-4" DEMAND CHARGE: per KVA per month First 200 KVA of maximum demand 3.00 Next 800 KVA of maximum demand 1.66 All over 1,000 KVA of maximum de- mand 1-11 Plus an ENERGY CHARGE as follows: Per KWH First 1,000,000 KWH per month 0.555c All over 1,000,000 KWH per month __0.444c Minimum Demand--500 KW First 1,000 KWH per month 4.44c Next 1,000 KWH per month 3.33c Next 6,000 KWH per month 2.22c All over 8,000 KWH per month 1.11c Provided that all consumption in excess of 8,000 KWH per month, which is also in ex- cess of 200 KWH per KW of the recorded maxi- mum demand each month, will be billed at 0.888c KWH. Natural Gas Natural gas from Monroe, Louisiana, is supplied Macon by the Macon Gas Company. The rates follow. SCHEDULE No. 1--General Gas Service: Service Charge--per meter per month $0.60 Plus the following charge for gas used (Per 1,000 cu. ft.) View of Grandstand at Williams Field 30 MACON Cozy Corner in the Living: Room of the Masonic Home of Georgia Learning- to Sew at Masonic Home of Georgia Home Economics Department, Masonic Home of Georgia "IN THE HEART OF GEORGIA" 31 Net Gross used per month For the first 2,00 Cu. Ft. used__$1.10 $1.20 For the next 3,000 Cu. Ft .85 .95 All over 5,000 Cu. Ft .60 .70 Prompt Payment Discount: The differ- ence between the net and gross rates stated above shall constitute the discount for prompt payment if bills are paid within ten days of their date Minimum Bill: The minimum mon'.hly bill shall be $0.85. SCHEDULE No. 2--Commercial Gas Service: Available to any commercial consumers, such as restaurants, hotels, bakeries, pressclubs, etc., for space hearing, commercial cooking, commercial refrigeration and like For all over 200,000 cu. ft. used per month $0.30 per 1,000 cu. ft. Prompt Payment Discount: 5 cents per 1,000 cu. ft. on all bills paid within ten days from presentation. Minimum Bill--shall be the sum of the service charge and maximum use charge. SCHEDULE NO. 3--Commercial Heating Service: Available only for space heating, central heating and building hot water heating in commercial buildings and apartments where gas is used as the exclusive medium of general space heating. For the first 50,000 cu. ft. used per month $0.40 per 1,C00 cu. ft. One of Macon's Educational Institutions uses. Service Charge-- $1.00 per meter per month, plus maximum use charge: For the first 500 cu. ft. per month of maximum hourly rate of use per 100 cu. ft. $1.00. For all over 500 cu. ft. per month of maximum hourly rate of use per 100 cu. ft. $0.50. PLUS--Consumption Charge: For the first 5,000 cu. ft. used per month $1.05 per 1,000 cu. ft. For the next 45,000 cu. ft. used per month $0.60 per 1,000 cu. ft. For the next 150,000 cu. ft. used per month $0.35 per 1,000 cu. ft. For the next 150,000 cu. ft. used per month $0.35 per 1,000 cu. ft. Fort the next 800,000 cu. ft. used per month $0.32 per 1,000 cu. ft. For all over 1,000,000 cu. ft. used per month $0.30 per 1,000 cu. ft. Prompt Payment Discount: 5 cents per 1,000 cu. ft. on all bills paid within ten days from presentation. Minimum Bill shall be $150.00 net per consumer per year. Special terms and conditions of service. This rate is not available for any other use than space heating and heating of water for general hot water service in apartments, etc. BALDWIN'S AND TELEGRAPH'S MACON GEORGIA MISCELLANEOUS 1935 DIRECTORY [Containing valuable information concerning local, state and national governments with the names of United States senators and representatives; county seats and populations and other useful information. COPYRIGHT 1935 BY BALDWIN DIRECTORY CO., INC. UNITED STATES GOVERNMENT FRANKLIN DELANO ROOSEVELT, President JOHN NANCE GARNER, Vice-President FRANKLIN DELANO ROOSEVELT President of the United States WALTER F. GEORGE U, S. Senator from Georgia 34 BALDWIN'S AND TELEGRAPH'S THE CABINET Cordell Hull, Secretary of State. Henry Morgenthau, Secretary of the Treas- ury. George Henry Dern, Secretary of War. Homer Stille Cummings, Attorney General. Claude A. Swanson, Secretary of the Navy. Harold L. Ickes, Secretary of the Interior. Henry Agard Wallace, Secretary of Agricul- ture, Daniel Calhoun Roper, Secretary of Com- merce. , Frances Perkins, Secretary of Labor. THE SUPREME COURT Charles Evans Hughes, Chief Justice. Associates Willis Van Deventer, James Clark McRey- nolds, Lewis Dembitz, George Sutherland, Pierce Butler, Harlan F. Stone, Owen J. Roberts, Benjamin N. Cordozo. GOVERNMENT OFFICIALS Treasurer of the United States: William Alexander Julian. Comptroller of Currency: J. F. T. O'Conner. Director of the Mint: Nellie Tayloe Ross. Register of the Treasury: Edward E. Jones. Director of the Bureau of Engraving: Alvin W. Hall. Judge Advocate General of the Army: Gen. Douglas McArthur. Quartermaster General of the Army: Gen. J. L. Dewitt. Surgeon General of the Army: Maj. Gen. Robert U. Patterson. Judge Advocate General of the Navy: Rear Admiral O. G. Murfin. Quartermaster General of the Navy: Brig. Gen. Hugh Matthews. Chief of the Weather Bureau: Charles F. Marvin. Chief of the Bureau of Animal Industry: John F. Mohler. Chief of the Bureau of Dairy Industry : O. E. Reed. Chief of the Bureau of Plant Industry: William A. Taylor. UNITED STATES SENATE Democrats 70; Republicans 24; Farmer-Labor 1; Progressives 1. Alabama: Hugo L. Black and John H. Bankhead (D). Arizona: Joseph F. Ashurst and Carl Hayden (D). Arkansas: Joseph T. Robinson (D) and Hattie Caraway (D). California: Hiram W. Johnson (R) and William Gibbes McAdoo (D). Colorado: Edward P. Costigan (D) and Alva B.Adams (D). Connecticut: Augustine Lonergan (D) and Francis T. Mahoney (D). Delaware: Daniel O. Hastings (R) and John G. Townsend, Jr. (R). Florida: Duncan U. Fletcher (D) and Park Ttammell (D). Georgia: Walter F. George (D) and Richard B. Russell, Jr. (D). Idaho: William E. Borah (R) and James P. Pope (R). Illinois: J. Hamilton Lewis and William H. Dieterich. Indiana: Frederick Van Nuys (D) and Sherman Minton (D). Iowa: L. J. Dickinson (R) and Louis Murphy (D).. Kansas: Arthur Capper (R) and George McGill (D). Kentucky: A. W. Barkley (D) and M. M. Logan (D). Louisiana: Huey P. Long (D) and John H. Overton (D). Maine: Frederick Hale (R) and Wallace H. White, Jr. (R). Maryland: Mildred E. Tydings (D) and George W. Radcliffe (D). Massachusetts: David I. Walsh and Marcus A. Coolidge. Michigan: James Couzens (R) and Arthur H. Vanderberg (R). Minnesota: Henrik Shipstead (FL) and Thomas D. Scall (R). Mississippi: Pat Harrison (D) and Theodore G. Bilbo (D). Missouri: Bennett Champ Clark (D) and Harry S. Truman (D). Montana: Burton K. Wheeler (D) and James E. Murray (D). Nebraska: George W. Norris (R) and Edward R. Burke (D). Nevada: Key Pittman (D) and Patrick McCarran (D). New Hampshire: Henry W. Keyes (R) and Fred H. Brown (D). New Jersey: W. Warren Barbour (R) and Harry Moore (D). New Mexico: Car] A. Hatch (D) and Dennis Chavez (D) New York: Royal S. Copeland (D) and Robert F. Wagner (D). North Carolina: Josiah W. Bailey (D) and Robert R. Reynolds (D). North Dakota: Lynn J. Frazier (R) and Gerald P. Nye (R). Ohio: Robert J. Bulkley (D) and Vic Donahey (D). Oklahoma: Elmer Thomas (D) and Thomas P. Gore (D). MISCELLANEOUS DIRECTORY 35 Oregon: Charles L. McNary (R) and Frederick Steiwer (R). Pennsylvania: James J. Davis (R) and Joseph F. Guffey (D). Rhode Island: Jessie H. Metcalf (R) and Peter G. Gerry (D). South Carolina: Ellison D. Smith (D) and James F. Byrnes (D). South Dakota: Peter Norbeck (R) and W. J. Bulow (D). Tennessee: Kenneth McKellar (D) and Nathan L. Bachman (D). Texas: Morris Sheppard (D) and Tom Connaily (D). Utah: William H. King (D) and Elbert D. Thomas (D). Vermont: Warren R. Austin (P.) and Ernest W. Gibson (R) Virginia: Carter Glass (D) and Harry Flood Byrd (D). Washington: Homer T. Bone (D) and Lewis B. Schwellenbach (D). West Virginia: M. M. Neely (D) and Rush D. Holt (D). Wisconsin: Robert M. LaFollette, Jr. (D) and F. Ryan Duffy (D). Wyoming: Robert D. Carey (R) and Joseph C. O'Mahoney (D). HOUSE OF REPRESENTATIVES ALABAMA John McDuffie (D), Monroeville. Lister Hill (D), Montgomery. Henry B. Steagall (D), Ozark. Sam Hobbs (D), Selma. Joe Starnes (D), Guntersville. William B. Oliver (D), Tuscaloosa. William B. Bankhead (D), Jasper. A. H. Carmichael (D), TVscumbia. George Huddleston (D), Birmingham. ARIZONA Isabelle Greenway (D), Tuscon. ARKANSAS William J. Driver (D), Osceola. John F. Miller (D), Searcy. Claude A. Fuller (D), Eureka Springs. Ben Cravens, (D), Fort Smith. David D. Terry (D), Little Rock. John L. McClellan (D), Malvern. Tilman B. Parks (D), Camden. CALIFORNIA Clarence F. Lea (D), Santa Rosa. Harry L. Englebright (R), Nevada City. Frank H. Buck (D), Vacaville. Florence P. Hahn (R), San Francisco. Richard J. Welch (R), San Francisco. Albert E. Carter (R), Oakland. J. H. Tolan (D), Oakland. John J. McGrath (D), San Mateo. B. W. Gearhart (R), Fresno. Henry E. Stubbs (D), Santa Maria. John S. McGroarty (D), Tulunga. John H. Hoeppel (D), Arcadia. Charles Kramer (D), Los Angeles Thomas F. Ford (D), Los Angeles. William I. Traeger (R), Hollywood. John F. Dockweiler (D), Los Angeles. Charles J. Colden (D), San Pedro. John H. Burke (D), Long Beach. Sam L. Collins (R), Fullerton. George Burnham (R), San Diego. COLORADO Lawrence Lewis (D), Hartford Fred Cummings (D), Fort Collins. John A. Martin (D), Pueblo. Edward T. Taylor (D), Glenwood Springs. CONNECTICUT Herman P. Kopplemann (D), Hartford. William L. Higgins (R), South Coventry. James A. Shanley (D), New Haven. Schuyler Merritt (R), Stamford. J. Joseph Smith (D), Waterbury. William M. Citron (D), Middletown. DELAWARE J. George Stewart (D), Wilmington. FLORIDA J. Harden Peterson (D), Lakeland. R. A. Green (D), Starke. Millard F. Caldwell (D), Milton. J. Mark Wilcox (D), West Palm Beach. William J. Sears, Jacksonville. GEORGIA Hugh Peterson, Jr. (D), Ailey. E. E. Cox (D), Camilla. Bryant T. Casteliow (D), Cuthbert. E. M. Owen (D), Griffin. Robert Ramspeck (D), Atlanta. Carl Vinson (D), Milledgeviile. [ Malcolm C. Tarver (D), Dalton. Braswell Deen (D), Alma. Frank Welchel (D), Gainesville. Paul Brown (D), Elberton. IDAHO Compton I. White (D), Clarks Fork. D. Worth Clark (D), Pocatello. ILLINOIS Arthur H. Mitchell (D), Chicago. Raymond S. McKeough (D), Chicago. Edward A. Kelly (D), Chicago Harry P. Beam (D), Chicago. A. J. Sabath (D), Chicago. Thomas J. O'Brien (D), Chicago. Leonard W. Schuetz, (D), Chicago. Leo Kocialkowski (D), Chicago. James McAndrews (D), Chicago. Ralph E. Church (R), Evanston. Chauncey W. Reed (R), Chicago. John T. Buckbee (R), Rockford. Leo E. Allen (R), Galena. Chester Thompson (D), Rock Island. J. Leroy Adair (D), Quincy. Everett M. Dirltsen (R), Pekin. L. C. Arends (R), Melvin. 36 BALDWIN'S AND TELEGRAPH'S James A. Meeks (D), Danville. Donald C. Dobbins (D), Champaign. Scott W. Lucas (D), Havana. Harry H. Mason (D), Uawnec. Edwin M. Schaefer (D), Belleville. William W. Arnold (D), Robinson. Claude V. Parson (D), Golcjnia. Kent E. Keller (D), Ava. Martin A. Brennan (D), Bloomington. Michael L. Igoe (D), Chicago. INDIANA William T. Schulte (D), Hammand. Frederick Landis (R), Logansport. Samuel B. Pettengill (D), South Bend. James I. Farley (D), Auburn. Glenn Griswold (D), Peru. Virginia E. Jenckes (D), Terre Haute. Arthur H. Greenwood (D), Washington. John W. Boehne, Jr., (D), Evansville. Eugene B. Crowe (D), Bedford. Finly H. Gray (D), Connorsville. Louis Ludlow (D), Indianapolis. William H. Larrabee (D), New Palestine. IOWA Edward C. Eicher (D), Washington. Bernhard M. Jacobsen (D), Clinton. John W. Gwynne (R), Waterloo. Fred Biermann (D), Decorah. Lloyd Thurston (R), Osceola. Hubert Utterbeck (D), Des Moines. Otha D. Wearin (D), Hastings. Fred C. Gilchrist (R), Laurens. Guy Mark Gillette (D), Cherokee. KANSAS W. P. Lambertson (R), Fairview. U. S. Guyer (R), Kansas City. Edward W. Patterson (D), Pittsburg. Randolph Carpenter (D), Marion. Jack Houston (D), Newton. Frank Carlson (R), Concordia. Clifford R. Hope (R), Garden City. KENTUCKY W. V. Gregory (D), Mayfield. Glover H. Gray (D), Owensboro. Emmet O'Neal (D), Louisville. Cap R. Cardon (D), Munfordville. Brent Spence (D), Fort Thomas. Virgil Chapman (D), Paris. A. J. May (D), Prestonburg. Fred M. Vinson (D), Ashland. John M. Robteon (R), Barbourville. LOUISIANA Joachim O. Fernandez (D), New Orleans. Paul H. Maloney (D), New Orleans. Numa F. Montet (D), Thibodaux. John N. Sandlin (D), Minden. Riley J. Wilson (D), Ruston. Jared Y. Sanders (D), Baton Rouge. Rene L. DeRouen (D), Ville Platte. Cleveland Dear (D), Alexandria. MAINE Simon M. Hamlin (D), S. Portland. Edward C. Moran, Jr. (D), Rockland. Ralph O. Brewster (R), Dexter. MARYLAND T. Alan Goldsborough (D), Denton. William P. Cole, Jr. (D), Towson. Vincent L. Palmisano (D), Baltimore. Ambrose J. Kennedy (D), Baltimore. Stephen W. Gambrill (D), Laurel. David J. Lewis (D), Cumberland. MASSACHUSETTS Allen T. Treadway (R), Stockbridge. William J. Cranfield (D), Longmeadow. Joseph E. Casey (D), Clinton. Pchr G. Golmes (R), Worcester. Edith Nourse Rogers (R), Lowell. A. 1 latt Andrew (R), Gloucester. William P. Connery, Jr. (D), Lynn. Arthur D. Healey (D), Somerville. Richard M. Russell (D), Cambridge. George Holden Tinkam (R), Boston. John P. Higgins (D), Boston. John W. McCormack (D), Boston. Charles L. Gifford (R), Barnstable. Joseph W. Martin, Jr. (R), North Attlebo. Richard B. Wigglesworth (R), Boston. MICHIGAN George G. Sadowski, (D), Detroit. Earl C. Michener (R), Adrian. Henry M. Kimball (R), Kalamazoo. Clare Hoffman (R), Allegan. Carl E. Mapes (R), Grand Rapids. William W. Blackney (R), Flint. Jesse P. Wolcott (R), Port Huron. Fred L. Crawford (R), Saginaw. Albert J. Engel (R), Lake City. Roy O. Woodruff (R), Bay City. Prentiss M. Brown (D), St. Ignace. Frank E. Hook (D), Ironwood. Clarence J. McLeod, (R), Detroit. Louis Rabaut (D), Grosse Pointe Park. John D. Dingell (D), Detroit. John Lesinski (D), Dearborn. George A. Dondero (R), Royal Oak. MINNESOTA August H. Andresen (FL), Red Wing. Elmer J. Ryan (D), St. Paul. Ernest Lundeen (D), Minneapolis. Melvin J. Maas (R), St. Paul. Theodore Christianson (R), Minneapolis. Harold Knutson (R), St. Cloud. Paul John Kvale (FL), Benson. William A. Pittenger (R), Duluth. R. T. Buckler (FL), Crookston. MISSISSIPPI John E. Rankin (D), Tupelo. Wall Doxey (D), Holly Springs. William M. Whittington (D), Greenwood. A. L. Ford (D), Ackerman. Aubert Dunn (D), Meridian. William M. Colmer (D), Pascagoula. Dan McGhee (D), Meadville. MISSOURI M. A. Romjue (D), Macon. William L. Nelson (D), Columbia. Richard M. Duncan (D), St. Joseph. C. Jasper Bell (D), Kansas City. Joseph B. Shannon (D), Kansas City. Reuben T. Wood (D), Springfield. Dewey Short (R), Galena. Clyde Williams (D), Hillsboro. MISCELLANEOUS DIRECTORY 37 Clarence Cannon (D), Elsberry. Orville Zimmerman (D), Gennett. Thomas C. Hennings, Jr. (D), St. Louis. James R. Claiborne (D), St. Louis. John J. Cochran (D), St. Louis. MONTANA Joseph P. Monaghan (D), Butte. Roy E. Ayers (D), Lewiston. NEBRASKA Henry C. Luckey (D), Lincoln. Charles F. McLaughlin (D), Omaha. Karl Stefan (R), Norfolk. C. G. Binderup (D), Holdrege. Harry B. Coffee (D), Chadron. NEVADA James G. Scrugham (D), Reno. NEW HAMPSHIRE William H. Rogers (D), Sanbornville. Charles W. Tobey (R), Temple. NEW JERSEY Charles A. Wolverton (R), Merchantsville. Isaac Bacharach (R), Atlantic City. William H. Sutphin (D), Matawan, D. Lane Powers (R), Trenton. Charles A. Eaton (R), Watchung. Donald H. McLean (R), Elizabeth. Randolph Perkins (R), Woodcliff Lake. George N. Seger (R), Passaic. Edward A. Kenney (D), Cliffside Park. Fred A. Hartley, Jr. (R), Kearny. Peter A. Cavicchia (R), Newark. Frederick R. Lehlbach (R), Newark. Mary T. Norton (D), Jersey City. Edward J. Hart (D), Jersey City. NEW MEXICO J. J. Dempsey (D), Santa Fe. NEW' YORK Robert L. Bacon (R), Westbury. William F. Brunner (D), Rockaway Park . J. L. Pfeifer (D), Brooklyn. Thomas H. Cullen (D), Brooklyn. Marcellus H. Evans (D), Brooklyn. Andrew L. Somers (D), Brooklyn. John J. Delaney (D), Brooklyn. Richard J. Tonry (D), Brooklyn. Stephen A. Rudd (D), Brooklyn. Emanuel Celler (D), Brooklyn. James A. O'Leary (D), West New Bright Samuel Dickstein (D), New York City. Christopher D. Sullivan (D), New York. William I. Sirovich (D), New York City. John J. Boylan (D), New York City. John J. O'Connor (D), New York City. Theodore A. Peyser (D), New York City. Martin J. Kennedy (D), New York City. Sol Bloom (D), New York City. Vito Marcantonio (R), New York City. Joseph A. Gavagan (D), New York City. Anthony J. Griffin (D), New York City. Charles A. Buckley (D), Bronx. James M. Fitzpatrick (D), Bronx. Charles D. Millard (R), Tarrytown. Hamilton Fish, Jr., (R), Garrison. Philip A. Goodwin (R), Coxsackie. Parker Corning (D), Albany. William D. Thomas (R), Hoosick Falls. Frank Crowther (R), Schenectady. Bertrand H. Snell (R), Potsdam. Francis D. Culkin (R), Oswego. Fred J. Sisson (D), Whitesboro. Bert Lord (R), Afton. Clarence E. Hancock (R), Syracuse. John Tabor (R), Auburn. W. Sterling Cole (R), Bath. James P. B. Duffy (D), Rochester. James W. Wadsworth, Jr. (R), Genesseo. Walter G. Andrews (R), Buffalo. Alfred F. Beiter (D), Williamsville. James M. Mead (D), Buffalo. Daniel A. Reed (R), Dunkirk. Matthew J. Merritt (D), Flushing. Caroline O'Day (D), Rye. NORTH CAROLINA Lindsay C. Warren (D), Washington. John H. Kerr (D), Warrenton. , Graham A. Barden (D), New Bern. Harold D. Cooley (D), Nashville. Frank W. Hancock, Jr. (D), Oxford. William B. Umstead (D), Durham. J. Bayard Clark (D), Fayetteville. Walter Lambeth (D), Thomasville. Robert L. Doughton (D), Gennett. Alfred L. Bulwinkle (D), Gastonia. Zebulon Weaver (D), Asheville. NORTH DAKOTA Usher L. Burdick (R), Bismarck. William Lemke (R), Fargo. OHIO John B. Hollister (R), Cincinnati. William E. Hess (R), Cincinnati. Byron B. Harlan (D), Dayton. Frank L. Loeb (D), Celina. Frank C. Kniffin (D), Napoleon. James G. Polk (D), Highland. L. T. Marshall (R), Xenia. Brooks Fletcher (D), Marion. Warren J. Duffey (D), Toledo. Thomas A. Jenkins (R), Ironton. Mell G. Underwood (D), New Lexington. Arthur P. Lamsneck (D), Columbus. William L. Fiesinger (D), Sandusky. Dow W. Harter (D), Akron. Robert T. Secrest (D), Senecaville. William R. Thom (D), Canton. William A. Ashbrook (D), Johnstown. Lawrence E. Imhoff (D), St. Clairsville. John G. Cooper (R), Youngstown. Martin L. Sweeney (D), Cleveland. Robert Crosser (D), Cleveland. Chester C. Bolton (R), Cleveland. Stephen M. Young (D), Cleveland. Charles V. Truax (D), Bucyrus. OKLAHOMA Wesley E. Disney (D), Tulsa. Jack Nichols (D), Eutaula. Wilburn Cartwright (D), McAIester. P. L. Gassaway (D), Coalgate. Josh Lee (D), Norman. Jed Johnson (D), Anadarko. Sam Massingale (D), Cordell. Phil Ferguson (D), Woodward. Will Rogers (D), Oklahoma City. 38 BALDWIN'S AND TELEGRAPH'S OREGON James W. Mott (R), Salem. Walter M. Pierce (D), La Grande. William A. Ekwell (R), Portland. PENNSYLVANIA Harry C. Ransley (R), Philadelphia. William H. Wilson (R), Philadelphia. Clare Gerald Fenerty (R), Philadelphia. J. Burrwood Daly (D), Philadelphia. Frank J. G. Dorsey (D), Philadelphia. Michael J. Stack (D), Philadelphia. George P. Darro (R), Philadelphia. James Wolfenden (R), Upper Darby. Oliver W. Frey (D), Allentown. J. Roland Kinser (R), Lancaster. Patrick J. Boland (D), Scranton. C. Murray Turpin (R), Kingston. James H. Gildea (D), Coaldale. William E. Richardson (D), Reading. C. Elmer Dietrich (D), Tunkhannock. Robert F. Rich (R), Woolrick. J. William Ditter (R), Ambler. Benjamin K. Focht (R), Lewisburg. Isaac H. Doutrich (R), Harrisburg. D. J. Driscoll (D), St. Marys. , Francis E. Walter (D), Easton. Harry L. Haines (D), Red Lion. Don Gingery (D), Clearfield. J. Buell Snyder (D), Perropolis. Charles I. Faddis (D), Waynesburg. Charles R. Eckert (D), Beaver. Joseph Gray (D), Barnesboro. William M. Berlin (D), Greensburg. Charles N. Crosby (D), Meadville. J. Twing Brooks (D)f Sewickley. James L. Guinn (D), Braddock. Theodore L. Moritz (D), Pittsburg. Henry Ellenbogen (D), Pittsburg. Matthew A. Dunn (D), Pittsburg. RHODE ISLAND Francis B. Condon (D), Pawtucket. John M. O'Connell, Westerly. SOUTH CAROLINA Thomas S. McMillan (D), Charleston. Hampton P. Fulmer (D), Orangeburg. John C. Taylor (D), Anderson. , John J. McSwain (D), Greenville. James P. Richards (D), Lancaster. Allard H. Gasque (D), Florence. SOUTH DAKOTA Fred H. Hildebrandt (D), Watertown. Theo B. Werner (D), Rapid City. TENNESSEE B. Carroll Reece (R), Johnson City. J. Will Taylor (R), LaFollette. Sam D. McReynolds (D), Chattanooga. J. R. Mitchell (D), Cookeville. Joseph W. Burns (D), Nashville. Clarence W. Turner (D), Waverly. Herron Pearson (D), Jackson. Jere Cooper (D), Dyersburg. Walter Chander (D), Memphis. TEXAS Wright Patman (D), Texarkana. Martin Dies (D), Orange. Morgan G. Sanders (D), Canton. Sam Rayburn (D), Bonham. Hatton W. Summers (D), Dallas. Luther A. Johnson (D), Corsicana. Nat Patton (D), Houston. Joseph J. Mansfield (D), Columbus. James B. Buchanan (D), Brenham. O. H. Cross (D), Waco. Fritz G. Lanham (D), Fort Worth. W. D. McFarlane (D), Graham. Richard M. Kleberg (D), Corpus Christi. Milton H. West (D), Brownsville. R. Ewing Thomason (D), El Paso. Marvin Jones (D), Abilene. George H. Mahon (D), Colorado. Maury Maverick (D), San Antonio. Charles L. South (D), Coleman. UTAH Abe Murdock (D), Beaver. J. Will Robinson (D), Provo. VERMONT Charles A. Plumley (R), Northfield. VIRGINIA Schuyler Otis Bland (D), Newport News. Colgate W. Darden, Jr. (D), Norfolk. Andrew J. Montague (D), Richmond. Patrick Henry Drewry (D), Petersburg. Thomas G. Burch (D), Martinsville. Clifton A. Woodrum (D), Roanoke. A. Willis Robert*on (D), Lexington. Howard W. Smith (D), Alexandria. John W. Flannagan, Jr. (D), Bristol. WASHINGTON Marion A. Zioncheck (D), Seattle. Monrad C. Wallgren (D), Everett. Martin F. Smith (D), Hoquiam. Knute Hill (D), Prosser. Samuel B. Hill (D), Waterville. Wesley Lloyd (D), Tacoma. WEST VIRGINIA Robert L. Ramsay (D). Follansbec. Jennings Randolph (D), Elkins. Andrew Sdminstno (D), Weston. George W. Johnson (D), Parkersburg. John Kce (D), Blucfield. Joe L. Smith (D), Beckley. WISCONSIN Thomas R. Amile (P), Elkhorn. Harry Sauthoff (P), Madison. Gardner Withrow (P), La Crosse. Raymond J. Cannon (D), Milwaukee. T'homas O'Malley (D), Milwaukee. Michael K. Reilly (D), Fond du Lac. Gerald J. Boileau (P), Wausau. George J. Schneider (P), Appleton. Merlin Hull (P), Black River Falls. Bernard J. Gehrmann (P), Mellen. WYOMING Paul R. Greever (D), Cody. ALASKA (Delegate) A. J. Dimond (D), Valdez. HAWAII (Delegate) Samuel W. King (R), Honolulu. PHILIPPINE ISLANDS Camilo Osias (Nat), Balaoan. Pedro Guevara (Nat), Santa Cruz. Elected for term of 3 years ending 1935. MISCELLANEOUS DIRECTORY 39 Georgia Government STATE OFFICIALS GOVERNOR Eugene Talmadge SECRETARY OF STATE John B. Wilson ATTORNEY GENERAL M. J. Yeomans TREASURER -George B. Hamilton COMPTROLLER GENERAL William B. Harrison COMMISSIONER OF AGRICULTURE STATE SCHOOL SUPERINTENDENT Tom Linder M. D. Collins COMMISSIONER OF COMMERCE AND LABOR H. M. Stanley PRISON COMMISSION E. L. Rainey. Chairman; Vivian L. Stanley, G. A. Johns PUBLIC SERVICE COMMISSION Jud P. Wilhoit, Chairman; Walter R. McDonald, George L. Goode, Tom Davis, Ben T. Huiet COURT OF APPEALS JJJuuudddgggeee WNJo..hRnF..BBJ.eronGvkulieensrsr'y JJJuuudddgggeee IAH. luHegx.hWSuJ..ttSoMntecpIhnetnysre JJJuuudddgggeee SM.. CW. .AtBkeinckson S. P. Gilbert SUPREME COURT JJJuuudddgggeee RRJo.ichChn.arBBde.lBlH. uRtcuhsseesloln, Jr. STATE SENATE (AH Democrats except as marked "R") District Name 111.i11111180'371520489I5673412 22222226543120 JohMn aCrv. inBAetSkastUrJiescvoknland HF.omMe. rDEidceknertiseolnd wwnrT Hcastktins A FE. RaNt.' wmTmaS KJ i.anngcaster A?UUe^nJ ACpopulinntgy Atkinson Bacon Baker Baldwin Baldwin Banks Barrow Bartow Bartow Ben Hill Berrien Bibb Bibb Bibb Bleckley Brantley Brooks Brooks Bryan Bulloch Bulloch Burke Burke BCaulthtsoun Camden Candler Carroll Carroll' Catoosa Charlton Chatham Chatham Chatham Chattahoochee Chattooga Cherokee Clarke Clarice Clay Clayton Clinch Cobb Cobb Coffee Colquitt Colquitt. Columbia Cook Coweta Coweta Crawford Crisp Dade Dawson Decatur Decatur DeKalb DeKalb DeKalb Dodge Bodge Dooly Dougherty Douerherty Douglas Early Echols Effingham Elbert Emanuel Emanuel Name H. L. Williams A. T. Minchew C. A. Williams Roy Salter Marion H. Allen J. Howard Ennis Floyd Lewallen Verlyn Booth Wm. S. Peebles Wm. H. Felton WJ. . HM. . SRwaiwndlliens Luther Bloodworth R. H. Freeman, Jr. CG.uyL.DB. oJwacdkesnon W. Harley Jones W. R. Blease Dr. T. R. Moye D. B. Warnell A. M. Deal Prince H. Preston, Jr. J. J. Bargeron Ralph E. Lewis E. S. Settle Jerome M. Clements Q. L. Claxton James A. Gardner Lawrence Garrett Dr. G. W. Camp Grady Head TS.peWnc.e WMr.eGncrahyson Frank A. McNall Girard M. Cohen Dr. Chas. N. Howard Gilbert S. Holland John R. Teasley Jake Joel Carlisle Cobb Chester Gavin H. Grady Moore WJa.mVes. TM.uMsgaronvneing Sam J. Welsch T. V. Williams John C. Parker Milton A. Shirah Dr. J. L. Weeks W. F. Patten Ellis G. Arnall Stonewall Dyer E. S. Harrison W. H. Dorris J. M. C. Townsend R. B. Whitmire S. Marvin Griffin Joe H. Kerbo Paul Lindsay Carl N. Guess David H. Ansley Manning McCranie A. R. Ross Robert Newby A. N. Durden George L. Sabados M. J. Morris Joseph Freeman I. F. Culpepper Fred B. Gnann T. F. Kelley John B. Spivey Alonzo H. Woods Residence Baxley Axson Alma Newton Milledgeville Milledgeville Commerce, R F D Winder Cartersville Cartersville Fitzgerald Ray City Macon Macon Macon Cochran Waynesville Barney Quitman Pembroke Statesboro Statesboro WSaardyinsesboro Jackson Morgan Kingsland Pulaski Bowdon Villa Rice Ringgold Folkston Savannah Savannah Savannah Cusseta Holland Canton Athens Athens Fort Gaines Conley Homerville Marietta Marietta Douglas Moultrie Moultrie Harlem Adel Newnan Newnan Mussella Cordele Wildwood Dawsonville Bainbridge Bainbridge Decatur Decatur Decatur Eastman Eastman Vienna Albany ADlobuagnlyasville Blakely Lake Park Clyo Elberton Swainsboro Swainsboro County Evans Eannin Fayette Floyd Floyd Floyd Forsyth Franklin Fulton Fulton Fulton Gilmer Glascock Glynn Gordon Grady Greene Gwinnett Gwinnett HHaalbl ersham Hall Hancock Haralson Harris Hart Heard Henry Houston Irwin Jackson Jackson Jasper Jeff Davis Jefferson Jenkins Johnson Jones Lamar Lanier Laurens Laurens Lee Liberty LLoinncgoln Lowndes Lowndes Lumpkin McDuffie McIntosh Macon Madison Marion Meriwether Meriwether Miller Mitchell Mitchell Monroe Montgomery Morgan Murray Muscogee Muscogee Muscogee Newton Oconee Oglethorpe Paulding Peach Pickens Pierce Pike Polk Polk Pulaski MISCELLANEOUS DIRECTORY Name R. E. DeLoach R. T. Hampton J. W. Culpepper R. C. Anderson Carl Griffin Tom Willingham John D. Black Worley Adams Wm. B. Hartsfield Ralph L. Ramsey Bond Almand W. L. Parks B. A. Hooks S. Hadley Brown Jule C. Neal J. P. Swann LF.awQr.enScaemmBoronwn Glyndon P. Tapp Dr. J. B. Jackson J. Hudson Terrell Victor H. West Marvin G. Pound G. N. Moore GT.. OBs. caSrauHnedrenrdson Jep J. Parham E. L. Reagan J. P. Etheridge D. J. Henderson H. Odell Williams LR.olOan.,dBeBnrtooonk, sJr. Dr. S. W. Martin Roy McCracken E. G. Weathers C. S. Claxton Carl C. Williams W. H. Mitchell E. D. Rivers Rufus I. Stephens Rubert L. Hogan C, C. Ansley Paul E. Caswell L. C. Groves Helen W. Coxon HTh. eoB.. WEd. wCaordlesman Fred C. Jones Joe Goolsby Henry G. Atwood A. A. Marshall L. M. Smith J. S., Burgin James S. Peters R. A. McGraw I. B. Bush Ernest M. Davis FAr. edM.B.ZeHllannedr Clifford McBride Harold Dobbins Fain S. Wilson B. O. Brinson Wm. A. Leonard J. R. Thompson, Jr. R. Pat Campbell M. L. Bond T. R. Watkins Herman H. Watson W. G. Brisendine Carl Darnell Dr. Lewis Oden S. M. Brown W. W. Mundy Dr. C. W. Peek J. F. Lee Residence Claxton Blue Ridge Fayetteville Rome Rome Rome Cumming Royston Atlanta Atlanta Atlanta Ellijay Gibson Brunswick Calhoun Cairo Greensboro LBauwforredncevillc Clarkesvillc Gainesville Gainesville Sparta Buchanan Cataula Hartwell Franklin, R F D McDonough Perry Ocilla Commerce PMeonndtiecreglrloass Hazlehurst Louisville Millen Wrightsville Round Oak Barnesville Lakeland Dublin Dublin Smith ville Hinesville Lincolnton Ludowici Valdosta Valdosta Dahlonega Thomson Valona Montezuma Danielsville Buena Vista Manchester Greenville Colquitt Camilla Pelham Forsyth Alston Rutledge Ramhurst Columbus Columbus Columbus BCoovgianrgt ton Lexington Dallas Fort Valley Jasper Blackshear Zebulon Cedartown Cedartown Hawkinsvillo 42 BALDWIN'S AND TELEGRAPH'S County Putnam Quitman Rabun Randolph Richmond Richmond Richmond Rockdale Schley Screven Seminole Spalding Spalding Stephens Stewart Sumter Sumter Talbot Taliaferro Tatnall Taylor Telfair Terrell Thomas TThifot mas Toombs Towns Treutlen Troup Troup Troup Turner Twiggs Union Upson Walker Walker Walton Walton Ware Ware Warren Washington Washington Wayne Webster Wheeler White Whitfield Wilcox Wilkes Wilkinson Worth Worth Name F. S. Batchelor Marion Thoms Lamar Green Olin Hammock Roy V. Harris Wilmer D. Lanier W. K. Barrett Wm. T. Dean H. Willis Hogg H. L. Howard Joe E. Johnson Wiley G. Milam J. J. Flynt W. C. Edwards D. G. Bland T. J. Young Reese Horton John B. Douglas F. G. Mitchell, Sr. J. D. Bradley Emory F. Parr John K. Whaley George M. Gammage H. R. Bannister Thos. Tipton M. S. Patten R. E. L. Mann J. E. Barnard James Fowler M. E. Groover Duke Davis J. Render Terrell, Jr. Tigner E. Thrasher Ei. Y. Mallory J. N. Parker W. S. Johnston E. A. Leonard J. A. Sartain J. T. Preston E. L. Almand John W. Bennett, Jr. Russell Twitty Joel H. Terrell Jeff Gilbert M. P. Scruggs J. P. Shedd Wm. Smith J. McRae Clements E. C. Hefner Kelly McCutchen W. T. Standard C. E. Sutton A. W. Daughtry Leon Houston Terrell R. Perry, Jr. Residence Eatonton Georgetown Clayton Shellman Augusta Augusta Augusta Conyers Ellaville Sylvania Donalsonville Griffin Griffin Toccoa Lumpkin Americus Americus Talbotton Crawfordvillo Glennville Reynolds McRae Bronwood Cooledge Meigs Tifton Lyons Hiawassee Soperton LaGrange LaGrangc LaGrange Ashburn Jeffersonville Young Cane Thomaston Lafayette Lafayette Monroe Monroe Waycross Waycross Warrenton Tennille Sandersvillc Jesup Preston Alamo Cleveland Dalton Rochelle Washington Allentown Sylvester Sylvester PAINTS -- WALLPAPER -- VARNISHES 307 MULBERRY STREET TELEPHONE 326 I^ 1 MORPHEY, TAYLOR & ELLIS, INC. Real Estate Sales--Leases--Loans Property Management--Insurance All Kinds -- Surety Bonds Cherry and Third Phones 267 & 268 Macon, Ga. R. Coke Connally bn iURGHARD-CONNALLY FUNERAL DIRECTOR Efficient--Courteous--Prompt Ambulance Service 718 Cherry Street Phone 1627 4 MACON TRADING & INVESTMENT CO. CO .2 CO PHONE 293 MONEY Signature Only Required 220 GEORGIA CASUALTY BLDG. QUALITY FURNITURE AT LOWEST PRICES STERCHI Phone 3100 BROS. STORES INC. Cherry and Broadway Macon CHAPMAN'S GARAGE 24-HOUR WRECKER SERVICE DRIVE - IT - YOURSELF Rent a Car--Drive it Yourself Assn, PHONE 2951 CO 413 MULBERRY ST. 417 Broadway Rhone 5036 Truly Family NEWSpapers [he Macon Telegraph - - Macon Evening AT YOUR SERVICE EMPIRE-DIXIE COAL CO. Our Dependability -- is -- Your Guarantee Dealers in QUALITY COAL Prompt Delivery Service 5th and Plum Streets Telephone 5721 MACON, GEORGIA ! i - ' V^' BALDWIN'S AND TELEGRAPH'S MACON GEORGIA BUYERS' GUIDE CIVIC SECTION ANT) PROFESSIONAL BLUE BOOK Containing display advertisements of business and commercial establishments, industrial plants and manufacturers; cards of professional men and women; full page announcements of churches, schools, clubs, lodges, associations and other civic institutions, alphabetically classified for convenient use. The Show Window of Copyright 1935 by Baldwin Directory Co., Inc. Macon ADVERTISING (DIRECT MAIL) PHONE 4521 FOR --MULTIGRAPHING --MIMEOGRAPHING --ADDRESSING --FOLDING --SEALING --STAMPING --MAILING The Letter Shop, Inc. COMPLETE DIRECT MAIL ADVERTISING SERVICE 563 1-2 Mulberry St. MACON, GA. CREATIVE ADVERTISING IS OUR BUSINESS The creation of IDEAS to sell by Direct Mail is featured by our personnel. We have created ORIGINAL IDEAS which have increased the business of our clients to their entire satisfaction. Write our ADVERTISING DEPARTMENT for advice on your advertising problems. SOUTHERN PRINTING AND PUBLISHING COMPANY PRINTERS . . . BINDERS . . . PUBLISHERS CHARLESTON,, SOUTH CAROLINA 41 Baldwin's and Telegraph's AUTOMOBILES 1935 Macon City Directory 15 BANKS This is Macon's Bank Part of an institution which is one of the t{hree largest Banks in all the South, the Citizensj & Southern National offers Macon individuals and business houses service whose vieiopoint is strictly local, but whose scope is the result of statewide operation. Officers MILLS B. LANE WILLIAM A. MURPHEY JOHN E. WALLACE T. I. DENMARK E. C. SCOTT P. G. BLITCH C. H. USINA Chairman of the Board President Assistant to President Vice-President Vice-President and Trust Officer Cashier Assistant Cashier ATHENS MACON & Southern onal Bank No Account Too Large... Norte Too Small.} ATLANTA SAVANNAH AUGUSTA VALDOSTA 46 Baldwin's and Telegraph's BANKS The First National Bank & Trust Company In Macon Complete Banking and Trust Facilities CAPITAL $500,000.00 SURPLUS $100,000.00 WM. G. LEE, Chairman of the Board M. H. LILES, President JAS. K. HOGAN, Executive Vice-President , R. C. DUNLAP, Vice-President E. P. PEABODY, Cashier C. E. NEWTON, Jr., Vice-President and Trust Officer H. P. FLEMING, Assistant Cashier JAMES W. OLIVER, Assistant Trust Officer Member of Trust Company of Georgia Associates 1935 Macon City Directory 41 BANKS CITY BANK and TRUST COMPANY BANKING IN ALL ITS BRANCHES Strong, Friendly, Home Owned Bank Deposits Insured Under U. S. Government Plan Tels. 1755-1756 Cherry and Cotton Aves. BEAUTY PARLORS Phone 9479 352 1-2 Second St. VANITY BEAUTY SHOP Specializing in All Branches BEAUTY CULTURE Expert Operators . . . Prices Reasonable Mrs. LeRoy Long Macon, Georgia BOTTLERS Macon Bottling Company 416-420 Oak St. Phone 3266 MACON, GEORGIA NEHI BOTTLING COMPANY We Manufacture a Complete Line of NEHI Products RUMS DRY GINGER ALE 1911 Broadway Phone 9286 48 Baldwin's and Telegraph's BOXES A. M. TOMLINSON W. T. TOMLINSON TOMLINSON PAPER BOX COMPANY Manufacturers of PAPER BOXES OF ALL DESCRIPTIONS No Order Too Large or Too Small to Receive Our Prompt Attention and Delivery "What Macon Makes, Makes Macon" 513 Oglethorpe Phone 4936 BUILDING MATERIAL McNAIR LUMBER AND SUPPLY COMPANY BUILDING MATERIAL Lime ... Plaster ... Cement... Lath Wallhoard .. . Sand and Gravel Fire Brick Fire Clay 266 Fifth St. Telephones 1400 and 1401 MACON, GA. BUSINESS COLLEGES ATTEND THE BEST COURSES There are none better. Approved by National Bureau of Education, Washington, D. C. INSTRUCTIONS Backed by over 40 years of actual office and teaching experience COST One-third less than is quoted by any school offering anything like the same class of training THE MERRIMAN SCHOOL 158 Cotton Ave. Phone 6367 1935 Macon City Directory 49 CARL DOHN CABINET MAKERS ADOLPH DOHN PHILIP, H. DOHN MACON CABINET WORKS Incorporated Designers and Manufacturers of STORE, OFFICE AND BANK FIXTURES Eighth and Poplar Sts. Phone 471 Henry G. Muecke, Pres. R. E. Muecke, V. Pres. MUECKE AND SONS COMPANY Incorporated CABINET MAKERS AND MANUFACTURERS Store Fixtures . . . Show Cases . . . Beer and Bar Equipment 614 New St. Phone 636 CHIROPRACTORS Archibald England 18 YEARS YOUR CHIROPRACTOR Graduate Palmer School of Chiropractic Phone 4557 615-618 Bibb Building 50 Baldwin's and Telegraph's CHURCHES first Baptist Church Washington and Poplar Hours of Worship Morning Worship 11:30 A. M. Evening Worship--October Thru May 7:30 P. M. Evening Worship--June Thru September 8:00 P. M. Sunday School 10:00 A. M. Baptist Training Union--October Thru May 6:15 P. M. Baptist Training Union--June Thru September, 6 :45 P. M. Midweek Services Sunday School Workers' Council Inspirational Service 6:15 P. M. 7:30 P. M. Joseph P. Boone, D. D., LL.DPastor Residence 121 High St. Telephone 3050 Church Office Educational Building. Telephone 297 1935 Macon City Directory 51 CHURCHES IRt. Olive Baptist Church ('Colored ) 957 Oglethorpe SERVICES Morning Worship 11:00 Evening Worship 7:30 REV. J. H. EVANS Pastor 52 Baldwin's and Telegraph's CHURCHES tabernacle Baptist Church ORDER OF SERVICE Sunday School Morning Worship b. r. p. u. Evening Worship 10:00 A. M. 11:15 AM. 6:30 P. M. 8:00 P. M. Midweek Prayer Meeting 8:00 P. M. REV. A. C. BAKER Pastor 232 ]High St. Phone 4078 2.935 Macon City Directory 53 CHURCHES Catnall Square Baptist Cburcb CORNER OF ASH AND ADAMS ST. MERCER CAMPUS HOURS OF WORSHIP Sunday School Morning Worship 10:00 A. M. 11:30 A. M. EVENING SERVICES Evening Worship April to October 8:00 P. M. Baptist Training Union, April to October 6:45 P. M. Evening Worship October Through April 7:30 P. M. Baptist Training Union, October Through April 6:15 P. M. MID-WEEK SERVICES (Wednesday) April to October 8:00 P. M. October Through April 7:30 P. M. REV. L. H. WRIGHT, Pastor 111 Coleman Avenue Telephone 708 Baldwin's and Telegraph's CHURCHES Uinevilk Baptist Church Vineville Avenue Phone 818 Services Bible School Morning Worship B. Y. P. U. Evening Worship Midweek Service, Wednesday 10:00 A. M. 11:30 A. M. 7:00 P. M. 8:00 P. M. 8:00 P. M. Rev. J. Ellis Sammons, D. D., Pastor 208 Delaware Ave. Telephone 6105 1935 Macon City Directory 55 CHURCHES St. Joseph's Catholic Church Macon, Georgia MASSES: Sundays, June to October 7:00 and 9:30--October to June, 7:00, 9:00 and 10-30 Holidays 6:30 to 7:00--Weekdays 6:30 and 7:30 CONFESSIONS Saturdays 4:00 to 6:00 and 7:00 to 9:00 P. M. REV. PETER McDONNELL, Pastor Telephone 1428 Baldwin's and Telegraph's CHURCHES Christ Church The Oldest Church in Macon 518 Walnut St. SERVICES Sundays: Holy Communion 8:00 A. M. Church School . . 10:00 A. M. Morning Service (First Sunday Holy Communion. Other Sundays Morning Prayer) 11:30 A. M. Evening Prayer--April Thru November 8:00 P. M. Evening Prayer--December Thru March 7 :00 P. M. Other Days: Holy Communion Fridays 11 A. M. Holy Days 8 A. M. THE REVEREND MORTIMER GLOVER, Rector 518 Walnut Street Phone 4515 1935 Macon City Directory 57 CHURCHES `In the Heart of Georgia After the Hearts of Georgians" first Christian Church Corner Orange and High Streets MACON, GEORGIA EDWARD T. SMALL, B. D., Pastor 132 REMBERT AVE. PHONE 6056-J C. S. JOYNER, Chairman Official Board MRS. C. 0. McAFEE, President Woman's Council HOURS OF WORSHIP: CHURCH SCHOOL MORNING WORSHIP CHRISTIAN ENDEAVOR SOCIETY EVENING SERVICE 10 :15 A. M. ll;30 A. M. 7:00 P. M. 8:00 P. M. 58 Baldwin's and Telegraph's CHURCHES Uineville Presbyterian Church Vineville Avenue at Culver Street SERVICES Church Schools in Departments Morning Worship Vesper Service Young People's League 10:15 A. M. 11:30 A. M. 6:15 P. M. 7:00 P. M. George M. Wilcox, Pastor MANSE 102 CULVER ST. PHONE 6132 1935 Macon City Directory CHURCHES temple Betb Israel Spring and Cherry Streets SERVICES FRIDAY EVENINGS SATURDAY MORNINGS SUNDAY SCHOOL SUNDAY 8:00 10:30 10:15 ISAAC E. MARCUSON Rabbi Telephone 2095 60 Baldwin's and Telegraph's CHURCHES "THE CHANGELESS CHRIST FOR A CHANGING WORLD" I|? laratuplmtl IGutltmut (Elfurri) of tit? 2t?it??m?r Holt Avenue, Between Napier and Montpelier Avenues Macon Georgia L. BOYD HAMM, Pastor 205 Chatham Street Telephone 121 SUNDAY SERVICES Morning, 11:30 Evening, 8:00 Sunday School, 10:30 Luther Leagues, 7:00 1985 Macon City Directory 61 CHURCHES (Urntritary lilrtluiiimt (Elutrrh NINE HUNDRED-FORTY COLLEGE ST. Macon, Georgia HOURS OF WORSHIP Church School Morning Worship Epworth League EVENING September through November December through February March through May June through August SERVICE = J. A. HARMON, D. D. Pastor 219 High St. 10:15 A. M. 11:30 A. M. 7:15 P. M. 8:00 P. M. 7:30 P. M. 8:00 P. M. 8:15 P. M. Telephone 1853 63 Baldwin's and Telegraph's CHURCHES Cast lHacon ITkfbodist Episcopal Cburcb, South HYDROLIA AND CHURCH STREETS Macon, Georgia Hoars of Worship (OCTOBER TO APRIL) CHURCH SCHOOL MORNING SERVICE EVENING SERVICE (APRIL TO OCTOBER) MORNING WORSHIP EVENING WORSHIP 10:15 A. M. 11:30 A. M. 7:30 A. M. 11:30 A. M. 8:00 P. M. Midweek APRIL TO OCTOBER OCTOBER THRU APRIL Service 8:00 P.M. 7:30 P.M. WADE ELMO SCOTT Pastor 104 CHURCH ST. TELEPHONE 2458-R 1935 Macon City Directory 63 CHURCHES first Street IRetbodist Cburcb 859 First Street Hours of Worship CHURCH SCHOOL Roy Tucker, General Superintendent MORNING WORSHIP EPWORTH LEAGUE EVENING WORSHIP MID-WEEK SERVICE--Wednesday 10:20 A. M. 11:30 A. M. 7:00 P. M. 8:00 P. M. 8:00 P. M. REV. C. BYRD HARBOUR, D. D. Pastor 861 First Street Felephone 3307 Baldwin's and Telegraph's CHURCHES mulberry Street metbodi$t Church CORNER MULBERRY AND FIRST STREETS FofirGstodb,uihldaisngb- eeerneccteodntionnuotuhsislysiotcec, u1p8i2e6d. bTyhias Mcoertnheord, isdtedCichautrecdh tfdorthoevewroarshhiupnadnredd syerevaircse. EDMUND F. COOK, D. D., Pastor ALBERT C. OUTLER, Asst. Pastor Res. D-2 Vineville Court Apts. Res. 101 First St. Phone 6383 Phone 5118-R CHURCH OFFICE 717 Mulberry St. Phone 4566 Morning CHURCH SCHOOL MORNING WORSHIP Services 10:00 A.M. 11:30 A.M. Ev enin 9 Dec. 1st to Mar.- 1st Mar. 1st to June 1st June 1st to Sept. 1st Sept. 1 to Dec. 1st e r v t c es IIII 8*00 s'-30 8'00 "^^Worshi";PEOPLE S VESPER SERVICE One Hour Before Evening MID-WEEK SERVICE _ -Wednesday Evening WELCOME T-o on lonely and want"^coormnpanThiHonnEfshNiipdA--TMMtoE ^^O1w*FjJm Ev!S* UWsS-hinC^HainR?IeSteiTreddr>T^aTSnRdaTvnri>oeTeu?drr raenstd--to , awllhowmhsooeavreer 1935 Macon City Directory 65 CHURCHES Uinevilie Methodist Church VINEVILLE AND FORREST AVENUES Macon, Georgia Hours of Worship SUNDAY SCHOOL MORNING WORSHIP 10:00 A. M. 11:30 A. M. Evening Worship YOUNG PEOPLE'S VESPER SERVICES EVENING WORSHIP 7:00 P. M. 8:00 P. M. Mid-~week PRAYER MEETING Service 8:00 P. M. REV. SILAS JOHNSON Pastor 247 Vineville Ave. 66 Baldwin's and Telegraph's CHURCHES W\x&\ Pruj5bi|tmmt(!JImn;lj Mulberry and First Sts. Services SUNDAY SCHOOL 10:15 A. M. MORNING WORSHIP 11:30 A. M. YOUNG PEOPLE'S LEAGUE (Sept, thru May) __ 7:00 P.M. EVENING WORSHIP (Sept, thru May) 8:00 P.M. MIDWEEK SERVICE Same as Evening Worship REV. ALBERT G. HARRIS Pastor 112 BUFORD PLACE TELEPHONE 2025 1935 Macon City Directory 67 CHURCHES Catnall Square Presbyterian Cburcb COLLEGE AND OGLETHORPE STS. Macon, Georgia 11 oar s of Worship SUNDAY SCHOOL MORNING WORSHIP PRESBYTERIAN LEAGUES (Summer 7:45 P. M.) 10:15 A. M. 11:30 A. M. 7:15 P. M. Evening Services EVENING WORSHIP C _'_____ 8:00 P. M. (Summer 8:30 P. M.) REV. C. LOGAN LANDRUM, Pastor 426 CARLING AVE. TEL. 2496 68 Baldwin's and Telegraph's CIVIC INSTITUTIONS JH$ibab Cemple n. a. o. n. m. s. U. T. WINSLETT Potentate R. G. WILLIAMS Chief Rabhan J. FREEMAN HART Assistant Rabban R. C. CROPPER High Priest and Prophet H. G. HOLLINGSWORTH Oriental Guide F. H. WILLIAMS ' Treasurer C. R. McCORD Recorder i t 715 Poplar St. 1935 Macon City Directory Telephone 1667 69 CIVIC INSTITUTIONS Joseph N. Neel, JrPost No. 37 AMERICAN LEGION GEORGIA DEPARTMENT Macon, Georgia BEN T. WATKINS Commander GROVER C. JONES First Vice Commander LESTER GRADY __ Second Vice Commander JULIAN T. POOL __ Adjutant J. W. WILLIS Finance Officer WARREN JONES _ Service Officer A. C. BAKER Chaplain NOLAN McCRARY _ Sergeant-at-Arms J. J. McCRARY Historian Meets the Second and Fourth Tuesday in Each Month at 8:00 P. M. AMERICAN LEGION AUXILIARY MRS. J. H. SIGMAN President MRS. J. HOLMES CLARK First Vice President MRS. ROBERT BONNER Second Vice President MRS. ROY KENNEDY Secretary MRS. J. T. McGOLDRICK Chaplain Meets 2d Friday in Each Month 11:30 A. M., American Legion Home 221 Forsyth St. Macon, Georgia Tel. 6298-J 70 Baldwin's and Telegraph's CIVIC INSTITUTIONS Boy Scouts of America CENTRAL GEORGIA COUNCIL EXECUTIVE BOARD HUGH QUIN T. BALDWIN MARTIN BRUCE C. JONES V. CARL SULLIVAN President Commissioner Treasurer Scout Executive W. M. WEAVER, Jr. L. T. BERND W. A. HARRIS H. D. CHAPMAN J. D. CRUMP THOS. HARROLD D. H. ADAMS A. A. BENEDETTO CHAS. H. DAVIS; PEYTON W. JONES C. D. McCOWEN P. T. ANDERSON MORRIS MICHAEL JAS. H. PORTER G. F. OLIPHANT ED. F. COOK C. C. HARROLD PAUL R. ANDERSON H. H. MITCELL W. H. MITCHELL W. P. FLEMING COUNCIL HEADQUARTERS Court House Phone 2581 DO A GOOD TURN DAILY 1935 Macon City Directory 71 CIVIC INSTITUTIONS Woman's Club OF MACON Baconsfield Clubhouse MRS. JOHN SELDEN MRS. BRUCE CARR JONES Historian Parliamentarian Regular Meeting Second Friday in Each Month at 3:30 P. M. Meeting of Executive Board First Friday in each Month at 11:00 A. M. Business and Professional Women s Club MRS. ELLAMAE ELLIS LEAGUE MAIME VINSON MRS. ADA PLATT MRS. LEE BARRON MRS. AGNES FREENEY President Vice President Recording Secretary Corresponding Secretary Treasurer Meets the First and Third Thursdays in Each Month at 6:30 P. M. Pilot Club International THELMA PETERSON LOUISE YEAGER LUCILLE JOHNSTON MRS. MARGARET JONES MRS. ANN LUCAS MAMIE WEISZ MRS. ALMA STUCKEY _ VERNA DWYER President First Vice President .-Second Vice President Third Vice President Recording Secretary Corresponding Secretary Treasurer Historian Meets First and Third Tuesdays in Each Month at 6:30 P. M. 72 Baldwin's and Telegraph's CIVIC INSTITUTIONS CIVITAN CLUB Builders of Good Citizenship MACON, GEORGIA DENNIS F. BROWN WM. A. BOOTLE PAUL J. DOSTER WALTER T. JOHNSTONE ROY G. WILLIAMS President Vice President Secretary and Treasurer Sergeant at Arms Chairman of Board Meets Each Friday 1:15 P. M. at Dempsey Hotel 1935 Macon City Directory 73 CIVIC INSTITUTIONS Macon Lodge 230 B, P, O, E, W. F. CRUTE EUGENE HORNE _ W. E. RYALS KENMORE BURNS B. J. FOWLER OSCAR BRADLEY W. H. DuBOSE W. E. MOBLEY ___ DON W. RAMSEY OSCAR BRADLEY _ AUGUSTUS DALY JAMES McCARDLE Exalted Ruler ..Esteemed Leading Knight Esteemed Lecturing Knight Esteemed Loyal Knight Chaplain Outer Guard Inner Guard Secretary Treasurer Tiler Esquire Organist Board of Trustees B. H. THARPE, Chairman W. T. WILLIFORD A. FOY BOONE Meetings First and Third Friday Nights of each Month at 8 :00 P. M., except June, July and August, during which time meetings are held the First Friday of each month at 8:00 P. M. CLUB ROOMS OPEN 8 P. M. to 9 P. M. Visiting Brothers Welcome 127 COTTON AVE. MACON, GEORGIA Telephone 9229 74 Baldwin's and Telegraph's CIVIC INSTITUTIONS Exchange Club Qf MACON, GEORGIA OFFICERS Flournoy J. Everett, President B. F. Merritt, Vice-President Frank Vincent, Treasurer Charles M. Cork, Secretary Georgia Casualty Bldg. Tel. 4806 Members of Board of Control DR. 0. R. THOMPSON, Chairman M. C. PITTMANN DR. W. W. CHRISMAN C. E. STEVENS EVERETT EDWARDS JAMES WALTON c. o. McAfee TOM M. JONES L. U. BLOODWORTH 1935 Macon City Directory 75 CIVIC INSTITUTIONS THE Rotary Club of MACON, GEORGIA W. ELLIOTT DUNWOODY W. D. ANDERSON, JR. IvELLY P. ALLEN FRANK F. JONES P. L. HAY, JR. President Vice-President Treasurer Secretary Sergeant-at-Arms Directors J. D. CRUMP R. C. CROPPER EDWD. T. FLANDERS J. CLAY MURPHEY DURWARD WATSON ARTHUR P. BARRY MEETS AT ROTARY HALL, 453 CHERRY ST. EACH WEDNESDAY 1:10 P. M. 76 Baldwin's and ..Telegraph's CIVIC INSTITUTIONS Character Building Evangelism Social Welfare (EIjt i>aluatuut Armg CAPTAIN and MRS. H. V. LEVICK Officers in Charge Advisorg Board ROY NEAL J. FREEMAN HART REV. M. GLOVER H. P. FLEMING President Vice-President Secretary Treasurer EUGENE BURDEN REV. BOYD HAMM PEYTON W. JONES TOM M. JONES HENRY KOPLIN MRS. ZULA McCORD DR. HARRY MOSES DR. C. L. RIDLEY MRS. W. E. STEWART BEN WATKINS B. E. WILLINGHAM RED SHIELD LODGE 614 Mulberry Street CITADEL 616 Mulberry Street Phone 2326 MACON, GEORGIA 1935 Macon City Directory 77 CIVIC INSTITUTIONS Central City College Macon, Georgia f Central City College is a Junior College, operated, by the General Mis-' sionary Baptist Convention of Georgia, aided by the Georgia Baptist Convention (white) and the Southern Baptist Convention (white), but particularly by a board of Southern white men known as the Advisory Board, of which Mr. James H. Porter, Vice-President of the Bibb Manufacturing Co., is chairman, and Attorney Arthur Lewis, a Macon lawyer, is Secretary and Dr. W. G. Lee, active Vice-President of the First National Bank of Macon, is treasurer. Central City College is a co-educational institution. Organized to prepare young women, boys and girls to serve in an effective way as religious and civic leaders among Negroes of America and foreign lands. The College is located on! the Clinton Road, one and a half miles from the business section of Macon. The College owns 235 acres of beautifully located land, on which is operated the College farm. Foodstuff to furnish the boarding students with milk, fresh vegetables and home-raised meat is the objective. The farm is in charge of a trained agriculturist. The College operates a four-year High School, Junior College and Ministerial Departments. Special attention is given to domestic science and Mechanical training. The charges for board and tuition are very reasonable. A limited number of students are permitted to work out a part of their expenses. FOR INFORMATION WRITE: Rev, J. H. Gadson, D. DPresident of Central P. O. Box 233, Macon, Ga. 78 Baldwin's and Telegrapfo's CIVIC INSTITUTIONS Mercer University MACON, GEORGIA {Established 1833) Coeducational OFFERS: Junior College Certificate, Bachelor of Arts, Bachelor of Science, Bachelor of Laws, Master of Arts and Master of Science Degrees. For Catalog Address: THE REGISTRAR 1935 Macon City Directory 79 CIVIC INSTITUTIONS Georgia National Guard MACON UNITS 30th Div. Hdqrs., Maj. Gen. H. D. Russell Commanding 59th Brigade Hdqrs. Co., Capt. M. A. Hilsman Commanding Service Co., Capt C. F. Chapman Commanding 121st Inf. Med. Detachment, Maj. R. C. Goolsbg Commanding 121st Inf Hdqrs., Lt. Col. F. A. Whitaker Commanding 1st Bat., 121st Inf. Hdqrs., Maj. J. W. Barnett Commanding Hdqrs. Co. 1st Bat. 121st, Lt. W. F. Geeslin Commanding Co. C, 121st Inf., Capt. D. C. Harris, Jr. Commanding Co. D, 121st Inf., Capt. M. A. Meath Commanding Band 121st, Warrant Officer Rog Atkinson Commanding ARMORY 506 1SF 80 Baldwin's and Telegraph's CIVIC INSTITUTIONS CITY OF Mt' AC ' ; ON CITY HERBERT I. SMART CALDER B. CLAY MRS. VIOLA R. NAPIER R. W. EVANS E. W. MAYNARD DR. B. W. GREENE ___ WATSON WALKER ___ DAVID S JONES HALL Mayor Mayor Pro Tem Clerk Treasurer City Attorney City Physician City Engineer Purchasing Agent Aldermen SAM S. CHANDLER DeWITT McCRARY J. MILTON HEARD A. J. FLOWERS H. W. PITTMAN HARRY D. CHAPMAN CHARLES L. BOWDEN E. R. LAYFIELD B. I. WALLER, JR. HENRY HARRIS CALDER B. CLAY C. GRAY WALDEN 1935 Msicon City Directory 81 CIVIC INSTITUTIONS BIBB COUNTY Georgia $ Courts HON. M. D. JONES Senior Judge, Superior Court HON. W. A. MeCLELLAN Judge, Superior Court HON. W. C. STEVENS Judge, Court of Ordinary HON. P. 0. HOLLIDAY Judge, Juvenile Court CHARLES H. GARRETT Solicitor General for Macon District, Superior Court A. E. BARNES and CLAUDE JOINER Court Reporters B County Commissioners J. E. YATES -- W. H. WEAVER T. W. CLIFTON L. S. DURE ___ T. M. RAINES . Chairman Vice Chairman Clerk Member Member County Officials J. R. HICKS, JR. Sheriff U. T. WINSLETT Tax Collector D. D. DUNWOODY Tax Receiver P. H. SANFORD Tax Assessor A. F. NEWTON Tax Assessor F. C. BENSON Tax Assessor MRS. AGNES L. FREENEY Treasurer H. D. CUTTER Surveyor W. P. JONES Superintendent Board of Education HARRY E. PAPE Probation Officer T. J. McCOMMON Jailer W. H. HYSLER Superintendent of Building Baldwin's and Telegraph's CIVIC INSTITUTIONS Bibb County Board of Education Officers J. E. HALL WALLACE MILLER W. T. MORGAN J. N. NEEL President Vice-President Secretary Treasurer Members W. T. ANDERSON J. E. HALL LEE M. HAPP J. H. PORTER J. H. HEARD W. T. JOHNSON WALLACE MILLER JOHN T. MOORE W. T. MORGAN J. C. MURPHEY J. N. NEEL A. R. WILLINGHAM Ex-Officio Members HON. WALTER C. STEVENS ~ HON. HERBERT SMART "V HON. MALCOLM D. JONES :.~fc hon. w. a. McClellan 1935 Macon City Directory 83 COAL DEALERS CLAUDE TRAWICK COAL CO., INC. Red Cardinal and Silver Star Coals and Coke 201 Edgewood Ave. Phone 59 COFFEE C. D. KENNY CO. 320 Oglethorpe Street Teas . . . Coffees . . . Sugars Phones 1936-1937 CITY DIRECTORIES Americas Finest Directories PRODUCED BY THE NATION'S FASTEST GROWING DIRECTORY PUBLISHERS Baldwin Directories are published in selected cities throughout the South in association with local newspapers and commercial organizations. Volumes carrying the Baldwin name are uniformly accurate, attractive and satisfactory. Comparison with directories published by other firms will show the superiority of the Baldwin product. An established organization, financially sound, alert to progressive ideas, and capably managed--* Baldwin Directory Co, Incorporated 125 Meeting Street CHARLESTON, SOUTH CAROLINA 84 Baldwin's and Telegraph's DEPARTMENT STORES DANNENBERG'S Macon s Foremost Department Store Phone 6400 Over 60 Complete Departments MMBSDTPHChrooiroeeegoyuinnslsesagei''c'sessrtsrsriy-WpCGFCtuloiieoogroatnndahrisrsisenhtgtiensgs MAIN FLOOR HGUAGJRSSeitaliimrwlaobftnvttvbbsedieeGoorlrbsernnwoaylselogaardrssyes Optical CUPGEYahlnlaeatirdtcnsdeetsarrrwwinwcGasaaerorlaeeordDs epartment DCSoaodfmeateesFrtiioacusnt WWoommeenn''ss CDoreastsses Furs Corsets and Brassieres SECOND FLOOR CBoatthtoinng-DSrueistss aSnhdopAccessories BMCheilailluidntryeerny'PsarWlorear IFEnulferacnntirttsiuc'reDReefpraigrtemraetnotrs Knitting Sphool Ladies' Rest Room DFTlrrouaopnrekrsCieosavneadrnindBgsRagusgs THIRD FLOOR Interior Decorating Window Shades Slip Covers Art Portrait Studio General Offices Wholesale Department AABTiuuarttteootserOyaAinlcRsdceescTshuoabrriegessing Hardware HWoaussheinfugrnMisahcinhginses AVuactouuSmeaCt lCeaonveerrss Bathroom Fixtures BARGAIN BASEMENT PEGrlaeercsdsterunirce SICruoopnopeklireesrss Paints and Varnishes CTASRDhaoeueloycltlioeesviCevRriBoyneuagpnDtattReieerrorpiinoeagmsrtment SUhnodeesrwear and Corsets HWPCihoeoiscmlideeerrenyGns'osoCdCosaotaastnsdanandDdoDmDreersestssisecesss Millinery BMWoeoynrs'k's CCClloloottthhhiiinnnggg && FFuurrnniisshhiinnggss 1935 Macon City Directory 85 ELECTRICAL CONTRACTORS EVES ELECTRIC (A. C EVES) CO. ELECTRICAL CONTRACTORS LIGHTING FIXTURES AND SUPPLIES 258 2nd Street Telephone 77 Macon, Georgia FUNERAL DIRECTORS 86 Baldwin's and Telegraph's FURNITURE Furniture Values Frigidaire and Ctosley Electric Refrigerators Electrolux Gas and Kerosene Refrigerators RCA and Philco Radios Sterchi Bros, STORES, INC. Phone 3100 Cherry and Broadway 1935 Macon City Directory 87 FURNITURE JOHNSON BROTHERS THE FURNITURE MEN Exclusive Dealers Estate Heatrolas and Gas Ranges Simmons Beautyrest Mattresses 461-463 Second St.--Near Poplar St. Tel. 2018 HARDWOOD FLOORS R. L. CLARKE CO. 1218 Broadway HARDWOOD FLOORS .... SCREENS WEATHER STRIPS . . . VENETIAN BLINDS ASPHALT TILE FLOORING Office Phone 5724 Residence 2765-J HOTELS ARLINGTON HOTEL T. 0. MOSELEY, Prop. Modern and Reasonable A N N E X 507 BROADWAY Visit the Old South Museum . . . Four Rooms, Rear of Lobby SF*4, 100 Rooms " --Rates $1.25-$2.00-- CENTRAL HOTEL Broadway at Mulberry Excellent- Coffee Shop Free Storage V -88 Baldwin's and Telegraph's HOTELS 1935 Macon City Directory 89 INVESTMENTS 90 Baldwin's and Telegraph's LAUNDRIES "Established 1900" CRESCENT LAUNDRY CO. LAUNDERERS, DRY CLEANERS AND DYERS "KNOWN FOR QUALITY WORK" 519 SECOND ST. PHONE 16 Independent Laundry Co, CLEANERS AND DYERS LINEN SERVICE Phone IOOO (See Classifications) 1935 Macon City Directory 81 LAUNDRIES SNOW'S LAUNDRY & DRY CLEANING CO. "Clean With Snow" POPLAR & NEW STS. PHONE 6000 LUMBER SHERWOOD LUMBER COMPANY Manufacturers of Hardwood and Pine Lumber PHONE 1763 MIKADO PLACE MANUFACTURERS KUHN MANUFACTURING CO. Janitors' Supplies Fly Spray--Disinfectants--Soaps--Brooms--Mops Deodorants--Chemicals Sweeping - Compound 314 Broadway MACON OWNED Phone 3628 MOTORCYCLES AND BICYCLES CLIFF WALKER Phone 4679 CO. HARLEY-DAVIDSON MOTORCYCLES "King of the Highways" COLUMBIA BICYCLES "America's Best Bicycle" "SALES AND- SERVICE" 515 Poplar St. 93 Baldwin's and Telegraph's NEWSPAPERS HOW MANY IN YOUR FAMILY? ALL WILL ENJOY READING THE MACON TELEGRAPH AND MACON EVENING NEWS -- THEY ARE FAMILY NEWSPAPERS. NEWS OF THE WORLD--BUSINESS, POLITICAL AND FINANCIAL FOR DAD NEWS OF FASHIONS, SOCIETY AND STORE NEWS FOR MOTHER . . . SPORTS AND SERIAL STORIES, TOO, FOR OLDER SONS AND DAUGHTERS. SPECIAL FEATURES FOR THE YOUNGSTERS, WITH DAILY COMIC STRIPS TO DELIGHT BOTH YOUNG AND OLD . . . AND 16 PAGES COLORED COMICS EVERY SUNDAY . . . YES, WE BELIEVE THAT YOU WILL AGREE . . . Every Member of the Family Will Enjoy TheT elegraph and Evening News They Are Truly Family NEWSpapers Macon Evening --AND-- News The Macon Telegraph 1935 Macon City Directory Telephone 6500 93 OFFICE SUPPLIES THE OFFICE SUPPLY HOUSE OF MACON Carries a Fine Stock of Art Metal Fireproof Cabinets and Files The Best of Desks, Chairs and Files in Wood and Steel Also Headquarters''for Kodaks--Golf--Tennis and Other Sporting Goods t Do Not Fail to Call on THE J. W. BURKE CO. Phones 74 and 75 406 Cherry St. ANDREW W. McCLURE, Pres. & Treas. CHARLES W. BALDWIN, Vice-Pres. L RUSSELL F. BRIGGS, Sec. MC CLURE OFFICE EQUIPMENT COMPANY OFFICE OUTFITTERS Exclusive Agents for A. B. Dick Mimeographs and Supplies TELEPHONE 903 560 MULBERRY ST. PACKERS T. & T. PACKING CO. Manufacturers of Pride and Dixie Hams . .. Bacons . .. Sausage "We Buy Hogs and Cattle" Telephones 1875-1876-1877 Boundary and Division Sts. PAINTS FACTORY DISTRIBUTORS Paints ... Varnishes ... Brushes ... Wallpaper SCHALL 307 Mulberry St. PAINT CO., INC. Phone 326 94 Baldwin's and Telegraph's PHOTOGRAPHERS BON ART STUDIOS, INC. Photographs of Quality Portraits and Commercial Photographs 362- 2nd Street Telephone 3826 MACON, GEORGIA PRINTERS PRINTING -- BOOKBINDING -- RUBBER STAMPS The Largest and Best Establishment in This Section Is THE J. W. BURKE COMPANY 406 CHERRY STREET With Improved Typesetting Machines and Automatic Presses We Are Prepared to Handle Promptly and Satisfactorily Any Kind of Work in Our Line Direct Advertising a Specialty Satisfaction Our Guaranty COGGIN & MANN QUALITY PRINTING ENGRAVED VISITING CARDS--WEDDING INVITATIONS and ANNOUNCEMENTS Service and Quality at the Right Price 618 POPLAR ST. PHOE 5080 HOLT & HANBERRY Commercial Printing TELEPHONE 3106 367 BROADWAY BIBB BLDG. 1935 Macon City Directory 95 PRINTERS CHARLES S. JONES CHARLES L. CONEY Jones & Coney COMMERCIAL PRINTERS "YOUR WORK DELIVERED WHEN PROMISED" Telephone 3087 411 Broadway MACON, GA. MURRAY PRINTING CO. High Class Commercial Printing LETTERHEADS--PROGRAMS Prompt, Efficient Service Phone 4491 47iy> Third St. 96 Baldwin's and Telegraph's REAL ESTATE A. T. HOLT CO. REALTORS Personal Service Real Estate and Renting Agents Also Specialize in Sales and Leases on All Classes of Property 569 MULBERRY ST. PHONES 946 and 947 Murphey, Taylor & Ellis, Inc. REALTORS REAL ESTATE RENTAL AGENTS COMMERCIAL LEASES SURETY BONDS INSURANCE ... ALL LINES CHERRY AND THIRD STS. PHONES 267 and 268 1935 Macon City Directory 97 RIDING CLUBS Rivoli Riding Club F. Wade Stepp Prop. Excellent Saddle Horses for Hire at Reasonable Rates. Courteous, Capable Attendants. Private Instructions Beginners. Special Attention to Children. VISITORS WELCOME Just a STEPP off the Highway -- Across Forsythe Road from Idle Hour. Telephone 222-J ROOFING CONTRACTORS GEORGIA ROOFING & SUPPLY COMPANY ROOFING CONTRACTORS and DISTRIBUTORS 306 Oglethorpe St. Phone 3121 MACON, GEORGIA Barrett Approved Roofers Albert E. Sheridan, Mgr. Recover Right With EVERLOX SHINGLES 36 MONTHS TO PAY BARRETT MONTHLY PAYMENT PLAN We Do Work Anywhere in Georgia 98 Baldwin's and Telegraph's TATNALL SQUARE THE FOLLOWING TATNALL SQUARE BUSINESS FIRMS WELCOME YOU TO THEIR COMMUNITY WHERE QUALITY AND SERVICE PREDOMINATES 1935 Macon City Directory 99 TRANSFER America's Finest Directories PRODUCED BY THE NATION'S FASTEST GROWING DIRECTORY PUBLISHERS Baldwin Directories are published in selected cities through out the South in association with local newspapers and com- mercial organizations. Volumes carrying the Baldwin name are uniformly accurate, attractive and satisfactory. Comparison with directories published by other firms will show the superiority of the Baldwin product. An established organization, financially sound, alert to progressive ideas, and capably managed-- Baldwin Directory Co, Incorporated 125 Meeting Street CHARLESTON, SOUTH CAROLINA - -------------- ' -- -i.n--i .1 --. - " 10# Baldwin's and Telegraph's LAWYERS CHARLES AKERMAN ATTORNEY AT LAW 409 Georgia Casualty Bldg. Telephone 369 Macon, Georgia MALLORY C. ATKINSON ATTORNEY AT LAW 409 Georgia Casualty Bldg. Telephone 369 Macon, Georgia HALLIE B. BELL LAWYER 320 Georgia Casualty Bldg. Phone 1817 CARLISLE & BOOTLE J. DOUGLAS CARLISLE LAWYERS WM. A. BOOTLE 501-03 Macon Savings Bank Bldg. Tel. 664 LAW OFFICES CORK & CHARLES M. CORK 901 Georgia Casualty Bldg. CORK CHARLES S. CORK Phone 1 1935 Macon City Directory 101 LAWYERS LAW OFFICES FEAGIN & FEAGIN R. DOUGLAS FEAGIN JOHN ELIOT FEAGIN 1-2 Hardeman Building Phone 193 L. THOS. (PAT) GILLEN LAWYER 318-20 Bibb Bldg. Tel. 5050 HARRIS, RUSSELL, HOPPER & WEAVER ATTORNEYS and COUNSELLORS AT LAW WALTER A. HARRIS JOHN B. HARRIS H. D. RUSSELL JOSEPH W. HOPPER A. H. S. WEAVER Georgia Casualty Building Phones 4861-4862 LAW OFFICES JACKSON & JACKSON J. MILLARD JACKSON EMMETT L. JACKSON 201 Bibb Building Phone 2241 102 Baldwin's and Telegraph's LAWYERS LAW OFFICES JONES, JOHNSTON, RUSSELL & SPARKS Edward P. Johnston Bruce C. Jones C. Baxter Jones Carl S. Oliver Phone 96 Scott Russell A. 0. B. Sparks Geo. S. Jones, Counsel Robert Bruce Jones Edward L. Benton Georgia Casualty Bldg. ARTHUR LEWISi ATTORNEY-AT-LAW Tel. 2681 Washington Block LAW OFFICES MARTIN, MARTIN & SNOW Fred R. Martin T. Baldwin Martin Cubbedge Snow M. G. Edwards, Jr. Phone 4731 618-626 Bibb Building LAW OFFICES MILLER & LOWREY WALLACE MILLER 353i/2 Third St. JAS. A. LOWREY, JR. Phones 3151 and 3152 GEORGE M. NOTTINGHAM HARRY E. NOTTINGHAM NOTTINGHAM & NOTTINGHAM LAW OFFICES 409-410 Georgia Casualty Bldg. MACON, GEORGIA Telephone 1147 1935 Macon City Directory 103 LAWYERS DENTISTS W. B, CHILDS, D.D.S. ORTHODONTIST Office Hours: 9:00 A. M. -- 12:00 Noon 2:00 P.M. -- 6:00 P. M. 701-08 Ga. Casualty Bldg. Tel 4341 104 Baldwin's and Telegraph's DENTISTS 1933 Macon City Directory 103 DENTISTS DR. B. H. SPURLOCK DENTIST 507-508 Bibb Building Phone 751 $ PHYSICIANS 106 Baldwin's and Telegraph's HOW MANY IN YOUR FAMILY? ALL WILL ENJOY READING THE MACON TELEGRAPH AND MACON EVENING NEWS -- THEY ARE FAMILY NEWSPAPERS. NEWS OF THE WORLD--BUSINESS, POLITICAL AND FINANCIAL FOR DAD NEWS OF FASHIONS, SOCIETY AND STORE NEWS FOR MOTHER . . . SPORTS AND SERIAL STORIES, TOO, FOR OLDER SONS AND DAUGHTERS. SPECIAL FEATURES FOR THE YOUNGSTERS, WITH DAILY COMIC STRIPS TO DELIGHT BOTH YOUNG AND OLD ... AND 16 PAGES COLORED COMICS EVERY SUNDAY . . . YES, WE BELIEVE THAT YOU WILL AGREE ... Every Member of the Family Will Enjoy The Telegraph and Evening News They Are Truly Family NEWSpapers Macon Evening --AND-- News The Macon Telegraph Telephone 6500 YATES MOTOR COMPANY SAVE TIME AND MONEY -- USE -- Baldwin's and Telegraph's Macon City Directory m A CHANDLER & STRICKLAND CO. Insurance Counsellors Fire--Tornado--Burglary--Full Coverage Auto Insurance Complete Facilities for Every Kind of Insurance at a Savings Under Dividend-Paying Policies Second Floor Ga. Casualty Bldg. Phones 426-427 u I THE DUNLAP ROOFING COMPANY Contractors and Dealers Building 'Specialties--Fire Extinguishers--Overhead Doors Termite Exterminators--Composition and Asbestos Roofing--Rockwool Insulation--Floor Covering PHONE 1400 Office and Warehouse 266 Fifth St. Truly Family NEWSpapers THE MACON TELEGRAPH cn MACON EVENING NEWS THE FIRST NATIONAL BANK & TRUST CO. ' IN MACON gxn COMPLETE BANKING FACILITIES CO TELL THEM AND YOU WILL SELL THEM -- USE DIRECT MAIL -- Consult > SOUTHERN PRINTING & PUB. CO. CHARLESTON, S. C. C. W. FARMER TELEPHONE 213 RUBBER BELTING -- HOSE PACKING 419 POPLAR STREET BALDWIN'S AND TELEGRAPH'S MACON GEORGIA Resident Directory 1935 Containing the full name, husband or wife's name, number of children under 16, designation of home ownership, position and employer and home address of all persons over 16 years of age, resid- ing in Macon and environs The publishers wish to express their appreciation to the business and professional establishments for the splendid co-operation and valuable assistance given them in the preparation of this volume. A list of the abbreviations used in this directory will be found on page 108 and a general index on page 3. The information herein contained waa taken by trained enumerators in a house-to-house canvass of the city and adjacent territory and checked with material supplied by employers. The publishers offer it as the most reliable information available but do not assume any responsibility for errors. For Population of Greater Macon see Page 2 Below are listed abbreviations for suburbs and settlements included in this volume: ECBCaherulselmtreovMpkuseaeecPoHanrekights-ECCMHBP NLInoaggpiieCesriadHbeienigHhetsigL_hCNtsHHtts1s NPSoaoyurttnhhe HMMiagiclhloslnands. PNSMMH Stinsonville S WUVnienisoetnvevirlnilleleHeights.WHVU On the page following are listed other abbreviations used in this volume COPYRIGHT 1935 BY BALDWIN DIRECTORY CO., INC. ABBREVIATIONS aacdcvnt aadccvoeurtnistainngt aaaAaaaaaaaaabbabbbabbbbbbbbbbbglggppusvrstegutklklelkrlldrmlrndktcdskcrrsyvktptettkdbpgymolngyhtdr--smdmrlnrmyttkdnnArrirtmh--earbb.ibabbagacoaabbsobulogarapipasaaboriotlrongtaApobcaboicersatouk,aktcaabaecurberkrcsumbkmtalkgkbgeumtvoenhiatielusirermbeewsantabileloydeegavmriddimnudaamteltlntnrltbanoineaeoaiiealeyddkiipriticonneienuanrcencacncoanncteeeeleydyngyknhndaneeghektltrttrtrrrr b(cbcrat)olbgstmkr cabinbebcrtomootlttoahlkrieneerdgsr ccccccccdecccdcccccdcdccdcchaohlaihhloolrtieoeooooitiiovknressrrrsrilaflmpnmnnnrpltdhrpurtfdost.nlrrr.ftcnlo--thccecccdhosoodoceicccn,nrmmoiphoafoscsddcnaenparmmcoctpcdleitcprrcudaoallchrr.riutcletilce.oecaestfasmuctiusieuccrrciachvfoontrhcccshceclcrttrerhninieeeiniuctttttitcitidvinouooeooeeeoereroanelcerhiikygennrrrrrrflrrrrtrrlttrt div division ddddooirrm dsriavmed,eo,mddedreaiisvtltteeiocrr ddedelrrsesftctmbstmkr rnel--e--cdtdrdriierscsat,srfmitbsmauekataoesnrrt eeeemlnleegvpctn eeefffffefffffldeonoxixxtnrtgrtrrrprtcstgmymywdhhvrnnnr engfeionleeeereeexfmfeelnxfcfeeleofwclofiattgxrapeecrnrherug,orenclvtpeifniafornacmfmimtsgiarlindtooyvgidoehcittageaanaeoorehrsaoeendynyneenesrrtlrtrr ffggghhhghhhhhiiiiuunnnend_rdnsdowtlrroncspses_sswgsnnnyltpr.hprrr.--rof.ruum.grs.nersohiicsonehlcrdeii,hoifegnndnhuarrhassggps,ihrrhotuhrgprdneorredhgaoserhhonuewiriaenpoolctwagoocecpunnoiguaettmrmhtteaerodcearrseoateryevdeeess!rrsrlr int--deincterior decorator int rev kl,l.ljIliianniwbrapnbddrnrolrrrysinternallarlluj.ielaleinknauvajuwoebudnmenetonerniydtpbelriuoperoseeeeryresrrrr mmmdaemcscehhachinmiset,rmcmhecaahcnhadininsieec mechl mechanical mmmMmmmmmmme--ffngeklekjgdrdnrtrtrrmr --edmimcMaaaln,enumturfmmoafmemamecparmocditconluautiahllamucrriilkagintkdirnanaeneeeeengnertrrrrt nmmmmpMNnPnPp(ooooohdppfrusast)ucaSplrrOnttstrrrlgm.rm.Pu.psuhihbcPoalp,mimorhcmmNesoaeontsSpMpruamapsummceoesnctoOpemiuhairdwnynfoooacfoaostfd,egfsrcbniunitttoialitcaooeeiecaaeethlsnerrererrsrllrrt pphhoytsog .phoptohgyrsaipcihaenr pppppppppppppppkikrrttlllrlrrnmsgeirmsoosrnthstfdfrbrbbdgrr -- prppepppppplrsprrlpulooserppairumafnoflsisarmeiepniicdpitscbdneslnetiuhbakaispidetrtnnceerecoeneeaekerggrerrrlrrrt pputrbnmkprattern mpuabkleicr ppuubbllr ppuubblilsihshinegr purch purchasing rrRrrr(edeerp)spD'r RrreuespirdarelersserD,eseniepdrtloaaierrvoitoneriemvcaearedryesr rrrrReleeettsdevtsrt rreReaseltvraeeeurtsrerietrtaanaentiddelt R R Railroad RRsssssssRecahleyysrhvciaMwvpilnSway Railway MsaalsielseshscSwsairseepsvoecrropivthmvnauioiinrcgactoyhgeensl sslmsmstnrs sesaamlesstmreasns sssssssssstssssstttteloetttpuuuecouewtttsedaectmlcrllrhplpprmenetrrhgtrvccefgghhotrr--rmn.isncsaauslltep,.sesssetsntwterteuteosimereanscpitesgllttaomsthsseaeteueocsreepnsotlgnpnraruahtnaifervecdgyichrpacpmitrdctciaieitapigohhapteseittiopoeareanoeceaoeetlndnhynnyrrnrleerrrrrt tttttttttuUUuUemonrrrrrSpnekaxkabdUShktdSSavnrraonpwstdAtskMlirer.tkrs.erttdtC--errUMaxa--SnttnnraiuttusuislarUiftpenmpictetetnhnekrdordreetesatoiw,erortktavtlSderuebCAsaoestedrntactateruoliaerickdkpvikmortrrnceeeeeepeeenogyrsrrrrrsrr U USniNted States Navy vet veterinary vwwwvwwywwwy-uddnkkihhtpdlcmsorscrheelsmstrn.v.i.c.y.ewwav-wrpuaadhrltrcwemwceowawshhlooianeimoywdomdrssiuakezraoteaakrseneelwsndneesrrrtt PROBER NAMES AAACllbafertxh Arch Arth Benj ACAlaebtxhAraaelnhrfidarnemeedr EECDldhaiwzansl Archibald Eug Arthur Fredk Benjamin Geo ElECizDdhawaabnraeliretehdsl JKJMoaassatrhgt Eugene Michl Frederick Nathl George Patk t.KMataJhJroeagsrmaeirnpeehest Michael Nathaniel Patrick RSWSTTRSoahhtiomeclmeobphosithd TSSRTWhSoRtehiaelcioooolmphldmbmhiauoaeeoramerrdnnestl ABBREVIATIONS FOR FIRM NAMES Central of Georgia Ry CCiittyy PFoirlieceDDeeppaartrmtCmeenontft--G._aCCFPRDDy Coleman-Meadows-Pate Co FeldieefraAl dEmmineirsgterantciyoCn--R-MeF--EPRCAo Georgia, Southern & Florida R R GS&FRR HoCmoerp Owners Loan HOLC Macon, Dublin & Savan- nah R R MD&SRR Penney J C Co Penney's Southern Railway System So Ry Willingham Sash & Door Co Willingham S&D Co Woolworth F W WCooolworth's EXPLANATION All people sixteen years or over are listed. Wives are listed with husbands, the wife being shown in parenthesis as followsSmith Robt R (Mary L). The number of children under sixteen years is shown after the wife's name as follows: Smith Robt R (Mary L) 3. The (o), both in the resident directory and the householders' directory designates ownership of the home. In case of a natural widow this fact is shown with the name of the deceased husband in parenthesis, whenever possible, as follows: Smith Mary L (wid Robt R). The occupation and place of employment are shown as follows: Smith Robert R (Mary L) elk Hub Clothing Co. The reseidence of each person is shown, "h" denoting a householder or head of the family, "r" denoting people in the home. Only one person at each home should be shown with the "h." Thus, a circular mailed to each householder will reach every home in the city. Married women, engaged in some other occupation than housekeeping, are listed individually in addition to their regular listing with their husbands as follows- Smith Mary L (Mrs Robt R) bkpr Henry Jones & Co r 210 Main. Names in heavy type denote patrons of the directory and are usually the leading firms in each line of business. The words "street" and "avenue" are understood. (oc) denotes that the person lives outside of city limits. Persons marked RD. living outside the city limits and receiving mail in the countryJ are Colored is shown by a (c). The publishers are very careful in using this, but do not assume any responsibility in case of error. This directory contains all the regular departments of the modem city directory and many features used by no other publisher in the United States. A numerical telephone directory each telephone according to number. will be found in the back of the directorJy listinSg The classified business directory lists each firm according to line of buainess. Tbe numerical street directory lists each street alphabetically and each house meawrhesicthtetHlteoepyhnolwinvmleeU.bmebraeywfrobt*ue1ndfthouehnissdt.rteeelTetphihenotne(ores)encdutemionbnoester.sashItonhuescyeahsaoepldpheeerasrh. awshAonfotoewrtenleeaptchhheonhheoouutshseee- nprmoifeZssifoTMnoailyfirrSmgsUaidrreancagrerdiesa,ltphheabPertiinctaelrliymaecscsoargdeinsgoftothcelacssitiyfi'csatlieoandsi.ng business and This directory shows the exact population of the city and environs at the present time. BALDWIN DIRECTORY COMPANY. Inc. A Modern Directory The 1935 Macon City Directory is an example of the ABCD type of directory as originated by Baldwin Directory Company, Inc. It contains many exclusive features which are invaluable to business and professional firms. Chambers of commerce, merchants* associations, newspapers and others interested in obtaining this type of directory service for their cities should communicate with the company. Baldwin Directory Co., Inc. Charleston, South Carolina Aaron Cassandras (c; Mary) 1 lab h 114 1st (U) Aaron Gertrude (c) cook r 529 (521) e 2d (EM) Aaron John H (c; Annie M) 1 (o) emp G G Hardeman Co h 1024 Main (EM) Aaron Mattie (c) dom Christ Ch Parish Hse h 760 Moore al Abram Anthony J (c; Flora) 1 lab h 121 Walker la Abram Beatrice (c) 5 maid City Hall h 124 Walker la Abram Daisy G (c) tchr Hazel St Sch r 328 2d Aaron Ralph S (Myrtle L) (o) patrolmn CPD h 748 Montpelier Aaron Thos W (o) r 740 Montpelier av Aaron Willie M (c) 5 cook Oglethorpe Private Infirmary h 3 New St la Abbott C C metal wkr Bartlett Sheet Metal Wks r Jeffersonville rd Abbott Louise r 1053 Walnut Abbott Margt r 1053 Walnut Abbott Wm B (Aletha) 2 emp Andrews Sheet Metal Wks h 1053 Walnut Abel Albert K (Rosa) 1 (o) mach C of Ga Ry h 763 Blackburn Abel Alma R (wid F T) (o) h 724 Montpelier Abel Callie M! (wid L A) h 157 3d Abel Elwin elk Ard Cash Gro r 2337 2d Abel Gladys elk County Superior Court h 755 Blackman Abel Harry B (Leola) (o) slsmn Nye Odorless Incinerator Co h 707 Blackburn Abel Ice Co (W W Abel) 320 Montpelier Abel Ida (wid L R) (o) h 772 Montpelier Abel James B mech Stroberg Body & Fender Wks r RD 2 Abel Jessie (c) 2 maid r 100 (723) Wings al Abel Jesse F (Audrey W) phys 309 Bibb bldg r 402 Montpelier Abel Louis W mach C of Ga Ry Abel Lula R (o) sten Bateman Co Inc h 615 Duncan Abel M Virgil (Nellie) 1 plmbr h 2337 2d Abel Mildred slswn Dannenberg's r 157 3d Abel Nick R (R Inez) 1 mach C of Ga Ry r 724 Montpelier Abel Sara C Mrs r 1059 Hazel Abel Sidney W (Ethel) 5 (o) gro 970 Ogle- thorpe h 1059 Hazel Abel Theo G r 1059 Hazel Abel Wm C student r 402 Montpelier Abel Wm W (Martha M) (o) (Abel Ice Co) h 402 Montpelier Abercrombie Effie (Mrs R M) warper Bibb Mfg Co r 520 Ash Abercrombie James E (Laura M) 2 h 1014 Ash Abercrombie Robt M (Effie) h 520 Ash Abercrombie W C & Son (W C & W C Jr) live stock 553 3d Abercrombie Wm C (Mattie) (W C Abercrom- bie & Son) h 133 Nottingham dr Abercrombie Wm C Jr (W C Abercrombie & Son) r 133 Nottingham dr Abernathy Ernest W (Mary) 1 emp Shell Pe- troleum Corp r 915 Walnut apt 1 Abernathy Minnie B r 728 Walnut Abernathy Velma r 728 Walnut ABNEY GUYTON G (Josephine) (o), cash City Bk & Trust Co, h 1219 Oglethorpe--Tel 515-W Abney James M bkpr City Bk & Trust Co r Abram Flora (c) emp So Crate & Veneer Co r 121 Walker la Abram Pearl (c) maid Steve Popper r 131 (150) Orchard Abrams Georgia (c) 6 maid W T Moody h 141 College Abrams Isaac (c; Pearl) trkr C of Ga Ry h 131 (150) Orchard Abrams Jessie Mae (c) lndrs r 109 (8) Jordon Abrams Mamie (c) (o) h 1109 Log Cabin blvd Abrams Monroe (c; Helen) 1 porter Macon Shoe Co h 711% 3d (V) Abrams Sami (c; Margt) 5 chauf R T Birdsey h 229 (235)_ Fargason (V) Acme Fish & Oyster Co (Sami & Michl Vullo) 662 Poplar Acme Sign Service (Ray Parker) 615% Cherry ACME WELDING CO, Elam E "Jack" Balkcom mgr, 619-21 Broadway--Tel 1377 Acree Maurice M (Clara) 2 (o) cotton buyer Bibb Mfg Co h 910 Ridge (I) Acuff Mary P (wid H M) r 716 Montpelier Adair Ralph P (Marjorie) 2 atndt Whitehead Serv Sta h 814 2d Adam Eliz (c) maid r 91 (107) Hazel Adams Adiel L cash Bibb Mfg Co r 657 College Adams Albert R (Emma P) 1 (o) mgr Pru- dential Ins Co h 147 Vineville (V) Adams Albert R Jr student r 147 Vineville (V) Adams Alice case wkr FERA r River rd RD 5 Adams Alma L Mrs tex wkr Adams Mfg: Co r 809 Woolfolk Adams Alstean (Mr3 Bartow) tex wrk Bibb Mfg Co r 29 Taylor Adams Alvin (c; Georgia) jan Massee Apt h 105 (107) 2d (V) Adams Annie (c.) r 500 (714)_ Campbell (SM) Adams Annie M tex wkr Bibb Mfg Co r 121 Comer ter (PM) Adams Arnette tex wkr Bibb Mfg Co r 34-36 Schell (EM) Adams Arnold F (Clifford H) 1 radio serv mgr Sterchi's r 229 Tatnall Adams Arth (c; Mabel) r 109 Brooklyn Adams Artis (c; Carrie) 3 del mn B Yellin Delicatessen h 116 (194), Virgin (V) Adams B Claude student r 99 Coleman Adams Bartow (Alstean) tex wkr Bibb Mfg Co h 29 Taylor Adams Bernice student r 100 Peachtree Adams Berry (c; Beanie) h 102 Clara Adams Bertha (c) maid O W Massey r 435 North Adams Blanche Mrs 1 r 4 Roff Home pi Adams-Buchanan Motor Co E M Adams pres C W Buchanan Jr sec-treas 716 Broadway Adams Carl Apt 3 M (Emily) slsmn h 363 Colle6ge y Abney 5T?hulprhmaWn Eemp(BpessOie)r a1g2t19NaOtglLeth&orpAe Ins Co h 220 1st Abraham Fredk elk M Abraham r 2241 (2233) Adams Carolyn r 505 Napier Adams Chas (c) 2 h 210 Bay Adams Chas (c; Ola) peddler h 328 Cedar (U) Adams Chas D (Mattie L) 1 pntr h 103 Caba- niss (EM) Abraham Melham (Charlotte) 2d h 2241 (2233) 2n 4 (o) gB ro 22< Abraham Naseem tex wkr Bibb Mfg Co r 22' (2233) 2d Abraham Paul rtk Melham Abraham r 22' (2233) 2d Adams Chas L (Annie D) 2 mach So Ry h 603 Forsyth ADAMS CHAS LE H JR (Louise T) 2, (McKinney & Adams), h 115 Summit (NH)--Tel 152-X-M Adams Chas S (Nellie) (o) elk Macon Telegraph r 132 High Ab(/2'w23oo3m ) 2PdhiHp elk Melham Abraham r 22- Adams Chas T presser Happ Bros Co r 208 Fulton (Lynmore) 1935 Macon City Directory 111 Adams Clarence (c) lab So Crate & Veneer Co Adam Ira (c; Josephine) hlpr So Crate & Ve- r 211 Division neer Co r 112 (12) Orchard Adams Clifford Mrs 1 r 310 Cedar (SM) Adams Irby H (Margt B) (o) phys 805 Ga Adams Clynton (Mrs T L) sten T L Ross Lbr Casualty Bldg h 202 Buford pi (V) Co r 801 Patterson Adams Isaac (c; Lelia) (o) gro h 219 Fulton Adams Crawford (c; Linda) 2 lab Riverside (EM) Cem h 94 (5) Schofield Adams J Paul (G Eloise) asst funeral dir Adams D H Motor Co D H Adams pres-treas Burghard-Connally r 471 Orange H L Slocumb vp autos 655 3d Adams Dana H (Martha) pres-treas D H Adams Jacob W Jr (Margt) 1 slsmn r 140 Georgia Adams Mtr Co h 401 College Apt 5B Adams James (c; Clara J) (o) carp h 231 (215) Adams Danl C (c;Sadie) jan r 209 4th (V) North Adams Danl D (Hattie) (o) pres Adams Mfg Adams James (Carman T) 1 florist Idle Hour Co h 456 College Nurseries r RD 1 Adams Edith (wid B C) h 99 Coleman Adams James (c) hlpr So Crate & Veneer Co Adams Edw (c) r 500 (714) Campbell (SM) r 94 (5) Schofield Adams Edw (c) r 224 (r) College Adams James (c) lab r 966 Ocmulgee Adams Ellen r 300 Vineville Adams Jewel student r 208 Fulton (Lynmore) Adams Elton M pres Adams-Buchanan Mtr Co Adams John (c; Bertha) chauf P W Jones r res Rivoli Ga Adams Elton M Jr slsmn R A McCord Mtr Co 435 North Adams John H (c; Mamie) 1 emp Snows Ldry res Rivoli Ga Adams Emma P student r 147 Vineville (V) h 324 3d (V) Adams John H (Kath E) 3 slsmn R A McCord Adams Ernest R (Vera Mae) 1 elk Macon Ca- Mtr Co h 1539 3d feteria h 141 Academy Adams I student r 202 Buford pi (V) Adams Essie M (c) student r 266 (666) Hall Adams John W (Martha) (o) h 87 Osborne pi (EM) Adams Estelle (Mrs Robt) tex wkr Bibb Mfg (I) Adams John W (Sarah) slsmn Macon Type- Co r 14 Bellevue rd writer & Ofc Sup Co r Arcadia Hotel Adams Eula M student r 208 Fulton (Lyn- Adams Joseph mech United Auto Co r Waldon more) rd Adams Eva C (Mrs C B) (o) h 657 College Adams Joseph G (Frankie) 3 barber Hayes Adams Evelyn student r 220 1st Barber Shop r 310 Washington Adams Frank (c; Sarah) 5 lab Atlantic Ice & Adams Kath L opr Happ Bros Co r 100 Pied- Coal Co h 500 (714J Campbell (SM) Adams Frank (c; Shirley) 1 elk P M Hatfield mont (SM) Adams Kentch (c) lab' r 559 Cheatham al h 667 Hazel Adams L Andrew (Stella) 4 h 119 Roff Home ADAMS FRANK E (Ethel T) 1 (o), Sec-Treas Taylor Iron Works & Supply Co, h 112 Plaza Adams Laura Mrs h 873 Orange Adams Leola (Mrs Wesley) tex wkr Willing- --Tel 2124 ham Mills r 14 (82) Mill Adams Frank E Jr (Eliz) slsmn Taylor Iron Adams Levi B (Sara) emp C of Ga Ry h 126 Wks r 112 Plaza Lee (Lynmore) Adams Geo r 28 Atlantic Adams Lillie (c) 1 lndrs 109 Brooklyn (S) Adams Geo 2 policeman City r 100 Peachtree Adams Lillie B (c) student r 94 (5) Schofield Adams Geo W (Ellen) supt Macon Gas Co h Adams Lizzie (c) maid Arlington Hotel 542 Ridge (I) Adams Lizzie (c) h 227 Collins pi Adams Georgia (c) maid Massee Apts r 105 Adams Louis D (Clyde) shpg elk Bldrs Lbr Co (107) 2d (V) h 505 Napier Adams Georgia M matron YWCA Residence Adams Louis G (Katie L) 2 mech Central S & r do D Co h 100 Piedmont (SM) Adams Geraldine emp Met Life Ins Co r 501 Adams Lucile (c) cook L E Hall r 110 Grant College (S) Adams Gertrude (c) student r 94 (5) Schofield Adams Lula r 106 American blvd Adams Gladys O Mrs h 300 Vineville Adams Lulu student r 99 Coleman Adams Grayson T tex wkr .Willingham Mills r Adams M Beatrice emp Appleton Ch Home r do 293 Belmont av Adams Mabel (c) cook Rhea Richardson r 109 Adams Harry P (Jennie) 1 (o) swtchmn C of Brooklyn (S) Ga Ry h 133 Parkwood (B) Adams Maggie (c) dom Masonic Home of Ga Adams Henry (c; May) emp Standard Tool r do & Handle Co r 710 Elbert Adams Mamie Mrs r 123 Oak Haven Adams Henry (c;Leola) 6 (o) carp h 110 Grant Adams Mamie (wid W A) r 965 Walnut (S) Adams Mfg Co D D Adams pres Ralph Adams Adams Herman T (Clifford) 3 brklyr h 100 v-p J C Bond sec-treas clothing mfrs 7 Ex- Davis (SM) press Adams Holt A (c; Maggie) (o) carp h 111 Adams Martha (wid A S) r 109 Inverness Walls' al Adams Mary A marker Snow's Ldry r Y W C A Adams Horace (Hazel) 1 tex wkr Bibb Mfg Co Adams Mary A r 300 Vineville h 77 Short (PM) Adams Mary F (c) cook E P Cary r 14 Belle- Adams Horace D (Martha) (o) sta mgr Am vue Oil Co h 356 Hardeman Adams Mary W (c) cook R B Hoskins r 402 Adams Hosea (c) h 211 Division Richard Adams Hubert (Nina) 2 emp Bibb Mfg Co h Adams Mattie (c) 2 emp Riverside Cem r 106 751 Hawthorne Wise Adams Hugh (c; Minnie) lab The Standard Adams Mavis (Mrs M A) tex wkr Bibb Mfg Co Tool & Handle Co h 311 Boundary r 121 Comer ter (PM) Adams Ida (wid F R) r 3 Union Adams Maxie (c) r 125 (117) Williams la Adams Inez (c) emp Bibb Mfg Co r 552 Smith Adams Maxie (Mrs W P) tex wkr Bibb Mfg row Co r 13 Bellevue rd 118 Baldwin's and Telegraph's Adams May B opr Happ Bros Co r Y W C A Adams Merritt A (Mavis) 2 tex wkr Bibb Mfg Co h 121 Comer ter (PM) Adams Minnie (c) maid Mary Ann Beauty Shop Adams Ralph (Eliz) 2 v-p Adams Mfg Co r 656 College Adams Richd (c) emp Mercer University r 1027 College dr Adams Richd (Doris) 1 emp Goodyear Tire & Rubber Co r 166 Magnolia Adams Robt (Estelle) 1 tex wkr Bibb Mfg Co h 14 Bellevue rd Adams Robt A auto mech r 4 Roff Home pi Adams Robt B student r 202 Buford pi (V) Adams Rosa L (c) r 500 (714)_ Campbell (SM) Adams Roscoe r 100 Peachtree Adams Roy (c) r 210 Bay Adams Ruby (c) r 556 Broad Adams Ruby tel opr Middle Ga Hosp r 873 Orange Adams S Russell (Lula) 1 brklyr h 293 Bel- mont Adams Sami (c; Eliz) tr dr City Scavenger Dept h 135 Hazel Adams Sami (Marguerite) U S A r 1070 Wal- nut Adams Sara (c) maid C G Anderson r 210 Bay Adams Sherwood W (Emily) 2 h 101 Peachtree Adams Stewart (c; Inez) lab h 552 Smith row Adams Susie (c) ldry wkr r 228 (721) Pear Adams Thos (c; Ella) 2 porter S H Kress Co h 965 Hazel Adams Thos M (Etta) 1 mach C of Ga Ry h 107 Grady Adams Todd L (Clynton PI) teller Citizens & Sou Nat Bk h 801 Patterson Adams Tommie L (c) r 500 (714) Campbell (SM) Adams Trudie M (c) emp Proctor & Gamble Mfg Co Adams V Jas (Ella F) 1 (o) lawyer 501 Ga Casualty Bldg h 704 Date Adams Vera M (Mrs E R) slswn Collins Bak- ing Co r 141 Academy Adams Warren hlpr R A McCord Mtr Co res Walden Ga Adams Warren E (c; Ida) h 518 Clinton Adams Wesley (Leola) 2 tex wkr Willingham Mills h 14 (82) Mill Adams Wm (c; May) lab City Scavenger Dept r 160 Bay Adams Wm L (Quida) slsmn Bailey Auto Parts Co r 157 Summit Adams Wm M (Flora) emp Macon Fish & Oys- ter Co r 768 Mulberry Adams Wm P (Maxie) tex wkr Bibb Mfg Co h 13 Bellevue rd Adamson Bettie E (wid H L) (o) h 350 (324) Pio Nono Adamson Clarence H (Sarah) 1 (o) h 125 Peachtree Adamson Louise r 350 (324) Pio Nono Adamson Ogene sten Adams Mfg Co r 353 1st Adamson Sarah (Mrs C H) tex wkr Happ Bros Co r 125 Peachtree Adamson Sarah E student r 125 Peachtree Addams I Eugenia tex wkr Willingham Mill r 210 Duncan Addams Pearl (wid Flauzell) 3 mattress wkr h 210 Duncan Addams T Watson r 210 Duncan Addelton Annie R waiter Warren's Quick Lunch r RD 2 Addison Herman E (Annie) slsmn Darling Shops r 411 Hill Crest Addison James D (Martha) traffic frt agt C of Ga Ry r 699 Anderson (SM) Addison Mildred V (wid S O) 2 (o) h 326 6th (SM) Addison Oliver L (Nora) 1 slsmn C-M-P Drug Co h 212 Belvedere dr (I) Addison Rogers C elk C of Ga Ry r 326 6th (SM) Addleton Armon (Clara) 1 emp Bucy Bee Lunch Rm r 128 (16) Holt Addleton Horace D (Mary) 1 mech Yates Mtr Co h 659 1st Addleton John F (Frances E) 1 emp Willingham Mills h Clinton rd extd (EM) Addleton Lee (Mrs Joseph) tex wkr Willingham Mills h 128 (16) Holt Addleton Marvin emp Crescent Ldry r 212 (17 j Holti Addleton Mary M (wid R E) h 307 Newberg (SM) Addleton Mattie (Mrs Otha) tex wkr Willingham Mills r 212 (17) Holt Addleton Ora emp Willing)ham Mills r 330 Dannenburg Addleton Otha (Mattie) tex wkr Willingham Mills r 212 (17) Holt Addleton Pearly M tex wkr Willingham Mills r 128 (16) Holt Addleton S J (Ora) 3 tex wkr Willingham Mills r 201 Carling Addleton Sami B (Willie B) emp Am Bakeries Co h 630 Plum apt 3 Addleton Victoria Mrs 1 tex wkr Willingham Mills h 212 (17) Holt Aderholdt Ernest M (J Faye) 3 slsmn r 162 Summit Adkins Alice (wid H G) r 1413 Edgewood Adkins Beatrice (c) r 119 (124) Wood al Adkins Elijah (Ida) 3 emp Bibb Mfg Co h 1017 2d Adkins Ida (Mrs Elijah) emp Bibb Mfg Co r 1017 2d Adkins John (c; Fannie) jan Lanier High Sch for Girls h 1009 Oglethorpe Adkins Joseph C (Margt) 1 tr dr Tomlinson Pa- per Box Co h 557 Oglethorpe Adkins Luther (c) r 261 Madison (V) Adkins Rufus F (Clara) r 557 Oglethorpe Adkins Sallie (c) emp Central City Bag Co r 261 Madison (V) Admore James (c; Mary) lab Taylor Iron Wks Afro-American Life Insurance Co (c) W A Collier mgr 429 Knights of Pythias Bldg Ahern Francis r 555 Broadway Aides Danl W (o) h 218 Reid Aids Frank R (Nancy) 2 h 144 Knott (SM) Aids June emp Macon Linen Sup Co r 144 Knott (SM) Aids Robt A asst bkpr Willingham S & D Co r 144 Knott (SM) Aids Wiley L (Bertha) 2 mach Proctor & Gam- ble Mfg Co h 141 Tenney (SM) Aiken Beulah (wid J T) r 320 (423) Log Cabin dr Aiken David H (Stella B) h 2340 Forsyth rd Aiken Emma (c) cook H T Bacon r 10 (750) Sparks al Aiken Emory C (Ada L) slsmn Industrial Life & Health Ins Co h 120 Appleton Aiken Ira P (Ola B) 1 (o) farm hd h 320 (423) Log Cabin dr Aiken J C (Leila S) 1 printer Macon Teleg Pub Co h 512 Log Cabin blvd Aiken James H r 120 Appleton Aiken Josephine r 120 Appleton Aiken Mary E (c) lndrs r 3 New St la Aiken Ola B (Mrs IP) checker Snow's Ldry h 320 (423) Log Cabin dr 1935 Macon City Directory 113 Aiken Wm (c- Emma) 1 h 10 (750) Sparks al Aiken Wm P (Sarah M) serv sta 3601 Hous- ton h do Ainsworth Wm N (Mary) bishop M E Ch (South) h 401 College apt 6 G Akeridge Alice (wid A D) h 858 Elm Akerldge J Kaleigh tex wkr Bibb Mfg Co r 55 Hydrolia Akeridge Sami N (Sicily) tex wkr Bibb Mfg Co h 55 Hydrolia Akeridge Wm (c; Della) 1 emp C of Ga Ry h 200 (413) Thomson's al AKERMAN CHAS A (Sarah D) (o), Lawyer 410 Ga Casualty Bldg--Tel 369, h 106 Culver (V)--Tel 1516-W Akers Harvey (Bessie) 4 h 457 Elm Akers Mable r 457 Elm Akers Sami L prof Wesleyan Col res Rivoli Ga Akers Wm D Jr div mgr R J Reynolds Tob Co res Rivoli Ga Akin Emma (c) dom Effie H Baker r 170 Sparks la Akin Lula (c) cook E H Dunn h 238 Collins pi Akin Maggie (c) maid P E Findlay r 1024 College dr Akin Otis (c) r 528 Grant Chapel al Akin Rosa (e) 1 r 1020 College dr Akin Sallie; M librarian Washington Memorial Lib h 401 College apt 6 H Akin Wallace M (Alice L) slsmn Huckabee Mtr Co r 407 Forsyth Akin Wm (c) emp Huckabee Mtr Co r 535 Grant Chapel al Akin Wm (c) del mn Tatnall Sq Pharm r 1020 College dr Akin Willie M (c) 1 maid r 528 Grant Chapel al Akins Buford (c; Maggie) emp S E Exp Co h 1024 College dr Akins James (c;. Rachel) brkmn C of Ga Ry h 414 Hazel Akins Jennie (c) r 527 (6) Grant Chapel al Akins Thos (c; Jennie) h 124 Wyche Akins Wm (c) delmn Chichesters Tatnall Sq Drug Store r 1020 College dr Akins Wm (c) lab Adams-Buchanan Mtr Co r 124 Wyche Akridge Claude (Nettie) 2 r 324 Reid Akridge Claude Jr r 324 Reid Akridge Cleveland (Mrs R A) h 324 Reid Akridge Nunar (c) 2 h 105 (504) Campbell (SM) Akridge Richd J dormitory mn Federal Transient Bur r 504 Plum Akridge Wm (c; Willie M) lab C of Ga Ry r 105 (504) Campbell (SM) Albea Robt (c; Lucy) 2 emp So Ry h 1016 College dr Albea Wm L (Arlis) serv rep So Bell Tel Co r 1357 Oglethorpe Albin James W (Anna) lab r 671 Edgewood Albion Apartments 920 College Albright J Oscar (Jennie M) agt Aetna Life Ins Co h 772 Patterson Alderman Rose (wid W B) 1 r 455 Carling Alderman Ruby waitress Macon Cafeteria 659 Hemlock Alderman Valetta checker Independent Ldry Co r 423 New Aldred Florence S (wid J W) (o) h 114 Clayton (V) Aldridge Willis (c) lab C fo Ga Ry Alexander Albert (c) lab r 412 Peachtree Alexander Amos (c; Pauline) 1 lab Buckeye Cotton Oil Co h 954 Hazel Alexander Amos Jr (c; Lola) lab Buckeye Cotton Oil Co r 954 Hazel Alexander Benj r 149 Comer ter (PM) Alexander C Lee (Alda R) 2 elk C of Ga Ry h 442 Duncan Alexander Carolyn (c) (o) tchr Green St Sch h 100 Empire (V) ALEXANDER CATHEY Y (Eliz W) (o), V-P Willingham Sash & Door Co, h 127 Boulevard--Tel 874 Alexander Chas B (C Eleida) 3 (o) formn Wade & Son h 300 Hendley Alexander Chas B Jr r 300 Hendley Alexander Della F Mrs (o) h 411 Ayers rd (B) Alexander Dovie r 2604 2d Alexander Drew (c) lab So Crate & Veneer Co Alexander Eliz student r 127 Boulevard (NH) Alexander Eulalie E sten Schofield Ins Agcy Inc res RD 2 Columbus rd Alexander Eulalie T Mrs 1 slswn Union Dry Gds Co h 619 Forsyth Alexander Frances (wid J A) tailoress Burden Smith Co r 130 Appleton Alexander Geo W (Jo) (o) genl storekpr C of Ga Ry h 750 Courtland Alexander Henry C hlpr A G Rhodes & Son r 140 Georgia Alexander Herman (The Brass Rail) r 448 Edgewood Alexander Isaac emp Macon Beverage Co r 448 Edgewood Alexander John D (c; Rosa) shoe shiner New York Clnrs r 322 (312) Monroe (V) Alexander John H (c; Louise) 1 hlpr Miller Bros h 103 Pond (V) Alexander Joseph (c) emp r 412 Peachtree Alexander Lillian (c) cook W E Swinson r 118 May Alexander Lois T student r 619 Forsyth Alexander Lorenzo (c) lab r 1025 Edgewood Alexander Louise (c) maid A E Barnes r 103 Pond (V) Alexander Lowell C (Ruth) 1 mus dir Baptist Tabernacle r 108 Napier Alexander Major L (c) r 543 (215) Mitchell Alexander Marion r 619 Forsyth Alexander Martha (c) 3 h 136 (404) Tinsley la Alexander Martha E (wid T L) h 157 Williams (SM) Alexander Mary (c) cook r 114 Spring Alexander Myrtle R Mrs 2 (o) dir Washington Pk h 483 Orange Alexander Neomi (c) cook 320 Orange Alexander Pauline mgr Mrs Atkins Bakery r 130 Appleton Alexander Robt J (Ruby) 3 mach Am Bakeries Co h 901 Orange Alexander Roosevelt (c; Wilhelmina) lab r 412 Peachtree Alexander School No 2 Mabel H Harris prin 836 College Alexander School No 3 Mrs Kate C Malone prin 117 North (NH) Alexander School No 4 Nell Collins prin Ridge nr Roycrest dr Alexander Virgil (c; Viola) 1 cook A M Domin- goes r 330 Ward (V) Alexander W C emp So Ry r Y M C A Alexander Wilhelmina (c) emp Snow's Ldry r 412 Peachtree Alexander Wm H (c; Lenora) 2 emp P O h 264 4th (V) Alexander Wm P (Sallie) 3 hlpr h 2325 2d Alexander Winnie (c) maid r 514 Flanders Alford Beulah M r 125 Willingham Alford Elijah F (Lizzie) (o) h 125 Willingham Alford Gladys (c) r 123 Brooklyn (S) Alford Henry (c) elv opr Bibb Bldg Alford Mattie (e) lndrs h 405 Chestnut Alford Robt (c; Mamie) porter Kalish Optical Co r 404 Chestnut 114 Baldwin's and Telegraph's Alford Wm A (Eliz) (Alford's Gro) h 303 (304) Campbell (SM) Alford's Grocery (W A Alford) h 303 (304) Campbell (SM) Alfriend Carrie (c) maid Mercer Univ r 332 Jackson Alfriend Clifford (c) h 221 5th (V) Alfriend Justine (c) r 221 5th (V) Alfriend Hath C student r 934 Vineville Alfriend Kyle T (Katie C) (o) sec Ga Educa- tion Assn h 934 Vineville Alfriend Kyle T Jr r 934 Vineville Alfriend Malcolm C (Louise) head teller First Nat Bk & Trust Co r 639 Forsyth Alfriend Mary tchr Alexander Sch Na 2 r 934 Vineville Allen A Oliver (Gladisy A) tex wkr Willing- ham Mills r 240 Duncan Allen Ada (c) r 4 South Boundary Allen Alene (wid Harry) r 134 Flamingo dr Allen Alfred (c) delmn Brown Gro r 488 Short (V) Allen Allen (c) ydmn h 218 Fargason (V) Allen Alonzo (c; Ella M) car washer Power Oil Co h 412 Monroe (V) Allen Amos B (Lily) (o) patrolmn CPD h 467 Napier Allen Anna (wid A J) (o) h 327 Columbus Allen Aubrey M student r 512 2d Allen Belle (wid W C) 2 h 229 (267) Willing- ham Allen Bernice (Mrs W O) spooler Bibb Mfg Co r 507 Calhoun Allen Bertha (c) maid Alma A Massey Allen Buford (Bessie) emp Maxwell Bros r 253 Broadway Allen C Aldaburt (Corinne) (o) h 620 Plum Apt 1 Allen C Payne (Marjorie) 1 slsmn r 104 Berk- ley dr (I) Allen Carl P (Annie E) 1 mach Taylor Iron Wks h 125 Plant (SM) Allen Carrie B sec First Baptist Ch r 415 Col- lege Allen Chas M (Clyde) 2 mgr Log Cabin Sin- clair Sta r 1150 Milledgeville Allen Clara (c) lndrs Macon Hosp r 655 Ogle- thorpe Allen Clarence (Grace) opr Bibb Mfg Co r 121 Ell (SM) Allen Claude (Gordie) pntr r 2085 3d Allen Clifford (Mrs O G) smstrs Happ Bros Co r 119 American blvd Allen Corinne (c) 1 r 862 Ocmulgee Allen Corlas (Carrie) h 2085 3rd Allen Cornell (c) r 75 (82) Schofield Allen Edna r 507 Calhoun Allen Edna r 852 Hazel Allen Edna J slswn Silver's r 247 High Allen Effie M (c) r 533 (415) Grant Chapel al Allen Eliz (Mrs W M) elk Crescent Ldry r 860 Orange Allen Elsie (c) emp Snow's Ldry r 228 (316) Blount Allen Emily sten Piggly Wiggly h 401 College apt 4 H Allen Ethel nurse Macon Hosp r do Allen Etta (wid C W) r 104 Berkley dr (I) Allen Eula Mae (c) maid C H McCrary r 1019 Edgewood Allen Evelyn Mrs 1 h758 2d Allen Evie (c; Mary) 3 emp C of Ga Ry h 234 Edgewood Allen F Ruth prin Joseph Clisby Sch r 104. Rembert Allen Frances (c) maid Regera & Regero r 221 Orange Allen Frank (c) r 218 Fargason (V) Allen Geo mech r 2014 2d Allen Geo N (Mary) mgr Central Hotel r do Allen Hansel H (Annie) 3 tex wkr Bibb Mfg Co h 30 Hydrolia Allen Harry (Florence) 2 r 314 Cutters Green (EM) Allen Harry T (o) dept dir Bibb Mfg Co h 104 Berkley dr (I) Allen Hattie P maid Emma B Johnston r 245 5th (V) Allen Henry (c; Carrie) 1 lab Bibb Mfg Co h 337 Boardman's al Allen Henry F (c) r 1064 Hazel Allen Henry S (Zelda F) 1 pntr C of Ga Ry h 125 Academy Allen Herman O (Leona) 1 emp City h 121 Garden Allen Ira O (Frances) (o) pastor Hazel St Pentecostal Ch h 516 Montpelier Allen Irving (c) (Johnnie) lab Macon Cooper- age Co h 367 Monroe (V) Allen J Crayton (Ruby) (o) mach Southland Knitting Mills h 614 Log Cabin blvd Allen Jack O student r 121 Garden Allen James (c; Tempie) (o) emp C of Ga Ry h 104 Empire (V) Allen James r 115 Jones (EM) Allen James W (Eliz) gro 852 Hazel h do Allen James W (Eliz) (o) h 507 Calhoun Allen Janie (c) r 121 Penn (V) Allen Jessie (c) dom J R Maddux r 1019 Edge- wood Allen John (Winnie) doffer Bibb Mfg Co r 264 Main (EM) Allen John (c; Ethel) mach Birdsey Flour Mills h 120 (198) Virgin (V) Allen John (c) h 6 West Boundary Allen Johnnie (c) cook Mrs Sarah C Nutting r 367 Monroe Allen Joseph (c; Louise) porter Union Dry Gds Co Allen Judge (c; Bertha) 1 lab Proctor & Gam- ble Mfg Co h 420 Hammond Allen Julius P elk Ga Roofing & Sup Co r Y M C A Allen K Poe (Annie) (o) sec Wood Peavy Furn Co h 662 College Allen Lela L Mrs slswn Days r 247 High Allen Lena E student r 517 Napier Allen Lillie (c) dom r 315 Hawkins Allen Lois r 115 Jones (EM) Allen Louvenia (c) dom r 125 Ritchey Allen Lucy B asst cash City Bd of Water Comrs h 104 Rembert Allen M Everett (Harvie C) photogr h 561 Boulevard (NH) Allen Maggie (c) 1 dom h 221 Orange Allen Maggie (c) dom W L Kelley r 519 2d (EM) Allen Major (c) 1 emp S E Compress & Whse Co h 125 Ritchey Allen Malissa (c) cook C H Garrett h 118 (196) Virgin (V) Allen Marie r 507 Calhoun Allen Marie r 852 Hazel Allen Mary (c) maid Mt De Sales Acad r 547 (41) Tendall Allen Mary E r 620 Plum apt 1 Allen Mattie slswn Penney's r 614 Log Cabin blvd Allen Mattie L (wid Willis) tex wkr Bibb Mfg Co h 230 (220) Clinton Allen Millie (c) maid T W Blankenship r 1032 Broadway Allen Minnie (c) 1 maid r 220 Short la Allen Minnie L (c) r 1019 Edgewood Allen Mosie M (c) maid r 1064 Hazel Allen Myrick W (Annie) 1 r 457 New 1935 Macon City Directory 115 Allen Nannie (wid H L) r 614 Log Cabin folvd Allen Neal (c) tr dr Atlantic Ice & Coal Co Allen Nina elk Bibb Mfg Co r 513 Hillyer Allen Nora (c) 2 maid h 1064 Hazel Allen Ola M (c) maid J L Sullivan r 1019 Edge- wood Allen Ora (c) cook h 107 (488) Short al (V) Allen Otis G (Clifford) 2 osteo 119 American blvd h do Allen Otis G Jr mech r 119 American blvd Allen Owen (c; Mattie) h Clinton rd extd (EM) Allen P Franklin (Laura R) 1 barber 202 (94) Holt h 2014 2d Allen Pleasant D (Amanda) (o) h 209 Ingle side (I) Allen R O'Neal (c) delmn W T McCreary r 1064 Hazel Allen Richd (c; Susie) h 356 Church al (SM) Allen Robt (c) lab So Crate & Veneer Co r 235 Gilmer Allen Robt (c; Leola) 3 lab h 910 Hazel Allen Robt B (Eunice) meats 512 2d h do Allen Ruby (wid S J) emp Happ Bros Co r 325 Ross Allen S W student r 512 2d Allen Sadie (c) cook r 910 Hazel Allen Sami (c) cook Stansell Potato Chip & Sandwich Co r 921 Hazel Allen Sami (c) lab r 221 Orange Allen Thelma (c) maid Donald Macmillan r 104 Empire av (V) Allen Thos M (Mattie) 1 h 1120 Ash Allen Tiny P (c) 3 lndrs r 218 Fargason (V) Allen Verdelle B (c) tchr East Macon Sch r 519 (535) Maynard Allen W L emp Madison Paint Co r Central Hotel Allen W Frank (Marie) 3 elk Atlantic Ice & Coal Co h 456 Beech Allen W Marvin (Eliz) 1 elk Chapman's Pharm r 860 Orange Allen Walter G (Leslie) h 517 Napier Allen Walter O (Bernice) emp Bibb Mfg Co h 507 Calhoun Allen Wm (c; Lillie) (o) carp h 315 Hawkins Allen Wm (c) delmn Leonard Watson r 324 2d (V) Allen Wm (c; Florence) emp C of Ga Ry h 324 2d (V) Allen Wm (c; Mary) h 570 (509) Chappell (SM) Allen Wm C (Laura L) 3 h 1525 2d Allen Wm E (Martha) 1 elk Mulberry Mkt b 1411 3d Allen Wm J (c) h 637 4th (WH) Allen Wm L (Lummie) (o) reprmn Marshall Furn Co h 115 Jones (EM) Allen Wm O r 115 Jones (EM) Allen Wm R (Annie E) (o) h 301 Buford pi (V) Allen Willie M Mrs tej? wkr Atlantic Cotton Mills r 4 Atlantic village Allen's, Studio (C R Coke) photogrs 161 Cotton Alley A K (Ruth) 1 emp Am Tel & Teleg Co h 2342 Forsyth rd Alley Aaron R (Ruth E) (o) emp trust dept First Nat Bk & Trust Co h 198 Brentwood Alley Chas E (Christine) batterymn Power Oil Co h 919 New apt 3 Alley Chas R h 220 Bright (SM) Alley Christine (Mrs C E) opr Adams Mfg Co r 919 New apt 3 Alley Gewinner tchr Virgil Powers Sch h 920 College apt 4 Alley Jeff D Jr (Mamie) 2 (o) elk So Ry h 203 Burton Alley Hath sch tchr r 920 College apt 4 Alley Mamie P (Mrs J D Jr) opr Happ Bros Co r 203 Burton Alley Mildred (c) dom r 1032 Broadway Alley Molcey r 920 College apt 4 Alley Ruth E (Mrs A R) dir City Play Grounds r 198 Brentwood Alliance Corp The L D Sheridan pres collectors 103 Ga Casualty Bldg Allied Trade & Ry Trans Council Harry Cole- man sec meets 1st and 3rd Thursday 8:00 p m 408 Poplar Allied Veterans League W C James pres meets 4th Fridays 8:00 p m 454(4 1st Allison Belle Mrs 1 r 101 Forest (B) Allison Don D (Agnes) 4 tchr Danier High Sch for Boys h 106 Del Park Allison Essie (c) cook Thos Harrold Jr r 853 Ash Allison Hobson (c) lab Buckeye Cotton Oil Co Allison Ruth Mrs 1 h 101 Forest (B) Allman David J (Eliz) 2 h 119 Nelson (SM) Allman Gerard r 119 Nelson (SM) Allman Milton hlpr Cliff Walker Co r 119 Nelson (SM) Alloway Emma r 664 Walnut Almand Aubra A (Louise R) (o) mgr So Cotton Oil Co h 711 Montpelier Almand Flora (Mrs G C) slswn Charis Corp r 451 Spring Almand Grover C (Flora) h 451 Spring Almand Jos M prof Wesleyan Col r Lundy rd Almand Louise sten Davis & Birch r 451 Spring Almand Paul E student r 451 Spring Almand Veleta emp Independent Ldry r 423 New Almond Akin (c) elev opr Dempsey Hotel h 116 Green Almond Mary (c) dom r 859 Broadway Alonso Vivian R elk Liggett's Drug Store r 247 High Alpha Lambda Tau Fraternity Paul Tucker reagent 110 Montpelier av Alpha Tau Omega Fraternity Paul Ward pres 936 College Alston Earl (c) emp General Reduction Co r 125 (10) Jordan Alston Elma Mrs slswn Dannenberg's r 456 Walnut Alston M R mech Harts Mortuary res Bolingbroke Ga Alston Marion waitress The Polar Bear Al-Sihah Temple AAONMS(CR McCord recorder) called meetings 715 Poplar Al-Sihah Temple Mosque 715 Poplar Alton Claude (Lucile) emp Mitchell-Williams Drug Co r 1535 2d Alumbaugh Edw C (Alief M) r 416 Ross Alvin James (Pearl) 1 (o) bus opr Ga Power Co h 109 Nelson (SM) Alwood Kath r 114 Oak Haven Alwood Wm E (Bessie) (o) h 114 Oak Haven Alwood Wm E Jr r 114 Oak Haven Amalgamated Association of St & Elec Ry Emps of Am No 898 (E A Griggs sec) meets 4th Fridays 4:30 p m 408 Poplar Amason Docia (Mrs W R) emp Happ Bros r 709 Main (EM) Amason Ella h 119 Tyrone blvd (I) Amason G Ross (Nona G) 2 (o) h 528 Montpelier Amason James T shpg elk Cudahy Pkg Co r 220 1st Amason Lester L (Willie) 3 r 223 (400) Forest (B) Amason Warren (Docia) h 709 Main (EM) Ambrose Louise W (Mrs P F) tchr r 2725 Forsyth rd Ambrose Paul F (Louise W) r 2725 Forsyth rd 110 Baldwin's and Telegraph's American Association of University W^men Amos Ezra E (Martha) atndt Bob Steven's (Macon Br) Mrs Dice R Anderson pres meets Serv Sta r 116 Park pi 1st wed of each month at 4 p m Wesleyan Amos Guy (Myrtle) 2 pntr r 1024 2d Conservatory Amos Hattie (c) lndrs r 266 (666) Hall (EM) American Bakeries Co T R Jones mgr 451 Plum Amos Jennie (c) r 110 (452) Johnson American District Telegraph Co L R Dublin Amos Lewis (c; Eunice) pntr Dessau Realty mgr 455 Cherry Co r 807 Elbert American Federation of Labor E P Scott sec Amos Lizzie (c) dom h 851 Broadway meets 2d and 4th Thursday 8:00 p m 408 Amos Martha (Mrs E E) opr Genone's Barber Poplar & Beauty Shop r 116 Park pi American National Insurance Co F H Ramei Amspoker Guy E (Jessie K) 2 (Macon Stor- supt 404 Grand Bldg age Battery Co) h 216 Corbin (V) American National Red Cross (Macon-Bibb Anchors Robt T (Hazel P) twister Bibb Mfg County Chapter Mrs Levinia C Leath sec Co Municipal Auditorium Anchors Wm S 1 (o) carp h 206 Georgia ter Americal Oil Co Sami Guthman agt, bulk plant Ancrum Benj (c) student r 122 Sycamore (V) Poplar at 7th, serv stas 603 Broadway and Anderson A Frank farmer r 210 West End 170 Spring Anderson Addie (c) maid Hotel Dempsey r American Optical Co J W Burnham mgr 108 1003 Broad Ga Casualty Bldg Anderson Allen (Mary) r 519 Walnut American Printing Co (E C & Virginia B Olm- Anderson Andrew D (Lucile) 5 emp Ga Pow- stead) 552 Mulberry er Co h 315 Chappell (SM) American Restaurant (R W Lynch) 514 Mul- Anderson Annie B sten Chas Akerman r 325 berry Forsyth American Telephone & Telegraph Co B W Fink Anderson Annie M (c) dom r 114 Davis (U) chf test bdmn 501 2d Anderson Aytche r 208 Jeff Davis (SM) Amerson Andrew (Inez) 5 hlpr h 303 Apple- Anderson Belle (c) 2 dom T M Raines r 105 2d wood (U) Amerson Annie (wid B J) r 384 (332) Pio Nono Anderson Benj (c; Mary) emp C of Ga Ry h Amerson Arth B (Agnes) (Amerson Sandwich 641 Pebble Shop) h 446 Spring Anderson Bertha Mrs spooler Bibb Mfg Co Amerson Chas B (Hattie) 5 h 556 Ash Anderson Carl L (Mary) phys 310 Doctors Amerson Cleo Mrs opr Happ Bros Co r 865 Bldg h 280 College Cherry Anderson Carolyn c student r 217 Rogers (V) Amerson Edith (Mrs Roy) tex wkr Willingham Anderson Carrie (c) 5 dom P S Lord h 1003 Mills r 119 (41) Holt Broad Amerson Evelyn student r 429 Johnson Anderson Cath (c) maid Ford Ware Amerson Frances L slswn H L Green & Co r Anderson Chas (c; Evelyn) carp h 506 O'Hara 107 Carlisle la Amerson Frank C (Edna) 5 carp h 117 Daley Anderson Chas student r 208 Jeff Davis (SM) Amerson Grover C (Pearl) 1 (o) bldg contr Anderson Chas G (Olive) (o) formn C of Ga 107 Carlisle h do Ry h 206 Jeff Davis (SM) Amerson H Stephens (Rosa) 4 slsmn Stand- Anderson Clayton & Co M J Meats mgr cotton ard Oil Co h 429 Johnson 350 Poplar Amerson Helen r 429 Johnson Anderson Cullen (Nettie) tex wkr Bibb Mfg Co Amerson James W (Annie) 6 hlpr h 120 Wil- h 10 Bellevue rd lingham Anderson Della (wid W A) 1 h 287 Morgan Amerson Louis student r 429 Johnson Anderson Dezon (c; Minton) (o) h 105 Fulton Amerson Maude tex wkr Atlantic Mill r 384 (EM) (332) Pio Nono ANDERSON D R Pres Wesleyan College and Amerson Nancy (wid A J) (o) h 423 Ross Wesleyan Conservatory of Music and Fine Amerson Ola (Mrs P J) tex wkr Bibb Mfg Co Arts h Wesleyan College Forsyth rd--Tels r 11 Roff Home pi 6371--6185 Amerson Paul L (Alice) emp Armour & Co r Anderson Dock (c; Pearl) 2 lab h 1162 Ocmul- 433 Carling av gee Amerson Peter J (Ola) 3 tex wkr h 11 RofC Anderson Edw (c; Bessie) lab h 618 Washing- Home pi ton Amerson Roy (Edith) 1 tex wkr Willingham Anderson Edw (c; Amanda) 1 (o) lab C of Ga Mills h 119 (41) Holt Ry h 112 (533) Campbell (SM) Amerson Sandwich Shop (A B' Amerson) 460 Anderson Eleanor (Mrs C B) 3 r 210 West End Cherry Anderson Eliz nurse 811 Poplar apt 17 r do Amerson Thelma E elk Newberry's r 107 Car- Anderson Eliz (wid C C) mgr Fredonia Apts lisle h 213 Bond apt C 1 Amerson Walter L tex wkr Atlantic Cotton Anderson Eliz (c) case aide County Relief Mills r 384 (322) Pio Nono Admn r 417 Monroe Ames Moselle (c) maid College Hill Apts h 109 Anderson Ella (c) r 102 (101) Bowman (104) Long la Ammons Frank (c) student r 805 3d (V) Ammons Geo M (Hessie) h 210 6th (SM) Ammons James A (c; Sara) (o) elk Ry MS h Anderson Ella L (c) cook J H Wilder r 199 (112) May Anderson Ernest D (c) r 160 Coles al 805 3d (V) ANDERSON EUG (Anne S) 1 (o), Editorial Ammons James A Jr (c) student r 805 3d (V) writer Macon Teleg Pub Co, h 933 Vineville Amoco Service Station H C Hamrick Jr sta opr --Tel 5949-J 314 Montpelier Anderson Eug (c; Mary) 5 h 712 Elbert Amos Annie B (c) (o) h 421 North Anderson Eugenia A student r 106 Plaza Amos C'areta (c) maid C L Lott r 421 North Anderson Eva (c) r 207 (545) Moore la Amos Eunice (c) cook Crescent Restr r 807 Anderson Evelyn (wid Chas) slswn Snyder's Elbert Ready-to-Wear h 208 Jeff Davis (SM) 1935 Macon City Directory 117 Anderson Evelyn J (c) cook Mary C Little r 506 O'Hara la Anderson Fannie (c) maid W E Gray Anderson Frank (c; Oree) 1 emp Art Furn Co h 128 e Ell Anderson Geo (c) r 231 Patterson Anderson Geo (c; Nellie) (o) porter Ry Exp Agcy h 223 Orange Anderson Geo Jr (c) cook r 223 Orange Anderson Geo E (Ruth C) 2 (o) ydmn C of Ga Ry h 506 Flamingo dr Anderson Geo R (c; Mary) 2 gro 101 Morris (B) h 103 do Anderson Geo R (The Watch Shop) r 111 Na- pier Anderson Geo W (Ruth) bkpr First Nat Bk & Trust Co r Bloomfield rd Anderson Halstead T (Vivian H) v-p Bankers . Health & Life Ins Co h 401 College apt 6 C Anderson Hannah (c) r 105 Amos (V) Anderson Hannah (c) r 103 Morris (B) Anderson Harry C (Louise P) 1 asst engr At- lantic Ice & Coal Co r 301 Clayton (V) Anderson Harry W (Annie) mgr Walgreen Co h 261 Georgia apt C 1 Anderson Hazel I sten Macon Production Cred Assn h 811 Poplar apt 17 Anderson Henry (c; Georgia) 2 lab' h 114 e Ell Anderson Homer (c) lab F S Royster Guano Co r 1003 Broad Anderson Homer Jr (c) lab F S Royster Guano Co r 1003 Broad Anderson Ira (c; Annie) 1 h 266 Madison (V) Anderson Isiah (c; Eunice) 1 lab h 207 (545) Moore la Anderson James (c; Erma) lab h 158 Edwards (U) Anderson James (c; Clara) 4 h 103 (224) Long la Anderson James C (Annie G) 2 (o) phys 718 Ga Casualty Bldy h 106 Plaza Anderson James L (Cecile C) (o) (Anderson Oil Co) h 217 Rogers (V) Anderson James T (Addie) 2 wtchmn Bldrs Lbr Co h 1814 3d Anderson Jennie (wid H C) (o) h 111 Napier Anderson Jennie (c) 1 lndrs h 226 Collins pi Anderson John (c) hlpr h 205 Holmes av Anderson John reeler Bibb Mfg Co Anderson John H (Mattie L) 1 (o) mgr Macon Peanut & Storage h 502 Duncan Anderson John R piano tuner 210 West End r do Anderson Josephine (c) h 114 Davis (U) Anderson Joshua (c; Lettie) h 715 (703) El- bert Anderson Julia (wid Wm) r 896 Winton Anderson Julia L (o) ofc asst County Tax Re- ceiver h 210 West End Anderson Kankakee tchr Lanier High Sch for Boys h 106 Napier Anderson Laura N r Sunset dr (SH) Anderson Lewis (c) delmn Geo Harden r 231 Paterson Anderson Lillie (c) 1 maid h 220 Collins pi Anderson Liza M (c) r 385 Melrose (EM) Anderson Lizzie (c) r 202 Douglas (V) Anderson Lola (c) cook r 756 Ocmulgee Anderson Lottie (c) r 220 Woodliff Anderson Louisa bkpr City Bd of Water Comrs h 210, West End Anderson Louise elk Macon Teleg Pub Co r 213 Bond Apt C 1 Anderson Lydia emp Happ Bros Co r 503 Main (EM) Anderson Mabel V student r 626 Church (CH) Anderson Maggie (wid W N) r 426 Jackson Anderson Martha L r 1814 3d Anderson Mary (c) dom G S Devereaux Anderson Mary (c) lndrs r 113 (555) Singlet- on's la Anderson Mary (c) r 127 Woodliff Anderson Mary A (c) lndrs h 116 Neal (V) Anderson Mattie (c) r Gaillard (V) Anderson Mattie (c) cook J A Matthews Anderson May B (c) lndrs h 210 Fretwell al Anderson Mildred (c) maid r 223 Orange Anderson Millie (c) 1 h 231 Patterson Anderson Murray E (Alice L) 2 furn repr 103 Pierce (V) h do Anderson Naomi (c) cook A C Young r 342 Long (SM) Anderson Nettie (Mrs Cullen) tex wkr Bibb Mfg Co r 10 Bellevue rd Anderson Otis C (Martha) (o) dentist 569% Cherry r RD 2 Anderson Paul R prin Lanier High Sch for Boys r 280 College Anderson Pearl (c) dom r 119 (112) May ANDERSON PEYTON T--(Nell G) (o), V-P and Gent Mgr The Macon Teleg Pub Co, Genl Mgr The Macon Teleg and Macon Evening News, Sec-treas Macon Federal Sav & Loan Assn, U S Postmaster h Sunset Drive (Shirley Hills)--Tel 1754 ANDERSON PEYTON T JR (Katherine M), Business Mgr and Asst Sec-Treas The Macon Teleg Pub Co, h Sunset dr (Shirley Hills)-- Tel 5622 ANDERSON R LANIER JR (Helen W) 1 (o) (Ryals, Anderson & Anderson), h 155 Emily ..pi (I)--Tel 3534 Anderson R Milford (Myra) slsmn Macon Gas Co r 218 Georgia Anderson Robt (Eliz)l bus dr Greyhound Lines r 854 Cherry Anderson Robt (c; Lizzie) 2 emp C of Ga Ry h 90 (121) Forest (V) Anderson Robt (c; Lulleen) 2 h 703 Daisy (SM) ANDERSON ROBT L (Gertrude R) (Ryals, Anderson & Anderson), h 568 Orange--Tel 2529 Anderson Romie Mrs r 315 Chappell (SM) Anderson Ruth C (Mrs G E) dietitian Happ Bros Co r 506 Flamingo dr Anderson S Venable (Eliz M) 1 mgr Cudahy Pkg Co h 102 De Soto pi Anderson Sallie M (c) cook W B Webb h 142 O'Neal's al Anderson Sami P (Mary B) 1 condr C of Ga Ry h 109 Capital (Mikado pi) Anderson Sue (wid J E) h 503 Main (EM) Anderson Tillie M (c) r 342 Long (SM) Anderson Thos E student r 1814 3d Anderson W B Frank Jr (Anna Ruth) 1 int dec 145 Academy r do Anderson Walker (c; Rosa L) 2 tr dr Taylor Iron Wks h 1130 Broadway Anderson Walter (c) porter Ga Seed Store Anderson Wm (c; Lila) cook Smitty's Barbecue Lunch h 770 Ash Anderson Wm (c; Lula M) 1 porter Central City Funeral Home h 157 Hill Anderson Wm B F bkpr Mansfield Dray Line Co h 145 Academy Anderson Wm D (Linda) pres Bibb Mfg Co h 945 Vineville Anderson Wm D Jr v-p Bibb Mfg Co r 945 Vineville Anderson Wm G (Lucy) dental laboratory 408 Macon Savings Bk Bldg r RD 2 ANDERSON WM T (Eliz A), Pres The Macon Teleg Pub Co, Editor The Macon Telegraph, h Nottingham dr extd (SH) RD 5--Tel 505 Anderson Willie M (c) lndrs h 160 Coles al Anderson Vashti (wid R E) r 220 Hydrolia 118 Baldwin's and Telegraph's Anderson Virginia D student r 217 Rogers (V) Andrews Lily B (c) 4 h 120 Jones Andos James (Palace of Sweets) r 304 Cherry Andrews Lily M (c) 1 h 160 Madison Andrews Annie (c) Indrs r 758 Ocmulgee Andrews Louis (c) r 160 Madison (V) Andrews Ardis G (Gladys) 1 bldg contr 457 Virginia h do Andrews Louise r 1536 Broadway Andrews Lydia J slswn Dannenberg's r 439 Andrews Bennett W mach C of Ga Ry r 616 1st Duncan Andrews Bertie M slswn Dannenberg's r 439 Andrews M Evelyn student r 503 Duncan Duncan Andrews M Pride (Eva) night formn Ry Exp Andrews C Fort (Irene T) 2 director Bibb Mfg Agcy h 115 3d Co h 239 Stanislaus cir Andrews Maggie (c) r 644 4th (WH) Andrews Cath r 911 Walnut Andrews Magruder (Claudia N) locksmith 572 Andrews Chas (c) (Vineville Lunch Em) r 507 Mulberry h 802 Spring Forsyth Andrews Mamie r 911 Walnut Andrews Chas M (c) r 112 Roff Home Andrews Mary (c) (Vineville Lunch Rm) r 507 Andrews Chas W (Mildred C) 2 (o) car repr Forsyth C of Ga Ry h 139 Heard (SM) Andrews Mattie (Mrs G C) gro 933 Montpelier Andrews Chauncy (c) emp Maxwell Bros r 160 r do Madison Andrews Maude opr Happ Bros Co res RD 5 Andrews Chesley B (Olive) (o) cash M D & S Andrews Merritt elk C A Couch r 156 Holt R R h 347 Hines ter (V) Andrews Milton C r 139 Heard (SM) Andrews Clyde cash Capitol Theatre r 310 Andrews Nannie (c) cook D M Ward h 112 Washington Roff Home Andrews Clyde (c) 2 peddler r 331 2d (U) Andrews Orena (c) r 106 (141) Clemons la Andrews Conrad W (Vera) slsmn Kuhn Mfg Andrews Peyton C (Sarah) pkr Art Furn Mfg Co h 126 Ponce de Leon (SM) Co r 760 Cherry Andrews E Willie r 815 Cherry Andrews Powell W (c) (o) r 433 Chestnut Andrews Edw C (Ruby) 2 slsmn Dannenberg's Andrews Roosevelt A (Grace) r 118 Emory h 710 Pine (SM) Andrews Edw R (c) carp r 433 Chestnut Andrews Ruby (Mrs E C) slswn Dannenberg's Andrews Eliz (wid J N) h 911 Walnut r 710 Pine Andrews Elmer R (Laurie) 5 (Andrews Tin Andrews Russell (c; Julia) 3 emp Macon Cbnt Shop) h 503 Duncan Wks h 235 Nona (EM) Andrews Estelle student r 710 Pine Andrews Sallie (wid C O) h 439 Duncan Andrews Ethel (c) r 315 (87) Plumtree Andrews Sandy A (Lillie) 2 florist Idle Hour Andrews Eugenia (Mrs Henry) tex wkr Happ Nurseries r RD 1 Bros Co r 908 Walnut Andrews Sarah (Mrs P C) pkr Carling Tile Co Andrews Felton E (Mary) 2 meat ctr Wilson's r760 Cherry h 109 College pi Andrews Sylvester (c) r 706 Hawthorne Andrews Frances (c) emp Palace of Sweets r Andrews Timothy (c; Hazel) lab So Crate & 706 Hawthorne Veneer Co h 752 Edgewood Andrews Fredk C (c) r 104 (2) Franklin St la Andrews Tin Shop (E R Andrews) 509 Cotton Andrews Geo elk Silver Moon Cafe r Southland av Hotel Andrews Vera H sten R W Crockett r 126 Andrews Gertrude (c) 1 h 706 Hawthorne Ponce de Leon Andrews Grace G opr Happ Bros Co r 118 Andrews Victoria elk Carling Tile Co r 139 Emory Heard (SM) Andrews Grover C (Mattie) 3 slsmn Worsham Andrews Viola (c) h 124 (224) Dannenberg & Sherill h 933 Montpelier Andrews W Dean tchr Wesleyan Conservatory Andrews Henry (Eugenia) r 908 Walnut Andrews Walker (c) hlpr Geo F Yetter Plmbg Andrews J Edw (Martha) carp h 131 Daley Co r 803 Ash Andrews J Robt (Willie) 3 h 1536 Broadway Andrews Walter (c; Mary) (o) lab So Ry h Andrews James (c; Annie) porter Morris Put- 103 Cleveland (SM) zel Inc h 758 Ocmulgee Andrews Wilbur J College Hill Pharm r 666 Andrews James W (Lois) 3 h 1533 3d College Andrews Jefferson G (Josie E) pkr Art Fur Andrews Wm E (Nancy) 2 elk College Hill Co r 126 Ponce de Leon (SM) Pharm h 666 College Andrews Jesse C (c) jan East Side Baptist Ch r 559 Broad Andrews Wm H (Annie M) (o) coir Atlantic Ice & Coal Co h 120 Lamar (V) Andrews Jos (c) 1 farmer r 809 (852) Cowan Andrews Willie D instr Wesleyan Col r 525 Andrews Jos D student r 815 Cherry Vineville Andrews Jos M r 2334 2d Andrews Winford student r 325 Clinton Andrews Jos W (Charlie B) 1 elk Ry Exp Agcy h 816 New Andrews Josie E (Mrs J G) elk Newberry's h 126 Poi\c'e de Leon (SM) Andrews John (c) emp So Ry h 809 (852) Cow- Andrews Edwin M (Grace) (o) watch mkr Kernaghan-Goodman Inc h 175 Virginia Angier Edith M (Mrs) 1 (o) h 216 Buford pi (V) an Angles Clinton (c) emp Barfield Feed Mills r Andrews John T (Leila) 2 h 815 Cherry 605 Main (EM) Andrews John T Jr r 815 Cherry Angles James pntr r 605 Main (EM) Andrews John W r 131 Daley Annis Jesse D (Exie) lab h 355 Central Andrews John W slsmn E C McMillan Paint & Ann's Cafe (Ann Saloom) 1303 Broadway Glass Co r 911 Walnut Ansley Robt E cbntmkr 767 3d h do Andrews Julia (c) dom K F Dunlap Anthony Ada D sch tchr r 1354 Edgewood Andrews Kath (c) cook Eliz M Feagin r 160 Anthony Aubrey (c) r 519 e 2d (EM) Madison (V) Anthony Bessie nurse Macon Hosp r do Andrews Lehman creeler Bibb Mfg Co Anthony Eleanor student r 1354 Edgewood Andrews Lessie (c) cook Mrs Mary M Lowe Anthony Eliz sch tchr r 1354 Edgewood r 106 Woodliff Anthony Lynn student r 1354 Edgewood 1935 Macon City Directory 119 Anthony Robt E (Mary E) prof Mercer Univ h 1354 Edgewood Antioch School (c) Cora C Johnson prin 310 Charles Apex The (F B Lane) confr 551 Broadway Appleton Church 321 Forest Hill Home Fanny B Duvall supF t Applewhite Jos D (Eunice) health officer City County cir Bd of Health res Avon rd, Fors1y7 th Appling Chas D (c) student r 1029 Clinton rd (EM) Appling Eliza (c) h 450 City Hall la Appling Frank (c; Arabella) cement fnshr h 102 (2) Orchard Appling Irving (c) gro 521 (122) Elliott h do Appling Nettie W (c) student r 1029 Clinton rd (EM) Appling P Geo (c; Gladys E) 2 (o) prin Hud- son & Industrial Sch h 1029 Clinton rd (EM) Appling Rosa (c) (o) dom Curt Mueller r 308 E 1st Arcade Billard Parlor (E C Asbell) 561 Cherry Arcadia Hotel (See Hotel Arcadia) Archbell W C prod buyer r Hotel Lanier Archer Ella M (c) h 26 Wall St la Archia Leo (c) tr dr Kinnett-Odom Co r 5 Wall st la Ard Alice opr Happ Bros Co res RD 1 Drv Branch Ga Ard Cash Grocery (J D Ard, J A Tebeau) 289 Washington Ard Fannie r 816 3d Ard Jennie (o) h 314 Flanders Ard John D (Marie) 2 (o) (Ard Cash Gro) h 721 Date Ard Kate C (Mrs T C) opr Happ Bros Co r 1146 Milledgeville rd Ard Nellie Mrs opr Happ Bros Co res RD 4 Ard Pauline r 1146 Milledgeville rd Ard Rebecca sten Bibb' Mfg Co h 409 Virginia Ard Reuben emp Bibb Mfg Co r 13 Bibb Ard Thelma Mrs opr Happ Bros Co r Drv Branch Ga Ard Tullie C (Kate) (o) tex wkr Bibb Mfg Co h 1146 Milledgeville rd Ard Tully E (Verba) 3 gro 169 Spring h 165 Spring Apt 5 Ard Wm F (Evelyn) gro 126 (786) Nussbaum h do Arden Morgan R (Sara) 1 emp C of Ga Rv b 206 Hill Crest Argo Margt r 811 Poplar Apt 6 Argo Thos V (Edna) 2 (o) condr So Ry h 701 Burton Argo Wm D (Bessie A) engr So Ry h 811 Pop- lar Apt 6 Argo Wm D Jr r 811 Poplar Apt 6 Arline Ellen cook 106 Osborne pi Arline James (c) jan Middle Ga Hosp Arline Mary (c) dom H B Bell r 309 Bartlett's Armstrong Cath tex wkr Bibb Mfg Co r 716 Plum Armstrong Dorothy G r 208 Clayton (V) Armstrong Ella (c) (o) lndrs h 111 Neal (V) Armstrong Ethel (wid Guy) (o) h 208 Clayton Armstrong Guy Jr student r 208 Clayton (V) Armstrong Harriet ofc mgr FERA r 224 Col- lege Armstrong Helen H student r 361 Cherokee Armstrong Hugh G (Rosia) 1 emp Miller Bros r 425 New Armstrong J Chas carp r 860 New Armstrong James H (Minnie) 4 r 143 Williams (SM) Armstrong James W (Nell E) 3 slsmn Ga Caro Oil Co h 108 Lawton Armstrong Jesse W (Frances) 1 lab h 117 Plant (SM) Armstrong Julius (c; Mary) lab h 657 Hazel Armstrong June (Mrs M F) emp Carling Tile Co r 113 (125) Colquitt Armstrong L Mae Mrs tex wkr Adams Mfg Co h 2231 2d Armstrong Mae Mrs tex wkr Bibb Mfg Co h 716 Plum Armstrong Margt (wid Ardel) r 224 College Armstrong Marion F (June) 1 r 113 (125) Colquitt Armstrong N Bruce (Martha) (o) civ engr h 361 Cherokee Armstrong Octavius A (Mary T) elk FERA h 300 College Armstrong Robt A hlpr Maxwell Bros & Bridgers r 125 Lawton Armstrong Robt I (Hattie) 1 carp h 860 New Armstrong T Wallace student r 108 Lawton Armstrong Victor E (Alma M) h 125 Lawton Armstrong Wm (c) r 111 Neal (V) Armstrong Wm L (c) agt Guaranty Life Ins Co r 111 Neal (V) Arnett Annie (c) h 181 (325) Nussbaunj Arnett Claude C (Laura K) (o) mgr Hallingan & McLellan Inc h 202 Clayton (V) Arnett Fannie (Mrs J T) tex wkr Willingham Mills r 64 Roff Home pi Arnett Fred L (Kath) 1 r 34 (24) Randolph pi Arnett Henry (Bufa) 2 tex wkr Willingham Mills h 109 Forest (B) Arnett John h 6 Roff Home pi Arnett Jos T (Fannie) 1 tex wkr h 64 Roff Home pi Arnett Louis E (Stella) 1 speeder hd Bibb Mfg Co h 855 Hazel Arnett Lucius B (Ethel) tex wkr Willingham Mills h 1 (2) Grand (B) Arnett Lucius B Jr tex wkr Willingham Mills r 1 (2) Grand (B) Arnett Mabel Mrs 1 r 1427 2d Arnett Margt G student r 202 Clayton (V) Arnett Mary C r 18 Bellevue rd ARLINGTON HOTEL, T O Moseley Prop, "Modern and Reasonable" Broadway nr Poplar (See Page 88) Arlington Place Kindergarten (Rosa Chaplin) Arnett Mattie (wid Joseph) h 18 Bellevue rd Arnett Sidney O (Lena) 3 h 8 Grand (B) Arnett Stella (Mrs L E) tex wkr Bibb Mfg Co r 855 Hazel 82 Arlington pi Armand Addleton emp Busy Bee Lunch Armand Banks col bk mgr Wesleyan Col Arnett Willie (wid J C) r 1427 2d Arnett Winnie (wid H V) r 349 Hines ter (V) Arnett Winsted sten r 349 Hines ter (V) Armand Vera (c) maid h 129 Adams Arnold A Felton (.Louise) 2 tr dr h 115 Capital Armour & Co M B Medlock mgr meat pkrs (Mikado pi) 250 Broadway Arnold Albert C (Irene) 1 dr Yellow Cab Co Armstrong Amanda (c) dom h 2 Bay al r 109 Ormond ter Armstrong Annie L (c) hlpr Crescent Ldry r 152 5th Armstrong Annie M (c) carder Bibb Mfg Co r 229 Telfair Armstrong Bobbie L r 860 New Arnold Albert M (Lillie) bus dr Ga Power Co h 109 Ormond ter Arnold Anne r 117 (200) Grand (B) Arnold Arth (Florence) 2 h 664 Elm Arnold Benj F (Robbie) 1 fruits 200 Main (EM) h 522 Ocmulgee 130 Baldwin's and Telegraph's Arnold C Monroe (Pearl N) 1 carp h 466 .Duncan Arnold Carl B (Libby) 1 flgmn C of Ga Ry h 778 Blackburn Arnold Carl B Jr r 778 Blackburn Arnold Cath opr Adams Mfg Co r 110 Reese Arnold Cecil (Ruth) emp Bibb Mfg Co r 523 Ash Arnold Cicero S r 117 (200) Grand (E) Arnold Cleo sten Macon Transient Bur r 662 Napier Arnold Danl S (Queenie) r 102 Center (EM) Arnold Dewitt C (Minnie L) 5 tex wkr Bibb Mfg Co h 16 Bibb Arnold Dock 1 hlpr r 110 Reese Arnold Ella R student r 305 North (NH) Arnold Ellen r 115 Buena Vista Arnold Ellen M r 522 Ocmulgee Arnold Elton R elk Karsten & Denson Co r 200a Beech Arnold Emma J (Mrs R T) opr Happ Bros Co r 233 Capital (Mikado pi) Arnold Emmett J (Myrtle W) (o) carp h 200a Beech Arnold Emmett J Jr (Ila) 1 elk Swift & Co i 200a Beech Arnold Emory M sign pntr r 466 Duncan Arnold Ernest A (Mattie) 2 farmer h 111 New- berg Arnold Fannie (c) nurse Met Life Ins Co h 421 Ward Arnold Fredk A (Agnes C) 1 (o) (Arnold's Shoe Parler) h 308 Buford pi (V) Arnold Geo M Jr elk r 411 Jackson Arnold Geo T (Elvisher) hlpr h 411 Jackson Arnold Homer J slsmn Yates Mtr Co r Hous- ton rd Arnold Hoke S (Verna) ftr Macon Gas Co r Thomaston rd Arnold Jack (Alma) welder r 764 Cherry Arnold Jessie R nurse Macon Hosp r do Arnold John H (Maude) 1 lbr wkr h 101 Lee (Lynmore) Arnold John T (Arelia I) h 117 Mill Arnold Leola H (Mrs Z H) opr So Bell Tel Co r 858 Cherry Arnold Lewis C (Viola) slsmn Macon Coca- Cola Btlg Co h 117 (200) Grand (B) Arnold Lillie (Mrs O B) winder Bibb Mfg Co r 1053 Hazel Arnold Lou (wid T L) r 2224 Broadway Arnold Louise (Mrs A F) emp Happ Bros Co r 115 Capital (Mikado pi) Arnold Louise r 108 Roye Arnold Lula (wid T L) r 212 Davis (SM) Arnold M Eug (Lillian A) (o) engr MD&SRR h 305 North (NH) Arnold Madge winder Bibb Mfg Co r 1 Bellevue rd Arnold Maggie L (wid S B) (o) dresmkr 415 Church (EM) h do Arnold Malcolm E Jr r 305 North (NH) Arnold Martha (wid Louis) r 216 Calhoun Arnold Mary (wid JO) r 316 Hill Crest Arnold Mary A slswn H L Green & Co r 109 Ormond ter Arnold Mary F (wid J T) h 1-2 Bellevue rd Arnold Maurice F (Pauline) slsmn T & T Pkg Co res Sofltee Ga Arnold Maurice F Jr elk T & T Pkg Co res Sofkee Ga Arnold Mavourneen (wid J T) 1 r 938 (892) Montpelier Arnold Morris (Lillian) waiter Nu-Way Lunch Rm r 402 Church Arnold Oliver O (Lillie) r 1053 Hazel Arnold Patsy ofc sec Dr J I Hall r 810 Mul- berry apt 5 Arnold Queenie (Mrs D S) tex wkr Bibb Mfg Co r 102 Center (EM) Arnold R Terrell (Emma J) 1 (o) bus dr Ga Power Co h 233 Capital (Mikado pi), Arnold Ray elk Karsten & Denson Co r 200 Beech Arnold Rob't B coir r 117 Mill Arnold Rufus r 411 Jackson Arnold Rufus J (Nelle) 2 yd formn Central S&D Co h 204 Mikado Arnold S Coleman (Ethel) carp r 662 Napier Arnold S Respess elk Bibb Mfg Co r 415 Church (EM) Arnold T Harrison masseur r 466 Duncan Arnold Thos W (Eva) yd formn C of Ga Ry h 805 Pine Arnold Wilber W (Cornelia) h 1155 Milledge- ville rd Arnold Wm elk Rogers Stores r RD 1 Arnold Wm E (Jewel) 2 asst mgr Rogers Stores h 119 Capital (Mikado pi) Arnold Wm F r 862 Hazel Arnold Wm J Jr emp C of Ga Ry Arnold Z Harrison (Leola H) emp C of Ga Ry h 858 Cherry Arnold's Shoe Parlor (Fredk Arnold) 418 3d Arrington Emmaline (wid J K) r 301 Beech Arrington Gilford (c) r 721 Daisy (SM) Arrington Henry D (Earnie) 6 h 915 Walnut apt 5 Arrington Milton W r 127 Winship Arrington Robt L r 915 Walnut apt 5 Arrington Sami L (Maybell) 3 printer Macon Telegraph h 127 Winship Arrington Terrell F r 127 Winship Arrington Wm S (Kath) 4 It CPD h 101 Nel- son (SM) Art Furn Mfg Co F R Happ pres M M Kaplan sec-treas 314 Fulton (Lynmore) Art Linen Shop (Philip Shalom) 464 Cherry Arthur Alexandra r 251 Appleton Arthur Chas student r 251 Appleton Arthur Geo (Stella) 1 (Passtime Billiard Par- lor) h 251 Appleton Arthur Kenneth M baker Am Bakeries Co r 125 Washington Arthur Pauline D (wid K M) matron So Bell Tel Co h 125 Washington Artistic Beauty Shop (Myrtle Heck, Edna Compton & Lucy Brown) 151 Cotton Artope Leila r 307 Orange Asbell Custis L (Ada V) wtchmn T & T Pack- ing Co h 620 Hemlock Asbell Edw B (Ethel R) 2 br mgr Rogers Inc h 204 Montpelier Asbell Edw C (S Frances) (Arcade Billiard Parlor) h 125 Birch (NHts) Asbell Emory E (Lucile) 1 pntr r 1545 College Asbell Geo E (Eloise) 5 pntr h 1544 College Asbell Horace B (Mary) 1 elk J C Moore h 524 (562) Oglethorpe Asbell J Andrew (Bessie L) (o) elk Taylor Iron Wks h 122 (153) Pierce (V) Asbell James (c; Cleola) lab So Crate & Ve- neer Co r 217 Madison Asbell James B (Eva) (o) slsmn Burden Smith & Co h 473 Duncan Asbell Johnnie B (wid F E) 4 h 901 New Asbell Mary J (Mrs H B) opr Happ Bros Co r 524 (562) Oglethorpe Asbell O Lacree (Marguerite) 1 atndt Atlantic Refining Co r 765 New Asbell Sidney (c) r 58 New Asbell Walter (Nellie) 2 h 108 Yates Asbey Mary (c) cook Penlope M Griffin h 103 (127) Curds al Asbury Addie (c) maid C B McElroy h 70 (144) Forest (V) 1935 Macon City Directory 131 Asbury Mack (c; Addie) emp C of Ga Ry b' 70 (144) Forest (V) Asbury Wilkes R (Frances) 2 supt Buckeye Cotton Oil Co h 100 Rogers (V) Ash Estelle r 119 Emory (SM) Ash H C r 906 Napier Ash Lewis M (Effie) 10 blksmth C of Ga Ry h 119 Emory (SM) Ash M Crawford r 119 Emory (SM) Ash Sami emp C of Ga Ry r 119 Emory (SM) Ashe Margt Mrs opr Ethel B Davis Beauty Shop r 114 Magnolia Ashford Annie (c) cook r 510 Hammond Ashkenazie Heime (Pauline) 2 (Star Mkt) h 1064 Elm Ashkenazie Lula (wid H) r 636 Ross Ashley Arth (c) hlpr Odom Candy Mfg Co Ashley Asa C (c; Ethel M) 2 (o) agt Afro- Am Life Ins Co h 88 (123) Forest (V) Ashley Bessie (c) emp Macon Linen Sup Co Ashley C Raymond mech Ga Auto Co r 914 Elm Ashley Clarence (c; Irene) cook Lanier Hotel r 112 Spring Ashley Columbus H (Maggie L) 1 mech r 155 Park pi Ashley Cora L (c) cook Macon Cafeteria r 770 Ocmulgee Ashley Dillard A (Tinie M) r 2642 Houston (SM) Ashley Eliz (Mrs M L) slswn Union Dry Gds Co r 415 Calhoun Ashley Ellen (c) 2 h 163 Bay Ashley Essie (c) 2 cook h 103 Roye Ashley Frances (Mrs J A) h 155 Park pi Ashley Harriet (c) r 163 Bay Ashley Henry G (Eliz) gro 819 Broadway r do Ashley Hettie (c) h 437 Middle (EM) Ashley Isolene (c) student r 622 Washington Ashley John (c; Bessie) lab The Standard Tool & Handle Co h 621 Division Ashley John E (Mary) r 914 Elm Ashley Jos (c) lab Standard Tool & Handle Co Ashley Lizzie (c) cook W F Newsome Ashley M Ladell (Eliz) 1 (o) mech Bibb Chev- rolet Co h 415 Calhoun Ashley Mack (c) lab Maxwell Bros r 415 Chestnut Ashley Mamie (c) 1 h 142 Bay Ashley Marshall (c; Vinie B) elev opr Dannen- berg's h 123 4th (V) Ashley Mollie (c) 2 h 125 (117) Williams la Ashley Moses (c) lab Maxwell Bros r 415 Chestnut Ashley Oakley K (e; Emma) porter Dannen- berg's h 84 (133) Forest (V) Ashley Pearl (c) cook H G Hollingsworth r 243 3d Ashley Reynolds (c) jan Terminal Co h 142 1st (V) Ashley Sami B baker Collins Baking Co r 117 2d Ashley Sylmon (c) r 415 Chestnut Ashley Thelma (c) r 163 Bay Ashley Vinie B (c) cook B R Chestney r 123 4th Ashley Webster (c; Pearl) tr dr Willingham S&DCor 243 3d Ashmore B Colson elk A&P Tea Co r 591 Carling Ashmore Mary L (wid W L) (o) h 121 Amer- ican blvd Ashmore Robt E student r 591 Carling Ashmore S T ins agt Liberty Natl Life Ins Co Ashmore Thos A ins agt Liberty Nat Life Ins Co Ashmore Walter G student r 591 Carling Ashmore Wm T (Carrie) trav slsmn h 591 Carling Ashmore Wm T Jr student r 591 Carling Ashton A Thos (c) cl prsr YMCA r 439 Mad- ison (V) Ashton Paul F (Daisy) 2 (o) mech So Ry h 115 Piedmont (SM) ASHTON THELMA F ofc sec Kernaghan- Goodman Inc r 115 Piedmont--tel 744-J Ashurst Paul L (Mary E) 2 mgr Loose-Wiles Biscuit Co r 359 Church (EM) Askew Benj R (Mattie) slsmn Ga Power Co h 317 Bond Askew Corinne (c) 2 lndrs h 909 Ocmulgee Askew F Reid (Sara) condr So Ry h 615 Oglethorpe Askew Marie (c) dom r 204 (223) Roye Askew Milton D (Dorothy) 1 slsmn Armour & Co h 136 Rembert Askew Wm (c; Marie) 2 hlpr C of Ga Ry Creo- sote Plant h 204 (223) Roye Askew Newton G (Carolyn) 2 engr So Ry h 44 Marion Associated Master Barbers Chapter No 284 E E Bateman pres A T Spell sec-treas meets 4th Mondays 568 Mulberry Astin Elmer R condr So Ry h 105 Appleton Astin James student r 105 Appleton Astin Ralph student r 105 Appleton Aston Melvin (Shirley) 3 mgr Cheeseman's Ice Cream Shops r 620 Pine Athon Annie M (wid J D) r 2814 Forsyth Athon Avlona W student r 2814 Forsyth Athon Dorothy E dietician Oglethorpe Private Infirmary r 233 Tatnall Atkins Albert opr Happ Bros Co r RD 4 Atkins Andrew H baker 204 Forsyth r 117 Park pi Atkins Columbus (c) hlpr So Crate Veneer Co h 13 Franklin St la Atkins Edw (c; Lula H) (o) h 223 Neal (V) Atkins Eliz (c) 1 nurse 200 Douglas (SM) h do Atkins Eula (c) 2 r 197 Division St la Atkins Fannie (c) maid Lanier High Sch for Girls r 1009 Oglethorpe Atkins Henry (c) emp F S Royster Guano Co r 227 Dunlap al Atkins Jas (c; Mary) r 932 Elbert (SM) Atkins John (c) jan Lanier High Sch for Girls h 1009 Oglethorpe Atkins Joshua (c; Margt) presser Hayes Clo Store r 460 Broad Atkins Leah S Mrs bakery 414 2d h 1514 Vineville Atkins Lee (c) butler P T Anderson (Shirley Hills) Atkins Leona Mrs opr Happ Bros Co r RD 4 Atkins Mamie (c) cook r 147 Forsyth la Atkins Missouri (c) 3 (o) h 506 (457) Alabama (SM) Atkins Mrs Bakery Pauline Alexander mgr 140 (120) Hardeman Atkins Noah (c; Viola) emp Bibb Mfg Co h 148 Ballard (EM) Atkins Sami T (c; Mamie) 1 lab Simpson Log Co h 147 Forsyth la Atkins Viola (c) cook N T Avret r 148 Ballard (EM) Atkins Winford opr Happ Bros Co r RD 4 Atkinson Addie (c) cook r 67 Spring Atkinson Chas (c; Anna) h 522 Hawthorne Atkinson Eva Mrs r 605 1st Atkinson Harold C (Lilly S) 2 (o) phys 220 Doctors Bldg h 206 Corbin (V) Atkinson Harry J (Pearl T) 1 slsmn Sparks Specialty Co h 513 Beech Atkinson Jerimiah (c; Addie) hlpr Maxwell Bros Furn Co h 67 Spring 123 Baldwin's and Telegraph's Atkinson John F (Ruth) 3 mach C of Ga Ry h 909 Walnut Atkinson Mabel r 110 Emerald ATKINSON MALLORY C (Gertrude G) 2 (o), lawyer 409-11 Casualty Bldg:, h 216 Corbin --Tel 1435-M Atkinson Ray Mrs slswn Union Dry Gds Co res RD 4 Atkinson Roy R mech C of Ga Ry r 896 Hillyer Atlanta Joint Stock Land Bank W M Jordan Jr rep 304 Bibb Bldg Atlanta Life Insurance Co (c) W C Lee mgr 423 Knights of Pythias Bldg Atlanta Macon Motor Express whse 350 Cherry Atlanta & West Point R R Co R F Wynne Jr div frt agt 605 Bibb Bldg Atlantic Cotton Mill School 211 Roff Home Atlantic Cotton Mills Inc G W McCommon pres-mgr R R McCommon sec-treas 300 Oak Haven ATLANTIC ICE & COAL CO Chas H Gordon Mgr, Waterville rd nr Reid--Tel 3636, Branches: 201 Pio Nono av--Tel 5098, 212 Walnut--Tel 5097, ice stas 307 Elizabeth and 2905 Houston av Atlantic Mills Community House 2 Atlantic Village Atlantic Refining Co Winship McLean mgr. bulk plant Division, serv stas 702 Broadway 500 Lawton, 571 Mulberry and 455 Vine Atlantic Refractories Co Inc W P Stevens pres. Washington Dessau v-p, R H Mason sec brick mfrs ofc 564 Mulberry ATLANTIC SERVICE STATION, J R Booker Mgr, 91 Coleman--Tel 9586 (See Page 99) Atwater Arth (c) cook Wisteria Cafe r 854 Ocmulgee Atwater Hilton (c; Bertha) (o) hlpr So Ry h 233 Jefferson Atwater James A (Ina M) 2 (o) bkpr Burden Smith & Co h 424 Carling Atwater Robt E (Florrie M) 4 yd cond C of Ga Ry h 148 Flamingo dr Atwell Geo D (Mary) waiter Bruskie's h 549 Telfair (SM) Atwell Jas W (Henrietta) firemn Truck Co No 2 h 222 Maynard Atwell Mary F (wid Geo D) 3 (o) gro 545 Telfair (SM) h do Atwell Wm J elk Mrs Mary F Atwell r 545 Telfair (SM) Atwood Avrill L r 210% Cotton Atwood Dorothy M (c) h 1413 1st Atwood E Jay (Lula M) (Atwood's Photo Studio) h 210% Cotton Atwood Geo W (Eliz H) statistical supvr Nat Re-employment Serv h 319 Duncan Atwood J O (c) delmn W T McCrary r 1335 Broadway Atwood Lula M (Mrs E J) (Atwood's Pleating Plant) r 210% Cotton Atwood Wm (c) lab r 1335 Broadway Atwood's Photo Studio (E J Atwood) 212% Cotton Pleating Plant (Mrs Lula M Atwood) 210% Cotton Aubrey Florence h 551 Plum August F Boyd (Bessie) designer Idle Hour Nurseries r Forsyth rd Augustine Lucile (c) 1 case aide County Relief Admn r 371 Monroe Aultman Edna emp Met Life Ins Co r 125 Rose pk Aultman Eula Mrs tex wkr Bibb Mfg Co h 1022 Aultman Lula (wid J W) r 653 Forsyth Aultman Nell student r 215 New Aultman Romno D r 653 Forsyth Aultman Thelma opr Happ Bros Co r 1022 2d Aultman Warren farm supv Ga Industrial Home r do Austin Adele r 106 (156) Palace (B) Austin Annie 3 smstrs r 754 Plum Austin Bishop (c) lab Proctor & Gamble Mfg Co Austin Cleo (c) dom r 1032 Broadway Austin Danl (c) lab r 102 (2) Fulton la Austin Edward Mrs r 607 Plum Austin Eleanor slswn Dannenberg's r 811 Pon- lar Apt 9 ^ Austin Estella (c) cook Robt Adams Austin Ethel (c) dom J J Hall r 616 Maynard Austin Florence (c) sch tchr Jeffersonville Ga r 28 (528) Clayton (V) Austin Frances (c) cook W P Adams Austin Frank (c; Hattie) lab Jeffreys-McEl- rath Mfg Co h Lawton rd (B) Austin Georgia (c) clnr Bibb Mfg Co Austin Isaiah (c) emp Jeffreys-McElrath Mfg Co Austin J R baker Am Bakeries Co r 320 College AuCsotin James (c) emp Jeffreys-McElrath Mfg Austin James (c; Mary) hlpr Massie & Felton Lbr Co r 228 Woodliff Austin John W (Jimmie) emp Ga Power Co h 615 Spring Austin Josephine (c) r 123 Lexington Austin Junior (c) shoemkr Edw Bashuk r 863 Pine Austin Katie L (c) maid W S Boone r 412 Ward (V) Austin Lena (c) 1 maid h 1 (417) Steins al Austin Mildred (c) h 1032 Broadway Austin Odessa (c) maid Maxine Elliott r 1032 Broadway Austin Sylvester (c) r 1032 Broadway Austin Wm (c; Lizzie) 4 h Lawton rd (B) * Austin Wm M (c; Arvilla) emp City h 320 4th (V) AUTO BANX (Chester J Straub) Used Cars Bought and Sold 364 1st--Tel 2867 (See top lines) Autrey W Herbert (Myrtle) 1 condr M D & S R R h 753 Pine Avalon Beauty Shoppe (Mrs Willie B Rustin) 514% Cherry Avant Alma Mrs 1 emp Happ Bros Co r 960 1st Avant Amanda (c) h 210 (329) Fargason (V) Avant Annie (c) hse maid Ga Acad for the Blind r (239) 241 Farguson Avant Chas E (Bernice) hlpr So Ry h 463 Spring Avant Geo (c; Ida M) emp Maxwell Bros h 120 (330) Braswell la Avant Henry J (Mary) 1 (o) emp C of Ga Ry h 113 Plant (SM) Avant Ida M (c) maid R M Poole r 120 (330) Braswell la Avant L Earle (Gladys) 2 pntr h 2036 2d Avant Norman A (Helen) (o) real est 569% Cherry h 1402 Vineville Avant Robt (c; Ida M) h 107 (4) Braswell la Avant Thos (c; Annie) h 239 (241) Fargason (V) Avant Wm T (Martha) r 960 1st Aveline Baptist Church (c) h 223 (285) Moore la Aultman Floyd R tr dr Armour & Co Aultman Harvey W (Frances) 1 tex wkr Bibb Mfg Co r 1022 2d Aven Wm G (Pauline) barber Union Dry Gds Co h 811 Poplar Apt 8 Avent Albert S r 108 College pi Avent J E emp So Ry r 108 College pi 1935 Macon City Directory 133 Avent John T (Margt) (o) capt C P D h 108 College pi Backer J Furniture Co Backer) 460 Poplar (Sidney and Aaron Avent W Lloyd (Anna M) 1 projectionist Capitol Theatre h 605 Forsyth Avera Bertha Mrs (wid) 2 smstrs r 202 1st Backer Sidney (Stella) 1 (J Backer Furn Co) r 853 Walnut Bacon Albert H Jr (Helen) 3 emp Bibb Mfg Avera Claude elk Whitman's Pharm r 202 1st Avera Emmett C (Viola E) (o) condr C of Ga Co h 30 Bibb ,, Bacon Helen (Mrs A H Jr) emp Bibb Mfg Co Ry h 337 Hanson (SM) Avera John B emp Dixie Roll & Cot Co h 244C Broadway r 30 Bibb Bacon Herbert T (Rose L) 2 toll board mn So Bell Tel Co h 113 Culver (V) Avera L E (Ruby M) 2 h 217 Bacon Avera Mattie (wid John B) 1 r 2440 Broadway Avera Milton J (Thelma) 1 (o) (Penny Profit Bacon Philip C (Sara) 1 emp R L Clark Co h 123S College Bacon Wingfield F (c; Hattie) lab C of Ga Ry Store) h 2402 Broadway Avera Susie M (wid W J) r 128 Winship Averett Inman D (Mary) 1 coir Buck Ice & Coal Co r 336 American blvd Averhart Janie (c) h 520 New Averill Albert E (Orva R) 3 mldr h 750 2d Averill Orva R (Mrs A E) drsmkr 750 2d r do Shops h 136 Tharpe Bacus Augustus B r 452% Mulberry Baggarly Alva student r 113 Williams (SM) Baggarly Alvah C (Verna N) 3 engr G S & F Ry h 118 Laurel Baggarly Eliz H student r 417 Adams Baggarly Ernest M (Vivian) 1 san inspr City Avery Andrew (c; Mamie) lab h 314 2d (V) Avery Annie M r 222 Ross Avery Apartments 337 Adams Bd of Health h 163 Cherokee Baggarly Henry J r 163 Cherokee Baggarly James B (Mamie) (o) formn So Ry Avery Doris (wid C J) r 618 Elm Avery Felix P (Ollie) 3 firemn So Ry h 1330 h 417 Adams Baggarly James B Jr drftsmn City Bd of Wa- 3d Avery Frances r 222 Ross Avery Gordon A (Jennie) slsmn Liberty Candy Co h 117 School Avery Jack elk Macon Evening News r 222 ter comrs r 417 Adams Baggarly Sara E Mrs 1 r 2804 Houston (SM) Baggarly Wm V (Florence) 1 engr So Ry h 113 Williams (SM) Baggarly Wm V Jr r 113 Williams (SM) Ross Baggett Scholey A (Lois J) (o) pntr Hucka- Avery John opr Dixie Roll & Cot Co Avery Rose tel opr So Bell Tel & Tel Co r 222 bee Auto Co h 1027 Clinton rd (EM) Baggett Scholey A Jr sten Taylor Iron Wks r Ross Avery Roxie M, (wid J S) opr Happ Bros Co h 1027 Clinton rd (EM) Baggs L D & Co (L D Baggs Jr) cert public 222 Ross Avery Talver (c; Wylene) hlpr Ray's Serv Sta h 311 2d av (V) accts 308 2d ,, Baggs Linton D Jr (Leah B) 1 (o) (L D Baggs & Co) h 1307 Vineville Avery Wm A (Mollie) r 117 School Bagley Leo V (Ruth) 7 h 455 Woolfoik Avery Wm H mach opr So Crate & Veneer Co Bagley Tillman B (Ruth) 2 tex wkr Willing- r 117 School Avret M Eliz (Mrs N T) drink stand opr Bibb Mfg Co r 26 Schell (EM) Avret Nathl T (M Eliz) 2 tex wkr Bibb Mfg ham Mills h 330 Dannenberg Bagwell Bernice (wid J W) 1 r 678 Courtland Bagwell Violet Mrs r 355 New Bagwell Wm H (Sarah T) bacteriologist City Co h 26 Schell (EM) Avrunin Louis (Sarah) (o) pawnbroker 508 Bd of Health h 204 Hines ter (V) Bailes Henry (c; Carrie) 8 h 101 (222) Long la Poplar h 54 Arlington pi Bailey Albert (c) porter Elks Club r 100 Ern- Avrunin Sol elk Louis Avrunin r 54 Arlington est pi Axam Cherry (c) maid Roberts Cafeteria r 515 2d (EM) Axam Susie (c) maid J E Hall r 367 Monroe Bailey Alice (c) emp Proctor & Gamble r 426 Hammond Bailey Alice J (Mrs J B) nurse FERA r 137 Magnolia Axam Wm (c) mech r 131 (123) Phillips la Bailey Alwyn F mech Adams-Buchanan r 912 Axam Wm (c; Susie) 3 r 367 Monroe Babb Ada G (wid J T) r 118 Crisp 2d Bailey Andrew (c) delmn Piggly Wiggly r 307 Babb Alice K Mrs ftr J N Neel Co r 137 Magnolia Bailey Andrew C (Louise Q) agt Peninsula Life Babb Alton K (Frances) 1 solr Snow's Ldry r 711 College Babb Chas H (Virlie K) 2 wood wkr Central S & D Co h 98 Harrold Ins Co h 100 (107) Lee (Lynmoore) Bailey Arcelius (c; Irene) lab Macon Cooper- age Co h 111 Elm Bailey Auto Parts Co (W J Bailey) 621 3d Babb Mamie Jo cash W T Grant Co r 820 1st Babb Mary r 820 1st Babb Pearl tailoress Vincent Campelli r 236 (136) Capitol (Mikado pi) Babb Sara A opr So Bell Tel Co r 118 Crisp Baber A Paul elk Southeastern Exp Co Bailey B Jewel elk Newberry's h 100 (107) Lee (Lynmoore) Bcoajiilmeyr rBioerirVthiaa (c) dcisohokwahsh2e0r7 E(l3li6s7)CaRfeairlro1a1d8 (18) Wise (V) Bailey Betty (c) maid F N Burch r 243 Mor- Baber Andrew J (Octavia) r 517 Giles Baber-Blackshear Birdie dancing tchr 856 Wal- nut r do Baber-Blackshear Mary (o) dancing tchr 856 Bailey Boysie (c; Mamie) 4 emp C of Ga Ry Creosote Plant h 707 3d (V) Bailey Carolyne r 178 Magnolia Walnut h do Bailey Carrie (c) h 155 (156) Madison (V) Bachnor Tug B (Velma) 2 r 430 Morgan av Bailey Chas (c) carder Bibb Mfg Co Backer Aaron (J Backer Furn Co) r 853 Walnut Bailey Chas E (Mollie) 2 (o) emp C of Ga Ry h 1103 Elm Backer Flora (wid Jacob) with J Backer Furn Co h 853 Walnut Bailey Chas T (Ladye K) (o) slsmn h 150 Summit 121 Baldwin's and Telegraph's Bailey Cherry (e) maid Allen's Studio r 612 Bailey James M (Alice M) 1 pntr r 506 Church Washington Bailey Clara (c) r 515 (529) Maynard Bailey Clarence J (c; Hattie) lab h 162 5th Bailey Danl (c; Maggie) (o) h 331 2d (U) Bailey David C (Nannie M) 4 lab r 520 (552) Oglethorpe Bailey Edgar (c) 3 r 110 (815) Amos (V) Bailey Edith emp Liberty Candy Co r 221 Jones (EM) Bailey James T (Annie) 2 elk P O h 854 (822) Pio Nono Bailey James W r 854 (822) Pio Nono Bailey John (c; Katie) 1 hlpr r 324 (297) Haw- kins Bailey John (c; Emily) mech h 321 3d (V) Bailey John H (Ida) h 511 Hawthorne (EM) Bailey Joseph B (Alice J) slsmn Steve M Sol- Bailey Edw L emp Ga Power Co r 415 New Apt 1 Bailey Eliz (c) r 438 Bright al Bailey Ell (c) porter Southland Hotel r 155 omon r 137 Magnolia Bailey Joseph R (c) jan Ballard Normal Sch r 431 Ward (V) Bailey Kitty M (c) dom Oliver Orr r 431 Ward (156) Madison (V) Bailey Elmer (c) emp Swift & Co r 120 TindalJ (V) Bailey Laura (c) r 5 Murray al (SM) Bailey Leon (c) emp Macon Linen Sup Co r Bailey Emily (c) dom Peyton T Anderson Jr Bailey Emma (c) cook r 475 Chestnut 360 Hazel Bailey Leonard (c; Ina) barber Gertrude Smith Bailey Ernest (c) delmn Piggly Wiggly r 307 h 152 Hill Green Bailey Leonard C (Frances) 4 (o) ins agt h 711 Bailey Ernest (c) emp C of Ga Ry r 102 Pringle Bailey Estus (c) porter Elks Club r 100 Ernest Bailey Evelyn (Miss N R) 1 slswn Union Dry Gds Co r 117 Virginia Bailey Fannie (c) sch tchr Roberta Ga r 100 3d Orange Bailey Litha (c) case aide County Relief Admn r 222 Chestnut Bailey Louise Q (Mrs AC) opr So Bell Tel Co r 100 (107) Lee (Lynmore) Bailey Lucile (c) r 307 Monroe (V) Bailey Lucile r 854 (822) Pio Nono (U) Bailey Fleming W (Mary L) 1 meter reader Macon Gas Co h 258 Columbus Bailey Florrie I (Mrs F. K) 4 spotter Indepen- dent Ldry Co r 32 Progress Bailey Frances Mrs sten FERA r 711 Orange Bailey Frances student r 1103 Elm Bailey Frank (c; Ida) 3 carp h 331 Ernest Bailey Freddie M slswn S H Kress Co r 178 Magnolia Bailey Furman (c; Mary) r 204 (105) Indus- trial Home rd Bailey G Douglas (c) porter Yellow Cab Bailey Geo (c; Mary) (o) lab h 100 3d (U) Bailey Geo B (Mary M) serv mgr Steve M Solomon r 104 Callaway (V) Bailey Geo H (Helen S) br mgr Toole Furn Co r 620 Hemlock Bailey Geo W (Julia) 1 custodian City Hall h 178 Magnolia Bailey Gwendolyn S Mrs opr So Bell Tel Co r 216 Cherokee Bailey Hattie (c) 6 r 119 Elm Bailey Hattie (c) bottle washer Gibson Vinegar Wks r 162 5th Bailey Hazel Mrs r 221 Jones (EM) Bailey Helen opr Happ Bros Co r 821 Mulberry Bailey Helen S (Mrs G H) opr So Bell Tel Co r 620 Hemlock Bailey Henry (c; Frankie) (o) carp Yates & Tabor Co h 100 Ernest Bailey Henry (c; Carrie) porter Dunlap-Peeler Hdwe Co r 156 Madison (V) Bailey Henry I (Martha) 2 emp C of Ga Ry h 119 Colquitt Bailey Henry M jan Pearl Stephens Sch r 136 Log Cabin dr Bailey Henry W (Annie) firemn So Ry h Ba1il0e4y0iH/2 e2zdekiah (c; Clara) lab Central J S & D Co h 110 (340) Booker's al Ba^y Hillman (c; Nellie) 2 farmer h 343 4th Bailey Malachi (c; Mattie B) lab Cherokee Brick Co r 392 Telfair Bailey Mamie (c) cook H P Moyer h 146 Middle (V) Bailey Mary A bkpr Union Dry Gds Co r 216 Cherokee Bailey Mary J (wid J T) h 149 Magnolia Bailey Mary M (Mrs G B) sten Ga Power Co r 104 Callaway (V) Bailey Marvin Z (Ruby) 1 (Marvin's Gro) h 102 Marshall (CP) Bailey Mattie (c) r 243 Morgan Bailey Mattie (wid M F) r 252 Broadway Bailey Mattie (c) cook J M Murray h 307 Green Bailey Mattie B (c) cook T M Wood r 392 Tel- fair Bailey Maude (wid J F) opr Happ Bros r 912 2d Bailey McCarthy J (c) r 431 Ward (V) Bailey Minnie (c) cook r 100 Ernest Bailey Minnie (c) cook Mt De Sales Acad r 302 Wood al Bailey Minnie C (wid J E) h 136 Log Cabin dr Bailey Neal (c) h 218 (122) Plummer's al Bailey Primrose (c) cook Ellis Cafe r 118 (IS) Wise Bailey Richd (e) delmn Morris Drug Store r 120 Tindall (SM) Bailey Robt (c; Eva) lab Cherokee Brick Co r 402 (509) Prince (SM) Bailey Robt C (c; Sarah R) (o) ins agt Pil- grim H & L Ins Co h 820 3d (V) Bailey Roy student r 32 Progress Bailey Ruby (c) r 307 Green Bailey Sami E (Ethel) 5 complaint mn Macon Gas Co h 677 Edgewood Bailey Sara A (wid S J) h 216 Cherokee Bailey Sarah (c) (o) h 403 (731) Campbell (SM) Bailey Sarah (c) (o) h 356 Monroe (V) Bailey Sarah R (c) tchr East Macon Sch r 820 Bailey Horace (c) delmn Carstarphen Inc r 119 Elm Bailey Ida B (c) r 113 (235) Stewart's al Bailey Iola (c) barber T J Hunt r 100 Ernest Bailey Irene (c) r 302 Gordon (CH) Bailey Jacob B (c; Suprenia) (o) jan h 210 Moughon (V) 3d (V) Bailey T Merritt bkpr Hart's Mortuary r 149 Magnolia Bailey T Washington appr Coggin & Mann r 178 Magnolia Bailey Thomas (c) r 515 (529) Maynard Bailey Thos P (Lois H) 2 meter reader City Bd of Water Comrs h 158 Oakland 1935 Macon City Directory m Bailey Viola (c) lndrs h 1225 3d Baker Joseph A emp Ry Exp Agcy r 1144 Mill- Bailey W Arb'ut mail elk Macon Evening News edgeville rd r 1041/2 2d Baker Julia (c) h 1335 1st Bailey Walter H (Mollie) 2 bgemn So Ry h Baker Junius L bkpr Sands & Co r 663 Plum 3602 Houston Baker Linnie B (c) r 106 (204) 3d (U) Bailey Wm (c; Mary) h 302 Wood al Baker Lizzie (wid Sami) h 411 Hill Crest Bailey Wm (c; Charlie M) 2 lab h 402 1st Baker Mamie (c) 2 lndrs h 1229 3d (WH) Baker Marvin C mach C of Ga Ry r 1144 Mill- Bailey Wm (c; Rosa) tr dr Webb Coal Co h edgeville rd 102 Industrial Home rd Baker Mary (c) cook H F Sanders r 811 Elm Bailey Wm B (c; Kitty M) (o) carp h 431 Baker Mary (c) cook C C Harrold r 263 3d (V) Ward (V) Baker Mary L (c) cook Ferd Guttenberger r Bailey Wm H opr Proctor & Gamble Mfg Co 522 e 2d (EM) r 216 Cherokee Baker Mattie (c) h 317 Green Bailey Wm J (Irene) 1 (o) (Bailey Auto Parts Baker Norma (c) cook Curtis Dickson r 1229 Co) h 320 Cherry 3d Baird J Elliott (Maybeth H) (o) teller Citizens Baker Otis (c) coir Atlanta Life Ins Co r 137 & So Nat Bk h 661 Hillyer 4th (V) Baird John L (Alma) 1 firemn C of Ga Ry b Baker Pauline (wid Arth) r 1052 Walnut 123 Richmond Baker Pearl (c) 5 h 10 Alabama (SM) Baird L Rentz Jr student r 789 Holt Baker Raymond (c) r 327 Robinson rd Baird Lyman R (Laurie) 1 (o) dispr So Ry h Baker Reba (Mrs A M) prin Fresh Air Sch r 789 Holt 533 Orange Apt 4 Baird Robt T (Mattie T) 2 (o) night chf opr Baker Richd (c; Linley) h 8 Parker al W U Teleg Co h 701 Birch Baker Rome (c) r 303 (300) Tindall (SM) Baird Robt T Jr student r 701 Birch Baker Rosa (c) 2 h 118 Tindall (SM) Baird W Eug student r 789 Holt Baker Ruby J (Mrs C E) emp Lyon-Harris & Bairnsfather Eliz S (wid J H M) r 202 Buford Brooks r 1146 Milledgeville rd BapisidW en Robt E (o) emp C of Ga Ry h 107 Baker Sallie (c) 1 lndrs h 4 (553) Witkowski's la Crisp Baker Sara (c) h 106 (730) Wings al Baker Annie (c) cook S M Solomon Jr r 225 Baker Sarah bkpr Darling Shops r 411 Hill North Crest Baker Arthur M (Reba) h 553 Orange Apt 4 Baker Sarah (c) maid Clare J Walker Baker Azra C (Edna G) 1 pastor Tabernacle Baker Sherman A (Lillie) 1 h 203 Ward (V) Baptist Ch h 232 High Apt 2 Baker Stephen J (Emma) instr Central City Baker Bertha Mae emp Lyon-Harris & Brooks College h 810 Napier r 1144 Milledgeville rd Baker Theo emp New York Cafe r Y M C A Baker Buddy (c) dep elk Bibb County r Colum- Baker Wm (c) porter G W Hubbel bus rd Baker Clarence E (Rubye) (o) emp C of Ga Ry Baker Wm (c) porter Taylor Furn Co r 158 4th (V) h 1146 Milledgeville rd Baker Wright (c; Mary) 6 lab Macon Cooper- Baker Cody (Alice) 1 emp C of Ga Ry r 151 2d age Co h 811 Elm Baker Doris Lt The Salvation Army r Recrea- Bakewell Frank P (Melanie) dept mgr Union tion Park Dry Gds Co h 804 Cherry Baker Effie H (wid J L) (o) h 156 Magnolia Bakerwell Y Dean (Kath C) 1 slsmn Huckabee Baker Eliz r 1517 Broadway Auto Co r 623 Vlneville Baker Emmett H (Martha) 3 pres Yellow Cab Trans & Bge Co r 301 Hardeman Bakis Angelo (White House Weiner Stand) r Gordon Hotel Baker Eva D (wid J D) 3 opr Happ Bros h 100 Baldwin Amie (wid H) h 1154 Milledgeville rd Kemper Baker Frank F (Gertrude H) (o) sec Grand Baldwin Annie R (wid D A) r 127 Highland Baldwin B Albert (Maxa) elk The Great A & Lodge of Ga h 113 Lamar (V) P Tea Co r 817 New Baker Frank F Jr sec-treas Yellow Cab Trans Baldwin Cecil A (Marguerite C) lawyer 408 Ga & Bge Co r 113 Lamar (V) Casualty Bldg h 119 Birch (NHts) Baker Geo (c; Ollie) 1 h 114 Spring Baker Geo F (Eliz) (o) engr So Ry h 1517 Baldwin Chas B emp C of Ga Ry Baldwin Chas L carrier P O r 323 Johnson Broadway Baker Geo P (Georgia) 1 tex wkr Bibb Mfg Co BALDWIN CHAS W (Frances H) (o), V- P McClure Ofc Equipment Co, h 114 DeSota pi h 760 Oglethrope --Tel 4499-W Baker Georgia (Mrs Geo) tex wkr Bibb Mfg Co r 760 Oglethorpe Baldwin Corinne (c) maid r 220 5th (V) Baldwin Cornelia (c) dom r 447 (707) Middle Baker Harry (c; Martha) 7 lab h 240 Berkley dr Baker Helen G student r 1144 Milledgeville rd Baker Isom F mach C of Ga Ry Baker James (c) chauf A O B Sparks h 522 e 2d (EM) Baker James (Alice) (o) gro 1139 Milledgeville (EM) Baldwin Cullie L Mrs slswn Union Dry Gds Co r 2921 Houston BALDWIN DIRECTORY CO INC Albert Orth, Pres-Treas; Robert Morton Baldwin, V-Pres; Louis A R Nelson, Sec; Heber Page, Supt of Production; J W Burke Co Publisher's Rep- rd h 1144 do resentative 406 Cherry; World's Largest In- Baker James B (c; Mattie) r 254 2d (V) dependent City Directory Publishers and Baker James O emp Ry Exp Agcy r 1144 Mill- Originators of the ABCD Type of City Di- edgeville rd rectories; Publishers Macon City Directory in Baker John (c) r 101 Forest (V) Co-operation with Macon Evening News and Baker John G (Capitola) 1 mtr cycle ofc CPD h The Macon Telegraph; Home office, 125 703 Adams Meeting St, Charleston, S C; Local office Baker John H elk r 1144 Milledgeville rd 450-452 Cherry Baker Joseph (c; Annie) h 225 North Baldwin Eleanor Mrs 1 r 468 Walnut 126 Baldwin's and Telegraph's Baldwin Directories Challenge Comparison QUALITY DIRECTORIES Carefully Planned Accurately Compiled Conveniently Arranged Excellently Printed Beautifully Bound Conservatively Styled Successfully Presented Promptly Delivered Regularly Issued CITY DIRECTORIES OF CHARACTER Published in Selected Cities Throughout the South in Association with Daily Newspapers and Local Commercial Organizations. BALDWIN DIRECTORY SERVICE IS UNIQUE! No other publisher in the United States offers to the public a directory of the type issued by the Baldwin organization. Business firms using' Baldwin directory service are unanimous in their acclaim of its many unique features. AMERICA'S FINEST DIRECTORIES BALDWIN DIRECTORIES OFFER TREMENDOUS ADVERTISING VALUE THROUGH THE NEW HOUSEHOLDERS' SUPPLEMENT WHICH IS PRESENTED TO THE HOMES Baldwin 125 MEETING STREET Directory Co, Incorporated CHARLESTON, SOUTH CAROLINA he reatest o 1 Advertising A conspicuous and attractive advertisement can be purchased in any Baldwin directory at an extremely reasonable price. When making up his budget for publicity the wise advertiser will remember the many special features of Baldwin service- He will take into consideration the large home circulation, the convenient arrangement of the display space, the excellence of the printing and binding and the number of times the directory is actually referred to each day of the year. The primary purpose of the Baldwin organization is, of course, the supplying of accurate and reliable directory information promptly and regularly at the lowest possible cost consistent with good service. For this reason it is possible to price the advertising space far below the amount which would be charged on the basis of value if the book were primarily an advertising medium. There is no advertising medium in the South today which offers as much actual advertising value per dollar invested as Baldwin city directories. al EVERY BALDWIN DIRECTORY MUST CONFORM STRICTLY TO THE SPECIFICATIONS PREPARED BY BALDWIN DIRECTORY CO., INC. The Baldwin organization is ever on the alert for suggestions and recommendations which may increase the value of its service. At all times it co-operates with the local Chamber of Commerce, Merchants Association, newspapers and commercial organizations. Its work is carefully planned and painstakingly executed. All information supplied is authentic; a double-check system is used to insure accuracy. Trained census managers and enumerators check and re-check all data which appears in the city directory. The information is secured by a house-to-house canvass of the territory covered. THE HOUSEHOLDERS' SUPPLEMENT The Householders' Supplement is carefully prepared to meet the requirements of the home. It contains a complete business directory of the city, a civic section with full-page announcements and photographs of the larger churches, clubs, libraries, schools, public buildings and civic institutions and a list of nationally advertised brands of merchandise with the name and address of the local agent or distributor. Newspapers, Chambers of Commerce, Merchants Associations and Others Interested in Further Information Concerning Baldwin Directories Should Write to: ^ for ^ ollar in America Every advertisement appearing in a Baldwin City Directory will be found also in the Householders' Supplement. The distribution plan for the supplement is thoroughly worked out and each copy is personally presented by a representative of the civic and commercial organizations of the city. The homes receiving copies of the supplement are carefully selected and there is very little dead circulation; almost every copy is referred to daily. The live circulation of a Baldwin directory advertisement is actually from five to ten times that of an advertisement appearing in an average city directory, and the Baldwin distribution is primarily in the home. SPECIAL FEATURES In addition to all of the regular departments usuallyfound in city directories, Baldwin directory service offers many exclusive features. Some of these are as follows: 1. All home owners are designated in the alphabetical resident directory and also in the street guide. 2. The number of children under 16 is shown after the name of the head of each family. 3. A numerical telephone directory is given. 4. A telephone guide arranged by streets is included. 5. Each nationally advertised brand of merchandise is listed under the proper business classification, with the name and address of the local agent or distributor. 6. Full page announcements, with photographs when possible, of all the larger churches, clubs, lodges, schools, libraries and other civic institutions are included, in a special civic section. 7. The directory covers not only the city itself but also the smaller settlements and towns in the territory immediately adjacent. 8. The book is beautifully and durably bound in imitation leather. 9. Directory stands are installed in all public places so that the general public may have access to the directory at all times without cost. 10. An exact census is taken of each community and the directory gives the population. 11. The advertising is conveniently arranged to give the subscriber and the advertiser the best possible service. 12. A Householders' Supplement is issued in each city for the use of individuals in their homes. This gives the Baldwin directory a circulation five to ten times greater than the average directory. Baldwin Directory Co,, lnc 125 Meeting St. Charleston, South Carolina BALDWIN DIRECTORIES ARE PUBLISHED IN CO-OPERATION WITH LOCAL NEWSPAPERS AND CIVIC ORGANIZATIONS BY THE WORLD'S LARGEST INDEPENDENT DIRECTORY PUBLISHERS cThe Asheville Advocate ASHEVILLE. N. C. January 1, 1935 Mr. Robert Morton Baldwin 87 Patton Avenue Asheville, North Carolina Dear Mr. Baldwin: I am more than pleased with the public response to the newspaper announcement that 3000 copies of the Householders' Supplement of the 1935 City Directory will be presented to the homes of Asheville and surrounding trade territory by the Asheville Merchants Association. Already they have received several hundred letters requesting that copies of this useful and attractive volume be reserved. The Householders' Supplement will serve two purposes: (1) It will furnish to the homes a well-arranged book of miscellaneous information and a complete buyers' guide of the city, which will be cherished in later years as a 1935 souvenir of Asheville. (2) It will supply to the business firms a tremendously valuable medium of advertising at a very low cost. It Is my opinion that through the supplement you have solved the difficult problem of raising sufficient money to pay for an accurate and complete city directory regularly. Business men are not reluctant to spend money for something of real worth. I was glad that the Asheville Chamber of Commerce and the Asheville Merchants Association endorsed the Baldwin directory. You have many unique features which will greatly increase the usefulness of the book. I find that most firms are particularly interested In vour designation of home owners in the resident directory and also in the"street guide, listing of the number of children under 16 in each family, numerical telephone directory and street telephone guide. The presentation of the supplement at each home by a personal represenr.at.ive of the Merchants Association will greatly increase the public interest in the directory and I am confident that next year we will have thousands of directory enthusiasts among the householders ,of Asheville. I am more than pleased to be associated with you in the publication of a directory of this character. HHT-KCL Publisher The Asheville Advocate Newspapers, Chambers of Commerce and Merchants Associations interested in securing Baldwin directory service for their communities may communicate with the Baldwin Directory Company, Inc., Charleston, South Carolina. Baldwin Eliz r 270 Hardeman Balkcom Fred slsmn Dannenberg's r 410 (416) Baldwin Eliz S (wid J C) r 124 Violet Montpelier Baldwin Eug (c) delmn Piggly Wiggly r 317 Balkcom H D B r Hotel Gordon Green Balkcom Hansel elk Balkcom's Pharm r 450 Baldwin Frances H (Mrs C W) tcbr Whittle Center (EM) Sch r 114 De Soto pi Balkcon Harry C elk Arcade Billard Parlor r Baldwin Fredk O (Betty) 4 mech Adams- 254 Washington Buchanan Mtr Co h 103 (137) Colquitt Balkcom Josephine elk Balkcom's Pharm r 450 Baldwin Gladys (Mrs W L) cash Union Dry Center (EM) Gds Co r 2920 Houston Balkcom Lilia (wid W W) (o) 194 (108) Cres- Baldwin Hattie (c) cook r 108 (127) Orchard cent (C'H) Baldwin Herman L emp C'opelan Junk Co r Balkcom Lucile student r 194 (108) Crescent 1154 Milledgeville rd (CH) Baldwin Henry W (Cullie L) h 2921 Houston Balkcom Marcus C (Martha) slsmn Dunlap- Baldwin Hurley E (Mrs J C) opr Adams Mfg Peeler Hdwe Co r RD Forsyth rd extd Co r 2132 Broadway Balkcom Martha sten Happ Bros Co r 211 Ap- Baldwin J Comer (Hurley E) wood wkr Cen- plewood tral S & D Co h 2132 Broadway Balkcom Mary student r 211 Applewood Baldwin J Comer Jr emp Bateman Peach Farm Balkcom Naomi (c) cook H B Massey h 108 (8) r 2132 Broadway Clara (EM) Baldwin J Henry (Eloise) (o) div supt C of Ga Balkcom Nathl (c) jan Fort Hawkins Sch r 213 Ry h 270 Hardeman Ocmulgee Baldwin James M (Ella E) r 201 Ponce de Leon Balkcom Nathl (c) tex wkr Bibb Mfg Co r 110 (SM) Short la Baldwin Joseph R (c) student r 108 (127) Or- Balkcom Ralph E (Sarah) emp So Crate & Ve- Flour Mills h 113 (215) Mill neer Co h 523 Elm Baldwin Joseph B (c) student r 108 (127) Or- Balkcom Robt P (Minnie) (o) mach So Ry h chard 211 Applewood Baldwin Lula (c) r 913 (633) Pio Nono Balkcom Robt P Jr elk Atlantic Ice & Coal Co Baldwin Luther (c; Mary) emp Kingman & r 211 Applewood Everett r 317 Green Balkcom Sarah (Mrs R E) opr Happ Bros Co Baldwin Marguerite C (Mrs C A) sten First r 423 Elm Nat Bk & Trust Co r 119 Birch (NHts) Balkcom Service Station ( A F Balkcom) 1137 Baldwin Mary (c) maid h 728 Ash Broadway Baldwin Mary r 270 Hardeman Balkcom Thos L (Lillie) 1 (o) sta opr Sawyer Baldwin Mary E (Mrs C L) sten The Letter Coal & Ice Co r RD 5 Shop Inc h 323 Johnson Balkcom Thos N (Grace) 1 h 240 College Baldwin Mary L (c) 1 emp Snow's Ldry r 408 Balkcom W Leonard (Annie) 1 wtchrnn Citi- e 1st (EM) zens & Sou Nat Bk r 763 Poplar BALDWIN ROBERT MORTON (Sara Mullin) Vice-Pres Baldwin Directory Co Inc r Nash- BBaallkkccoomm'sWPmharrm25a4cyW(aBsh: JingBtaolnkcom) 340 Main ville Tenn (EM) Baldwin Sami (Martha) auto mech r 621 Elm Ball B Louise (c) emp Snow's Ldry r 119 Rock- Baldwin Sami A (Dovie) car repr C of Ga Ry hill la h 364 Spring Ball Chas J (Dolly) 6 emp Fish Hatchery h Baldwin Walter (c; Rebecca) emp Sterchi 205 (2) Dannenberg Stores r 115 Simmons (B) Ball David (c; Mary S) 4 lbr h 1214 3d Baldwin Wm L (Gladys) auto repr 2921% Ball Florence (c) r 116 (216) Wings Hill Houston h 2920 do Ball Justin emp Fish Hatchery r 205 (2) Dan- Baldwin Youther (c; Sadie) 1 r 317 Green nenberg Bales Alice r 1543 Broadway Ball Mamie (c) 1 h 116 (216) Wings Hill Bales Bernard (Ola) 1 (o) h 100 Dover (B) Ball Mary (c) 1 r 1313 1st Bales Cornelius A (Gladys) meter repr Macon Ball Nelton (c; Bessie) 2 trkr C of Ga Ry h Gas Co r 369 1st 119 Rockhill la Bales Doris emp Bibb Mfg Co r 1319 2d Ball Wm (c; Eliz) lab Bibb Mfg Co r 216 Bales Gladys (Mrs C A) marker Snow's Ldry r Walker la 369 1st Ballard Boskie (c; Ella B) 1 lab h 105 Drew's Bales Sophie (wid E N) 3 h 1319 2d Qtrs Bales Walter L (Ozella) elk W G Dean h 1543 Ballard Claude E student r 325 Duncan Broadway Ballard Emily r 415 Elm Balkcom A Peyton mgr McCrary DeWitt Drug Ballard Emma (c) (o) lndrs h 112 4th (U) Co h 338% Main (EM) Ballard F Eliz slswn S H Kress Co r 325 Dun- Balkcom Albert F (Clyde L) (o) (Balkcom can Serv Sta) h 739 Montpelier Ballard Grady hlpr r 415 Elm Balkcom Annie r 240 College Ballard John (c; Annie) h 497 Gilmer Balkcom Bosie (c; Etta) emp Cottons State Ballard John W (Allie F) pastor Willingham Fertilizer Co h 435 Elbert Bapt Ch h 325 Duncan Balkcom Bryant J (Lydia E) 2 (o) (Balkcom's Ballard Jones (c; Geraldine) 4 emp Atlantic Pharm) h 450 Center (EM) Ice & Coal Co h 717 (704) Elbert Balkcom Charlotte (c) cook h 424 (451) El- Ballard Leon (c; Minnie) emp Macon Linen liott Sup Co r 1343 Broadway BALKCOM ELAM E "JACK" (Beulah), mgr Ballard Lera (c) r 1246 (1179) Broad Acme Welding Co, r 652 Pine--Tel 3149-W Ballard Leroy (c; Minnie) 1 h 1246 (1179) Balkcom Effie sch tchr r 240 College Broad Balkcom Elder (c; Delia) tex wkr Bibb Mfg Ballard Lucy (c) cook C B Moore Co h 109 Short la Ballard Lula (c) r 804 Edgewood Balkcom Eloise tchr Pearl Stephens Sch r 194 Ballard Normal School (c) R G Von Tobel prin 108) Crescent 50 Forest (V) 1935 Macon City Directory 127 Ballard Ollie (c) dom r 102 Roberts (U) Ballard Ray tchr Wesleyan Conservatory r do Ballard V Margt student r 325 Duncan Ballard Wm (e; Eliz) 2 lab C of Ga Ry h 559 Cheatham al Ballizia Angelo elk Frank Ballizia r 401 Wal- nut Ballizia Frank confr 21 5th r 401 Walnut Baltimore Jesse (c) jan Ga Nat Guard Armory r 450 City Hall la Bam Lucile (e) dom E S Bragg Banjo Mamie (c) Indrs r 303 Ward (V) Banker Allyn C (Beatrice) emp Met Life Ins Co r 114 Rose Pk Bankers Health & Life Insurance Co P L Hay pres, N T Weaver, v-p, P L Hay Jr v-p, H T Anderson v-p, P W Jones sec-treas, home & dist ofc 211 Cotton Bankers Insurance Building 211 Cotton Banks Arth A (Pauline) mech Bibb Chevrolet Co h 221 Ell (EM) Banks Arth J (Bertha M) 1 stereo Macon Evening News r 702 1st Banks Bertha (c) presser Crescent Ldry r 112 (6) Franklin St la Banks Bessie tchr Fort Hawkins Sch r 701 Forsyth Banks Beulah (c) (o) h 401 Prince (SM) Banks Danl (c) pkr C-M-P Drug Co r 305 Wood al Banks E L mech R A McCord Mtr Co r 219 New Banks Essie (c) 1 cook T H Hall h 8 (908) Clayton (V) Banks Eutha M (c) r 220 (156) Disroon al Banks Fannie (c) h 465 Douglas (V) Banks Frank (c) r 107 Simmons Banks Frank (c; Eliz) h 616 Hammond Banks Frank (c; Lela) lab h 10 Ross St pi Banks Geo (c) dairy wkr r 308 Dover (B) Banks Geo (c) emp Bibb Mfg Co r 510 Martha Banks Geo (c; Laura) pntr h 651 Ross Banks Geo T (Jessie) (o) h 139 Highland Banks Geo W (c; Ophelia) (o) carrier P O h 255 1st (V) Banks Harry (c; Cora) 3 emp McKesson-Riley h 905 (105) Dempsey Banks Henrietta (c) 1 tchr Stinsonville Sch r 224 Ward (V) Banks Ida (c) Indrs h 305 Wood al Banks James H (Hazel) elk L D Green r 542 Log Cabin blvd Banks Jim R (c; Patsy) (o) h 124 Steven's Square Banks John (c; Ruth) 5 emp Terminal Sta n 807 Dempsey Banks Leila (c) (o) smstrs h 121 Neal (V) Banks Leonard (c; Eunice) 2 emp Sunshine Creamery r 209 Wood al Banks Lizzie (c) dom Mrs M L Halliburton r 236 (140) Cowan Banks Lonnie (c; Leola) 2 lab Macon Cooperage Co h 612 Hammond Banks Lucy C (c) (o) Indrs h 400 Rutherford (SM) Banks Lula (c) barber G W Hatfield Banks Lula A (wid J A) (o) h 701 Forsyth Banks Major (c) lab Mansfield Dray Line Co Banks Mamie (c) maid h 323 4th (V) Banks Marie (c) Indrs r 940 (502) Montpelier Banks Mattie L nurse 701 Forsyth r do Banks Milton (c; Flossie) 3 jan Washington Bldg h 334 Madison (V) Banks Minnie (c) Indrs r 905 (105) Dempsey Banks Obie (c; Mary) r 107 (9) Franklin St la Banks Ostell (c; Bertha) h 6 Franklin St la Banks Pearl (c) maid Lanier High Sch for Girls Banks Richd (c) clock repr h 806 (820) Cowan Banks Robt (c) r 86 Bay Banks Rosa W (c) r 220 (156) Disroon al Banks Russell (c) 4 emp Cherokee Brick Co r 202 (160) Peacock Banks Sally (c) maid Hotel Lanier r 1425 Broadway Banks Sallie M (c) 1 dom r 114 (106) Rock Banks Sami M elk Bibb Mfg Co r 218 Georgia Banks Susie (c) maid r 152 Spring St la Banks Thos (c; Eliz) 2 presser Snow's Ldry h 107 (365) Curd's al Banks Walter (c; Willa) box opr Kinnett- Odom Co r 606 New Banks Wm (c; Nellie) 5 h 329 Corbin (V) Banks Wm (c; Carrie) emp Happ Bros h 159 Thomas (EM) Banks Wm (c; Frances) 2 lab Macon Gas Co r 220 (156) Disroon al Bankston Creacy (c) (o) dom G M Smith h 512 Fort Hill Bankston Ella Lee (c) tchr Bartow Ga r 512 Fort Hill Bankston Geo D (Inez) 3 (o) carrier P O h 415 Mikado Bankston J Eug waiter Popular Cafe r 508 3d Bankston J R emp Ga Power Co r 209 1st Bankston John E (Ethel L) restr 508 3d h 508y2 do Bankston L Wesley student r 508% 3d Bankston Lillian T Mrs r 609 Vineville (V) Bankston M Carol student r 508% 3d Bankston Marie (c) student r 512 Fort Hill Bankston Pauline (c) nurse County Relief Admn r 529 Flanders Bankston R E Jr projectionist Capitol Theatre r 3d fir Hardeman Bldg Bankston Wyley (c; Pauline) emp C of Ga Ry r 529 Flanders Banton Wm (c) r 210 Moughon (V) Baptist Ministers' Assn L H Wright pres meets Mondays 10:30 A M First Baptist Ch Baptist Tabernacle The 902 2d Barbee Bertha Mrs 3 h 1007 Hazel Barbee Georgia P tex wkr Bibb Mfg Co r 1007 Hazel Barber David M (Swaney) 3 tex wkr Atlantic Mills h 33 Atlantic Barber Hartley (c) lab C of Ga Ry Barber Howard D (Lucile) 2 (o) slsmn Armour & Co h 736 Patterson Barber Janie (c) maid T B Sherwood r 100 (20) Kahn's al Barber Mary M (Mrs C W) (o) sten A L Miller High Sch h 215 Nottingham dr Barber Julia (c) 1 maid h 146 (132) Phillips la Barber Lillie G (c) r 100 (20) Kahn's al Barber Robt (c; Hattie) 1 emp Dempsey Hotel h 307 Walnut Barber Will (c; Rosa) 1 pkr Bibb Mfg Co h 105 (112) Powell Barclay A A r Hotel Macon Barden Agnes supv Pub Sch r 3202 Forsyth rd Barden Benj F (Nell C) (Barden & Taylor) r 130 Georgia Barden F Mike tailor J N Neel Co r Capitol Hotel Barden & Taylor (B F Barden, H N Taylor) whol gros 7 Terminal Bardley Alonza R Jr (c) emp Carling Tile Co r 713 Ash Bardley Lucy (c) maid r 713 Ash Barfield A Cliff elk M D & S Ry r Fickling Hotel Barfield Alf P elk Ga Seed Store res RD 1 Barfield Alton N shpg elk Am Bakeries Co r 442 Washington 128 Baldwin's and Telegraph's Barfield Asa C rate elk M D & S R R Co r Fickling Hotel Barfield Bayne sta atndt Am Oil Co Barineau Wm L (Christine) 1 emp C of Ga Ry h 1519 3d Barker Barney B (Lessie C) condr So Ry h 105 Barfield Bennett W emp Jackson-Wynn Co h 670 College Barfield Beulah Mrs h 442 Washington Barfield Chas (Lucile) r 415 New Apt 1 Barfield Darian J (Verdie) slsmn Progressive Lamar (V) Barker Barney B Jr mech Cliff Walker Co r 105 Lamor (V) Barker Betsy student r 105 Lamar (V) Barker Bettie (wid H T) h 204 Hightower (SM) Life Ins Co h 1327 3d Barfield Dorothy L nurse 105 Ingleside (I) r do Barfield Dress Shop (T W Barfield) 360 Broad- Barker Clifford C (Ruby) 1 formn Macon Linen Sup Co h 100 Capitol av Barker E B atndt B J Champion r 105 Lamar way Barfield Eliz (wid W Ml r 109 Brookdale (B) (V) Barker Essie (c) maid Mary S Burke h 324 Barfield Ellis E (Minnie) 2 pntr h 157 (206) Dempsey White (SM) Barker Florrie H (Lucy E) 3 (o) patrolmn Barfield Ernest A (Hettie) 2 (o) whse formn M D & S Ry h 220 Jones (EM) Barfield Ernest I tex wkr Bibb Mfg Co r 220 Jones (EM) Barfield Ernest M cred mgr Adams-Buchanan Mtr Co r 442 Washington Barfield Feed Mills (H L and J R Barfield Jr) 248 5th Barfield Floyd (Thelma) emp C of Ga Ry r 511 Napier Barfield Frank R traffic rep SAL Ry r 1025 Clinton rd Barfield Geo R Jr (Martha O) agt Ga Hwy Exp Inc h 105 Ingleside C P D h 107 Nelson (SM) Barker Frank (c) r 253 North Barker Geo M (Eliz E) (o) bkpr Jeffreys-Mc- Elrath Mfg Co h 193 Laurel Barker Geo T (Ola) (o) h 110 Florence Barker Henry carp h 299 Chappell (SM) Barker Idell (c) cook Thos Gilbert r 12 Parker (V) Barker John D (Georgia) emp Taylor Iron Wks r 653 2d Barker Joseph F delmn A R Wellon r 105 Park pi Apt 2 Barker Lizzie (Mrs L A) spinner Bibb Mfg Co r RD 6 Barker Luther A (Lizzie) emp Bibb Mfg Co Barfield H Lee (Minnie) 4 (o) (Barfield Feed r RD 6 Mills) h 550 College Barker Robt T (Mamie) h 325 Ross Barfield Hillie (c) r 105 (8) Franklin St la Barker Rosa Mrs 1 tex wkr Payne Mill r 97 Barfield James (Manelle) 1 tr dr Armour & Co Green (PM) r 220 Jones (EM) Barker S T (Beulah) h 324 Chappell (SM) Barfield Jessie R ofc sec Mercer Univ r 523 Barker Wilhelmina opr Happ Bros Co r 325 Linden Ross Barfield John H elk Golden Eagle Co h 733 Barker Wm C (Mary M) 1 bkpr Macon Paper Date Co h 108 English (V) Barfield John R Jr (Blanche) 3 (Barfield Feed Barker Wm D (Irene) 1 sgt U S M C Recruit- Mills) h 670 Courtland ing Sta h 105 Park pi Apt 2 Barfield John W (Eve) 1 hlpr r 1327 3d Barkley Hattie M (wid R D) 2 h 7 ift Broad Barfield Julius P (Georgia) 2 h 131 (101) Barksdale Byron B (Etta) mach C of G Ry h Charles 467 Monroe (V) Barfield Kath opr Happ Bros Co r 620 2d Barksdale Dorothy elk Harris, Russell, Poppet Barfield Lena D (Mrs T W) slswn Barfield & Weaver r 467 Monroe (V) Dress Shop r 125 Culver (V) Barksdale Jennie (c) maid Washington Des- Barfield Lester L (Bertie) 3 h 944 (510) Mont- sau r 313 2d (V) pelier Barksdale Julian lab Kinnett-Odom Co r 718 Barfield Lillie Mrs elk r 619 Pine Plum Barfield Mattie (wid F M) h 523 Linden Barksdale Richd (c; Jennie) h 313 2d (V) Barfield Melvin r 442 Washington Barksdale Rosa (c) student r 313 2d (V) Barfield Mildred opr Happ Bros Co r 869 2d Barksdale Vessie (c) r 313 2d (V) Barfield Neita asst sec Jr Chamber of Com- Barksdale W Howard (Louise) elk P O h 414 merce r 442 Washington Belmont Barfield Thos W (Lena) (o) (Barfield Dress Barksdale Wyman M clo presser r 1052 Wal- Shop) h 125 Culver (V) nut Barfield W Edgar (Maude) (o) h 1025 Clinton Barlow Annie h 346 Flanders rd (EM) Barlow Annie (wid W M) tex wkr Bibb Mfg Barfield W Toland sis mgr Dr Pepper Btlg Co Co r 325 Clinton r 1025 Clinton rd Barlow Ethel H (Mrs R O) tex wkr Bibb Mfg Barfield Wesley (Alma) emp Macon Telegraph Co r 325 Clinton r 1327 3d Barlow Florence (c) 2 r 1144 Broadway Barfield Wm (Carrie) lab h 453 Arch Barlow Harry E (Lois) mech Schwartz & Barge Emma (c) h 2119 Wyche's al Phaul r 129 Yates Barge Erdis (c) maid r 2119 Wyche's al Barlow Jas E (Minnie) 1 (o) h 343 Flanders Barge John A (Alva C) 3 slsmn Frank Roberts Barlow James E Jr r 343 Flanders h 7 Dessau pi Barlow Lavotia opr Happ Bros Co r 346 Flan- Barge John C r 7 Dessau pi ders Bargeron Beatrice (Mrs J G) elk Jo Jo's r 611 Barlow Lois (Mrs Harry) opr Adams Mfg Co r Duncan 129 Yates Bargeron Joseph G (Beatrice) (Jo Jo's) elk Barlow Lorenzo C (Mattie L) h 352 Clinton Macon Evening News h 611 Duncan Barlow Morgan T (Josephine) 3 mech Schwartz Bargeron W Heyward (Margt C) 1 detective & Phaul h 215 (161) Center (EM) C P D r 684 Hillyer Barlow Robt O (Ethel) tex wkr Bibb Mfg Co Bargeron William H emp Bibb Mfg Co r 611 h 325 Clinton Duncan Barlow Sara A (Mrs W M) emp Bibb Mfg Co Bargsdale Charlie (c) cook Bloodworth's Cafe r 129 Yates 1935 Macon City Directory 129 Barnes A Emmett (Ethei) (o) court reporter Bibb County h 910 Napier Barnes John T (Nora) 2 int dec h 915 Walnut Apt 8 Barnes A Emmett Jr (Sarah H) 2 (o) pres Barnes John T Jr (Ruth) 2 prsmn Macon Barnes & Barnes Inc h 117 Buford pi (V) Evening News r 803 Cherry Barnes Albert (c) r 957 Pio Nono Barnes Albert (c; Susie) 2 emp Maxwell Bros h 220 Elliott Barnes John W elk Great A & P Teo Co r 210 Flamingo dr Barnes Jordan r 821 Mulberry Barnes Allen (c) lab Atlantic Ice & Coal Co Barnes Joseph (Susie) h 324 Dannenberg Barnes Amanda (c) r 161 Elbert Barnes Joseph (c; Parlee) (o) porter Otto Barnes Anna (c) 2 sch tchr r 907 Pio Nono Harness Co h 500 Jay Barnes Apartments 356 New Barnes Kate (c) 1 emp Independent Ldry Co Barnes Augustus (c; Geneva) 2 lab Bibb Mfg h 706 (604) Hall (EM) Co h 361 Hazel Barnes L Carolyn student r 105 Brentwood Barnes Avery Mrs furn rms 821 Mulberry h do Barnes L Lavette student r 316 Washik^ton Barnes Benj (c; Martha) h 101 Woodliff Barnes Bennett (c; Rosie) 1 h 489 Long St la Barnes Laura (c) maid A S Simmons h 824 Edgewood (SM) (SM) Barnes Lawrence r 915 Walnut Apt 8 Barnes Beulah L (wid J G) (o) (J Gardner Barnes Lila (c) 1 h 248 Powell Barnes Fur Shop) h 316 Washington ' Barnes Carrie (c) lndrs h 319 Coles al Barnes Liss (c) hlpr So Crate & Veneer Co r 220 Woodliff Barnes Cora (c) (o) h 146 e Academy (EM) Barnes David A Jr (Eva) 1 meat ctr Rogers Barnes Lola M (c) lndrs r 213 Yates al Barnes Mamie C tchr Chas H Bruce Sch h 213 Inc h 105 Brentwood Bond Apt D 2 Barnes Dewey D (Garnet B) 1 (o) emp Am Barnes Martha (c) maid r 101 Woodliff Tel & Teleg Co h 207 Hines ter (V) Barnes Martha A (c) lndrs r 112 Cowan Barnes Dorothy C tchr Alex Sch No 2 r 213 Barnes Mary (c) 2 h 423 Elliott Bond Apt D 2 Barnes Elias L (Mae) emp Gill's Bakery h 1823 Barnes Mary S (wid GW) r 811 Walnut Barnes Mattie elk R C Cropper Co r Y W C A Broadway Barnes Mattie L (c) maid Frances Conner r Barnes Eliz (Mrs H R) cash Penney's r 322 423 Elliott Orange Barnes Melvin (c) student r 957 Pio Nono BARNES ERNEST V (Sophie S) 1 (o), SecTreas Hotel Dempsey, h 328 Beech--Tel 2393 Barnes Milas (c; Ada) hlpr Swift & Co r 354 Pine Barnes Ernestine (c) maid W T Turtington i Barnes Moses (Victoria) sec-treas Bateman Co 640 4th (WH) Barnes Ethel (c) r 489 Long St la (SM) Inc h 649 Hillyer Barnes Nell B sten Citizens & So Nat Bk r 649 Barnes Ethel (c) emp Macon Linen Sup Co r Hillyer 161 Elbert Barnes Ophelia opr Happ Bros Co r 128 Fort Barnes Eva (c) maid Leonard Caserio r 328 Hill McClain la Barnes Eva H student r 105 Brentwood Barnes Oscar W (c; Laconia) 2 lab City St Dept h 558 Ward (V) Barnes Eva W (c) cook F F Baker r 203 Mi| Barnes Patsy (c) r 523 Hazel tual (V) Barnes Randolph (Louisa) 8 h 803 (275) Bal- Barnes Genie (c) (o) h 209 3d (V) lard (EM) Barnes Genie C administrator FERA r 211 Cherokee Barnes Raymond G elk C of Ga Ry r RD 2 Barnes Rose student r 821 Mulberry Barnes Geo (c) cook Coffee Cup Cafe Barnes Rosa (c) r 311 Womack Barnes Geo (c) (Lou) emp Buckeye Cotton Oil Co h 455 Coles al Barnes Rosa (c) maid C A McConnell r 538 Jackson Barnes Geo W (Sadie B) slsmn Taylor Iron Wks r 105 Seminole Barnes Ruth Mrs (o) h 356 New Apt 1 Barnes Seletha (c) r 110 (8) Orchard (V) Barnes Gertrude (c) cook Stella Smith h 131 Barnes Smith (c) lab Buckeye Cotton Oil Co (122) Wood al Barnes Susie (c) lndrs h 517 Coleman al Barnes Goliath (c; Eva W) r 203 Mutual (V) Barnes Taylor (c; Mary) lab City r 527 For- Barnes Gracie (c) r 401 (300) Elizabeth (SM) syth Barnes Gussie (c) 2 clnr Bibb Mfg Co h 107 Barnes Thelma (c) r 364 Elm 7th (B) Barnes Thos L (c) porter Dempsey Hotel r 314 Barnes Henry S (Mattie) prof Mercer Univ h 3d (V) 503% Adams Barnes Vesroe (c; Laura) 1 lab C of Ga Ry h Barnes Hugh R (Eliz) mech Ga Power Co r 322 123 Clark la Orange Barnes Warren O (Maggie) (o) bgemn G S & Barnes I L Mrs slswn J N Neel Co r Columbus F Ry 210 Flamingo dr rd Barnes Wilbur O elk The Great A & P Tea Co Barnes J Gardner Fur Shop (Beulah Gardner) r 210 Flamingo dr 316 Washington Barnes Wm (c) 2 farmer h 701 (608) Crisp Barnes James (c; Nellie) h 103 (115) 3d (U) Barnes Wm (c) lab Proctor & Gamble Mfg Co Barnes James B (Lucille M) (o) gro 200 Barnes Wm T (c; Hattie) 2 (o) agt Atlanta Orange r 105 Kenmore pi (CP) Life Ins Co h 309 Berry Barnes James O (Sue) baker Am Bakeries Co Barnes Willie C (c) h 301 Hawkins r 203 (128) Fort Hill Barnes Willie M (c) r 308 Cedar (U) Barnes James O (Jennie) (o) slsmn h 227 Barnes & Barnes Inc A E Barnes Jr pres ins Cedar (SM) 361 Cotton Barnes Jefferson (c; Carrie) (o) tr dr Chambers Lbr Co h 957 Pio Nono Barnes Jennie C r 211 Cherokee Barnett Clarence M (Essie M) 2 carp h 302 Belmont Barnett Fred (c; Mattie) 3 lab h 124 Adams Barnett Geo L elk Mulberry Mkt r 406 Forsyth Barnes John (c; Mamie) (o) carp h 308 Cedar Barnett Jack S elk Sami Barnett r 514 Church (U) (EM) 130 Baldwin's and Telegraph's Barnett John W (May) 2 lawyer 305 Bibb Bldg r 541 Georgia Barnett Loulie tehr Wesleyan Conservatory r do Barnett Mfg Co (W O and R C Barnett) har- ness mfrs 315 Poplar Barnett Matthews asst mgr Mulberry Mkt r 406 Forsyth Barnett Milton student r 514 Church (EM) Barnett Morris (Esther) (o) (Mulberry Mkt) h 406 Forsyth Barnett Robt C (Mildred) (Barnett Mfg Co) r 193 Magnolia Barnett Sami elk Mulberry Mkt r 406 Forsyth Barnett Sami (Sarah) 1 gro 514 Church (EM) h do Barnett Thelma r 406 Forsyth Barnett Wm O (Barnett Mfg Co) r 807 Cherry Barnette E Hartley (Lucile) 3 slsmn h 407 Virginia Barnette James student r 407 Virginia Barnham Wm (c) emp Willingham Mills Barnwell Harry W slsmn Clark Memorial Inc r 207 Hendley Barnwell James H (Beatrice) newspaper re- porter h 122 Birch (NHts) Barnwell May r 207 Hendley Barnwell Nina (wid G R) 1 h 596 Hillyer Barnwell Square Apartments 119-21 Birch (NHts) Barnwell Wm C (Minna) (o) train dispr So Ry System h 207 Hendley Barnwell Wm C Jr slsmn Fenner & Beane r 207 Hendley Baron Chas (c; Ella) r 108 Randall la Baron Henry (c) jan r 815 Ocmulgee Barr Wm (c; Leanna) 1 lab Buckeye Cotton Oil Co h 527 Gilmer Barrentine Margie Mrs opr Happ Bros Co r RD 4 Barrentine Ozzie (Mattie) r 428 Main (EM) Barrentine Walter W emp C of Ga Ry Barrett Benj (c; Ethel) emp C of Ga Ry h 169 (321) Nussbaum Barrett Birdie M (c) r 651 Elm St la Barrett Edw (c) lab Proctor & Gamble Co Barrett Eliz (wid J J) (o) h 310 Hill Crest Barrett Henry (c; Camilla) h 118 (114) Rail- road Barrett Joseph (c; Mattie) 1 (The Sugar Bowl) h 243 Tindall (SM) Barrett Lydia S student r 310 Hill Crest Barrett Lucy sec to the pres Mercer Univ r 421 Adams Barrett Mattie S (c) maid 99 Vineville (V) Apt A 1 Barrett Ola M (c) ldry wkr r 308 Coles al Barrett Wm J student r 421 Adams Barrington John O (Ida) 2 h 1534 Broadway Barrington Madie spinner Bibb Mfg Co r 859 Cherry Barron Alva L (Mrs S N) opr Adams Mfg Co r 416 Elm Barron Clara (c) emp So Bell Tel Co h 1 Cole- man al Barron Clarence J (Magnolia) 3 tex wkr Payne Mill h 151 Comer ter (PM) Barron Edw (c; Susie) 5 emp C of Ga Ry h 810 Elm y Barron Ella M (wid W J) r 919 (1985) Log Cabin blvd Barron Elvira (wid J R) r 856 Pine Barron Fannie (c) h 111 4th (V) Barron Haskell E (Kathryn V) co repr So Bell Tel Co r 478 College Apt 5 Barron John (c; Elberta) h 47 Harris Barron Kath V (Mrs HE) opr So Bell Tel Co r 478 College Apt 5 Barron Lilia (c) 3 h 519 Flanders Barron Martha nurse Middle Ga Hosp r do Barron Mary (c) dom J T Crenshaw Barron Myrtice S (Mrs J L) tchr Fort Haw- kins Sch h 401 College Apt 6 F Barron Schuyler N (Alva L) 4 hlpr r 416 Elm Barron Seth H interne Macon Hosp r do Barron Wm (c; Eliz) r 723 (r) Broadway Barron Wm (c; Lizzie) lab h 802 (2) Murray al Barron Wm (c; Tempie) 3 tractor opr Paul Williams Co h 611 Ross Barrow Alma (c) lndrs Crescent Ldry r 262 4th (V) BARROW ANDREW W (c; Helen) (o) (Inde- pendent Funeral Home) h 410 3d (V)--Tel 3892-R Barrow Benj (c) h 303 Womack Barrow Ethel (c) r 855 (856) 3d (V) Barrow Helen (c) cash Independent Funeral Home r 410 3d (V) Barrow Jessie (c) maid r 855 (856) 3d (V) Barrow Mimi physical instr A L Miller High Sch r 114 Coleman Barrow R Roy (M Frances) with McCord Mtr Co h 99 Vineville (V) Apt F 4 B'arry Arth P (Patsy) 1 mgr Capitol Theatre h 864 Mulberry Apt 3 A Barshow Frank A (Nellie) 4 h 132 Holt Bartee Homer G (Grace) dist chf So Bell Tel Co h 142 Beverly pi Barthlen Alphonso rector St Peter Claver Cath- olic Ch h 430 Ward (V) Bartlett Alma (c) lndrs h 209 Wood al Bartlett Blanton I (Addie M) 2 batterymn Jack Mann Battery Co h 143 Rose pk Bartlett Chas L (Emma) (o) lawyer 612 Ga Casualty Bldg h 1218 Ash Bartlett Charles R r 308 Log Cabin dr Bartlett Chas W (Kate) 1 tex wkr Willingham Mills h 28 (89) Mill Bartlett Clara (c) student r 215 (433) Ala- bama (SM) Bartlett Everett L mech Bibb Chevrolett Co 620 3d Bartlett Estelle sten Bibb Mfg Co r 251 Oak- land i Bartlett Frances student r 251 Oakland Bartlett Fred mech Macon Auto Exch 215 2d Bartlett Geo W (c; Mary L) (o) mech h 9 Bartlett Bartlett Helen R prof Wesleyan College r do Bartlett lone (Mrs J W) marker Snow's Ldry r 212 Hydrolia Bartlett James W (lone) 1 carp r 212 Hydro- lia Bartlett John W (Gladys) 1 elk W N Shin- holster h 114 Highland (LCHts) Bartlett Kate (Mrs C W) tex wkr Willingham Mills r 28 (89) Mill Bartlett Margt student r 251 Oakland Bartlett Marguerite r 28 (89) Mill Bartlett Mary L (wid L J) opr Adams Mfg Co h 516 Oglethorpe Bartlett Milton T (Mary M) farmer h 312 Log Cabin dr Bartlett Paul student r 251 Oakland Bartlett Robt L (Taye) 2 lab H C Marshall Dairy h 323 (24) Mercer (B) Bartlett Sandy (c; Ellen) 6 lab h 215 (433) Alabama (SM) Bartlett Sheet Metal Works (W E Bartlett) 653 (r) Broadway Bartlett Susie (Mrs W T) tex wkr Willingham Mills r 4 Randolph pi Bartlett Walter (Josephine) hlpr r 1223 2d Bartlett Walter E (May) 4 (o) (Bartlett Sheet Metal Wks) h 949 Elm 1935 Macon City Directory 131 Bartlett Walter L (Beulah) 1 wtchmn Willingham Mills h 251 Oakland Bartlett Wm E (Tressie) 2 h 201 (301) Park (B) Bartlett Wm T (Susie) 1 tex wkr Willingham Mills h 4 Randolph pi Bartlett Wright r 308 Log Cabin dr Barton Ada (Mrs Vernon) spinner Payne Mill r 126 Comer ter (PM) Barton Carl (c; Pearl) lab h 163 Lynwood (V) Barton Dixie W (Hazel) 1 emp C of Ga Ry h 120 Inverness Barton Earl H (Louise) 3 slubber hd Payne Mill h 110 Green (PM) Barton Eliz Mrs 1 opr Happ Bros h 46 White (SM) Barton Fannie L cash J N Neel Co r 220 1st Barton Forrest W (Minnie L) 2 tex wkr Payne Mill r 118 Comer ter (PM) Barton Hillary r 118 Comer ter (PM) Barton J C (Mae) 3 r 118 Comer ter (PM) Barton Louise (Mrs Earl) spinner Payne Mill r 110 Green (PM) BARTON MARY LOU Bursar Wesleyan Con- servatory of Music and Fine Arts r do--Tel 4437 Barton Minnie L (Mrs Forrest) tex wkr Payne Mill r 118 Comer ter (PM) Barton Pearl (c) cook r 163 Lynwood (V) Barton Vernon S (Ada) tex wkr Payne Mill h 126 Comer ter (PM) Barton Wallace lab r 860 2d Bashinski Benj J (Bernice) 2 (o) phys 320 Doctors Bldg h 120 Buford pi (V) Bashinski Sarah (wid Louis) h 800 Cherry Bashuk Edw (Wilner T) 1 clothing 554 Poplar h 412 Vineville Baskett James (c) (Anna) lab r 1256 2d Baskett Raymond W (Ida M) tex wkr Bibb Mfg Co h 219 Jackson Baskette Braddock M (Lemma) 2 h 1244 College Baskette Braddock M Jr twister Bibb Mfg Co r 1244 College Baskette Bruce N (Annie) 1 pntr r 1244 College Baskette Robt dairy wkr John T Smith r 12451 College Baskette Sue L emp Middle Ga Pecan Growers r 1244 College Baskin Gus (c) r 940 (502) Montpelier BASKIN WM H (Marian) (o) Pres Builders Lbr Co Inc, h 317 Adams--Tel 5094-J BASKIN WM H JR (Frances) 2 (o), V-P Builders Lbr Co Inc h 517 Ridge (V)--Tel 1729 Bason Emma (c) 1 h 141 (121) Nussbaum Bason Emory (c) lab r 266 Broad (EM) Bason Frances (c) r 651 Ross Bason Kath( c) cook J E Bankston r 266 Broad (EM) Bass Bus Lines W L Whiting supt 320 Broadway Bass Chapel M E Church G F Erwin pastor 3102 Forsyth rd Bass Chas hlpr r 200 Plumtree (EM) Bass Chas T (Eliz) 4 pntr h 328 Hydrolia Bass Cora E (c) lndrs h 4 (315) Hanson (SM) Bass Eva (c) h 111 Tindal (SM) Bass Ida (c) dom r 102 Empire (V) Bass Irene L (wid J M) h 855 Mulberry Apt 302 Bass J Melton r 855 Mulberry Apt 302 Bass James M (Ruth) 3 h 415 New Apt 1 Bass Jesse emp Maxwell Bros r 616 1st Bass Lula (Mrs M W) opr Happ Bros Co r 863 Elm Bass M W (Lulu) 1 h 863 Elm Bass Marcus (c; Mary L) 1 lab C of Ga Ry h 360 Edison Bass Mattie (wid W T) h 319 Clinton Bass Minnie (c) 8 h 1019 Edgewood Bass Nannie H (Mrs R L) emp Bibb Mfg Co r 367 (347) Hydrolia Bass Princess (Mrs Grady) 3 spooler Payne Mill r 409 Elm Bass Robt L (Nannie H) pntr h 367 (347) Hy- drolia Bass Robt L Jr r 367 (347) Hydrolia Bass Wm C mech R A McCord Mtr Co r RD 1 Bass Wm J (Willette) 1 meat ctr W C Rushin h 616 Walnut Bassett Annie R Mrs 4 h 138 Tenney (SM) Bassett Bernard W (Johnnie) dr Yellow Cab Co r 2301 2d Bassett Bernice sch tchr Paris Ga r 507 Geor- gia Bassett Carrie L (wid Newton) opr Happ Bros Co r 99 Daisy Park Bassett Chas R (Viola) mech Central S & D Co r 112 School Bassett Estelle (wid Henry) r 619 Walnut Apt 6 Eassett Florence G Mrs bkpr J N Neel Co r 507 Georgia Bassett Geo (Annie) 1 cbntmkr Central S & D Co h 416 Elm Bassett Geo Jr r 416 Elm Bassett H Eliz Mrs 1 r 2838 Houston (SM) Bassett John r 416 Elm Bassett Mallary E (Mildred) 1 (o) laddermn C F D h 112 School Bassett R Elvin (Mabel C) bkpr Central of Ga Bkg Co r 258 Orange Bassett Ralph P (Henrietta) mgr Met Life Ins Co res Fort Valley Ga Bassett Remhert E plmbr F X Daly Co r 99 Daisy Park Bassett Texana (wid B A) r 868 2d Baston Annie student r 203 Hartley (CP) Baston Chas E (Julia) emp C of Ga Ry h 217 Jackson Baston Ella (wid C C) r 101 Grenada ter Baston Wm M (Letha) 1 h 203 Hartley (CP) Batchelor Alice student r 23 Lake City (EM) Batchelor Artis R (Jewel) 1 emp C of Ga Ry h 104 Emory (SM) Batchelor Chas M (Maggie) h 23 Lake City (EM) Batchelor Grace student r 23 Lake City (EM) Batchelor Lonzo N (Clara) (o) chf elk So Ry h 1208 Ridge (I) Batchelor Louise nurse Macon Hosp r do Batchelor Maggie (Mrs C M) tex wkr Bibb Mfg Co r 23 Lake City (EM) Batchelor Mary A (wid J H) 1 (o) h 125 Ruth- erford (SM) Batchelor Ruth tex wkr Bibb Mfg Co r 23 Lake City (EM) Bateman Albert G (Sophronia) wtchmn C of Ga Ry h 906 Oglethorpe Bateman Cecil M (Agnes) mach Taylor Iron Wks r 605 Carling Bateman Clara (Mrs E E) slswn Dannenberg's r 123 W Grenada ter Bateman Clifford H (Louise M) 1 (o) pres Bateman Co Inc h 1107 Vineville (V) Bateman Codono V (wid J H) 1 (o) h 121 Ell (SM) Bateman Co Inc C H Bateman pres, D C Bate- man v-p, Moses Barnes sec-treas, fruit growers and shipper 264 5th Bateman Cora r 228 American blvd Bateman Dewey C (Edna) 1 v-p Bateman Co Inc r Walden Ga Bateman Edith student r 123 w Grenada ter 133 Baldwin's and Telegraph's Bateman Emmett E (Clara) (o) emp C of Ga Ry h 123 W Grenada ter Bateman Ernest E (Lillie A) (o) barber 318 Broadway b 560 Boulevard (NH) Bateman Gilbert C il^yda E) meat ctr Great A & P Tea Co h 228 American blvd Bateman Hansell R meat ctr Great A & P Tea Co r 228 American blvd Bateman Helen L student r 1107 Vineville (V) Bateman James H lab r 121 Ell (SM) Bateman Julian H meat ctr Great A & P Tea Co r 228 American blvd Bateman Leila (wid L R) r 808 Orange Bateman Leola E (wid O C) (o) h 435 Vine- ville (V) Bateman Marie student r 123 W Grenada ter Bateman Martha (wid T F) slswn Union Dry Gds Co r 560 Boulevard Bateman Mary (c) cook A A LeGuin Bateman Mary (c) maid r 404 Crisp Bateman Milton E r 906 Oglethorpe Bateman O Belle checker Crescent Ldry r 906 Oglethorpe Bateman R Neal (Nell) 1 (o) ticket agt Ter- minal Ticket ofc h 119 Inverness Bateman Rebecca (c) Indrs r 220 Pond (V) Bateman Robt L (Eliz) r 217 Bond Bateman Ross C meat ctr Great A & P Tea Co r 228 American blvd Bateman Roy F (Willie J) emp Art Furn Mfg Co h 128 Grady Bateman Terrel M (Eula) firemn C F D h 906 Oglethorpe Bateman W Chas (Eliz) 1 mkt mgr Great A & P Tea Co h 705 Winton Bateman Wm (c) furn repr h 317 Coles al Bateman Wm (c) lab Buckeye Cotton Oil Co Bates C Alleene (Mrs O G) beautician Dan- nenberg's r 568 1st Bates Emma R (c) instr Central City College r 1035 Clinton rd Bates Evie (Mrs R C) winder Bibb Mfg Co r 319 White (SM) Bates Ocie sten So Paint & Varnish Co r Y W C A Bates Oscar G (C Allene) pntr r 568 1st Bates Roy C (Evie) 1 tex wkr Bibb Mfg Co h 319 White (SM) Bates Sulina (c) h 119 (10) Braswell la Bates Thos H (Hazel) 3 card Bibb Mfg Co r 654 Hawthorne Bates W Albert (Edna) knitter Bibb Mfg Co h 1664 2d Batson Bertha (Mrs W G) tex wkr Willing- ham Mills r 226 Duncan Batson John L r 391 Belmont Batson John W L (Mae) 1 dep elk County Tax Coir h 391 Belmont Batson Jos H tex wkr Willingham Mills r 226 Duncan Batson La Verne student r 391 Belmont Batson Oscar M (Alice) (o) brakemn C of Ga Ry h 3214 (3198) Houston (SM) Batson Walter G (Bertha) 3 tex wkr Willing- ham Mills h 226 Duncan Battle Abr (c) r 103 Sutley Battle Annie (c) h 257 White al Battle Annie L (wid C G) (o) h 597 College Battle Annie M (c) maid r 304 Gordon (CH) Battle Bessie (c) student r 304 Gordon (CH) Battle Bobbie L cook J B Nutting r 304 Gor- don (CH) Battle C B (c; Lillie) lab h 822 Montpelier Battle Carrie (c) 3 Indrs h 505 (511) Maynard Battle Chas (c) lab City Scavenger Dept Battle Chas (c; Mamie) lab h 113 (558) Ful- ton la Battle Clifford (c; Asa) 2 h 320 Green Battle Cora L (c) maid W E Fort r 211 Fretwell al Battle Danl K (Irene) 1 engr Standard Tool & Handle Co h 517 Giles Battle Elbert (c) r 675 Dunlap Battle Ella (c) h 456 Chestnut Battle Ephriam (c; Lula) r 904 Hazel Battle Evans (c; Ora L) h 435 (211) Pio Nono Battle Frances (c) cook D A Tarver r 584 Everybody's Crossing Battle Frank (c; Bettie) (o) h 116 Grant (S) Battle Golduster (c) 1 h 158 Glen Battle Henry (c; Frances) dairymn h 584 Everybody's Crossing Battle Henry B (c; Mattie) 1 (o) porter Capi- tol Theatre h 1043 Pio Nono Battle Homer (c; Annie K) 1 h 12 Alabama (SM) Battle Isaac (c; Lula) lab h 116 (521) John- son's al Battle James (c; Eleanor) 2 h 204 (105) In- dustrial Home rd Battle James (c) emp Jeffreys-McElrath Mfg Co Battle John (c; Mary R) emp Cherokee Brick Co r 704 (262) Charles Battle John (c) lab r 827 Montpelier Battle John H (c) hlpr Maxwell Bros r 439 (448) Middle (EM) Battle Joseph (c; Clara) 1 delmn T M Raines Gro Co r 305 Dure (U) Battle Lee (c) cook Mercer Univ r 207 (252) Prince (SM) Battle Lillian M r 597 College Battle Lillie (c) cook T E P Woodward r 822 Montpelia Battle Lucinda (c) (o) Indrs h 110 (340) Rock Battle Lucy (c) dom h 220 (227) Moughon (V) Battle Lula (c) peddler r 156 May av (U) Battle Mary (c) maid J Brad Wall r 325 5th (V) Battle Mary L (c) 1 cook H E Bussey r 163 Roye Battle Mary R (c) cook J C Sanders r 704 (262) Charles Battle Mattie (c) h 173 1st (V) Battle Mazie (c) h 110 Short la Battle Minnie (c) 4 Indrs h 240 Plant row Battle Mollie (c) r 114 (812) Railroad Battle Monroe (c; Rosa) 2 (o) swtchmn C of Go Ry h 203 Bartlett Battle Nellie (c) r 24 Parker (V) Battle Nettie (c) r 305 Dure (U) Battle Nora (c) ldry wkr h 614 Chapman al Battle Ollie (c) dom r 320 Cheatham al Battle Robt (c; Essie) (o) h 304 Gordon (CH) Battle Robt (c) (Ola) 1 r 257 White al Battle Robt (c; Sarah) chauf r 104 Spring Battle Robt (c; Lula) (o) peddler h 156 May (U) Battle Rubye (c) maid r 115 Sycamore Battle Sarah (c) cook T E Highsmith r 104 Spring Battle Sim (c; Ollie) hlpr City Repr Shop h 110 (10) Wise (V) Battle Sylvester (c) lab r 135 (115) Wood al Battle Thos tr dr Burney Bros Co 453 5th Battle Virlene (c) emp Snow's Ldry h 401 (300) Elizabeth (SM) Battle Wm (c) lab r 207 (127) Edison Battle Willie (c) lab C of Ga Ry Batton Hardy L (Bessie) 1 (o) emp C of Ga Ry h 137 Virginia Batton Wimbric L appr C of Ga Shops r 137 Virginia Batts Ida (wid J W) r 314 New Baughcum Elisha J (Carolyn) 4 jwlr h 141 (139) Oakland 1935 Macon City Directory 133 Baughcum Lovejoy D (Georgia) (o) barber Genone's Barber & Beauty Shop h 254 Bankston Baughcum John M (Thelma M) 2 (o) auto mech City Bd of Water Comrs h 647 Forsyth Baughcum Wm L (Henrietta) 1 slsmn Cotton States Fertilizer Co h 125 Birch (NHts) Baul Ollie (c; Hessie M) (o) jan Bankers Ins Bldg h 433 Madison (V) Baull Chester (c) r 117 Sycamore (V) Baull Jane A (c) sch tchr Marshallville Ga r 117 Sycamore (V) Baull T Ulysses (c) porter Collins Baking Co r 117 Sycamore (V) Baull Wm (c; Ida J) (o) h 117 Sycamore (V) Baumgartner B` Grace student r 422 Log Cabin blvd Baumgartner Ida E r 422 Log Cabin blvd Baumgartner Chas F (Beulah) 2 (o) mech Adams-Buchanan Mtr Co h 422 Log Cabin blvd Baxley David D (Maggie) 3 wtchmn Fish Hatchery h 159 Nelson (SM) Baxley Inez F (Mrs J R) cash Dannenberg's r 131 High Baxley John R (Inez F) asst bkpr C-M-P Drug Co r 131 High Baxley John W (Adella) (o) h 3024 Houston (SM) Baxley Margt emp Macon Hosp r do Bay Street Baptist Church (c) 122 Bay Bay Street Cash Grocery (Fred Fallas) 102 Bay Bayman Clarence (c) lab So Crate & Veneer Co Baynard Geo A (Corinne) (o) slsmn Union Dry Gds Co h 104 Culver (V) BAYNE CHAS J (Mary H) (o), Editor The Macon Evening News, h 6 Glynn--Tel 3135-J Bayne Kate r 486 Orange Bayne Louise V ofc sec HOLC r 486 Orange Bayne Sami E pharm Shelverton-Bayne Drug Co h 486 Orange Bazemore Claude student r 132 Cole Bazemore Crowell O (Ella M) 1 engr So Ry h 132 Cole Bazemore Geo elk Pig-in-Sax r 2218 Forsyth rd Bazemore Gordon r 132 Cole Bazemore Lester barber Southland Barber Shop r 1539 3d Bazemore Louis r 132 Cole Bazemore Nettie Mrs r 148 Parkwood (B) Bazemore Nettie H (wid O C) (o) h 2642 Houston Bazemore Sara student r 826 Orange Bazemore Wallace L (Jessie) 1 (o) phys 817 Ga Casualty Bldg h 127 Beverly pi Bazemore Walter L (Tolitha E) elk City of Macon h 826 Orange Beach Donald D (Carolyn F) 2 sis engr Macon Gas Co h 208 Corbin (V) Beach James R (Annie J) elk C of Ga Ry h 416 Forest (V) Beacham James O barber Bob Stephens Barber Shop r 815 Poplar Beacham W Clyde (Lucy) 3 elk S E Exp Co h 213 Heard (SM) Beal Claude (c; Fannie) (o) emp C of Ga Ry h 703 (610) Crisp Beale James T (Bertha) 4 h 106 (173) Forest (B) Beale Mark (c) lab Buckeye Cotton Oil Co Beale P Rembert (Lila M) 2 formn City of Macon h 205 Ponce de Leon (SM) Beall Addie mlnr Union Dry Gds Co r 357 1st Beall Anita A student r 311. Cherokee Beall Birdie slswn Dannenberg's r 357 1st Beall Dorothy G student r 311 Cherokee Beall Henry W (Lemma) (o) condr C of Ga Ry h 204 Maple Beall Holst C (Mary L) 1 (Flanagan's Camp) h 2923 Houston (SM) Beall James (Evelyn K) (o) h 407 Forsyth Beall Lila M (c) maid Mary R Dodge r 527 Cotton Beall Olin P (Annie A) (o) spec agt New Eng- land Mut Life Ins Co h 311 Cherokee Beall Rosa D (wid Edw H) (o) h 520 Edge- wood Beall Trueser (wid S H) h 357 1st Bean Edw C (Minnie Lee) eng C of Ga Ry h 213 Ell (SM) Beanbo Albert auto mech r 619 1st Beard Carl L (Zulee) 2 emp J W McCook Lbr Co h 722 Mulberry Beard Margt Mrs 1 r 321 Melrose (B) Bearden Fannie (c) 1 h 235 Gilmer Bearden Florence sten Empire Dixie Coal Co Inc r 150 Dixie Bearden Paul delmn A R Wellons 280 Colum- bus Beardsley Sidney J (Frances) 2 slsmn h 518 Giles Bearfield Mildred (Mrs S A) emp Happs Bros r 757 New Bearfield S Adus (Mildred) 1 clo presser Dan- nenberg's r 757 New Bearings Maggie (c) h 308 Forest (V) Bearings Supply Co A M Wing pres, Elbert Jenkins, sec-treas, auto sups 651 3d Beasley Annie E (Mrs W C) spinner Bibb Mfg Co r615 Elm Beasley Clyde (Mrs Julian) opr Adams Mfg Co r 615 Elm Beasley Cora r 115 Washington Beasley Emmett T (Lucile L) 1 firemn CFD h 2605 Broadway Beasley Francis (Ruby) hlpr r 1019 Ash Beasley James B (Clydia M) hosemn CFD 410 Beech Beasley James C delmn Mitchell & Williams Co r 115 Washington Beasley Julian (Clyde) emp Bibb Mfg Co h 615 Elm Beasley Marie waitress Glass' Pharm r 858 2d Beasley Maude (wid S R) 1 h 115 Washington Beasley Oscar C (Lucy) 6 slsmn Macon Coca- Cola Btlg Co h 858 2d Beasley Pascal (c; Mattie) 3 lab Fruit Grow- ers Exp h 301 (552) Waterville rd Beasley Robt L dr Yellow Cab Co r 115 Wash- ington Beasley Wm C (Annie E) 1 emp Bibb Mfg Co h 615 Elm Beasley Wm E 1 r 615 Elm Beaty Cath student r 863% Orange Beaty Clyde (Agnes) 1 condr C of Ga Ry h 863% Orange Beaty H Fred Jr student r 3005 Houston (SM) Beaty Herschel F ( Oda B) 3 (o) condr C of Ga Ry h 3005 Houston Beauford Marvin (c) porter Power Oil Co r 507 Coleman al Beavy Geo C (Alice) barber Tatnall Sq Barber Shop r 219 Lawton Becham Chas A h 201 Carling Becham Dorothy r 201 Carling Becham Oscar L (Dovie) 2 mech Spark's Mtr Co h 164 Spring Becham Susie tex wkr Southland Knitting Mills r 201 Carling Becham Wallace r 201 Carling Beck Alf F (Willie) 2 carp h 667 Edgewood Beck Callie (wid J W) 1 h 837 Main (EM) 134 Baldwin's and Telegraph's Beck Edw O (Ethel) 5 tex wkr Bibb Mfg Co h 32 Taylor Beck Ethel (Mrs E O) tex wkr Bibb Mfg Co r 32 Taylor Beck Frances r 837 Main (EM) Beeland Mary Mrs emp Bibb Mfg Co r 419 Edgewood x _ BEELER CLARENCE O (Beatrice A), Sec- Treas Macon Memorial Park Inc h Colum- bus rd--Tel 2803-W Beck Harvie emp Bibb Mfg Co r 270 Main Beggs David C elk Alf Macks Pharm Inc r 109 (EM) Rembert Beck Hazel student r 837 Main (EM) Beck Jack X (Reba) 2 patrolmn CPD h 608 Beggs Geo B drftsmn Ga Power Co r 109 Rembert Montpelier Beggs Hilda student r 109 Rembert Beck Jasper N (Lizzie) h 4 Lake City (EM) Beggs Wm H slsmn So Sports Co r 109 Rem- Beck John F (Lora) 1 emp Art Furn Mfg Co bert r 122 Grady Beck John S (Eva) 2 hlpr r 4 Lake City (EM) BEGGS WILMER E (wid Geo S), supvr City Play Grounds, h 109 Rembert av--Tel 4699-J Beck Joseph O (Ruby A) 2 tex wkr Bibb Mfg Behr Eliz (wid H J) (o) h 1020 Elm Co h 54 Hydrolia Behr Florence H r 1020 Elm Beck Lillian waitress Hotel Dempsey r 101 Behr Henry J (Ethel A) 1 archt 355 y2 Cherry (25) Avon rd r 365 Church (EM) Beck Minnie (wid C G) tex wkr Bibb Mfg Co Behr Joseph r 1020 Elm r 386 Clinton Behr Theresa r 1020 Elm Beck Otis S (Hattie) 2 hlpr r 823 Main (EM) Belcher Eliz A (Mrs S A Jr) interviewer Beck Ruby A (Mrs J D) tex wkr Bibb Mfg FERA r 102 Rogers (V) Co r 54 Hydrolia Belcher Samuel A Jr (Eliz A) elk Bibb Mfg Beck Sidney lab r 837 Main (EM) Co r 102 Rogers (V) Beck Willie tex wkr Bibb Mfg Co r 4 Lake Belding Merrill P (Lennie) elk S W Abel h City (EM) 108 Ross _ Becker Annie (c) h 223 Division Belknap D Gordon (Maggie) tex wkr Payne Becker (Mrs S L) mus tchr 310 Cherokee r do Mill h 10 Grand (B) Becker Simon L (Ida) 2 (Union Furn Co) h Belknap Rich C (Flossie) trav slsmn r 139 310 Chfirokss Rembert Beckett Geo W (Lola) 1 emp M D & S Ry h Bell Adeline (c) cook r 630 Monroe (V) 206 Center (EM) Bell Adelle (c) cook M E Seagrove r 630 Mon- Beckham Agnes r 144 Piedmont (SM) roe (V) Bfeckham Laura (wid R Y) r 108 Buford pi (V) Bell Albert P (Bertie) h 689 College Beckley Norman H (Mary) stmftr r 717 Cher- Bell Alberta tchr Miller High Sch r 689 Col- ry lege Beckum Geo C (Ida P) 1 eng C of Ga Ry h 328 Bell Alf (c; Bennie) 3 h 513 Campbell (SM) Hanson (SM) Bell Algeria (c) cook E P Stone r 630 Monroe Beckum Wilson (c; Lillie B) h 303 (314) 3d Bell Annie (c) h 7 Woodliff (U) Bell Annie (c) maid Rose Hill Cem r 113 Beda Etta College (c) 100 Grant (V) Spring Bedenbaugh Albert W stock mgr Adams Bell Arth (c) lab r 224 Plant (SM) Buchanan Mtr Co r 619 1st Bell Aubrey (c) cook C K Williamson r 257 Bedgood Edw delmn Abel's Gro r 128 Cole Antioch rd . Bedgood Emma L r 128 Cole Bell Augustus (c; Annie) 1 emp Collins Bak- Bedgood Hansel M (Hattie M) 1 engr C of Ga ing Co r 420 Bay Ry h 128 Cole Bell Bertha M (c) h 49 (54) Green's al Bedgood Hansel M Jr r 128 Cole Bell Carolyn student r 689 College Bedgood Jacqueline (Mrs J J) opr Happ Bros Bell Carrie (c) maid Macon Hosp r 262 Broad Co r 721 Pine Bell Carrie L (c) 1 r 133 Army Lot Bedgood James J (Jacqueline) 1 waiter Wis- Bell Chas (c) r 121 (21) Williams la teria Cafe r 721 Pine Bell Chas (c; Anna) 2 (o) lab C of Ga Ry h Bedgood Weldon L (Lois) slsmn Industrial 248 Plant (SM) Life & Health Ins Co r 475 Duncan? Bell Claudia (c) r 1 (417) Steins al Bedingfield Allen (c) h 131 (27) Railroad Bell Clinton B (Edith) 1 dr Atlantic Ice & Bedingfield Annie L (c) cook 201 New Coal Co h 613 Log Cabin blvd Bedingfield Claudia r 131 (27) Railroad Bell Cora (c) maid Southland Knitting Mills Bedingfield Geo (Eva) (o) condr So Ry h 717 r 108 (149) Railroad 1st Bell Cranston (c; Charlie) cook h 723 (r) Bedingfield Susie (wid Wm) (o) h 3404 Hous- Broadway ton (SM) Bell David (c; Doris) 1 emp Birdsey Flour Bedley Eloise (c) 1 lndrs r 115 Gibson Mills r 511 (527) Maynard Bedney Evelyn (c) r 101 (179) DeBorde (SM) Bell Edith (Mrs C B) beauty shop 613 Log Bedney Leomi (c) maid r 101 (179) DeBorde Cabin blvd r do (SM) Bell Edw (Lillie) emp Bibb Mfg Co r 509 Haw- Bedney Minnie (c) maid h 9 DeBorde (SM) thorne . Bedney Ruth (c) 2 presser Economy Shoe Bell Edw (c; Lizzie) tailor C N Pitts r 766 Reprs h 728 (638) Prince (SM) Ocmulgee Bee Lula (c) lndrs Y M C A r 857 3d Bell Ella (c) 1 (o) h 115 (531) Campbell (SM) Beebe Eliz drsmkr 817 Mulberry r do Bell Emma (c) emp Snow's Ldry r 317 Pat- Beecham Jessie Mrs 2 r 1522 Broadway terson Beecher Geo (c) r 9 Alabama (SM) Beecher Hattie (c) r 9 Alabama (SM) Beecher Hollis (c) (o) lab h 9 Alabama (SM) Beeks Walter H (Raymond E) (o) sec-trea's Dure & Beeks Co h 119 Oak Haven Beeland Lula D (wid W J) (o) h 131 North Bell Evelyn (c) 2 waitress J H Smith r 110% (14) Fulton la Bell Florence E (wid H A) r 3329 Houston (SM) Bell Floyd (c; Bessie)' h 510 (110) Elliott (NH) Bell Frank (c) lab So Crate & Veneer Co 1935 Macon City Directory 135 BELL HALLIE B (Mary N) 1 (o), lawyer 320 Ga Casua'ty Bldg--Tel 1817, h 398 Suwanee --Tel 554-W (See Page 101) Bell W A tchr Lizella Ga Lanier High Sch for Boys J res Bell Harry E elk Farmers Trading Post r Cross Keys Bell Henrietta (c) 2 emp Bibb Mfg Co h 128 Army Lot Bell Homer F (Emma) hlpr r 930 Walnut Bell Ida (c) dom r 621 Middle (EM) B^ Jack A (Mattie) r 1138 (r) Milledgeville h 5 (310) Hanson (Sm)' WALTER L (Thelma) 2, optometrist Hilbun's h 111 Brentwood Bell Warren (c) atndt B J Champion r 616 Chapman al Bell Wm (c; Janie B) lab h 234 Plant al Bell Wm B (Lula) 3 (o) emp C of Ga Ry h 1138 Bell James (c) h 1214 (r) 3d Bell James (c; Idelle) 1 dish washer Dannen- berg's r 106 (127) Richard (U) Bell James (Clarine) emp Bibb Mfg Co h 509 Hawthorne Bell Jeff (c) r 108 (149) Railroad Bell Jefferson (c; Fannie) (o i gdnr h 391 (290) Neel (U) S Bell John (c; Cora) 1 h 108 (149) Railroad Bell John (c) r 128 Sycamore (V) Bell John (c; Emma) farmer r 317 Patterson Bell John (c; Ida) lab Atlantic Ice & Coal Co r 1208 Broadway Bell John (c; Alice) 1 lab r 701 (608) Crisp Bell John student r 101 Rembert Bell John Jr (c) jan F W Woolwo lh Co r 317 Patterson Bell John A (c) lab C of Ga Ry r 123 (119) Sycamore (V) Bell Julian (c; Rosa) 1 (o) lab C of Ga Ry h 700 (690) Hall (EM) 7 Bell Julius (c) h 527 Calhoun Bell Junia (c) r 501 (553) Broad Bell Junius J (c) dentist 226% Cotton r 115 (531) Campbell (SM) Bell Leonard (c; Edith) 1 emp C of Ga Rv h 236 Edgewood Bell Lizzie (c) presser Independent Ldrv r 106 (953) Ocmulgee 7 Bell Louise Y (c) tchr East Macon Sch r 417 Ward (V) Bell Lucy (c) enp Snow's Ldry r 966 Elm Bell Lula (c) h 11 Fordville la Bell Luther (c; Patience) (o) h 1033 Pio Nono Bell Maggie (c) 3 h 966 Elm Bell Marie (c) cook J B Meyer r 459 Army Milledgeville rd Bell Wm B Jr r 1138 Milledgeville rd Bell Woodie (c) dr Kinnett-Odom Co r 6 (755) Sparks al BELL'S PHARMACY (Reason & Bell) 400 Montpelier--Tel 1100 (See Page 99) Belle Millinery Co (Lee Irvine) whole 360 Broadway Bellevue A M E Church (c) 100 6th av (B) Bellevue Baptist Church 305 American blvd Bellevue Baptist Church (c) E O Bivins pas- tor 103 3d (B) Bellevue Cash Grocery (Annie Lyster) 201 American blvd Bellevue School Nora Edmondson prin 864 American blvd Bellflower Benj T (Eddie M) 1 r 461 New Bellflower E Marvin r 461 New Belmont Apartment 615-19 Walnut Belmont Grace L slswn Darling Shops r 423 Johnson Brre* lmo-- nt Ocsciaur Bue(RuoseLbudr E) (oj)ondnespotn mgr Union Dry Gds Co h 423 Johnson Belos Louis (Plaza Cafe) r Hotel Macon Belote J Harold Jr (Betty L) 1 stereo Macon Telegraph r 314 Forsyth Belson Max (Jean) 2 (Belson's Cash Mkt) h 1200 Broadway Belson's Cash Market (Max Belson) 1200 Broadway Belvin Jettie D (c; Ophelia) (o) jan J W Burke Sch h 723 (612) Prince (SM) Belvin Ophelia (c) maid J W Burke Sch r 723 (612) Prince (SM) BENEDETTO ARISTIDE A (Gertrude) 3 (o), Pres Crescent Ldry Co, h 827 Orange--Tel Bell Marvin (c; Gertrude) 2 r 423 Elliott Bell Mary (c) h 347 (449) Alabama (SM) Bell Mary (c) 2 h 114 (22%) Fulton la Bell Mary D (c) dom F X Daly r 635 Fort Hill Bell Max (c; Rosetta) lab h 95 Harris al Bell Merritt student r 402 (318) Suwanee Bell Minnie h 1217 Broadway Bell Minnie (c) h 224 Plant (SM) Bell Nan L student r 1138 Milledgeville rd Bell Nona (c) 1 h 19 (133) Wilkowski's la Bell Obie (c) emp Bibb Mfg Co r 128 Army Lot Bell Other (c) lab Proctor & Gamble Mfg Co Bell Otis (c) lab Proctor & Gamble Mfg Co Bell Otis (c; Mary D) 1 emp Bibb Mfg Co h 635 Fort Hill Bell Raymond (c; Mary) 2 r 102 (104) Bbok- er's al Bell Reason H (Georgia) 1 (Bell's Pharm) h 622 Duncan Bell Rhoda (c) r 324 Bright al Bell Robt (c; Ethel) h 507 Norris Bell Robt (c; Ida) 3 emp C of Ga Ry h 100 Richard (U) Bell Seaborn J student r 689 College S220-J Benedetto Marjorie nurse Macon Hosp r do Benedetto Joseph student r 827 Orange Benefield Emmie L (c) cook r 116 (272) Sin- gleton's la Benefield Marvin (c; Minnie) 2 atndt Power Oil Co r 102 (554) Tinsley la Benford Alberta (c) r 104 Tindall (SM) Benford Carrie (c) 5 h 104 Tindall (SM) Benford Carter G Mrs (o) h 701 Napier Benford Cora (c) h llo 2d (V) Benford Eddie J (c) h 160 Broad Benford Elnora (c) (o) h 503 (507) Maynard Benford Elnora (c) maid r 503 (507) Maynard Benford Felix (c) r 104 Tindall (SM) Benford Geo W (c; Mattie) (o) carp h 215 Duval Benford Jeff D (c) lab r 503 (507) Maynard Benford Louise (c) r 110 2d (V) Benford Mary (c) maid Douglas Hotel r 104 Tindall (SM) Benford Mary E tchr r 701 Napier Benford Rosetta (c) maid r 104 Tindall (SM) Benford Ruby (c) student r 110 2d (V) Benford Thomas L (c; Mary) h 402 (504) Maynard Bell Simon (c; Lizzie) 1 tr dr Mansfield Dray Benford Turner (c) r 176 Astor Line h 106 (953) Ocmulgee la Bell Susie M (c) h 122 (134) Kahn's al Bell Tommie (c) r 248 Plant (SM) Benford Willie (c) r 616 Fort Hill Benford Willie E (c) cook r 503 (507) May- nard 136 Baldwin's and Telegraph's Benjaman Emma (c) emp Bibb Mfg Co h 102 (1) Tracey's la Benjaman Warren (c) brkmn C of Ga By r 1432 Broadway Benjamin Wm (c; Katie) emp So Ry h 119 (161) DeBorde (SM) Benn Chas M (c; Mabel) 5 h 204 Douglas (V) Benn John B (c; Sallie M) h 110 3d (U) Benn John B Jr (c; Clara) 1 atndt Am Oil Co h 865 Ocmulgee Benn Mary L (c) r 110 3d (U) Benner Alice (wid Chas) r 316 Washington Benner Martha r 172 Magnolia Benner Robbie T (wid Clifford) h 172 Magnolia Bennett Abr elk Bennett & Co r 1540 Broad- way Bennett Andrew (c) orderly The Clinic Bennett Barney T r 4012 Houston Bennett Bertha (wid J G) r 476 College Apt 15 Bennett Carl C (Naomi) 3 (o) Mut Pur Co h 906 Ridge (I) Bennett Chas (Bertha) mech Nehi Btlg Co h Bennett W Ida (wid W C) (o) h 4012 Houston Bennett W Walter (Matilde D) accnt Art Furn Mfg Co h 375 College Bennett Walter M (Doris) 1 wtchmn Bibb Mfg Co h 166 Gardner (PM) Bennett Wm D emp So Natural Gas Co r 110 Pearce Bennett Wm J (Eugenia) h 715 Walnut Bennett Wm M (Mae) 3 emp Monk's Garage h 100 Pryor Bennett Wm P r 2 Rose pi Bennett Wm W student r 375 College Bennor Joseph Jr (Emma M) blr mkr C of Ga Ry r RD 3 Houston rd Bennor Joseph N (Ethel D) (o) mach supvr C of Ga Ry h 903 Napier Bennor Rudolph D (Iris) 2 electrn C of Ga Ry h 290 Cherry Benson Chas L (Willie) winder Bibb Mfg Co 210 Plumtree Benson Edna r 900 (r) Main (EM) Benson Ella N (c) maid r 26 (205) Macon 1747 Broadway Bennett Cherry (c) r 165 Coles al Bennett & Co (Leon and Rose Bennett) gros 1540 Broadway Bennett D Gerald (c) r 319 Plant (SM) (EM) Benson Frank C (Lucy) (o) tax assessor Bibb County h 662 Napier Benson Geo W (Inez) 1 emp C of Ga Ry h 572 Hillyer Bennett Danl (c; Bessie) emp Art Furn Mfg Co h 140 (123) e Ell Bennett Doris (Mrs W M) tex wkr Payne Mill Benson Lillie (wid T A) r 854 Courtland Benson Mary (wid H H) h 1539 1st Benson Wm (Mahala) 3 hlpr r 900 (r) Main r 166 Gardner (PM) Bennett Dorothy sten Timothy Hardin r 127 High (EM) Bentley Andrew M (Mabel) (o) engr C of Ga Ry h 114 Boulevard (NH) Bennett Edith ofc sec Harry Moses r 127 High Bennett Eloise R (wid F S) h 871 Mulberry Bennett Hazel cash W U Teleg Co r 4012 Hous- ton Bennett J Gordon (Lucile) slsmn Swift & Co Bentley Borie B (c; Katie) (o) lab C of Ga Ry h 261 Antioch rd Bentley Charlotte (c) r 341 3d (V) Bentley Herbert (c; Marie) 3 lab C of Ga Ry Creosote Plant h 927 Pio Nono h 476 College Apt 15 Bentley James A (Martha) 3 tex wkr Willing- Bennett James C r 4012 Houston ham Mill h 919 (1985) Log Cabin blvd Bennett James G (Ida F) mach Taylor Iron Bentley Jeffrey (c; Lou) 3 r 314 3d (V) Wks r RD 2 Bloomfield rd Bentley Jesse (Zona) 1 r 424 American blvd Bennett Jerry (c; Annie) 2 (o) lab C of Ga Bentley John (c) lab' h 303 5th (V) Ry h 319 Plant (SM) Bennett Jesse G (Sallie M) 2 wtchmn Bibb Bentley John H (Ada) 2 emp Hatchery r 460 Carling State Fish Mfg Co h 732 Oglethorpe Bentley Lonnie (c) porter Y W C A r 261 An- Bennett John H tex wkr Bibb Mfg Co r 732 tioch rd Oglethorpe Bentley Ruby r 460 Carling Bennett Lee A (Sue M) lbrmn h 126 Cleve- Bentley Thos (c; Ida) h 8 Alabama (SM) land (V) Bentley Wm (c; Mary) farmer h 99 Society Bennett Leon (Bennett & Co) h 1540 Broad- (EM) way Bentley Wm J (c) pin str Lucky Strike Bowl- Bennett Lloyd E emp So Natural Gas Co r 110 ing Alleys h 529 Cotton Pearce Benton Beatrice (Mrs B H) tex wkr Payne Bennett Louise (c) 2 h 1123 Edgewood Mill r 130 Comer ter (PM) Bennett Luke (c) lab F S Royster Guano Co Benton Benj H (Beatrice) 4 tex wkr Payne Bennett Marion r 912 Walnut Mill h 130 Comer ter (PM) Bennett Matilde (Mrs W W receptionist FERA Benton Bernice E (Mary) 1 construction wkr r 375 College County r 758 Cherry Bennett Nellie (c) lndrs Macon Hosp r Mc- Benton Danl M (Emma) (o) printer Flynn Clain al Printing Co h 416 Ross Bennett Ollie (wid W F) h 127 High BENTON EDW L (Wynelle W), lawyer 1007- Bennett Otis P knitter Bibb Mfg Co r 4012 20 Ga Casualty Bldg, h 350 Vista cir (V) -- Houston Tel 5275-W Bennett Paul H emp So Natural Gas Co r 110 Benton Estelle (c) cash N C Mut Life Ins Co Pearce r 242 Middle Bennett Richd (c) r 319 Plant (SM) Benton Gertrude L (wid James) r 247 High Bennett Richmond (Jewell) 1 (Tatnall Sq Bar- Benton Henry P (Sabana) engr C of Ga Ry ber Shop) r RD 2 r 207 Forsyth Bennett Rose (Bennett & Co) r 1540 Broad- Benton Lois (c) (o) h 242 Middle (V) way Benton Mary E student r 416 Ross Bennett Rufus (c; Leila) 1 emp Art Furn Mfg Benton Mary L (c) r 336 Jackson Co h 228 (316) Blount Benton Mattie J (c) r 318 Green Bennett Sallie M (Mrs J G) tex wkr Bibb Mfg Benton Zella C (c) prin Pleasant Hill Sch r Co r 732 Ogelthorpe 242 Middle (V) Bennett T Waring student r 375 College BerCkmans Anne r 401 College Apt 4 G Bennett Timothy (c) emp Builders Lb'r Co r Berckmans Caroline r 401 College Apt 4 G 3 Park Hotel al Berckmans Louis A II r 401 Apt 4 G 1935 Macon City Directory 137 Berckmans Mary C elk Ga Hwy Exp Inc r 401 College Apt 4 G Berckmans Robt C (Caroline) horticulturist h 401 College Apt 4 G Berg Banner student r 127 Nottingham dr Berg E Z shoe repr r Hotel Southland Berg Joseph (c; Mamie) gro 235 Middle (V) h 43 Green's al Berg Joseph student r 127 Nottingham dr Berg Leonard (Willie) 1 (o) (Len Berg's Chili Parlor) h 12T Nottingham dr Berg's Len Chilli Parlor (Leonard Berg) 449 Wall Bergman Carl A (Via) 2 emp Ga Power Co h 132 Curry pi Berkner Alwyn A slsmn Middle Ga Prod Co i 122 Pinson (SM) Berkner Cath L mach Southland Knitting Ob r 978 Montpelier Berkner David C carp r 611 Church (CH) Berkner Edith student r 1001 Montpelier Berkner Eliz (wid H J) r 161 Nelson (SM) Berkner Gladys r 1001 Montpelier Berkner Howard L (Evelyn) ftr Macon Gas Co h 122 Pinson (SM) Berkner J Hubert Jr r 1001 Montpelier Berkner John A farmer r 122 Pinson (SM) Berkner Joseph H (Pauline) 3 prsmn Smith & Watson Printing Co h 1001 Montpelier Berkner J Prentice (Pansy L) 1 r 1001 Mont- pelier Berkner Wm P (Nellie L) 1 pntr Wesleyan College h 978 Montpelier Berley Nellie L ofc sec Christ Episcopal Ch r 1601 Vineville (V) Berliner Harold (Emily) 1 (o) Standard Parts Co) transfer 702 3d h 126 Merritt (I) Berman James slsmn Sterchi's r 91 Lawton Bernal Nell xray technician Macon Hosp r 617 Orange Bemd Aaron B vp-treas G Bernd Co r 205 Clisby pi Bemd Arth (Jessie B) 2 (o) dept mgr Dan- nenberg's h 120 (149) Pierce (V) Bernd Edw I student r 120 (149) Pierce (V) Bemd Ferd slsmn G Bernd Co r 205 Clisby pi Bernd Florence tchr Lanier High Sch for Boys h 103 Cleveland (V) Bernd G Co L J Bernd pres A B Bernd vp- treas raw hide 468-70 Broadway Bernd Gus student r 115 (197) Elizabeth pi (V) Bernd Henrietta (wid Augustus) (o) h 205 Clisby pi Bernd Lawrence J (Eva B) 1 (o) pres G Bemd Co h 115 (197) Elizabeth pi (V) Bemell Fred emp Blue Goose Cafe r 460 Mul- berry Bernhardt Mary E Mrs (o) opr Happ Bros Co h 3309 Houston (SM) Bernhardt Missouri (wid Herman) r 144 High Berry Asa mill wkr Middle Ga Lbr Co Berry Blannie L (c) (Berry's Dry Gds Co) r 596 Fort Hill Berry Claiborne B (c; Estella) (Hubbard Funeral Home) h 206 Grant (V) Berry Dry Goods Co (c) (M W and Blannie L Berry) 359 and 765 Broadway Berry Edw (c; Jethora) 1 auto mech r 98 Key (U) Berry Fannie (c) h 137 Magnolia la Berry Henry F carp A T Holt C h 1015 Hazel Berry Jackson (c; Lillie) h 105 (165) Virgin (V) Berry James E (Clara) 2 h 268 Irving (Lyn- more Estates) Berry Kath D (Mrs R R) sten MD&SRR Co r 127 Crescent (CH) Berry Lucile (c) 1 r 153 (218) Nussbaum Berry Moses W (c; Blannie L) (Berry Dry Gds Co) h 596 Fort Hill (EM) Berry O Benj (c; Hattie) emp So Crate & Veneer Co r 79 Wilder (SM) Berry Obie (c) lab r 1207 1st Berry Russell R (Kath) (o) slsmn Bibb Mfg Co h 127 Crescent Berry Sallie (c) h 236 5th (V) Berry Sol (c) car washer Wm Griffin r 752 Elm Berry W Randolph call boy C of Ga Ry r 268 Irving (Lynmore Estates) Berryhill Hannah (c) r 303 (608) Colquitt Berryhill Walter (c) 303 (608) Colquitt Besner Harry (Beatrice) 5 h 108 American blvd Besson Geo E slsmn r Terminal Hotel Best Bernard L (S Frances) 1 r 112 Lamar (V) Best Broad r 477 Spring Best DeWitt r 254 Washigton Best James W (Ethel) 1 ehauf CFD h 2442 2d Best Mattie (wid H K) 1 (o) h 307 Amer- ican blvd Best Reymond C slsmn Sears-Roebuck r 254 Washington Bethea Clarence P (Fannie C) auto mech h 760 New Bethel Methodist Ch (c) H H Davis pastor 806 Pio Nono Bethel Primitive Baptist Ch 96 Flamingo dr Bethel Primitive Baptist Ch (c) Arth Jones pastor Henderson (B) Bethen Linda nurse Middle Ga Hosp r do Bethune Benj T (Helen) 1 (o) r 121 Crisby pi Bethune Carrie Mrs tex wkr Willingham Mills h 122 (13) Holt Bethune Elbert H tex wkr Willingham Mills r 122 (13) Holt Bethune G Roy Jr student r 257 Hardeman apt 3 Bethune Geo R (Gladys) dist mgr U S Nat Reemployment ofc h 257 Hardeman apt 3 Bethune Kirk mach Bibb Mfg Co r 257 Harde- man apt 3 Betsy Ross Coffee Shop Mrs Mary C Rodden- b'erry mgr 513 Cherry Betty Jane Shoppe (T D & Mrs Esther F Fried) antiques 414 Cherry Beulah Baptist Ch (c) E D White pastor 1613 Broadway Beverage Sales Co H A Dotson mgr beer dstbtrs 359 5th Beverly Dress Shop Mrs Elberta Kaufman mgr 414 3d Beville Bessie operating supv Middle Ga Hosp r do Bewley Wm C (Fannie) genl mgr Ga Peach Growers Exch h 232 Stanislaus cir Bias Mary (c) dom r 2211 (r) Forsyth rd Bibb Auto Service (G A Malcom) reprs 717 3d Bibb Auto Wrecking Co (J H Donaldson D G Pritchett) 753 Broadway Bibb Bag Co (Carl Bloch) 472 Broadway Bigg Body Si Fender Wks E O Youngblood mgr 454 Plum BIGG BROKERAGE CORP Jack A Gordon mgr, Salary Buyers, 206-07 Bibb bldg tel 995 Bibb Building R E Shackelford supt 403 Cherry Bibb Chevrolet Co R C Dunlap pres J D Wat- son sec-treas autos 620 3d Bibb Clay Products Co G S Woodruff supt brick efrs 10th cor Oak BIBB-COUNTY OF COURT HOUSE 2d at Mulberry Agricultural Agent D F Bruce, Federal bldg Attorney, J C Estes, 501 Ga Casualty bldg Board of Health J D Applewhite health ofer, 720 New 138 Baldwin's and Telegraph's Board of Public Education, W P Jones supt Court House City Court of Macon, E W Butler judge O L Long solr, Court House COMMISSIONERS, J E Yates chm, W H M Weaver v-chm, L S Bure, X M Raines & W O Kenney members, T W Clifton elk, Court House--tel 412-413 Court of Ordinary, W C Stevens judge Court House Court Reporters A Et Barnes & Claude Joiner Court House Home Demonstration Agent Frances C Lowe Federal bldg Jail, T J McCommon jailor, Court House Juvenile Court P O Holliday judge Court House Law Library Mrs Haddye Renitz librarian Court House Municipal Court Hugh Chambers judge Court House Probation Officer Harry E Pape Court House Relief Administration Ollie Tinley ofc mgr 155 Broadway Relief Administration, Mrs Lelota Parham supvr surplus sups 900 3d Sheriff J R Hicks Jr Court House Solicitor General C H Garrett Court House Superintendent of Building W H Hysler Court House Superior Court Hon M D Jones & W A McClellan judges Court House Surveyor H D Cutter Court House Tax Assessors P H Sanford A F Newton & F C Benson Court House Tax Collector U T Winslett Court House Tax Receiver D D DunWody Court House Treasurer Mrs Agnes L Freeney Court House Bibb County Democratic Womens club Mrs Robert Halliburton pres meets 2d Thurs 4 p m Hotel Dempsey Bibb Daily Record Emmett Snellgrove pres Carl Beard vp Chas H Davis sec-treas publication 470 Cherry BIBB INVESTMENT CO Walstein L Walker mgr Salary loans 203-04 First Nat Bk bldg tel 2517 Bibb Lumber Co (R H Hillman) 736 Hillyer Bibb' Mfg Co W D Anderson pres J H Porter & W D Anderson Jr vprests A A Drake Jr sec-treas cotton gds mfrs ofc & plant No 1 235 Main (EM) Bibb Mfg Co M R Gardner supt mill No 2 671 Hawthorne Bibb Mfg Co (Payne Mill) P E Findlay Jr supt Bellevue rd nr C of Ga Ry Bibb Mfg Co auditorium 701 Oglethorpe Bibb Mfg Co clinic (Payne Mill) Mary Herndon nurse in charge 70 Davis (PM) Bibb Mfg Co clinic No 1 Dr J B Ward 227 Clinton Bibb Mfg Co clinic No 2 688 Oglethorpe Bibb Mfg Co club house 1013 1st Bibb Mfg Community House 219 (226) Clinton Bibb Mfg Co Social Workers Home Mary W Brown in charge 221 (210) Clinton BIBB MATTRESS CO, Edgar B Meaders mgr, mattress renovating, 415 Pine--tel 5576 Bibb News Co (W N & G Z Glover) news dlrs 563 Broadway Bibb Poultry Co (T J Wood) 421 Cotton Bibb Printing Co (J W Hancock) 365 Cotton Bibb Shoe Shop (N T Isaf) reprs 254 (236) Main (EM) Bibb Supply Co (L F McEachern) fety sUps 203 Poplar Bible Harry B (Tennie) 1 (o) (Mozo Furn Co) h 370 Jasamine Bickley Bessie tex wkr Willingham Mills r 236 (102) Virgin la (V) Bickley Una emp Willingham Mills r 236 (102) Virgin la (V) Biddy Mary h 803 Cherry Bigby Felix (Rose) ydmn Power Oil Co r 802 Mulberry Bigby Frances (wid W T) h 802 Mulberry Biggem Lem (c) opr Bibb Mfg Co r 155 Coles al Biggerstaff Alice (wid E L) r 307 Park (B) Biggerstaff Chas E (Mae) 1 elk Proctor-Gam- ble Mfg Co r 920 1st Biggerstaff Cleve W (Leila) coir Snyder's Ready-to-Wear h 307 Park (B) Bigham Annie (c) cook Canter's Delicatessen r 254 Garden (EM) Bigham Daisy (c) cook C L Cannon Bigham Robt (c; Annie) hlpr C of Ga Ry h 254 Garden (EM) Bigler Geo A (Hattie) carp h 305 Jenkins Bill's Cash Grocery (W M Joyner) 102 Hazel Billings Chas (c; Effie) 1 lab Swift & Co h 416 Bay Billings Danl W (c) r 132 Jones Billings David (c; Mary) lab h 267 Walnut Billings Henry W prsmn Carling Tile Co h 1514 2d Billings Lillie (c) h 201 (2) 3d (B) Billings Lily B (c) student r 132 Jones Billings Robt D (c; Lillie) 2 jan Bibb bldg h 533 Monroe (V) Billings Rosebud (c) student r 132 Jones Billings Sami (c) lab Jeffreys-McElrath Lbr Co r 201 3d (B) Billings Thos E (Lillian) (o) formn Macon Tel- egraph h 541 Georgia Billingslea Abr (c; Ella) (o) lab h 759 Fort Hill Billingslea Alvin (c) r 210 (213) Neal (V) Billingslea Burrell (c; Rosa) tr dr Noland Co Inc h 1205 1st Billingslea Eliz (c) r 263 5th (V) Billingslea Eugenia (c) 1 h 19 Wall St la Billingslea Fannie (c) maid 2518 Forsyth rd r do Billingslea Hattie (c) r 210 (213) Neal (V) Billingslea Joshua (c; Eliz) bellmn Hotel Macon r 263 5th (V) Billingslea Leonard (c) (o) emp C of Ga Ry Shops h 707 (136) Hall (EM) Billingslea Lucile (c) r 603 Center (EM) Billingslea Malinda (c) dom h 444 (5) Shoals al Billingslea Mary M (c) 1 r 221 Orange Billingslea Minnie (c) 6 r 151 Hill Billingslea Otis (c; Ollie) barber h 251 Cowan Billingslea Randolph (c; Louise) 2 emp Stew- art Oil Co h 603 Center (EM) Billingslea Rosa (c) cook Mrs Harris r 1205 1st Billingslea Seaborn B (c; Rosa B) 4 (o) emp Fried's Garage h 210 (213) Neal (V) Billingslea Victoria (wid L C) (o) h 820 New Billingslea Wm (c; Ada) 1 lab h 953 Hazel Billingsley Alma (c) emp Independent Ldry Co Billingsley Ethel Mrs 1 h 304 Carling Billingsley Sami F student r 304 Carling Billingsly Harry (c; Lillie) 6 orderly h 1070 Hazel Biltmore Apartments 811 Poplar Bimbley Isabelle (c) h 510 Martha Bines Henry (c; Mary) tr dr Buck Ice & Coal Co r 1313 1st Binford Alonzo B (Edith E) 2 (Binford's Sin- clair Filling Sta) h 1604 Vinevillle (V) 1935 Macon City Directory 139 Binford J Erie (Myrtie M) coir The Reliable Bishop Anita I Mrs opr Ethel B Davis Beauty Outfitters h 109 Stonewall pi (V) Shop r 410 Forsyth Binford Mary (c) 2 ldry wkr Independent Ldry Bishop Bernice (c) maid h 851 Foster's pi h 513 Port Hill BISHOP F JOE (Mary Ella) (o) inspr of bldgs Binford's Sinclair Filling Sta (A B Binford) City of Macon h 311 Napier--tel 1075 1604 Vineville (V) Bishop Forrest L r 616 Johnson Binion Annie (wid Frank) (o) h 116 (130) Bishop Harriet G (wid J W) r 417 Cleveland Charles (SM) Binns Bert (c) r 227 (722) Pear Bishop James G (Corrie) surveyor U S Coast Binns Essie M (c) dom Herman Mueller r 158 & Geodetic Survey r 616 Johnson Broad Bishop James P (Ida) (o) bldg contr 616 Binns Georgia (c) lndrs h 227 (722) Pear Johnson h do Binns James (c; Mattie) 4 h 158 Broad Bishop James T slsmn r 311 Napier Binns Mattie (c) cook R L Brantley r 158 Bishop Jamie R (Mary) 1 carp h 110 Davis Broad (SM) Binns Peter (c; Essie) 1 barber G W Hatfield h 503 Center (EM) Binns Taswell lab h 214 Main (EM) Birch Ada (wid W B) (o) h 511 Napier Birch Geo S elk US Dept of Agr r RD 1 Birch Hazel student r 501 Napier Birch John N (Hazel) 1 (Davis & Birch) h 501 Napier Birch John N Jr (Ruth) (o) vp Juliette Mill- ing o h 216 Albemarle pi (I) Birch Leila (o) h 235 High Birch Lois tchr Alex Sch No 4 r 511 Napier Birch Wm B elk FERA r 511 Napier Birch Willie M r 511 Napier Bird Chester (c; Sara) 3 h 438 Hammond Birdsey Angus B (Kath) 1 (o) vp Birdsey Flour Mills h 254 (115) Stanislaus cir Birdsey Buford S with Birdsey Flour Mills r 304 Vineville (V) Birdsey Cecil student r 104 Vineville (V) Bishop John T clothes clnr 558 Mulberry r Fickling Hotel Bishop Joseph B (c) porter Firestone Auto Sup & Serv Stores h 753 Ash Bishop Joseph E (Dorothy) inspr Nat Pk Serv h 401 College apt 3E Bishop Mary (c) h 21 Cheatham al Bishop Robt E (Mildred L) mach Willingham S & D Co r 198 Brentwood Bishop Ruth (wid Elmer J) r 35 Bibb Bishop Whit usher Capitol Theatre r 616 Johnson Bishop Wm A (Eliz) 1 (o) slsmn 624 Ingle- side (I) Bittick Isaac r 125 Peachtree Bittick W Rollie Jr (Juanita) flgmn C of Ga Ry r 301 Mikado Bittney Wm (c) r 209 Elm Bius Diana elk FERA r 116 Crisp Bius Earl M (Mary) h 116 Crisp Birdsey Flour Mills J S Birdsey pres A B Birdsey vp L C Brown sec R T Birdsey treas Poplar cor 8th, ret stores 2637 Broadway, 320 Main (EM), 802 Montpelier, 462 Mulberry, 473 & 2648 2d Birdsey Herbert emp Birdsey Flour Mills r 104 Vineville (V) Birdsey John S (Helen M) 1 (o) pres Birdsey Flour Mills h 304 Vineville (V) Birdsey Martha L student r 304 Vineville (V) Bius Virginia emp So Bell Tel Co r 116 Crisp Bivins Arth (c; Gussie) chauf F G Wilson h 24 Moore Bivins Edw al (c; Mattie) 5 (Broadwray Clnrs) h 702 (601) Charles Bivins Elijah (c) r 1302 (1411) Dempsey Bivins Eliz (c) 1 h 139 Bright al Bivins Emmett O (c; Roxie) (o) pastor Bellevue Baptist Ch h 208 Cedar (U) Bivins Ernest L (c) r 388 Neel (U) Birdsey Ralph T (Evelyn) 1 (o) treas Birdsey Flour Mills h 104 Vineville (V) Birdsey Sami R (Loretta) h 264 Belvedere dr (I) Birdsong C Walker (Viola) 4 h 1432 3d Birdsong Carrie (c) tchr East Macon Sch r 113 Bivins Eug (c) emp Sapp's Gro r 225 Turpin Bivins Felton (c; Eula) delmn A D Jones r 162 May (U) Bivins Geo (c) r 139 Bright al Bivins Henry (c) porter Dixie Roll & Cot Co r 110 (5) Davis al (529) Campbell (SM) Birdsong Cora B' emp Adams Mfg Co r 865 1st apt 4 Bivins Henry C (c; Lula) firemn C of Ga Ry Creosote Plant h 504 (420) Hall (EM) Bivins Howard (c; Mary) lab C of Ga Ry h Birdsong Dovie nurse 810 Spring r do 148 Tupelo Birdsong Edna (c) cook Ray Carter h 205 Bivins Howard J (Kath A) 1 aud Bibb Mfg Co Powell Birdsong Ida (c) emp Jack's PI r Clinton rd r 208 Clayton (V) Bivins James (c) r 139 Bright al nr River rd Birdsong James (c) emp Jacks Place r Clin- Bivins Jas (c; Idell) plstr h 301 Ward (V) Bivins Jesse (c; Vandella) 2 firemn So Ry h 8 ton rd nr River rd Birdsong Lillie Mrs r 407 Walnut Birdsong Lucille (c) r 113 (529) Campbell Spring Bivins John J (Ollie) 3 carp r 304 Cleveland (SM) (SM) Bivins Joseph (c; Eliz) 2 h 622 (7) Gilmer Birdsong Malinda (c) 2 cook V R Patrick h Bivins Lonnie (c) 2 h 51 Monroe (U) 113 (529) Campbell (SM) Birdsong Mollie (wid G B) r 2091 3d Bivins Lonnie (c; Robt Lee) lab Willingham S&D Co h 414 Gilmer Birdsong Richd E (Nanaline) 2 (o) drftsmn Bivins Louis (c; Rosa) lab F S Royster Guano Taylor Iron Wks h 540 Ridge (I) Co h 708 (588) Maynard Birdsong Richd E Jr student r 540 Ridge (I) Bivins Mary (c) h 1102 (1008) Broad Birdsong Robt (c) r 206 Tindall (SM) Bivins Monroe (c; Anna) 2 h 100 (500) Camp- Birdsong Wilse dep sheriff Municipal Court r bell (SM) RD 1 Dry Branch Bivins Myrtle (c) lab Proctor & Gamble Mfg Birrick Ellis J (Fannie) 1 gro 203 5th h 408 Walnut Co Bivins Owen (c; Edith) h 1302 (1411) Birrick Fannie (Mrs E J) spinner Bibb Mfg Co r 408 Walnut Dempsey Bivins Primus (c; Rosa) 2 h 7 (134) Mal- Bishop Alpheus student r 616 Johnson loy's al 140 Baldwin's and Telegraph's Bivins Rachael (c) h 209 (366) Railroad Bivins Tabernacle (c) 521 e 2d (EM) Bivins Thos (c; Lillie B) lab So Crate & Ve- neer Co h 102 Dure (U) Bivins Thos U (c; Mamie) (o) emp C of Ga Ry h 202 (100) Charles Bivins Walter (c) 2 lab' h 172 Moore al Bivins Wm (c; Beatrice) 2 emp Freeman-Dent- Sullivan Co h 137 Adams Bizzell Frank A meat ctr Marvin's Gro r 2129 Forsyth rd Bizzell Henry D (Christina A) 5 mach Wade & Sons h 454 New Bizzell Mary Mrs nurse The Clinic r 712 Hillyer Black Benj B' hlpr Goodyear Serv Inc r 106 Park (B) Black Chester B (Pearl) tex wkr Willingham Mills h 105 (48) Holt Black Ernest D (Harriet B) 1 (o) vp Central Cotton Oil Co h 110 Plaza Black Eva G (c) tchr East Macon Sch r 20 Spring Black Georgia (Mrs R O) tex wkr Bibb Mfg Co r 827 Hazel Black Gus (c; Mattie) lab r 506 e Academy (EM) Black Kate tex wkr Willingham Mills r 105 (48) Holt Black Laura E (wid M L) r 609 Log Cabin blvd Black Lillian r 105 (48) Holt Black Lottie (wid B B) 2 r 106 Park (B) Black Margt student r 110 Plaza Black Mary (wid C A) r 209 Log Cabin dr Black Nancy (c) h 216 (159) Grant (V) Black Osie (c) r 1303 1st Black Pearl (Mrs C B) tex wkr Willingham Mills r 105 (48) Holt Black R Odell (Georgia) 1 tex wkr Bibb Mfg Co h 827 Hazel Black Sarah K student r 106 Park (B1) Black Thos (c) porter Terminal Sta h 155 Orange St la Black Virginia (c) nurse 216 (159) Grant (V) r do Black Virginia student r 745 Ridge (I) Black W Fredk student r 745 Ridge (I) Black Wm F (Jessie May) (o) chf engr C of Ga Ry Creosote Plant h 745 Ridge (I) Blackburn A J Jr (Mildred S) mgr Hotel Macon r do Blackburn Grace r Hotel Macon Blackburn Mildred S (Mrs A J Jr) elk Hotel Macon r do Blackburn Roy M (Monetious) 1 asst mgr Liberty Nat Life Ins Co h 2455 Forsyth rd Blackman Alice M (c) 3 r 76 (75) Ernest Blackshear Celia (c) r 2 3d St la Blackshear Chas A (Kate) soft drinks 220 Hydrolia h do Blackshear Clara (c) r 1633 Broadway Blackshear Edw (c) chauf r 318 Walnut Blackshear Edw (c; Levia) 1 emp Swift & Co h 708 (705) Elbert Blackshear James (c; Louise) 1 porter Carter Hdwe & Sup Co r 608 Norris Blackshear James R emp Bibb Mfg Co Blackshear Katie (Mrs C A) winder Bibb Mfg Co r 220 Hydrolia Blackshear Lemon (c; Hattie) 1 lab r 1633 Broadway Blackshear Louise (c) dom W R Owen r 608 Norris Blackshear Maria W r 328 Handson (SM) Blackshear Mattie (c) carder Bibb Mfg Co r 100 Society 1935 Macon City Directory Blackshear Thos (c; Sarah) lab Cherokee Brick Co h 320 Elm Blackshear Tommie (c) lab Proctor & Gamble Mfg Co r 320 Elm Blackshear Wm (c; Laura) 1 emp C of Ga Ry r 100 Society (EM) Blackshear Wm (c; Willie M) 1 lab Genl Reduction Co r 1012 Main (EM) Blackwell Leila r 512 Log Cabin blvd Blcakwell Wm G Jr (Mary A) 1 mgr Maxwell Bros Furn Co h 885 Hillyer Blair Anna (wid R F) h 1427 2d Blair Benj r 4 Holt (NHts) Blair Dorothy Mrs 3 h 413 Duncan Blair Florence tchr Winship Sch r 516 Napier Blair J Floyd (Annie) 1 tex wkr Payne Mill h 115 Comer ter (PM) Blair John D (Lucille M) 3 (o) athletic director Mercer Univ h 175 (207) Boulevard (NH) Blair Lester (Zudie V) 1 tex wkr Willingham Mills h 4 Holt (NHts) Blair Madge A (wid Alex) (o) h 516 Napier Blair Sami M (Ruth) pntr r 38 (102) Ran- dolph pi Blalock Gladys (c) cook r 501 (502) Elbert Blalock Willie (c) emp Jeffreys-McElrath Mfg Co Blanchett James B furn repr 103 Wood h do Bland Arth (c) hlpr So Crate & Veneer Co r 105 Rose Crest av Bland Clara O r 265 Columbus Bland David (c; ClaVudia) 1 emp C of Ga Ry h 704 (695) Hall (EM) Bland Eliza (c) r 800 (139) Maynard Bland Emma (c) cook C H Hays r 410 Monroe Bland Henry (c) h 113 (4) O'Neal's al Bland Langster (c; Emma B) (o) carp h 956 Broad Bland Leon (c) shoe shiner Macon Hat Clean- ing Co r 120 Jones Bland Mary (c) 4 (o) h 116 5th (V) Bland Nannie C (wid Edw) r 232 High apt 3 Bland Virginia C bkpr Idle Hour Nurseries r 232 High apt 3 Blanford Bennie (c) r 139 Bright al Blanford Henry (c) r 139 Bright al Blanford Jesse (c) r 314 (66) Plummer's al Blanford John (c) lab So Crate & Veneer Co r 139 Bright al Blankenship Clara (Mrs T W) opr Happ Bros Co r 115 Capitol Blankenship Kirk T pastor South Side Ch of Christ r YMCA Blankinship Runette (Mrs O L) emp Bibb Mfg Co r 915 Elm Blankenship T Wesley (Clara) 2 elk Ard Cash Gro r 115 Capitol Blanks Blanche C student r 201 Ridge (I) Blanks Louise (wid Orrie) r 219 Vista cir (I) Blanks Louis R elk F S Royster Guano Co r 201 Ridge (I) Blanks Otis L (Norine) 4 (o) elk Ry M S h 201 Ridge (I) Blanks Philip S student r 201 Ridge (I) Blanks Texas (wid A O) r 5 Roff Home pi Blanks W Francis student r 201 Ridge (I) Blanton Clarence emp C of Ga Ry r 920 New Blanton Geo W (Martha R) slsmn Dessau Realty & Ins Co h 631 Forsyth Blanton May r 1114 Oglethorpe Blanton Nellie Mrs h 920 New Blanton Wm M bus dr So Stages Inc r 803 Pine Blash Alex (c) porter Worsham & Sherrill r 115 (555) Fulton la Blash Jackson (c; Marie) hlpr So Crate & Ve- neer Co h 190 Northwest Boundary Blash Mattie (c) r 314 Monroe (V) BLOODWORTH HARVEY B (Olive R) (o), Blash Sara (c) r 314 Monroe (V) Pres Palm Purchasing Co & United Purchas- Blash Veal (c) lab Central S&D Co r 602 (112) ing Co Inc, h 500 Beech--tel 1515 Colquitt Bloodworth James waiter Smitty's Barbecue Blasingame Arlie (c) (o) dom h 207 (193) Lunch 421 3d 1st (U) Bloodworth James E (Bloodworth's Cafe) r 718 Blasingame Dora (c) h 103 2d (B) Anderson (SM) Blasingame Geo (c; Epsie) emp Macon Cooper- Bloodworth Jesse L r 253 Broadway age Co r 705 (706) Elbert Bloodworth Jesse L Jr r 253 Broadway Blasingame Grady W (Mamie) 2 elk Wilson's Bloodworth John M (Sallie) tr dr City Scaven- h 624 1st ger Dept h 2173 2d Blasingame John W (Iva E) 2 dr Dixie Dairies Bloodworth John W (Lila B) r 250 (308) Pio h 101 North (NH) Nono Blasingame Odessa (c) cook F E Sims r 103 Bloodworth Julia (wid J B) h 615 2d 2d (B) Bloodworth Julian P Mrs r 758 Cherry Blasingame Woodrow emp McKesson-Riley r Bloodworth Leah (Mrs G T) emp Idle Hour RD 2 Club r 329 College Bledsoe Ernestine sec Vineville Methodist Ch Bloodworth Leona tmkpr Happ Bros Co r 620 r 117 Rogers (V) Anderson (SM) Bledsoe Fannie (c) 1 r 127 Park Hotel al Bloodworth Lillian tchr Burke Sch r 718 An- Bledsoe Irving R (c; Mary) shoe repr 343 Ala- derson (SM) bama h 721 (613) Prince (SM) Bloodworth Lonnie (c; Leila) 3 delmn Vine- Bliss D La Rue (Gladys L) slsmn Snows Ldry ville Drug Co r 109 Grant (S) h 164 High Bloodworth Louie A (Evelyn) (Winton's Bliss Eliz E binder Lyon, Harris & Brooks r 129 Pharm) r 718 Anderson Lawton Bloodworth Lucile student r 718 Anderson (SM) Bliss Gladys L (Mrs D L) cash Burden Smith & Co r 164 High Bliss John W student r 129 Lawton Bliss Oliver R (Birdie G) yd formn So Ry h 129 Lawton BLITCH PIERCE G (Ernestine) 2 cash Citi- zens & Sou Nat Bk h 109 Florida--tel 829-J Bloch Alex buyer Bloch Hide Co r 324 Hill Crest Bloch Carl (Bibb Bag Co) real est 472 Broad- way r 118 (198) Buckingham pi Bloch Chas J (Marie) 1 (o) (Hall & Bloch) b 303 Hill Crest Bloch E Marian student r 303 Hill Crest Bloch Hide Co (Michel Bloch) 348 Poplar Bloch Michel (Bloch Hide Co) r 324 Hill Crest BLOCK ALECK (Leonora) , Pres Riverside Bloodworth Luther U (Rachel) 2 (o) (Bloodworth & Bloodworth) h 513 Hillyer Bloodworth Mae tex wkr Willingham Mills r 203 (3) Dannenberg Bloodworth Minnie L (o) h 214 Knott (SM) Bloodworth Pansy (Mrs Prentice) emp Macon Linen Sup Co r 2173 2d Bloodworth Prentice E (Pansy) 2 r 2173 2d BLOODWORTH RACHEL (Mrs L U), Sec- Treas Palm Purchasing Co r 513 Hillyer-- tel 1062 Bloodworth Reba I student r 807 Mikado Bloodworth Robt r 225 Knott (SM) Bloodworth Robt H (Agnes) (o) carp h 718 Anderson (SM) Bloodworth T Coleman (Bloodworth & Bloodworth) res Miller Field Ice & Coal Co, h 810 Mulberry, apt 1--tel 484 BLOCK EARLE H, vp Hotel Dempsey, r same BLOCK HERBERT M (Eliz F) 2 (o), vp & Genl Mgr Hotel Dempsey, h Oak Cliff rd (Shirley Hills)--tel 464 Block Johnnie R (c) 1 maid h 1066 Hazel BLOCK NICHOLAS M (Hattie M), Pres Hotel Dempsey, r same Block Apartments 810 Mulberry Blocker Annie (Mrs J P) spinner Bibb Mfg Co r 280 White al Blocker Augustus (c) dish washer W A Waldorf r 240 Plant row Blocker Jos P (Annie) emp Willingham Mills Bloodworth Wm G (Lillie M) 4 slsmn Carter Hdwe & Sup Co h 424 Ridge (I) Bloodworth Wm G Jr student r 424 Ridge (I) Bloodworth Winton E (Winton's Pharm) r 718 Anderson Bloodworth's Cafe (J E Bloodworth) 515 Broadway Bloodworth & Bloodworth (L U & T C) law- yers 4 Hardeman bldg Bloom Bessie (c) lndrs Crescent Ldry Bloom Ira (c; Fannie) 6 lab h 211 (431) Alabama Bloom Jessie (c) r 1028 College dr Bloom Joseph B (c; Ida) 2 tex wkr Bibb Mfg h 280 White al Bloodson John (c; Sallie) lab Atlantic Ice & Coal Co r 200 Toombs (SM) Bloodworth Alonzo (c) r 311 Blount Bloodworth Clarence r 253 Broadway Co h 1028 College dr Bloom Lillie (c) cook Z D Schell r 211 (431) Alabama Bloom Rhoda (c) r 1028 College dr Bloom Susie (c) maid r 1028 College dr Bloodworth Clarence r 2173 2d Bloomfield Baptist Ch (c) F W Evans pastor Bloodworth Clarence tr dr Atlantic Ice & Coal Co r 615 2d Bloodworth Curtis M (Essie B) 1 tex wkr Willingham Mills h 203 (3) Dannenberg Bloodworth Edna V r 405 Ridge (I) Bloodworth Eliz (wid J M) 1 r 918 New Bloodworth Essie B (Mrs C M) emp Willing- ham Mills r 203 (3) Dannenberg Columbus Road Blossom Geo L (Helen G) 2 (o) mfrs agt 813 Ga Casualty bldg h 2700 Forsyth rd Blount Anne (c) r 525 3d (V) Blount Annie K (o) h 637 Fort Hill Blount Arth L (c) r 637 Fort Hill Blount Bernice (c) sch tchr r 637 Fort Hill Blount Bessie tex wkr Happ Bros r 826 Bloodworth Evelyn r 203 (3) Dannenberg Main (EM) Bloodworth Geo r 300 (317) Log Cabin dr Blount E Fredk emp C of Ga Ry r 664 Plum Bloodworth Geo T (Leah) 1 elk PO h 329 College Blount Eliza (e) lndrs r 655 Elm St la Blount Eugenia W (wid J H) (o) h 364 Orange Bloodworth H Otis (Ruth) 1 (o) carrier PO h Blount Eula D (c) dom J H Carter r 218 Gar- 807 Mikado den (EM) 142 Baldwin's and Telegraph's Blount Eunice (wid J E) 1 bkpr Snyder's Ready-to-Wear r 157 Williams (SM) Blount Fannie r 364 Orange Blount Frances (wid Wm) nurse 3809 Houston r do Blount G Wm (Alma) 1 emp Spillers Restr h 826 Main (EM) Blount Geo (c; Lizzie) 1 h 606 (206) Edison Blount Geo Jr (c; Annie) lab h 613 (207) Edi- son Blount Herman (c) student r 637 Fort Hill Blount Irene tex wkr Happ Bros r 826 Main (EM) Blount Janie (c) h 425 Ward (V) Blount Julia (wid John) r 206 Jeff Davis (SM) Blount Lennie (wid G S) 3 h 101 Highland (LCHts) Blount Lilia M (c) 5 lab r 104 (235) Elliott Blount Martha (c) cook r 525 3d (V) Blount Mary (c) waitress Douglass Hotel Grill r 101 Calhoun Blount Mattie (wid G B) r 826 Main (EM) Blount Mattie P mgr Nurses Official Registry r 130 High Blount Paul (c) r 525 3d (V) Blount Sarah (c) lndrs r 425 Ward (V) Blount Wm C Jr (Eulalie B) 2 (o) trav slsmn h 1303 Vineville (V) Blow Bennie (wid S H) r 605 1st Blow Ellis L emp Willingham Mills h 34 (24) Randolph pi Blow Lula (wid J J) r 34 (24) Randolph pi Blow Maysie r 605 1st Blue Edw (c; Hattie) lab h 111 Drew's Qtrs Blue Front Lunch Room (R E Ogburn) 416 Mulberry Blum Arie I (Madeline) 2 (o) pres Central Bedding Co & Macon Mattress Co h 217 Corbin (V) Blum Clarence slsmn Bibb Chevrolet Co r 385 Orange Blum Herbert student r 118 (198) Buckingham pi Blum L Jack (Louvenia T) 1 pres Southeastern Battery Co Inc h 1309 Vineville (V) Blum Leo J (Freda) (o) slsmn h 118 (198) Buckingham pi Blum Leo J Jr student r 118 (198) Buckingham pi Blum Moies A (Stella) elk FERA h 802 Cherry Blunt John (c; Lizzie) 3 porter Jones, Johnston, Russell & Sparks h 224 (254) North (V) Blunt John Jr (c) delmn Mulberry Mkt r 224 (254) North (V) Blythewood Edw (c) dom h 35 Cheatham al Boatman Henry T (c; Jackie R) 1 bellmn Arlington Hotel r 431 Ward (V) Boatwright Annie M (c) 1 h 152 Spring Boatwright Geo (c) hlpr Maxwell Bros r 152 Spring Boatwright Jennie (o) h 102 Yates Boatwright Mollie opr Bibb Mfg Co r 102 Yates Boatwright Rosa (c) r 102 (202) Elliott Bobbie Homer (Julia) h 362 (328) Pio Nino Bobbitt Wm C (Emma) r 1061 Ash Bobo J Ebb (Lois H) 1 shopmn Ga Auto Co r 104 West End Bobo Ralph (Salha) 6 (Standard Mkt & Gro). h 159 Franklin Bobo Salha (Mrs Ralph) (Standard Mkt & Gro) r 159 Franklin Bobo Walton E (May) trav slsmn h 401 College apt 3B Bob's Bar B Q Pit (Thos Hall J M Clements) 981 Montpelier Boddiford Lucile (Mrs T M) marker Independent Ldry Co r 168 Spring Boddiford Thos M (Lucille) 1 r 168 Spring Bodrey Florine r 101 Helen Bodwell Chas M (Anna M) 1 pntr h 505 Jack- son Boger Wm K (Ethel K) asst mgr S H Kress Co h 855 Mulberry apt 105 Boggs Wm A (Eliz) slsmn h 818 Hemlock Boilermakers Union Joseph Bennor sec meets on call 1502*4 Broadway Boland Andrew D (Annie L) 2 plmbr A B Lee Plmbg & Htg Co h 211 Mikado Boland Annie L elk Woolworth's r 209 Mikado Boland Ida (c) maid S B Price Free Library Boland Jas W (Minnie L) (o) formn Taylor Iron Wks h 209 Mikado Boland Joseph L (Mattie K) 2 (Boland's Ga- rage) h 112 Crisp Boland Monroe M slsmn Maxwell Bros Furn Co r YMCA Boland Walter E (Fannie Mae) 3 steel wkr Taylor Iron Wks h 1501 2d Boland Zeima J Mrs r 118 Log Cabin dr Boland's Garage (J L Boland) 419 Pine Bolden Adolphus (c) emp Shier's Shoe Shop r 402 Gilmer Bolden David (c; Annie) (o) brkmn C of Ga Ry h 118 (150) DeBorde (SM) Bolden Fred (c) clo presser Edw Bashuk Bolden Gussie (c) emp Proctor & Gamble r 118 (150) DeBorde (SM) Bolden Mack (c; Rachel) firemn C of Ga Ry h 402 Gilmer Bolding Hattie (c) 1 cook Douglass Hotel Grill h 105 (597) Singleton's la Bolding Kath (c) r 105 (597) Singleton's la Bolen M M emp Maxwell Bro Furn Co r YMCA Boles Sami P (Mary T) 1 (o) formn Ga Power Co h 319 Buford pi (V) Bolles Appleton F (Addie) emp Am Optical Co h 207 Cherokee Bolling Flora (wid H C) r 457 Arch Bollinger Alton A r 105 Edna pi (LCHts) Bollinger Elwyn student r 135 Napier Bollinger Ethel sten H M Reid & Co r 105 Edna pi (LCHts) Bollinger John W (Mary L) 3 asst supt PO h 105 Edna pi (LCHts) Bollinger Kath bkpr Carter Hdwe & Sup Co r 756 Ridge (I) Bollinger Robt A (Alma) bldg contr 756 Ridge (I) h do Bolt Albert brklyr Adam-Swirles Mill r 103 Ridge (I) Bolton Annie slswn Union Dry Gds Co r 520 Elm Bolton Geo S (Annie) (o) gro 100 Johnson's al h 520 Elm Bolton Geo T (Mildred) 2 (o) mach C of Ga Ry h 3805 Houston Bolton Grace r 520 Elm Bolton Lila r 520 Elm Bolton Pearl (c) r 438 O'Hara la Bolton Walter E elk W R Werden Co r 520 Elm BON ART STUDIO (Mrs Lillian Cook, Chas A Gerrell) specializing in Portrait Photography, 362 2d--tel 3826 Bon Ton Cafe M G Ellis mgr 301 Cherry Bond Apartments 233 Bond Bond Elijah (c; Idella) lab h 150 e Academy (EM) Bond Ethel S (Mrs T M) (Country Mkt) res RD 1 Bond Herman C (Bessie) (o) h 617 Adams Bond Idella (c) cook C E Crawley r 150 e Academy (EM) 1935 Macon City Directory 143 Bond Jerome (c; Ellen) 1 li 402 (463) Alabama (SM) Bond Joseph C sec-treas Adams Mfg Co res Dry Branch Ga Bonner Wm (c) lab Barfield Feed Mills Bonner Wm T (c; Beulah) hlpr Collins Bak- ing Co r 967 Ocmulgee Bonner Willie (c) lab Willingham Mills r 121 Bond Julius L (Ruth) r 209 Ninadell dr Bond Margt (wid J C) h 436 Ross Bond Mary (c) maid Southland Hotel r 402 (463) Alabama (SM) Bond Rayme nurse Middle Ga Hosp r do Bond Stella opr Happ Bros Co r 125 Knott (SM) Bond Tully M (Ethel S) mgr Country Mkt res RD 1 (721) Railroad Booker Albert (c) r 120 (213) Frank al Booker Annie (c) lab' Proctor & Gamble Mfg Co Booker Arth (c) lab r 320 Williams (EM) Booker Arth P (Mary B) elk Carter Hdwe & Sup Co h 137 Rembert Booker Belle (c) h 100 (1) Cemetery la Booker C B (c; Lola) 3 tex wkr Bibb Mfg Co Bond Ulysses porter Collins Baking Co Bonnell A H Mrs emp J L Hainline r Fickling Hotel Bonner Annie M (c) h 314 Monroe (V) r 508 Flanders Booker Chas J (Willie Mae) (o) lab PO h 104 Oak (I) Booker Eliz (c) 2 maid C C Broome h 120 Bonner Bernice L (Sallie) emp James Lbr Co r 390 Clinton Bonner Cleveland H (Kate) 3 carp A P Copeland h 160 Nelson (SM) Bonner Earlene (c) r 269 3d (V) (213) Frank al Booker Ella (c) r 1437 Broadway Booker Emmie (c) cook r 320 Williams (EM) Booker Eug (c; Hollie) lab r 1052 Pio Nono Booker Gertrude (c) cook L I Waxelbaum r Bonner Eliza (c) h 119 (11) Tinsley la Bonner Emma (c) 4 cook h 116 Gibson Bonner Emma L (c) 1 r 269 3d (V) 133 (405) Tinsley la Booker Harry (c) chauf J T Ross r 100 (1) Cemetery la Bonner Emmie (c) r 316 (340) Tindall (SM) Bonner Evelena (c) 1 maid Annie H Oliver h r 269 3d (V) Bonner F Evelyn student r 390 Clinton Bonner Geo (c; Alice) 1 lab Proctor & Gamble Mfg Co h 107 Elm Bonner Griffin (c; Mattie) 3 lab r 316 (340) Tindall (SM) Booker Hattie (c) r 7 7th Booker Hattie (c) cook h 133 (405) Tinsley la Booker Haywood (c) lab Buckeye Cotton Oil Co r 1437 Broadway BOOKER J RABY, Mgr Atlantic Serv Sta, r YMCA Booker J Wilbur r 421 American blvd Booker James C (c) tex wkr Bibb Mfg Co h Bonner Ida (c) dom h 500 Edison Bonner Idell (c) maid W M Brown r 316 (340) 508 Flanders Booker Jerry M (Mary) 2 (o) mech C of Ga Tindall (SM) Baking Co h 421 American blvd Bonner Isaac (c; Mary) h 118 Franklin Bonner James (c; Lillian) emp Hotel Dempsey Booker Josephine (c) maid r 320 Williams (EM) r 101 (4) Jordan Bonner Joseph (Edith) 1 (o) guard City Stock- ade h 101 3d \ Bonner Julia M (c) h 206 Woodliff Bonner Justine (c) r 101 (4) Jordan Booker Lee (c; Josephine) 1 lab h 1210 (326) Woolf oik Booker Lila (c) 1 (o) h 1052 Pio Nono Booker Lula (c) emp Independent Ldry Co Booker Mamie (c) dom Benj Yelin h 107 Bonner Kath r 280 (r) Main (EM) Bonner Lafayette (c) bellmn Hotel Macon r Tindall (SM) Booker Matau (c) lab r 320 Williams (EM) 101 (4) Jordan Bonner Louis W (c) (o) h 403 Applewood Bonner Louise cash Glass Pharm r 220 1st Booker Mattie (c) maid W A Martin r 108 Jordan Booker Otis H (Josephine) 2 (o) engr Atlantic Bonner Mae r 369 1st Bonner Mae (Mrs D R) emp Happ Bros r Arcadia Hotel Ice & Coal Co h 1405 3d Booker Raymond (c) tr dr r 320 Williams (EM) Bonner Mamie (c) h 116 (112) Thomas (EM) Bonner Mamie (c) h 26 7th Booker Sims (c; Annie) 5 lab Atlantic Ice & Coal Corp h 1 Bright al Bonner Mattie M (c) 1 cook h 113 (543) Tinsley la Bonner Moses (c) lab r 116 Gibson Bonner Narcissus (c) cook J F Lloyd r 314 3d (V) Bonner Nathan (e) r 1125 Napier Bonner Orion (c; Evelyn) emp Dempsey Hotel Booker Sylvester (c; Laura) 1 r 1052 Pio Nono Booker T Wilson student r 421 American blvd Booker Thelma (c) r 1437 Broadway Booker Willie M (Mrs C J) elk Macon Tele- graph r 104 Oak av (I) Booker Wilma M (c) cook P S Howard r 320 Williams (EM) r 105 (6) Jordan Booker Wilson (c) (o) lab h 320 Williams Bonner Pearl (c) h 406 Craft la Bonner Pearl (c) r 109 Wall's al Bonner Rabon J (Ruth) hlpr r 110 Crisp (EM) Boon K Lois sten Art Furn Mfg Co r 101 St James (SM) Bonner Reese usher Rialto Theatre r 160 Boon Mattie L (wid W O) (o) h 101 St James Nelson (SM) Bonner Robt (c; Mary) emp Cherokee Brick (SM) Boone A Foy (Merle) (o) h 221 Nottingham Co h 406 (410) Charles Bonner Robt (c; Ethel M) emp Cherokee Brick Co h 305 (606) Colquitt Boone Ada (c) h 615 Ross Boone Annie (c) cook Ellis Horton r RD 1 Boone Annie M (wid J A) h 314 New Bonner Robt (Pearl) 1 slsmn Adams-Buchanan Mtr Co h 731 Ridge (I) Boone Buford (Frances H) reporter Macon Evening News r Columbus rd RD 2 Bonner Ruby L (c) maid r 269 3d (V) Boone Buster (c) h 303 Elbert Bonner Shelton (c; Annie L) 4 h 93 (113) Roosevelt (V) Bonner Thos (c; Rebecca) 2 (o) firemn C of Ga Ry h 101 (4) Jordan Bonner Visia (c) (o) h IQS (6) Jordan Boone Chas (c; Mary) h 521 Chappell (SM) Boone Cora L dom H B Mozo r 202 (174) Roye Boone Edith student r 652 Pine Boone Eliz mus tchr 652 Pine r do 144 Baldwin's and Telegraph's Boone Geo A (Dora E) coir Burden Smith & Co Bost Wm student r 1001 Walnut r 852 Orange Bostic Eloise (c) emp Bibb Mfg Co Boone Henry C (Callie) (o) (Moore & Boone) Bostic Emma (c) 1 cook h 424 Monroe (V) h 107% Hardeman Bostick Gussie (c) emp Dempsey Hotel r 303 Boone J Danl (Ira M) 1 (o) gro 514 Pine h Short (EM) 652 do Bostick Henry (c) r 229 Moughton (V) BOONE JOSEPH P (Leona R), Pastor First Bostick Mamie (c) clnr Bibb Mfg Co Baptist Ch, h 121 High--tel 3050 Bostick Mamie (c) 2 lndrs h 303 Short (EM) Boone Sallie G (o) h 719 2d Boone Sara (c) 1 r 521 Chappell (SM) Bostick Mattie (wid Boston Beatrice (c) W J) maid Lreo7l1a7yE2 2d Bateman r Boone Sylvia (c) dom h 202 (174) Roye 524 3d BOONE TOLAR H (Jennie) (o), Vp & Geni Boston Benj (c; Beatrice) 3 r 524 3d (V) Mgr Loan & Trust Co, h 531 College--tel Boston Bertha (c) maid W G Aven r 524 3d 2464-J Boston Frank (c) delmn Chapman's Pharm r Boone Toof A (Mozelle) 1 dental dir City Bd 206 (157) North (V) of Health h 308 Linden Boston Geo (c) 3 firemn Proctor & Gamble Boone Walter L (c; Ruby) lab r 162 Hazel Mfg Co r 315 Division BOONE WALTER S (Irene) 2, Treas Ga Loan Boston Gordon W (c) delmn Chapman's & Trust Co, h 362 College--tel 1806-W Pharm r 206 (157) North (V) Boone Wm (c) lab h 998 Montpelier Boston Leather Co (S Schwartz) 414 Poplar Boone Wm P (c; Annie R) 7 lab C of Ga Ry Boston Lettie (c) r 616 (13) Gilmer Creosote Plant h 300 Industrial Home rd Boston Louis (c; Mattie) 1 lab h 425 Cedar Boose Wm (c; Susie) 1 lab h 106 (205) Col- (U) quitt Boston Major (c) lab C of Ga Ry r 206 (157) Booth Alice (Mrs C L) opr Happ Bros Co r North (V) 423 American blvd Boston Martha (c) lndrs h 103 Neel (U) Booth Andrew L emp C of Ga Ry Boston Mary (c) 206 (157) North (V) Booth Chandlor L (Vanon L) pntr h 105 (261) Boston Victoria (c) h 524 3d (V) Clinton Bostwick Marion B (Amanda) 2 emp Central Booth E Sidney locksmth H & HR Huhn r 243 Cotton Oil Co h 419 Elm Duncan Bostwick O Kyle r 419 Elm Booth Flossie A Mrs 2 tex wkr r 352 Clinton Bostwick Twigg (c) tr dr Kingham & Ever- Booth J Carl student r 909 Napier ett h 312 Green Booth Jesse appr Taylor Iron Wks r RD 5 Boswell Chas (c; Dora) 3 emp Kinnett-Odom Booth John C (Ruby I) trav slsmn h 909 Co h 213 (143) Virgin la (V) Napier Boswell Dora (c) cook C A Williams r 213 Booth John C Jr student r 909 Napier (143) Virgin la Booth Leonard R (Kate C) (o) slsmn Ga Power Boswell Doris G (Mrs W C) dental hygienist Co h 209 Nottingham dr P G Gates r 106 Buford pi (V) Booth Lillian student r 909 Napier Boswell Edmond A tr dr r 900 Orange Booth M Edgar (Callie) emp C of Ga Ry h Boswell Eug (Myra J) coir Ga Power Co h 71 311 Cutters Green (EM) Arlington pi Booth Ronnie tex wkr Bibb Mfg Co r 311 Boswell Eug Jr bkpr r 71 Arlington pi Cutters Green Boswell Herbert elk Hotel Lanier r do Boothe Florence r 134 (131) Maynard Boswell J Young slsmn Huckabee Auto Co r Boothe I .Newton (Myra) 1 hlpr h 134 (131) 3043 Houston Maynard Boswell Jasper (c) lab MD&SRR r RD 5 Boothe Joseph E slsmn C D Kenny Co r 134 Boswell Joseph W emp Bibb Mfg Co r 71 (131) Maynard Arlington pi Boothe Nettie (wid R T) 1 r 804 Woolfoik Boswell Kath (c) maid R E May r 213 (143) Boothe Wm r 134 (131) Maynard Virgin la (V) BOOTLE WM A (Virginia) 1 (o) (Carlisle & Boswell W Chas (Doris G) phys 709 Ga Cas- Bootle) h 120 (200) Buckingham pi--tel ualty bldg h 106 Buford pi 3809-J Boswell Wm L (Laura) condr So Ry h 900 Borders James B (c) evangelist r 317 Patter- Orange son Boswell Wm W emp Ga Roofing Sup Co r 900 Borders Raymond (c) tchr Rural Schs r 317 Orange Patterson Bough Wm (c) emp Bibb Mfg Co Borders Thomas (c) student r 317 Patterson Bounds Annie L Mrs r 105 Brentwood Borum Douglas student r 630 Church (CH) Boutwell Alex Mrs opr Happ Bros Co r 618 Borum John R (Annie B) lab h 364 Center Telfair (EM) Boutwell Benj F Jr (Willene) 1 slsmn McKes- Borum Joseph E (Nadean) 2 (Macon Cycle Co) son-Riley r 218 Georgia av r 667 2d Boutwell Curtis elk Sample's Gro r 2105 Broad- Borum Julius C (Willie) 1 formn Adams way Swirles Mill h 630 Church (CH) Boutwell Earl J r 1537 College Borum Julius C Jr r 630 Church (CH) Boutwell Emma opr Happ Bros Co r 1537 Borum Lillie Bell (c) h 450 City Hall la College Borum Nadean (Mrs J E) emp Happ Bros r Boutwell Geo B (Eliz) mach So Ry h 2105 667 2d Broadway Bost Annie V (Mrs J P) 1 tex wkr Happ Bros Boutwell Harlow (Ruby) 3 hlpr h 274 Willing- Co h 1001 Walnut ham Bost Euline r 1001 Walnut Boutwell J Julian (Odessa) 2 h 673 Edgewood Bost Fannie (wid W H) h 914 Elm Boutwell James C r 208 Washington Bost Geo L (Marguerite) 1 emp C of Ga Ry Boutwell Odessa (Mrs J J) opr Happ Bros Co h 811 Poplar apt 19 r 673 Edgewood Bost Inez M tex wkr Happ Bros Co r 1001 Wal- Boutwell Ronald knitter Bibb Mfg Co r 145 nut Cole 1935 Macon City Directory 145 Boutwell Rosa B r 208 Washington Bowen Robt A (Lottie F) 1 (o) h 120 Hines Boutwell Willie Mrs 1 emp Southland Knitting ter (V) Mills r 3 Gustin pi Bowen Ruby (c) emp Central City Bag Co r Bouyer Carlos J (c; Rosa) h 817 Daisy (SM) 407 (450) Womack Bouyer Clifford (c; Annie) firemn So Ry h Bowen Steph E (Carrie E) agt Bankers H&L 814 Elm Ins Co h 403 Spring Bouyer Gus (c; Mollie) 1 plmbr r 611 Pebble Bowen Ulysses (c) lab r 105 e Ell (SM) Bouyer Mamie (c) maid r 522 e 2d (EM) Bowen Wm (c; Willie P) 3 lab h 117 Phillips la Bowden Aldine H agt Wofford Oil Co r 452 Bowen Wm M r 115 Florence av Spring Bower Bishop W (D Ilda) 3 agt Bankers H&L Bowden Alva L (Mollie) h 304% 3d Ins Co r 341 Calhoun Bowden Arilla (c) emp Bibb Mfg Co r 1325 Bowers Alf M Jr student r 230 (220) Clinton Broadway Bowers Alice (wid J D) emp Bibb Mfg Co h Bowden Bertie (wid H C) 3 tex wkr Willing- 1817 3d ham Mill h 242 Roff Home Bowers Edw (c; Alma) 1 (o) blrmkr C of Ga Bowden Chas r 121 Stratton Ry h 525 e 1st (EM) Bowden Chas L (o) dist mgr Wofford Oil Co Bowers Jessie M r 304 Center (EM) h 2603 2d Bowers John E (Mary) repr Economy Shoe Bowden Clifton (c; Malissa) (o) mech Macon Reprs r 554 1st Coca-Cola Btlg Co h 225 (226) Cedar (U) Bowers Louie M (Mattie M) 2 tex wkr Bibb Bowden Clyde J (wid T B) (o) tex wkr Happ Mfg Co r 304 Center (EM) Bros h 121 Willingham Bowers Mary (Mrs J E) opr Happ Bros Co r Bowden Edgar (c) r 125 (333) Braswell la 554 1st Bowden Elbert (c; Lottie) emp Atlantic Ice & Bowers Nellie Mrs tex wkr Bibb Mfg Co r 23(T Coal Co h 304 (450) Elizabeth (SM) (220) Clinton Bowden Eloise tchr r 2603 2d Bowles: John R (Dollie) 3 barber Flint's Bar- Bowden Henry (c; Annie L) h 104 (100) Adams ber Shop r 1231 College Bowden Homer J (Iva) 1 (o) sgt CPD h 306 Bowles May h 104 West End Jones (EM) Bowman Albert (Ida) r 1015 (2009) Log Cabin Bowden Ida (c) Indrs Crescent Ldry r 754 Elm blvd Bowden James (c; Arilla) 1 lab h 1325 Broad- Bowman Albert (c; Elnora) (o) icemn h 218 way Pond (V) Bowden James H (c; Laura) (o) h 105 Cedar Bowman Alice (wid J A) 1 h 150 Cole (U) Bowman Carrie (e) maid r 631 Fort Hill Bowden James K tex wkr Willingham Mill r Bowman Clinton (c) r 112 (220) Green (V) 242 Roff Home Bowman Danl (c; Pearl) 4 h 52 Parker (V) Bowden John O (c) h 422 Ward (V) Bowman Danl G linemn Ga Power Co Bowden Lizzie (c) h 726 (636) Prince (SM) Bowman Delia (c) 2 (o) Indrs h 305 (205) Bowden Mattie Mrs 1 h 143 Williams (SM) Cowan Bowden Mollie (Mrs A L) opr Happ Bros Co Bowman Eliz (c) r 383 Robinson rd r 304% 3d Bowman Emily (c) student r 218 Pond (V) Bowden Ralph (c; Mildred) h 416 Gilmer Bowman Ethel S sten Woolworth's r 150 Cole Bowden Rosa L (c) huckster r 105 Cedar (U) Bowman Everett C (c) r 218 Pond (V) Bowden Sara student r 2604 2d Bowman Geo C emp Bibb Mfg Co Bbwden Verna tex wkr Happ Bros r 121 Wil- Bowman Gladys (c) 4 maid r 968 Elm lingham Bowman Herbert (c; Mattie) tex wkr Bibb Bowden W Herman (Lillie) (o) dep sheriff Mfg Co r 100 Society (EM) Bibb County h 2604 2d Bowman James T mgr Idle Hour Billiard Par- Bowden Wm C (Eloise) mtr cycle ofc CPD r lor r 150 Cole 62 Arlington pi Bowman Leah (c) student! r 112 (220) Green Bowden Wm O r 143 Williams (SM) (V) Bowdoin Chas C (Minnie D) carp h 580 Bou- Bowman Mack (c; Jimmie) porter Freeman- levard Dent-Sullivan Co h 253 North Bowdoin Stardar G (Minnie) spinner Bibb Mfg Bowman Mamie (c) (o) h 364 2d (V) Co h 39 Bibb Bowman Marie J slswn H L Green & Co r 150 Bowdre Eliz B (wid B T) 2 r 105 Pierce (V) Cole Bowen Archie (c) r 117 Wall al Bowman Mattie (c) 1 (o) h 315 2d (V) Bowen Clara cash Dannenberg's r 811 Poplar Bowman Monroe (c; Rosa) 2 h 101 (200) apt 9 Carter (B) Bowen David (c; Pearl) 1 h 259 North Bowman Nathan D (c; Annie) lab Jeffreys- Bowen E Walton student r 113 Rogers (V) McElrath Lbr Co h 201 (1) 3d (B) Bowen Fred (c) delmn W C Butler r 105 e Ell Bowman Robt (c) carp h 319 Womack Bowen Fred (c; Magnolia) emp Masonic Home Bowman Thelma Mrs 1 opr Adams Mfg Co r of Ga h 104 Wall's al 822 1st Bowen Henry (c; Ruby) 1 r 407 (450) Womack Bowman Wm (c; Roberta) 1 (o) lab C of Ga Bowen Jesse J (Nell T) 3 h 103 North (NH) Ry h 813 (875) Maynard Bowen Jewel D (Pearl) 1 hlpr r 225 Apple- Bowman Wilman (c) r 112 (220) Green (V) wood Bowman Winona (wid R B) r 319 Walnut Bowen Joseph (c) student r 407 (450) Womack Boxx Annie M (wid G L) 1 r 408 Mikado Bowen Leila (c) 1 h 407 (450) Womack BOY SCOUTS OF AMERICA, V Carl Sullivan Bowen Lillie (c) 3 h 105 e Ell (SM) Scout Executive, Court House--tel 2581 Bowen Louise M student r 113 Rogers (V) Boyce Cath Mrs r 620 Pine Bowen Magnolia (c) emp Jacks Place r 104 Wall's al Bowen Milton M tr dr Power Oil Co res WaySide Ga Boyd Albert (c) emp Idle Hour Club r 105 Neal (V) Boyd Annie C (c) maid F W Walthall r 309 3d (U) Boyd Bessie (c) r 105 Neal (V) Bowen Pearl (c) cook T A Jacobs r 259 North Boyd Douglas r 100 Grand (B) 146 Baldwin's and Telegraph's Boyd Douglas (c; Maggie L) 4 delmn Simmons Gro h 4 South Boundary Boyd Gertrude r 821 Cherry Boyd James C (c; Avalena) r 289 1st (V) Boyd Kizzie (c) h 309 3d (U) Boyd Lee (c) firemn Proctor & Gamble Mfg Co h 217 (121) Plummers al Boyd Louis C (Nellie) tex wkr Payne Mill r 100 Grand (B) Boyd Maggie (c) 1 cook R T Birdsey h 105 Neal (V) Boyd Ollie M (c) tailor Edw Bashuk h 203 Summit Hill (S) Boyd Sadie (c) cook P G Shipp r 309 3d (U) Boyd Susie M (c) 1 r 203 Summitt Hill (S) Boyd Wm (c) r 309 3d (U) Boyd Wm (c) emp Idle Hour Club r 105 Neal (V) Boyer Abraham student r 627 Adams Boyer Alton student r 120; Plant (SM) Boyer C Baxter (Ola M) 2 hlpr h 2451 2d Boyer Geo V (Irene) 1 slsmn h 120' Plant (SM) Boyer James (c) lab James & Kingman Lbr Co r 411 Arch Boyer Mamie (c) dom J A Jackson Boyer Ross (Ruby) 3 bus opr r 567 1st Boyett A Delwin (Adenea) shoe repr H L Green & Co r 258 College Boykin John C (c; Ola) 1 (o) carp h 8 Bertha- dale dr (V) Boyle Edw r 5 Randolph pi Boyle Mary Joe tex wkr Willingham Mills r 5 Randolph pi Boyle Mary Lou (wid J S) h 5 Randolph pi Boyles Raymond E printer Am Printing Co r RD 4 Smith rd Boynton Linton (c; Ethel) porter J C Land b 108 (442) New St la Boynton Lucy (c) h 151 Lincoln (V) Boynton Mary B (c) smstrs r 151 Lincoln (V) Boynton Q T (c) r 151 Lincoln (V) Boynton Laura (c) dom F W Tronce Bozeman Cath M slswn Burden Smith & Co r 88 Arlington pi Bozeman Hennie (wid C H) r 42 Brigham (PM) Bozeman James L r 811 Winton Bozeman Hath r 811 Winton Bozeman Kemper (Mrs W H) tex wkr Payne Mill r 42 Brigham (PM) Bozeman Mattie L (wid TP) h 254 Washing- ton Bozeman Mildred r 811 Winton Bozeman Mildred tchr Lanier High Sch For Girls r 88 Arlington pi Bozeman Robt L (Nancy) (o) h 811 Winton Bozeman W Howard (Kemper) 4 tex wkr Payne Mill h 42 Brigham (PM) Bozeman W Sidney r 811 Winton Bozeman Wm E (Mildred L) (o) bkpr Ga Loan & Trust Co h 88 Arlington pi Bozze Charlotte r 421 Oak Bracken James W (Manilla) 2 engr MD&SRR h 271 College Bradbury J Louis (Mary) 1 (o) div storekpr Ga Power Co h 104 De Sota pi Bradbury Mary (Mrs J L) tel opr Dannen- berg's r 104 DeSota pi Braddy Clifton T (Cornelia) 1 elk G W Goins h 342 Duncan Braddy Frances (Mrs O H) tex wkr Willing- ham Mills r 319 Montpelier Braddy Maggie (Mrs W E) tex wkr Payne Mill r 174 Palace (B) Braddy Mollie (wid J B) r 22 (4) Bellevue rd Braddy O Harry (Frances) elk G W Goins r 319 Montpelier Braddy Walter E (Maggie) (o) h 174 Palace Braden Marjorie Mrs bkpr Bearings Sup Go h 261 Georgia apt D2 Bradfield Eva r 405 Montpelier Bradfield Geo W (Nellie) 1 emp Willingham S&D Co h 118 Willingham Bradford Anna cook J H Porter Bradford Floyd V (Willie M) (o) mech Hucka- bee Auto Co h 760 Date Bradford Lucinda (c) cook Woolworth's r 134 Moughon (V) Bradley Alonza (c) lab Carling Tile Co Bradley Iona H (Mrs W J Jr) file elk FERA r 855 Mulberry apt 300 Bradley John B (Lela) condr C of Ga Ry h 203 Newberg (SM) Bradley Joseph D Jr (Nell) 2 slsmn Am Bak- eries Co h 764 Montpelier Bradley L C (c) lab Macon Cooperage Co r 701 Hammond Bradley Laura (c) h 121 (119) Tatnall Bradley Louise (c) maid r 606 Ross Bradley Lucy (c) maid Winship McLean r 713 Oak Bradley Mary (c) maid 114 Oak Haven Bradley Mary B (Mrs Oscar) elk Oscar Brad- ley r 813 Poplar apt 3 Bradley Mattie (c) cook E E Bullard r 115 (10) Frank al Bradley O W speeder hd Bibb Mfg Co Bradley Oscar (Mary B) 1 gro 545 Cotton h 813 Poplar apt 3 Bradley Oscar Jr elk Oscar Bradley r 813 Poplar apt 3 Bradley W J Jr (Iona H) r 855 Mulberry apt 300 Bradley W Joseph (Blanche) 1 (o) prof Mer- cer Univ h 745 College Bradley Walter (c) porter A Schulte r 62 Spring , Bradley Willis tr dr r 224 Georgia Bradshaw G Russell (Ruby) barber Flynt's Barber Shop r 127 Pearl Bradshaw Julia (c) (o) h 169 (163) May (U) Brady Coralie supt nurses Macon Hosp r do Brady Estelle (wid John) (o) h 201 Oakland Brady Fannie F (wid J S) (o) h 912 Walnut Brady Gordon student r 201 Pierce (V) Brady James E (Della) (Gordon Gro Co) h 22 Progress Brady Lucius emp Bibb Mfg Co Brady Margt checker Snows Ldry r $17 Poplar apt 2 Brady Margt student r 619 (611) Johnson Brady Mary A r 421 Calhoun Brady Nellie r 421 Calhoun Brady Sara student r 450 Center (EM) Brady Thelma student r 201 Pierce (V) Brady Thos E (Carrie) 1 hlpr h 421 Calhoun Brady Tilton M (Lena) cond So Ry h 516 F.lm BRADY'S PLACE (J B Finney) Beer and Wines 163 5th--tel 9400 Bragg C Clark (Eliz) slsmn J W Burke Co h 363 College apt 4 Bragg Doris r 217 Carling Bragg Earle S (Mary E) 3 printer Macon Teleg Pub Co h 131 Curry pi Bragg Edgar R (Mary) 3 tr dr Nat Biscuit Co h 1446 College Bragg Eleanor student r 30 (90) Mill Bragg Eliz (Mrs C C) sten Penn Mut Life Ins Co r 363 College apt 4 Bragg Harold tex wkr Willingham Mills r 217 Carling Bragg J Robt (o) gro 1219 2d h 505 Duncan Bragg Joel R (Sarah M) tex wkr Willingham Mills h 30 (90) Mill Bragg Joel S r 2017 2d Bragg Marion announcer WMAZ r 224 Adams 19S5 Macon City Directory 147 Bragg Mary (Mrs J R) tex wkr Willingham Brand Clarence (Mattie) emp Washburn Stor- Mills r 30 (90) Mill age Co r 120 Chappell (SM) Bragg Palmer E (Dora) elk C of Ga Ry h 106 Brandt Danl W chf opr C of Ga Ry r 302 Madden av Buford pi (V) Bragg Sarah M (Mrs J R) emp Willingham Branford Lucy M (c) maid 315 Jenkins Mills r 30 (90) Mill Branham Columbus (c) emp Standard Tool & BRAGG WALTER T (Nena) (o), Treas J W Handle Co h 111 Edgewood Burke Co, h 224 Adams--tel 1312 Branham Katie (c) r 111 Edgewood Bragg Walter T Jr (Ailene) 2 elk J R Bragg Branham M Howard bkpr Clark Memorials r 505 Dunean av Inc r 120 Tyrone blvd (I) Bragg Wesley D (Leah) 1 emp Willingham Branham Percy (c; Blanche) 1 pntr h 207 Mills h 217 Carling Orange Bragsdale Chas (c; Julia) cook h 357 Maple Brannan Gibb r 111 Pineview Brake Durwood A slsmn Sunlite Electrik Bake Brannan James H (Addie) 1 hlpr h 202 Cut- Shop Ine r 511 Pine lers la (EM) Brake Henry T (Bessie) 5 slsmn Jewel Tea Co Brannon Addie (wid Robt) r 415 Montpelier h 511 Pine Brannon Andrew J (c) r 317 Hammond Brake Henry T Jr slsmn Sunlite Electrik Bake Brannon Chas B (c; Mattie M) 1 h 618 4th Shop Inc r 511 Pine (WH) Barke James L (Argress) elk Gordon Gro Co Brannon Ellis W (Jewell R) 2 (Brannon's Serv r 103 (100) Oakland Sta) h 3111 Houston av Brake Luther E (Blannie) carp h 251 Belmont Brannon Frank bkpr City Treas r YMCA Bramblett Hewlett L (Alice L) 2 barber Haye's Brannon Wm B (c; Gertrude) 1 (o) h 305 Barber Shop h 245 Bond apt 2 Womack Branan Albert B (Lula) h 421 Chappell (SM) Brannon's Service Station (E W Brannon) Branan Albert M r 421 Chappell (SM) 3111 Houston av (SM) Branan Alvah L (Alice I) h 504 Duncan Brantley Addie (wid E R) 4 emp Bibb Mfg Co Branan Edgar W (Ruby) 1 condr C of Ga Ry h 1027 2d r 2420 2d Brantley Alf (c; Mary) h 321 Corbin (V) Branan Emma H (wid O F) drsmkr h 126 Brantley Alice nurse Macon Hosp r do Laurel Brantley Avice (Mrs R L) tex wkr Bibb Mfg Branan Harold H (Anese H) 1 slsmn South- Co r 18 Lake City (EM) land Coffee Co h 310 College apt 1 Brantley Belton M r 218 American blvd Branan Helen (wid C M) h 760 1st Brantley Benj (c; Zollie) (o) emp C of Ga Ry Branan Helen nurse Macon Hosp r do Creosote Plant h 115 Simmons (B) Branan Henry L (Carolyn) 1 sawyer h 210 1st Brantley Celebira opr Happ Bros Co r 1537 1st Branan Isaac (c; Nellie) chauf R W Crockett Brantley Chas (c) r 106 Powell h 365 Robinson rd Brantley Cheney (Margt) 1 elk So Ry h 310 Branan Jos J (Minnie L J) (o) h 769 Mulberry Hines ter (V) Branan LeRoy student r 210 1st Brantley Clara (c) (o) lndrs h 700 Clinton Branan Lula (Mrs A B) opr Happ Bros Co r Brantley Clinton (c; Eva M) barber 408% 421 Chappell (SM) Poplar h 324 Ward (V) Branan M Benj (c) carp r 156 (241) Forsyth la Brantley Emma (c) (o) h 106 Powell Branan Margt W sten Turpin & Lane r 109 Brantley Emory L (c) h 830 Edgewood Buford pi (V) Brantley Ethel (Mrs O D) cash Kalish Optical Branan Marian E sten Bibb Mfg Co r 126 Co r 615 Walnut apt 1 Laurel Brantley Eva (c) typist County Relief Admin Branan Martha C r 760 1st r 324 Ward Branan Martha L r 610 2d Brantley Fenella student r 663 Hemlock Branan Mary E student r 2420 2d Brantley Florence M (wid Frank) r 615 Branan Mary M (wid W M) 1 h 610 2d Walnut apt 1 Branan Millie (wid J H) r 340 Columbus Brantley Fredk (c; Jonnie) lab r 315 Division Branan Minnie L J (Mrs J J) opr So Bell Tel Brantley Gertrude E Mrs r 123 Magnolia Co r 769 Mulberry Brantley Harry T (Fay) del slsmn Gulf Refin- Branan Nellie (c) cook L G Entrekin r 165 ing Co h 333 San Juan Robinson rd Brantley Ida (Mrs Henry) r 957 Elm Branan Ralph asst undtkr Hart's Mortuary r Brantley Isaac (c; Carrie) (o) lab C of Ga Ry 755 Cherry h 134 Moughon (V) Branan Ruth D tchr Burke Sch r 610 2d Brantley J D (Eva M) 7 flgmn C of Ga Ry h Branan Sophia A r 109 Buford pi (V) 206 Newberg (SM) Branan Wm (Alleen W) dep sheriff Bibb county Brantley John (c; Minnie) 8 lab C of Ga Ry h 109 Buford pi (V) h 218 Plant (SM) Branan Wm Jr (Mary L) civ eng City of Brantley John G tr dr The Texas Co r Jef- Macon h 811 Poplar apt 10 fersonville rd Branan Wm T (Louellen) h 127 Holt Brantley Jordan (c; Anne) 2 lab Buckeye Cot- Branan Woodrow M r 504 Duncan ton Oil Co h 308 (63) Plummer's al Branch Douglas D emp YMCA r 772 Walnut Brantley Laverne (c) student r 106 Powell Branch Gordon B (Ella Mae) 5 emp Birdsey Brantley Lillie M (c) maid h 156 Phillips la Flour Mills h 114 (9) Myrtle (EM) Brantley Lindsay (c) lab Proctor & Gamble Branch J M bkpr Armour & Co r YMCA Mfg Co Branch Jewel B nurse Macon Hosp r do Brantley Louella (wid J J) r 104 St John (EM) Branch Mary (Mrs Olyn) opr Bibb Mfg Co r 300 Center (EM) Branch Octavius C (Patty) h 772 Walnut Brantley Louie (c) tchr E Macon Sch r 700 Clinton Brantley Mack C (c) barber Clinton Brantley r 324 Ward (V) Branch Olyn (Mary) tex wkr Bibb Mfg Co r Brantley Marshall (c; Laura) lab Willingham 300 Center (EM) S&D Co h 116 Cowen Branch Viola (c) dom C J Chappell Brantley Mary (c) cook r 678 Dunlap al 148 Baldwin's and Telegraph's Brantley Mary E (wid J T) (o) h 113 Stonewall pi (V) Brantley Matthew J (Lula) wtchmn Bibb Mfg Co h 2 Flanders Brantley Matthew J Jr tex wkr Bibb Mfg Co r 2 Flanders Brantley Mattie Mrs 2 h 1920 Broadway Brantley Q Douglas (Ethel) barber Gay Bar- ber Shop h 615 Walnut apt 1 Brantley Robt (c) emp City Playgrounds r 134 Moughon (V) Brantley Hobt L (Avice) tex wkr Bibb Mfg Co h 18 Lake City (EM) Brantley Rosa L (c) dom J B O'Neal r 116 Cowan Brantley Sessoms hlpr r 104 St John (EM) Brantley Sylvia (wid W B) 4 emp Happ Bros Co h 955 Elm Brantley Thos (e) emp Lewis Evans r 162 Elm Brantley Tilman (c; Cynthia) 1 (o) h 117 (148) Cedar (U) Brantley Tobe (c; Nellie) emp City h 458 e Academy (EM) Brantley Voncille cash Hayes Clothing Store 1 615 Walnut apt 1 Brantley West (c) lab Cherokee Brick Co Brantley Wm H (c) barber Clinton Brantley r 408% Poplar Brantley Wm I (Bertha) 1 barber h 663 Hem- lock Brantley Wm I (Daisy) 1 supt Nat L&A Ins Co h 474 Orange apt 1 Brantley Zollie (c) cook B L Caldwell r 115 Simmons (B) Brass Rail The (J L Simpson, Herman Alex- ander) restr 311 3d Braswell Annie (Mrs J J) opr Happ Bros Co r 107 Harrold Braswell Benj (c) lab F S Royster Guano Co Braswell Benj (c) tr dr Marshall Furn Co r 520 Calhoun Braswell Bertha (wid Gene) 1 student r 128 Rembert Braswell Chas J (c) r 116 (160) Brief (V) Braswell Clarence (c; Minnie M) emp Jef- freys-McElrath Mfg Co h 125 Forest (V) Braswell Dock (Paralee) r 217 Broadway Braswell Dollie (c) r 212 Coles al Braswell E Waswick h 216 Applewood Braswell Emma r 200 Cole Braswell Esko (c) emp Bibb Mfg Co r 519 e Academy Braswell Estella (c) cook r 204 (1) Tatnall la Braswell Florine (c) dom W A McClellan Braswell Frank (c) r 511 (705) Campbell (SM) Braswell Geo (c) r 414 (555) Henrietta (SM) Braswell Geo (c; Dollie) r 62 Spring Braswell H Grady (Celestine) 3 lintermn Buckeye Cotton Oil Co h 160 Jeff Davis (SM) Braswell Ida V (wid A N) (o) h 100 Anthony rd Braswell J Jackson (Annie) mech Adams Buchanan Mtr Co h 107 Harrold Braswell James waiter Spiller's Restr r 124 1st Braswell Jas A (c; Theodosia) (o) barber 507 Broadway h 456 Pio Nono Braswell Jas H (c; Lizzie) emp Jeffreys-McElrath Mfg Co h 116 (160) Brief (V) Braswell Jewell r 1531 3d Braswell Jimmie (c) case aide County Relief Admn r 456 Pio Nono Braswell John elk r 509 Arch Braswell John J mech Adams Buchanan Mtr Co r 107 Harrold Braswell Landis E (Ophelia) 1 route formn Independent Ldry Co h 549 Boulevard (NH) Braswell Levi (c) hlpr Maxwell Bros h 579 Siam Braswell Litta (c) r 579 Siam Braswell Lizzie (c) emp Independent Ldry Co r 212 Coles al Braswell Luther T emp Bibb Mfg Co r 616 1st Braswell Marion (Rosa Lee) hlpr r 558 Hem- lock Braswell Mose (c; Lizzie) 1 emp City h 115 (113) Thomas (EM) Braswell Myrtle (c) r 414 (555) Henrietta (SM) Braswell Ollie L (c) cook R L Anderson r Stinsonville Braswell Reuben (c) 3 firemn C of Ga Ry h 511 (705) Campbell (SM) Braswell S T (c) porter Piggly-Wiggly r 204 (1) Tatnall la Braswell Thos A (Kelly) 1 r 1004 Walnut Braswell Wallace pkr Adams Mfg Co r 913 New Braswell Walter (c; Angeline) waiter Demp- sey Hotel r 62 Spring Braswell Wm (c; Perry Lee) lab Taylor Iron Wks h 22 (422) Steins al Braswell Willie A (c) r 511 (705) Campbell (SM) Brawner Coleman E (Pauline) 2 speeder hd Bibb Mfg Co r 256 Hydrolia Bray Alice (c) emp Snow's Ldry r 313 Tel- fair (SM) Bray Annie P (Mrs J W) opr Mary Ann Beau- ty Shoppe r 516 Log Cabin blvd Bray Chas (c; Mamie) 2 (o) pdlr h 121 1st (U) Bray Cleo r 234 Roff Home Bray Edw (Ellen) tex wkr Atlantic Mill h 234 Roff Home Bray Harmon (c; Marie) 4 lab h 1137 (1214) Broad Bray Henry A (Leila) pntr h 201 Hydrolia Bray J Alfonsa (Lillian) 2 (o) tex wkr Bibb Mfg Co h 103 (2) Balkcom Bray James (c) r 132 (131) Sycamore (V) Bray Jas L slsmn A G Rhodes & Son r 218 Georgia Bray James W (Annie) 3 (o) emp So Ry h 516 Log Cabin blvd Bray Leila (Mrs H A) tex wkr Bibb Mfg Co r 201 Hydrolia Bray M Nita r 201 Hydrolia Bray Mattie (c) 1 dom r 132 (131) Sycamore (V) Bray Nina emp Macon Cafeteria r 758 Cherry Bray Perry M (Myrtle) gro 117 Hardeman r 407 Forsyth Bray Ruby L (Mrs S M) spinner Bibb Mfg Co r 922 New Bray Sara E r 201 Hydrolia Bray Seneca M (Ruby L) 1 tr dr Sterchi's h 922 New Bray Wm L (Mamie) h 501 Georgia Bray Wm L student r 201 Hydrolia Bray Willie (c; Lucile) chauf r 212 (227) Roye Bray Zedrick A 2 (o) emp So Ry h 215 Jeff Davis (SM) Brazil Jesse (c) r 1% Woodliff Brazil Judson (c) r 506 (5071 Crisp Brazzeal C David (Henrietta) 1 asst mgr Bank- ers H&L Ins Co h 212 Pierce (V) Brazzeal J Jefferson (Leila) 1 trav slsmn h 703 Holt Brazzeal Jeanette student r 703 Holt Brazzeal John J student r 703 Holt Brazzeal M Eliz sten Bankers H&L Ins Co r 212 Pierce (V) Brazzeal R Thos student r 212 Pierce (V) Brazzeal Valerie student r 703 Holt Brevard Addie G (wid Wm) h 128 Virginia 1935 Macon City Directory 149 Brevard Betty cash McCommon Bros r 128 Virginia Brew J H (Mamie) slsmn r Central Hotel Brew Mamie (Mrs J H) hskpr Central Hotel r do Brewer Cora (wid H D) r 811 Walnut Brewer Henry G student r 203 Peachtree Brewer James W (Grace) 1 sign pntr Nehi Btlg Co h 603 Mikado Brewer John H (c; Ida) h 446 Curd (SM) Brewer Mary (Mrs Raymond) 1 r 144 Wil- liams (SM) Brewer Mary O (Mrs J R) tex wkr Bibb Mfg Co h 203 Peachtree Brewer Mildred opr Dixie Roll & Cot Co r 203 Peachtree Brewer Nathan (Ola) 2 tex wkr Payne Mill h 157 Comer ter (PM) Brewer Nolda student r 592 Duncan Brewer Thos (c) emp Thomas Funeral Home r 229 Patterson Brewer Wm J (Ethel) 2 barber 312 Main (EM) h 903 Napier Brewington Eugenia (c) (o) dom h 123 Wash- ington Brewington Lewis (c) r 444 (5) Shoals al Brice Chester A (Louise) 1 firemn GS&FRR r 115 3d Brice Coleman J (Gladys) 2 (o) mech So Ry h 2025 2d Brice Crawford (c) 1 h 106 e Ell Brice E Gertrude student r 1925 2d Brice Ernest (c; Eula) delmn Leaptrot's Mkt h 216 Gantt pi Brice Ernest R r 559 Ash Brice Eula L (c) cook L O Gunter r 106 e Ell Brice Geo W pntr r 2321 Broadway Brice James W (Minnie) (o) emp C of Ga Ry h 2321 Broadway Brice Joseph F (Laura) (o) blrmkr So Ry h 559 Ash Brice Lula M (c) r 29 Reid Brice Maggie Mrs spinner Bibb Mfg Co r 2321 Broadway Brice Odessa Mrs 2 r 774 Mulberry Brice Reuben (c; Carrie) hlpr Swift Oil Mill h 110 Concord Brice Robt W (Nora) (o) blrmkr So Ry h 1925 2d Brice Vather L (c) r 106 e Ell Brice Wm H (Emma) (o) welder C of Ga Ry h 407 American blvd Bridgeman Grant pntr Hotel Dempsey r Camp Wheeler rd Bridgeman Thos C mach C of Ga Ry Bridgers G Herbert (Melissa) 2 (o) gro h 122 Rogers (V) Bridges C Elmo (Jewel) 1 emp Washburn's Storage r 761 Mulberry Bridges C Jethro slsmn Dannenberg's h 926 Cherry Bridges Claude S mach C of Ga Ry h 490 Cherry Bridges Clem (c) emp C of Ga Ry Creosote Plant Bridges Cleo (wid C C) r 568 Walnut Bridges Daniel W refrigeration serv mn r 926 Cherry Bridges Edna nurse Macon Hosp r do Bridges Florence (wid J W) r 107 Brentwood Bridges Gordon (Bertie) 2 pntr r 607 Plum Bridges Irene (wid Claude S) r 490 Cherry Bridges James J mach C of Ga Ry r 490 Cherry Bridges Jos H slsmn r 490 Cherry Bridges K Frances 490 Cherry Bridges Louise H dir children's div South Ga Conference r 490 Cherry Bridges Mattie Mrs r 217 Ross Bridges Sarah M opr Happ Bros Co r YWCA Bridges Wiley R (Maude E) 1 emp Gulf Refin- ing Co h 108 (146) Charles Bridges Wm (c; Della) coal roller City Bd of Water Comrs r Monroe Hill Briggs Annie B r 3803 Houston Briggs Arch R (Annie) 2 (o) bldg contr 3803 Houston h do Briggs Arizona (c) maid J W Popper r 302 Madison Briggs Harry (Lillie) (o) jwlr R H Matthews Inc h 133A Oakland Briggs Louis (Gladys) 1 carp r 3803 Houston Briggs Marias W (Eliz O) 1 elk C-M-P Drug Co r 204 Ormond ter BRIGGS RUSSELL F (Florence D) 2 (o), Sec McClure Ofc Equipment Co, h 415 Belmont --tel 1107-J Brigham Alfred (c; Christine) 1 ehauf R L McKenney r 221 Telfair Brigham Gladys (c) sch tchr Dublin Ga r 68 (137) Forest (V) Brigham Shelton (c) r 68 (137) Forest (V) Brigham Virginia (c) maid J H Porter h 68 (137) Forest (V) Brigham Walter (c) hlpr McKenney & Adams r 68 (137) Forest (V) Bright Chas waiter Spiller's Restr r 144 Magnolia Bright Georgia M cash Mitchell & Williams Co r 144 Magnolia Bright Harry (Margt) firemn CFD r 249 Hardeman Bright James (c) emp Hutchings Funeral Home r 524 Calhoun Bright Josephine L (wid J L) h 252 Broadway Bright Louise Mrs h 919 New apt 4 Bright Margt (Mrs T J) h 144 Magnolia Bright Margt C r 144 Magnolia Bright Nettie L (c) cook J H Mercer Brightwell Nannie (wid Geo) r 335 College Brightwell Richd emp Am Optical Co r 607 Winton Briley Arlena (c) 1 h 342 Gilmer Briley Clarence emp Bibb Mfg Co Briley Jesse (c; Roosevelt) emp Bibb Mfg Co r 235 Telfair Briley Jos A (Evelyn) 3 agt Am Nat Ins Co r 269 Maple Brim Christine nurse Middle Ga Hosp r do Brimery Nais (c; Bernice) butler E H Dunn r 230 Jones Brinson Bonnie (c) student r 420 Liberty (SM) Brinson J Chas (c; Phoebe M) (o) h 107 2d (B) Brinson Wesley (c; Della) emp C of Ga Ry h 420 Liberty (SM) Brisby Annie (c) 3 maid h 210 Turpin Briscoe Agnes (c) 1 h 108 Wyche Briscoe Andrew (c; Willie) lab So Ry r 114 5th Briscoe Della (c) r 754 Ocmulgee Briscoe Jessie (c) cook C T Hodges r 300 (164) Roye Briscoe Mary (c) 1 r 916 Pio Nono Briscoe S Walter (Josie L) meter repr Macon Gas Co h 131 Academy Brisendine James E hlpr Schwartz & Phaul Inc r 120 Yates Bridges James S (Aquilla V) wtchmn So Crate Brisendine Mildred E (Mrs W E) waitress & Veneer Co r 926 Cherry Newberry's r 129 Yates Bridges Jewel (Mrs C E) emp Liberty Candy Co r 761 Mulberry Brisendine Thos emp City Water Wks r 129 Yates ISO Baldwin's and Telegraph's Brisendine Wm E (Mildred E) hlpr Schwartz & Phaul Inc h 129 Yates Brisker Ola (c) maid T L Collins r 517 e 1st (EM) Bristol Lindsay (c; Elizabeth) lab Bibb Mfg Co h 204 Elliott Britt Dora (Mrs J W) opr Happ Bros Co r 406 Cedar Britt Fredk E sec-treas Nat Pecan Mktg Assn r Lanier Hotel Broady Arth (c; Fannie) 6 (o) h 101 Wise (V) Broady Arth (c; Annie B) jan Wesleyan College h 260 4th (V) Broady David (c) student r 101 Wise (V) Broady James (c) r 101 Wise (V) Broady Preston (c) cook W H Felton r 101 Wise (V) Brock Bertha (c) cook L W McManus r 120 Green Britt G Curtis (Nora) 1 (o) detective CPD 6 260 Appleton Britt Irene (Mrs J M) opr Happ Bros Co r 917 Elm Britt James W (Dora) opr Happ Bros Co h 406 Cedar la (SM) Britt John T Jr (Annie) (o) plmbr 815 American blvd h do Britt Jerry M (Alice) h 125 Knott (SM) Britt Lonnie T (Lula M) (o) pntr h 456 Edge- wood Britt Lula M (Mrs L T) smstrs Happ Bros Co r 456 Edgewood Britt Nannie (wid J M) r 260 Appleton Britt Paul (Ophelia) opr Happ Bros Go h 225 (264) Willingham Britt Robt H (Bernice) r 1525 2d Britt Wiley F (Annie) (o) pntr h 611 Church (CH) Britt Wm E (Ina) (o) pntr h 115 (304) For- est (B) Britt Zollie 1 sunt Bibb Bldg r 768 Cherry BRITTAIN RALPH L (Gladys I) 1 Asst Agt The Texas Co h 340 North (NH)--tel 415-J Brittingham Harry A (Ruth R) rep Fruit Growers Exp Co r 1011 Clinton rd (EM) Britton Enoch (c; Clemmie) h 1013 Elbert Britton Hattie (c) h 206 O'Hara la Britton Margt (wid M H) r 1923 2d Britton Sadie checker Crescent Ldry r 247 High Broach Alex H (Mattie) capt Pump Co No 4 h 219 Belmont Broach Altoff C (Biddie L) h 615 Walnut apt 2 Broach Edna tel opr Union Dry Gds Co r 615 Walnut apt 2 Broach Emmett r 219 Belmont Broach Hilda opr So Bell Tel Co r 615 Wal- nut apt 2 Broach John C (Minnie) r 133 Fort Hill Broach La Nelle opr So Bell Tel Co r 615 Walnut apt 2 Broadbent Wm teleg opr O H Levi r 477 Spring Broadnax Corinne (c) maid T L Ross r 925 Ash Broadus Jas L (c) tr dr Bibb Mfg Co Broadus L Effers (c) tr dr Bibb Mfg Co Broadus Larue (c) dom E C Matthews r 400 Davis Broadway Building 461 Broadway Broadway Cash Market (J M Simmons) meats 410 Broadway Broadway Cleaners (Edward Bivins) 1232 Broadway Broadway Fish Co (Joseph Sagnibene) 1301 Broadway Broadway Lunch (c) (Mary B Stewart) 361A Broadway Brock Malvin J (Alma) 1 fixer Bibb Mfg Co h 41 Bibb Brockman Fredk (Brady) h 203 Cutters la (EM) Brockman John D (Ora R) 1 barber Brockman's Barber Shop r 508 Church (EM) Brockman Ora (Mrs J D) tex wkr Bibb Mfg Co r 508 Church (EM) Brockman Swep O (Mattie) (Brockman's Barber Shop) h 508 Church (EM) Brockman's Barber Shop (S O Brockman) 400 2d Brodnax T Clark (Leone) budget mgr Goodrich Silvertown Stores r 720 Forsyth Brokenshire Melvin R (Julia S) 2 mgr Macon Transient Bur r 131 Cole Bronson Addie (c) 3 lndrs h 405 (412) Womack Bronson Dell B (wid S C) (o) h 318 Johnson Bronson Fearbie (c) cook Mrs A J Dennis Bronson Henry (c; Hazel) 4 b'ellmn Macon Totel h 205 Bartlett Bronson Horace W (Mary C) dept mgr J N Neel Co r 400 Forest (V) Bronson Horace W Jr student r 400 Forest (V) Bronson Jack (c; Louise) 4 carp h 130 Clark (EM) Bronson Kath B tchr Alexander Sch No 2 r 318 Johnson Bronson Lelia (c) dom A F Boone r 401 (298) Cowan Bronson Louise (c) student r 401 (298) Cowan Bronson Pauline D tchr Virgil Powers Sch r 318 Johnson Bronson Thos (c; Zola) 3 (o) carp h 401 (314) Womack Bronson Wm Jr (c; Lelia) 1 (o) carp h 401 (298) Cowan Brookins Amanda (c) r 145 Pecan Brookins Cleo (c) cook J A Leverette r 145 Pecan Brookins Fred (c) opr Bibb Mfg Co Brookins Helen (c) maid h 342 Douglas (V) Brookins Horace D (c) student r 342 Doug- las (V) Brookins Terry (c; Alice) (o) lab Central S&D Co h 145 1st (V) Brooks Adams (c) elk C-M-P Drug Co h 122 4th (V) Brooks Adeline (c) h 305 Graham's lot Brooks Agnes (Mrs Richd) opr Happ Bros r 304 Mikado Brooks Alma (Mrs P W) elk Melton Gro r 309 (197) Log Cabin blvd Brooks Alva (c) 1 dom r 106 (110) Pringle Brooks Anne E student r 107 Courtland Brooks Arth J (Grace M), (o) h 552 Hemlock Brooks Calvin (Martha) emp Atlantic Mills r 32 Atlantic Village Brooks Charles (c) r 122 Cedar (U) Broadway Top & Body Shop (L M Coursey) auto reprs 715 Broadway Brooks Chas (c; Hattie) glazier Willingham S&D Co r 535 3d (V) BROADWAY TRADING CO Ollie C Herndon Mgr, Wm J Malone Asst Mgr, Salary Loans, 4 Jacques Bldg, 407 Broadway--tel 1701 Broady Annie B (c) maid Freeman Hart r 260 4th (V) Brooks Chas H (Ruby) 1 (o) (Dixie Dental Laboratory) h 222 Albemarle pi (I) Brooks Chas L elk Bibb Mfg Co r 284 College Brooks Chas S (c; Hattie) 1 mgr Tasken's Barber Shop 638 Washington 1935 Macon City Directory 151 Brooks Clarence (c) cook R S Jaques r 106 Empire Brooks Claude (c; Daisy) (o) firemn C of Ga Ry h 851 Ash Brooks Clifford E (Athalena) 1 electm Ga Power Co r 231 Washington Brooks Doris marker Snow's Ldry r 193 Magnolia Brooks Drucilla (c) cook C C Hendrix Brooks Edw (c; Emma) 3 lab Bibb Mfg Co h 305 Moore al Brooks Eva r 122 Lamar (V) Brooks Fannie B (c) maid H C Kendall h 220 Woodliff Brooks Floyd (c; Georgia) huckster h 460 e Academy (EM) Brooks Frances E sten New Hampshire Fire Ins Co r 110 Clayton Brooks Francis (c) r 122 4th (V) Brooks Frank B (Frances W) 1 slsmn h 107 Oourtland Brooks Frank F (Vivian) slsmn Macon Shoe Co r 133 Oakland Brooks Fredk (c) r 178 Park Hotel al Brooks G Edw (Cla>-a) hlpr Millirons Plmb'g & Heating Co r 223 Applewood Brooks Georgia (c) cook r 460 e Academy (EM) Brooks Gordon V (Eliz) credit mgr Dannen- berg & Waxelbaum Co h 864 Mulberry apt 3E Brooks Guy W (Noma) slsmn Huckabee Auto Co 113 Inverness Brooks Harold (c; Julia) 2 agt Atlantic Life Ins Co r 806 (700) Crisp Brooks Hattie H (c) agt Pilgrim Health Life Ins Co r 535 3d (V) Brooks Henry (c; Pearl) 2 (o) h Henderson (B) Brooks Herbert J (Delia M) designer Idle Houp Nurseries r 859 Walnut Brooks Ida (c) 1 maid Avner Chambers h 379 Monroe (V) Brooks Ida M (c) cook 805 Main (EM) Brooks J A School (c) Ruth Taylor prin 103 Main (S) Brooks J Henry (Bessie) 3 tex wkr Bibb Mfg Co h 53 Hydrolia Brooks James (c) hlpr Brannon's Serv Sta r 457 Colquitt (SM) Brooks James (c; Frances B1) porter Sunlite Electrik Bakery h 226 Roosevelt (V) Brooks James B restr wkr r 122 Lamar (V) Brooks James D (Beulah) 3 hlpr h 1221 2d Brooks James L (Mary C) (o) chf elk So Ry Frt Depot h 125 Magnolia Brooks Jean (Mrs W D) tex wkr Bibb Mfg Co r 225 Applewood Brooks Jesse B wtcKmn Macon Milling Co Brooks Jessie (c) 4 Indrs h 457 Colquitt Brooks John (c) emp So Ry r 107 (1620) Johnson's al Brooks John B (Princie L) (o) h 122 Lamar (V) Brooks John D (c) shoe shiner Palmetto Bar- ber Shop r 225 5th Brooks John W (Mary) emp Atlantic Mills h 19 Atlantic Village Brooks Julia (c) cook h 805 Ocmulgee Brooks K Paul r 122 Lamar (V) Brooks King (c) hlpr Hightowers Serv Sta r 205 Elm Brooks L Frances student r 110 Pierce (V) Brooks Lee (c; Ida L) 2 lab h 3 (312) Han- son (SM) Brooks Lessie emp Macon Cafeteria r 759 1st Brooks Lillian (c) 2 r 341 4th (V) Brooks Lillie (c) maid T R Gunter h 528 Wade's la Brooks Lizzie (c) 3 h 122 Cedar (U) Brooks Lola (c) cook J Gilbert Price r 1231 3d Brooks Lottie (c) r Henderson (B) Brooks Lucy (c) dom h 306 (243) Roye Brooks Lula Mrs emp Ga Pecan Growers Assn r 100 Davis (SM) Brooks Marilou student r 222 Albermarle pi (I) Brooks Mary (c) 1 h 455 Monroe (V) Brooks Mary C sten Dannenberg & Waxelbaum Co h 110 Clayton (V) Brooks Mary E (c) cook J S Carter r 109 (121) 3d (B) Brooks Mary L r 100 Davis (SM) Brooks Maude (wid G J) 1 slswn Union Dry Gds Co r 359 Clinton Brooks Maxwell (c) carrier Macon Teleg h 105 Main (S) Brooks Northern (c; Mary) 1 lab r 109 (121) 3d (B) Brooks O Lynwood (Laura B1) (o) condr C of Ga Ry h 110 Pierce (V) Brooks Obie (c; Mary) h 450 Martha Brooks Paul W (Alma) 1 (o) asst bkpr FERA h 309 (197) Log Cabin blvd Brooks Peter (c) r 233 e 2d (EM) Brooks Rebecca (c) 3 r 341 4th (V) Brooks Richd F (Agnes D) agt Progressive Life Ins Co r 304 Mikado Brooks Robt B r 122 Lamar (V) Brooks Robt F (Mamie) 1 (o) (Lyon, Harris & Brooks) h 863 2d Brooks S Lonnie (Beatrice) r 252 Broadway Brooks Sallie (c) 2 h 233 e 2d (EM) Brooks Sami (c) cook Wm Smith h 341 4th (V) Brooks Susie (c) h 15 Graham's lot Brooks Thos P student r 113 Inverness Brooks Vivian (Mrs F F) sten Adams Mfg Co r 133 Oakland Brooks Wm B (Lizzie) 2 emp MD&SRR h 353 Center (EM) Brooks Wm B (c) tchr r 806 (700) Crisp Brooks Wm D (Jean) 1 h 225 Applewood Brooks Willie L (c) cook J C Booth Broome Aileefi W Mrs 5 (o) h 605 Mikado Broome Carrie W (wid W H) emp Southland Knitting Mill h 254 Jeff Davis (SM) Broome Christine asst prof Wesleyan Col r 106 Holt (V) Broome E Margt r 254 Jeff Davis (SM) Broome Elsie K (wid L J) 2 tex wkr Willing- ham Mills r 1905 Vineville (V) Broome Lester emp Willingham Mills Broome Rufus P (Lillian) 3 carp h 213 Kemper Broome Willie M (wid Christopher) (o) h 106 Holt (V) Broomfield Julia (c) 2 h 124 Green Brotherhood of Locomotive Engrs No 210 (C of Ga Div) O T Lavender sec meets Sundays 3pm 515 2d Brotherhood of Locomotive Engrs No 786 (So Ry Div) A J Smith sec meets 2d & 4th Sundays 3pm 515 2d Brotherhood of Locomotive Engrs & Firemn Ladies Auxiliary Mrs Charlotte Smith sec meets 2d & 4th Fridays 8pm 408 Poplar Brotherhood of Locomotive Firemen C E Langston sec 2d & 4th Sundays 1502% Broadway Brotherhood of Maintenance of Way Emps meets 502% 2d Brotherhood of Railroad Carmen Central City Lodge No 226 meets 1st & 3d Mondays 8 p m 408 Poplar Brotherhood of Railroad Trainmen No 376 J C Fitts sec meets 1st & 3d Sundays 8pm 515 2d 152 Baldwin's and Telegraph's Brotherhood of Railway Clerks meets on call Brown Bernice (c) cook G C Joyner r 230 408 Poplar Jones Brotherhood of Railway Signalmen meets Brown Berta smstrs Macon Pleating Co r 502% 2d 620% Cherry Broughton Alberta (c) maid E H Hardin r 3 Brown Bertha (c) 1 h 500 Hammond Woodliff Brown Bertha (c) r 138 (141) Sycamore (V) Broughton Chas (c) porter Capitol Hotel r do Brown Bertha (c) r 210 3d (U) Broughton Irene (c) h 156 Hill Brown Btessie Mrs h 963 Cherry Broughton Lula maid W E Burch h 3 Woodliff Brown Boise (c) delmn W G Dean r 124 Browder Joseph (c; Lois) 2 jan Tatnall Sq Bright al Bapt Ch h 1159 Oglethorpe Brown Boston (c; Emma) r 211 (600) Williams Browder Ruth (wid R E) r 401 College apt 2C (EM) Brown A Alton (Anna V) 1 mech Collins Bak- Brown Buford (c) lab r 110 New St la ing Co r 628 Orange Brown Burns (c) student r 72 (143) Forest (V) Brown A Sidney (Stevetta) drftsmn Dennis & Brown Buster (c; Margt) emp Sawyer Ice & Dennis h 102 Ella (SM) Coal Co h 353 Church al (SM) Brown Aaron (c; Bertha) porter J S Waldorf Brown C Noble (Irene) emp Happ Bros Co h & Son r 524 3d (V) 1913 3d Brown Ada elk Newberry's r RD 2 Wes- Brown Cajor (c) 3 h 107 (155) Elizabeth (SM) leyan dr Brown Calvin (c) r 423 Cotton Brown Ada (c) lab Proctor & Gamble Mfg Co Brown Cappie tex wkr Payne Mill r 112% Brown Agnes h 457 Oak Brookdale (B) Brown Albert (c) lab Atlantic Ice & Coal Co Brown Carl H (Gwendolyn) (o) dentist 1002 Brown Albina (wid R H) h 423 New Ga Casualty bldg h 108 Florida Brown Alex (c; Sila) 1 h 228 Jordan's al Brown Carlton r 203 Ridge (I) Brown Alex (c; Lily) lab C of Ga Ry r 421 Bay Brown Carolyn elk W T Grant Co r 126 Log Brown Alf L (Lila) emp C of Ga Ry h 201 Cabin blvd New Brown Carrie (c) 1 h 124 Cheatham al Brown Alice r 126 Log Cabin blvd Brown Carrie (c) (o) h 222 Madison (V) Brown Alice (c) emp So Crate & Veneer Co Brown Carrie L tchr Burke Sch r 822 Orange r 205 Hazel Brown Carrie L (wid J J) (o) h 1535 2d Brown Alma (c) 3 presser Independent Ldry r Brown Carlton H (Lois) 5 bus opr Southeast- 115 Woodliff ern Greyhound Lines h 341 Columbus Brown Alonza (c) r 315 Jefferson Brown Carswell (c) lab Carling Tile Co Brown Alonzo (c) gro 344 Middle (V) r 237 do Brown Cath (c) r 421 e 2d (EM) Brown Alva C (c) hlpr J H Settle r 2001 Brown Cecil emp McKesson Riley r 3401 Broadway Houston (SM) Brown Anderson (c; Mary) 3 lab Moyar Lbr Brown Chas (c) h 125 (19) Frank al Co h 358 Bay Brown Chas (c; Louise) 2 h 215 Neal (U) Brown Andrew (Nan) h 224 (124) Balkcom Brown Chas (c) delmn M H Mitchell h 107 Brown Andrew W (c; Annie) 1 (o) (Brown's Brief (V) Barber Shop) h 504 Broad Brown Chas (c; Susie M) emp Bibb Mfg Co Brown Anna (c) h 322 (312) Monroe (V) h 303 Burnett Brown Anna (c) 1 lndrs h 204 Antioch rd Brown Chas emp Happ Bros Co r 865 1st apt 1 Brown Annie (c) h 719 Daisy (SM) Brown Chas engr C of Ga Ry r 468 Walnut Brown Annie (c) r 224 (124) EkJison Brown Chas (c) lab Taylor Iron Wks r 508 Brown Annie (c) h 104 (1) Fulton la Elbert Brown Annie (c) r 4 Wall St la Brown Chas (c; Annie) lab C of Ga Ry h 3 Brown Annie (c) r 219 5th (V) Waterville rd Brown Annie (c) cook Claudya Worsham Brown Chas (c) tr dr Atlantic Ice & Coal Co Brown Annie (c) 2 cook h 318 (316) Monroe h 804 Edgewood (V) Brown Chas B (c; Eva M) 4 lather h 367 Brown Annie (c) dom h 219 5th (V) (344) 3d (U) Brown Annie (c) lndrs h 111 Shoals la Brown Chas F (Susie) (o') car inspr So Ry Brown Annie Lou tex wkr Happ Bros Co r h 129 (163) Parkwood (B) 224 (124) Balkcom Brown Charles M (Marie A) 1 mach C of Ga Brown Annie M (c) r 43 Green's al Ry h 205 Newberg (SM) Brown Annie M (c) r 75 New Brown Chas N dr Yellow Cab Co r 122 Brown Annie M (c) lndrs h 5 Opera Hse al Academy Brown Annie R (c) r 595 (501) Smith (EM) Brown Chas T (Nell) cotton weigher Bibb Mfg Brown Arcelius (Rosa M) 2 (o) hlpr Ga Kao- Co res RD Forsyth rd lin Plant h 608 Broad Brown Chas T (C Lula) (o) (Brown's Watch Brown Arlene r 128 Rembert Repair Shop) h 126 Log Cabin blvd Brown Arth (Estelle) 1 tex wkr Payne Mill Brown Chas T Jr plmbr r 126 Log Cabin blvd h 95 Green (PM) Brown Chauncey (c) lab C of Ga Ry r 719 Brown Arth L (c; Louise) hlpr Bob Young Daisy (SM) Used Car Exch r 851 Foster's al Brown Christine (c) cook J S Lewis r 202 (135) Brown Ashley (c) jan So Cotton Oil Co r RD 3 Neal Brown Ashley (c) lab C of Ga Ry Brown Clara M (c) cook R L Walden r 426 (r) Brown Augustus (c< Zetta) 3 (o) carp h 205 Main (EM) Anthony rd Brown Clara (c) cook h 369 Monroe (V) Brown Augustus (c; Emma) tester Bibb Mfg Brown Clarence B (Sarah) h 215 Carling Co h 136 (214) Clark (EM) Brown Clarissa (c) r 529 Grant Chapel al Brown Beatrice (c) 2 tex wkr Atlantic Cotton Brown Claude (c; Mary E) 1 r 105 (107) Mill r 135 Middle (V) Brief (V) Brown Benj (c; Mary) 1 h 315 Jefferson Brown Claude (c; Sallie) emp Bibb Mfg Co h Brown Bernard H (Nell) 4 firemn CFD h 132 606 Center (EM) Ell (SM) Brown Claudie (c) h 120 Wings Hill 1935 Macon City Directory 153 Brown Claudine (c) maid r 105 (107) Brief (V) Brown Clement (c; Rebecca) 2 h 959 Ogle- thorpe Brown Cletia W Mrs tchr Burke Sch r RD 2 Brown Clevon (c) r 595 (501) Smith (EM) Brown Clifford (c; Christine) chauf r 202 (135) Neal (V) Brown Clyde student nurse Oglethorpe Private Infirmary r do Brown Corinne (wid C H) h 3 Roff Home pi Brown Corrie tex wkr Bibb Mfg Co r 663 Hemlock Brown Crosby (c; Lucile) 5 hlpr MD&SRR r 522 e 2d (EM) Brown Curley M (c) maid Dr T L Woodward Brown D F emp Pepsi-Cola Btlg Co r YMCA Brown Daisy L (c) maid H M Oldham r 112 (164) Virgin (V) Brown Danl C (c) atndt Am Oil Co r 107 (5) Frank al Brown David (c; Ida) glazier Central S&D Co r 115 Johnson (SM) Brown David B (Annie L)5 doffer Bibb Mfg Co h 15 Bibb Brown Dena (c) maid W M Parks r 6 Brown Eula (c) emp Atlantic Mills r 118 (133) n Holt Brown Eunice r 618 Elm (Mrs Otto) emp Bibb Mf6g Co Brown Evelyn h 105 Riley (CP) Brown Evelyn slswn Woolworth's r 963 Cherry Brown Evie (wid J C) h 867 New Brown Ezekiel (c) r 1071 Colemans la Brown F Willard atndt Cherry St Serv Sta r 120 Lawton Brown Fannie (c) 2 cook r 111 (302) Craft Brown Fannie (wid J E) opr Happ Bros Co h 119 Plant (SM) Brown Fannie L r 129 (163) Parkwood (B) Brown Fay N (Mrs H B) bkpr Brown-Kline Sign Co r 104 Beuna Vista dr Brown Fleetwood M r 822 Orange Brown Fleming (Beulah) 1 hlpr r 254 Wash- ington Brown Florence opr So Bell Tel Co r 712 1st Brown Florine (c) r 726 (8) Reynolds al Brown Frances (Mrs J G) checker Independ- ent Ldry Co r 124 Cole Brown Frances opr Happ Bros Co r 821 Mul- berry Brooklyn Brown Dennis F (Marion) (o) pres Southland Coffee Co h 240 Riverdale dr (I) Brown Dock (c; Beulah) emp So Ry r 806 (807) Charles Brown Dora (wid J W) r 112 Montpelier Brown Dora (c) (o) peddler h 206 2d (TJ) Brown Doris cash S H Kress Co r 963 Cherry Brown Drewell (Lenora) 5 doffer Bibb Mfg Co r 408 Ross Brown Duncan (c; Ruby) 3 (o) lab h 595 (501) Smith (EM) Brown E H (Maggie) baker Collins Bakins Co r RD 1 Brown Edgar G elk Ry MS 105 Florida Brown Edith (c) h 368 3d (U) Brown Edw (c; Jessie) (o) barber Brown's Brown Frances J emp Happ Bros Co r 474 Orange apt 3 Brown Frank (c; Viola) lab Irby Bros Plmbg Co h 216 Turpin Brown Frank (c) presser Elec Dry Cleaning Co r 369 Monroe (V) Brown Frank (c) waiter Our Place r 122 (12) Hudson Brown Fred D (Edna L) agt Bankers H&L Ins Co 321 Forsyth Brown Fredk r 203 Ridge (I) Brown Fredk (c) chauf r 222 Madison (V) Brown Fredk (c; Minnie) lab h 450 City Hall la Brown Freeman (c; Elnora) 1 h 615 (14) Gilmer Brown Geneva (c) dom h 9 Murray al Brown Geo (c) carp r 142 4th (V) Barber Shop h 404 Broad Brown Edw (c; Pearl) 1 emp Cherokee Brick Brown Geo (c; Ruth) emp Independent Ldry h 1234 Broadway Co h 1 (201) Toombs (SM) Brown Edw (c) lab City St Dept Brown Geo (c; Essie) lab Buckeye Cotton Oil Co r 1223 Broadway Brown Elisha W mech Huckabee Auto Co r 526 Edgewood Brown Ella (c) r 232 (136) Cowan Brown Elmer (c) lab h 312 Burnett Brown Elsie r 1219 Vineville (V) Brown Elvira (c) cook C H Schofield r 172 5th (V) Brown Emma (c) dom r 136 (214) Clark (EM) Brown Emma (c) 1 maid r 1239 Dempsey Brown Ernest carp F S Royster Guano Co Brown Ernest W (Ruth) 5 emp State Fisn Hatchery h 110 Enterprise Brown Essie (c) dom h 206 (104) Plum- Brown Geo (c) lab r 125 (19) Frank al Brown Geo F sta mgr r 105 Thomas (LCHts) Brown Geo H (Eliz) 1 emp Ivy-Turner Ice Cream Co r 754 Broad Brown Geo T elk First Nat Bk & Trust Co r 872 Hillyer Brown Geo T (Valentine) 2 emp C of Ga Rv h 412 Walnut Brown Geo T (Janie) flgmn So Ry h 125 Daley Brown Georgia (c) cook Wards Bar-B-Q PI Brown Georgia (c) hlpr Bibb Mfg Co Brown H Elmo (Beatrice) mach C of Ga Rv mer's al h 666 Hemlock Brown Essie M (c) h 533 (415) Grant Chapel al Brown Essie P (c) r 216 Garden Brown H Lamar (Clara) 2 (o) electrn Lowe Elec Co h 203 (103) Balkcom Brown Estelle (Mrs Arth) tex wkr Payne Mill r 95 Green (PM) Brown Haderick (c; Gladys) r 177 Lincoln (V) Brown Hardy K (Laura B) 2 elk Gt A&P Tea Brown Ethel (c) h 103 (19) Kahn's al Brown Ethel M (c) dom h 152 Moore al Co h 345 North (NH) Brown Harrison W trk dr Standard Paper Co Brown Ethel P (c) maid r 213 Fretwell al Brown Harry B (Fay N) 3 (o) Brown-Kline Brown Ethel R (Mrs W L) tex wkr Bibb Mfg Sign Co) h 104 Beuna Vista dr Co r 151 2d Brown Harry T (Della) overseer Payne Mill Brown Eug (c) r 258 4th (V) h 158 Comer ter (PM) Brown Eug C cigars 453 2d r 431 Carling Brown Hartridge B (Ella K) (o) carp h 307 Brown Eug C Jr slsmn Maxwell Bros Furn Co r 476 College apt 3 Brown Eug D (Cora G) (o) condr So Ry b 203 Ridge (I) Brown Eug J (c; Mary) bellmn Hotel Southland r 226 Orange (308) Log Cabin dr Brown Harvey lab So Crate & Veneer Co Brown Hattie (c) (o) h 152 1st (V) Brown Hazel cook C B Grace Brown Hazel (c) elev wn Central Hotel r 703 Clinton Brown Helen (c) r 421 e 2d (EM) 154 Baldwin's and Telegraph's Brown Henry (c) r 1239 Dempsey Brown Henry (Ethel) emp Atlantic Ice & Coal Co h 310 Center (EM) Brown Henry (c; Minnie) hlpr r 113 Powell Brown Henry (c; Collis) lab h 329 (237) Di- vision Brown Henry (c; May) lab Macon Cooperage Co h 525 Gilmer Brown Henry (Bertha) 2 lab h 405 Madison (V) Brown Henry (c; Gussie M) 2 lab h 4 Ross St pi Brown Henry E emp C of Ga Ry Brown Hodge B (Dora) 1 (o) h 201 (526) Clerks la Brown Homer F (Lois H) elk Bibb Mfg Co h 284 College Brown Hoyt slsmn J W Burke Co r 140 Mag- nolia Brown Brown Ida Ida B(c1 )(cd)omr r 822 Hurley la 112 Phillips la Brown Ida M (c) prin Cressville Sch r 149 2d av (V) Brown Ina C (wid P M) h 315 Bond Brown Irene (c) 1 dom h 149 Sycamore (V) Brown Irene Mrs slswn Burden Smith & Co r 232 Georgia Brown Isaac (c; Roberta) h 214 Short St la (EM) Brown Isaac E (Eva) 4 carp Proctor & Gam- ble Mfg Co h 2003 Broadway Brown Israel (c; Jessie M) 2 r 1055 Pio Nono Brown J Benj student r 128 Tenney (SM) Brown J Frank hse phys Middle Ga Hosp h 722 Spring Brown J Frank Jr (Frances J) mgr Economy Auto Stores Inc h 107 Rogers Brown J Henry soft drinks Central City Pk r do Brown J Holland (Mary) 1 sec-treas Piggly Wiggly Inc h 208 Clisby pi Britt J Melton (Irene E) 2 pntr h 101 Ruther- ford (SM) Brown J O lab The Standard Tool & Handle Co r Masonic Home rd Brown J Walter (Helen) 1 slsmn h 250 Jeff Davis (SM) Brown Jacob (c) dr Dixie Dairies Brown James (c; Marie) r 209 (305) Camp- bell (SM) Brown James (c; Sara) 1 r 533 (415) Grant Chapel al Brown James r 867 New Brown James (c; Emma) h 77 (174 Oliver (SM) Brown James (c; Sara) h 6 Spring Brown James (c; Mary) dr Kinnet-t-Odom Co h 30 (27) Reid Brown James (Nina) emp Happ Bros Co r 1148 (2) Milledgeville rd Brown James (c; Jessie) 4 (o) lab h 210 3d (U) Brown James (c; Eliza) 1 (o) porter King- man & Everett h 138 (141) Sycamore Brown James C (c; Gertrude) lab C of Ga Ry h 531 e 1st (EM) BROWN JAMES E (c; Lillie) Dean Central City College h 1035 CUnton rd Brown James E student r 666 Hemlock Brown James F Jr (Emily M) 1 (Brown & Groover) h 573 Orange Brown James R student x 154 Oakland Brown Janie (c) maid r 115 Gibson Brown Jerry N (Lois) 1 tex wkr Bibb Mfg Co h 214 Jackson Brown Jessie G (Frances) 1 sta atndt Gulf Re- fining Co h 124 Cole Brown Jesse W student r 472 Beech Brown Jessie (c) r 6 Bartlett Brown Jessie student r 1355 Edgewood Brown Jessie (c) tchr r 404 Broad Brown Jewell Mrs marker Snow's Ldry r 160 Nelson Brown John (c; Hattie) h 317 Gilmore Brown John (c) h 118 Rockhill la Brown John (c; Eula) carder Bibb Mfg Co r 118 (133) N Holt Brown John (c; Lavinia) chauf 2501 Forsyth rd Brown John (c) emp F O Schofield r 8 (757) Sparks al Brown John (c; Pearl) emp So Ry h 113 4th (U) Brown John (c) hlpr Miller Bros r 703 Clinton Brown John (c; Hath) hlpr Macon Paper Co h 117 Lynwood (V) Brown John (c; Mary) 2 lab Willingham S & D Co h 305 e 2d (EM) Brown John (c; Ora L) plmbr h 703 Clinton Brown John B (c) (The Tavern) r 105 (44) Linden Brown John D mgr S H Kress & Co h 533 Orange Apt 17 Brown John F (Anna) (o) mech So Crate & Veneer Co h 170 (140) Oakland Brown John H (Mabel) 6 steel wkr Taylor Iron Wks h 1917 2d Brown John L (c; Cora Lee) 3 lab h 453 Mon- roe (V) Brown John W (Myrtle) 5 emp So Ry h 128 Tenney (SM) Brown Jordan (c; Mary) lab City Scavenger Dept h 7 Bartlett Brown Joseph (c) r 527 Gilmer Brown Jos (c) cook 3604 Houston Brown Joseph (c) delmn W C Butler r 204 An- tioch rd Brown Joseph (c) delmn Bennett & Co r 522 Calhoun Brown Joseph (c; Rebecca) 3 hlpr So Crate & Veneer Co h 5 Woodliff Brown Joseph (c) lab Atlantic Ice & Coal Co Brown Joseph (c; Lillie) 1 lab h 8 Cheatham al Brown Joseph (c) lab r 109 (678) Stripling al Brown Joseph (c; Emma) tex wkr Payne Mill h 126 (209) Orchard Brown Joseph H (Maude) 1 (o) pntr Ga Pow- er Co h 136 Piedmont (SM) Brown Joseph J (c) r 507 (508) Elbert Brown Julia K (wid F L) 1 drsmkr h 526 Edgewood Brown Julia (c) maid Mrs Cecile Cassidy r 239 3d (V) Brown Julia (Mrs W V) sten Dunlap-Peeler Hdwe Co r 284 College Brown Juliette A (c) tchr B S Ingram Sch r 152 1st Brown Julius S (Nina D) policemn r 757 Mont- pelier Brown Kate (c) h 43 Harris Brown Kath (wid J G) h 472 Beech Brown Kath (c) maid Middle Ga Hosp r 117 Lynwood (V) Brown-Kline Sign Co (H B Brown F W Kline) 511 Mulberry Brown Laura (c) r 122 (12) Hudson Brown Laura (c) lndrs h 5 Buckner al Brown Lawrence (c) lab Mansfield Dray Lines Co Brown Lawrence J bkpr Irby Bros Inc r 165 2d Brown Lawyer (c; Eliz) h 504 (603) Henrietta (SM) (PM) Brown Lee tex wkr Payne Mill r 95 Green 1935 Macon City Directory 155 Brown Lee A emp Am Optical Co r RD Bloomfield rd Brown Lemon T (c; Jennie A) h 227 Roosevelt (V) Brown Leo (c; Bertha) tex wkr Bibb Mfg Co r 10 Short (EM) Brown Leon C (Mary E) 2 (o) sec-mgr Birdsey Flour Mills h 1201 Ridge (I) Brown Leon O (Minnie L) (o) gro 2015 Vineville h 101 Marshall (CP) Brown Lessie (c) 3 r 124 Bright al Brown Lessie B (c) lndrs Crescent Ldry h 5 Lennox la Brown Lewis M emp C of Ga Ry Brown Lewis M (Macon Pleating Co) h 620% Cherry Brown Lillian (c) r 133 Jones Brown Lillian (c) cook J M Hirsh r 156 Guern- sey la Brown Lillie (c) r 103 (127) Curds al Brown Lillie (c) 817 Elbert Brown Lillie (c) cook R L Anderson r 112 (282) Amos (V) Brown Lillie (c) instr Central City College r 1035 Clinton rd Brown Lillie M (c) nurse r 318 (316) Monroe (V) Brown Lina (c) r 237 Middle (V) Brown Lincoln (c) lab C of Ga Ry Brown Lizzie (c) 4 r 611 Shoals al Brown Lois H (Mrs H F) sec W A Williams r 284 College Brown Lonnie M (Velma) 6 h 1325 3d Brown Louella (c) cook J A Greene Brown Louis (c; Beatrice) r 415 Bay Brown Louise (c) r 101 (22) Elizabeth (SM) Brown Lucille (c) cook N S Jones r 219 5th (V) Brown Lucile (c) maid Mary S Platt r 455 Monroe (V) Brown Lucius (c; Florence) lab Jeffreys-Mc- Elrath Mfg Co r 231 Riley (CP) Brown Lucy (Artistic Beauty Shop) r 139 Daisy pk Brown Ludie (c; Magnolia) lab h 3 City Hall la Brown Luella tchr h 822 Orange Brown Lula Mae (c) r 342 Gilmer Brown Mabel S (Mrs J L) nurse City Bd of Health r 2908 Forsyth rd Brown Mack (c) r 819 Fort Hill Brown Mack (c; Zola) 1 lab h 779% Reynolds al Brown Mada student r 472 Beech Brown Madison L (Verta) 1 trav slsmn r 620 Pine Brown Maggie (c) r 1016 Ocmulgee Brown Maggie C Mrs opr Happ Bros Co res Dry Branch Ga Brown Malcolm H r 203 Ridge (I) Brown Mann (c) lab Macon Cooperage Co Brown Margt (c) r 219 Jordan's al Brown Marg r 620 Pine Brown Margt Mrs 1 coir Macon Teleg r 1328 2d Brown Marie (c) maid r 209 (305) Campbell (SM) Brown Marie (c) maid J W Armstrong h 317 Jackson Brown Marie opr Freeman's Beauty Parlor r 760 New Brown Marie student r 128 Tenney (SM) Brown Marion r 401 College Apt 8 D Brown Marshall (c; Corine) 1 emp Indepen- dent Ldry h 220 Hazel Brown Martha (c) dom h 1127 (952) Broad Brown Martha (Mrs W H) tex wkr Happ Bros Co r 276 Ell (SM) Brown Martha R treas Mercer Univ r 472 Beech Brown Marvin (Louise) 1 r 110 Ayers (B) Brown Marvin student r 129 (163) Parkwood (B) Brown Marvin M (Nora) 2 emp Go Power Co h 1165 Milledgeville rd Brown Mary (wid Jos) r 1 Atlantic Village Brown Mary (c) 1 r 612 Broad Brown Mary Mrs 2 r 314 Cutters Green (EM) Brown Mary (wid J H) r 9 Dessau pi Brown Mary (c) 1 h 122 (12) Hudson Brown Mary (c) 1 r 409 (407) Ward (V) Brown Mary (c) r 178 5th (V) Brown Mary (c) cook W A Yoeman r 112 Long St la (SM) Brown Mary (c) cook B L Fetner r 455 Mon- roe (V) Brown Mary (c) maid Union Dry Gds Co r 160 College Brown Mary (c) 4 maid h 276 Madison (V) Brown Mary B sten N Y Life Ins Co r 281 Orange Brown Mary E slswn H L Green & Co r 423 New Brown Mary I (wid F M) h 872 Hillyer Brown Mary M student r 1328 2d Brown Mary W social serv wkr Bibb Mfg Co h 221 (210) Clinton Brown Mat (c; Ludella) h 100 (212) Book- er's al Brown Mattie (c) dom r 165 Hazel Brown Mattie (c) maid Crane & Co r 522 e 2d (EM) Brown Maude (Mrs M W) sten Macon Type- writer & Ofc Sup r 474 Orange Apt 2 Brown Maxie (wid C B) r 767 Poplar Brown Maynard W (Maude W) 1 sta opr Shell Petroleum Corp h 474 Orange Apt 2 Brown Millie (c) 3 r 410 (557) Henrietta (SM) Brown Milton emp F S Royster Guano Co Brown Milton (c) emp Bibb Mfg Co h 2 Bar- field Brown Mingle B (c; Fannie) 2 emp Taylor Iron Wks h 1071 Coleman's la Brown Minnie (c) h 228 Hurley la Brown Minnie (c) cook W E Ryals r 113 Pow- ell Brown Missouri (c) r 99 (116) Forest (V) Brown Mittie (c) h 818 Ash Brown Monroe (c; Fannie) (o) h 217 Calhoun Brown Nan (c) cook W W Merritt r 522 e 2d (EM) Brown Nancy (c) h 140 (141) Middle (V) Brown Naomi (wid W N) r 1165 Milledgeville rd Brown Napoleon (c) r 1239 Dempsey Brown Neill H (Kate M) meat ctr Leaptrot's Mkt h 3319 Houston (SM) Brown Nellie r 217 Broadway Brown Nettie M (c) cook L H Wright r 21 Virgin la Brown Ola (wid C S) emp Macon Pleating Co r 620% Cherry Brown Ola (c) h 249 5th (V) Brown Olin (c) lab Macon Trans Co r 289 1st (V) Brown Oilver (c) r 516 Hammond Brown Ora (c) lndrs Crescent Ldry r 703 Clin- ton Brown Oscar (c) tester Bibb Mfg Co Brown Oscar E (Mary B) (o) h 281 Orange Brown Ossie (c; Mattie) lab So Crate & Ve- neer Co h 110 Harris la Brown Otto (Eunice) 1 r 618 Elm Brown Pauline (c) lndrs r 522 Calhoun Brown Pauline (c) lndrs r 211 (115) Moore la Brown Pearl Mrs 1 r 46 Brigham (PM) 156 Baldwin's and Telegraph's Brown Pearl (c) r 317 Jackson Brown Pearl (c) dom R L Fulghum r 522 e 2d Brown Pearlie (c) 2 lndrs h 6 Bartlett Brown Peggy r 457 Oak Brown Perry L (c) dom h 422 Northern Brown Peter (c; Mary) lab James Lbr Co h 101 Mulberry Brown Pope M (Mildred A) mach Taylor Iron Wks r 106 Ponce de Leon Brown Queen (c) cook L W Snyder r 1012 El- bert Brown R Lawson (Vonceille) 1 (o) slsmn Sparks Mtr Co h 341 College Brown R Malcolm (Harriett) 1 plmbr r 215 Carling Brown Ralph elk FERA r 963 Cherry Brown Randall (c; Amanda) h 226 Orange Brown Rena (c) maid Geo Lumpkin Brown Reese (c; Winnie) h 112 Ash Brown Richd r 551 Arch Brown Rich (c) lab Cherokee Brick Co Brown Rivers H r 165 2d Brown Robt (c) r 160 College Brown Robt (c; Cora) h 51 Fordville la Brown Robt r 244 Washington Brown Rob't (c; Sophie) delmn Melton Gro Co r 435 Cedar (U) Brown Robt (c) (o) emp P O h 605 Fort Hill Brown Roberta (c) lndrs h 111 Short la Brown Rosa (c) maid r 1 Violet av Brown Rosa L (c) 2 h 75 New Brown Rosa L (c) cook D W Barton r 320 Maple Brown Rosa L (c) 2 lndrs h 120 Broadway Brown Rosa L (c) maid M P Jackson r 1159 Oglethorpe Brown Rosa M (c) lndrs r 7 Bartlett av Brown Rosetta (c) cook h 104 (22) Davis al (EM) Brown Ruby (c) student r 105 (107) Brief (V) Brown Ruby opr Happ Bros Co r 224 (124) Balkcom Brown Rufus (c) carp G G Hardeman Co r 205 (358) Craft Brown Ruth opr Happ Bros Co r 224 (124) Balkcom Brown S Franklin (Lula) 2 tex wkr Atlantic Mill h 233 Roff Home Brown Sami O (c; Emma) 1 hlpr So Crate & Veneer Co r 239 Woodliff Brown Sanders (c) emp Vineville Dog & Cat Hosp r 667 Hazel Brown Sarah (c) dom r 189 Davis al Brown Sarah (c) r 233 Gilmer Brown Sarah (c) h 317 Harris la Brown Sarah (wid D A) r 314 New Brown Stella (c) r 109 May (U) Brown Susie (c) 2 h 124 Jones Brown Susie r 244 Washington Brown Sylvester (c; Eva) hlpr So Ry h 116 5th Brown Thos (c) (o) h 830 (826) 3d (V) Brown Thos (c; Queen) emp W C Scott h 1012 Elbert Brown Thos (c) jan Bateman Co r 2 Barn- hart's Bottom Brown Thos (c; Addie) 2 lab C of Ga Ry h 707 (605) Prince (SM) Brown Thos (c) lab City Scavenger Dept Brown Thos E (Maude M) (o) mach C of Ga By h 3038 Houston (SM) Brown Turner (c; Roberta) 2 h 535 Grant Chapel al Brown Turner (c; Maggie) lab h 1047 Pio Nono Brown U Iverson (Effie) 4 hlpr h 104 (105) Balkcom Brown Ulysses (c) h 134 Moccasin Slide Brown Undine sten Ga Loan & Trust Co r 1219 Vineville Brown Vastie (c) cook Mary Biddy r Clemons la Brown Verlene (c) r 124 Bright al Brown Vesta (c) dom J W Goins Brown Victoria (c) student r 111 Shoals la Brown Viola (c) sausage mkr T & T Pkg Co Brown W H Mrs opr Happ Bros Co r 128 Ten- ney (SM) Brown W Harrison (Martha L) emp Standard Paper Co r 276 Ell (SM) Brown W Merrell (Delores) 2 (o) meter engr Ga Power Co h 120 Lawton Brown W Morris (Sarah) 1 (o) h 111 Florida Brown W Ralph (Ethel K) 2 elk P O h 321 1st Brown Walter (c; Hattie) lab Jaques & Tins- ley h 443 Flanders Brown Walter G (Mary E) 1 stock elk Adams Mfg Co r 613 Arch Brown Walter R (Ruby L) lab City of Macon r 125 Rutherford (SM) Brown Walter V (Julia) h 284 College Brown Wiley C (Lillie) 2 swtchmn So Ry h 2001 Broadway Brown Wm (c) r 556 (502) Chappell (SM) Brown Wm (c; Lillie) h 628 Hammond Brown Wm (c; Maggie W) h 101 Neal (V) Brown Wm (c; Pearline) 1 emp Piggly Wig- gly h 712 Hazel Brown Wm Burgess John (Annie S) miner h 165 English Ridge (I) Burgess Lillian mach opr Happ Bros Co r 821 Burkett Kath sch tchr Union Sch r 542 Ridge Mulberry (I) Burgess Malcolm S (Nell S) emp Ga Kaolin Burkett Lillie (Mrs J B) r 425 College Co h 114 Corbin (V) Burkett Lizzie M (wid L W) r 115 Lamar Burgess Morris (Mary) 3 miner h 145 Sum- (V) mit Burkett Louise tel opr County Relief Admn Burgess Walter N (Ora) 1 emp Bibb Mfg Co r 209 1st r 212 Adams Burkett Ora E (Addie) civ engr Govt h 358 Burghard Annie M r 1018 Vineville Spring BURGHARD-CONNALLY (R Coke Connal- Burkett Sara (Mrs W A) sten r 425 College ly), Funeral Directors 718 Cherry--Tel Burkett Sue (c) maid Hotel Lanier r 109 (205) 1627 (See front cover supp, page 86 and Elliott Cards BD) Burkett Wm A (Sara) mech Standard Oil Co Burghard Cora tchr Virgil Powers Sch r 341 r 425 College Hardeman Burkhalter Elma W (Mrs L H) elk City of Burghard Francis tchr Lanier High Sch for Macon r Rivoli dr Boys r 341 Hardeman Burkhalter Laris H (Elma W) agt N Y Life Burghard Lucia E (wid L H) (o) h 115 Hines Ins Co r Rivoli dr ter (V) Burkhalter Natha L (wid O J) 3 h 3043 Hous- Burghard M Frances (wid Aug) h 341 Harde- ton man Burks G Cecil (Myrtle) tchr Lanier High Sch Burghard Minnie R r 1018 Vineville for Boys h 511 (507) e Napier Burgin Spond (c) lab So Ry h 83 Cheatham al Burks Thelma Mrs 1 opr Freeman's Beauty Burke Annie (wid A A) (o) h 1507 3d Salon r 240 Ell (SM) Burke Beulah (wid E L) (o) opr Adams Mfg Burleigh Peter S (c) (o) farmer h 106 Key Co h 102 Nelson (SM) (U) Burke Cynthia r 1709 3d Burleigh Robt (c; Della) (o) h 119 Key (U) Burke Dora (wid H A) r 518 Napier Burley Lumpkin (c; Mamie) lab h 105 (656) BURKE EDW W JR (Lora H) 1 (o), V-P J Peacock W Burke Co, h 571 Ingleside (I)--Tel 5068 Burman Geo (c) lab Proctor & Gamble Mfg Burke Effie B (wid E W) h 3202 Forsyth rd Co Burke Ethel r 1709 3d Burnam Alice (c) maid J R Scandrett r 107 Burke Eula W (wid Abram) r 2501 Forsyth Elm rd Burnam Essie (c) maid Nevarro Apts r 251 Burke Geo (c) h 260 Hall 5th (V) Burke Henry (c) lab C of Ga Ry h 3 (r) Wa- Burnam Fannie (c) 2 cook Brown Wimberly terville rd h 307 (332) North Burke Huge A h 710 3d Burnam J W (c) emp Bibb Mfg Co Burke J R dr Southeastern Greyhound Lines Burnam Lola (c) maid M B Medlock r 101 (1) 121 Nelson Alabama BURKE J W CO, W F Walton Pres-Mgr, E Burnell Fred (Henrietta) waiter Geo Poulos h W Burke Jr VP, W T Bragg Treas, W W 456% Mulberry Shepherd Sec, Stationery, Office Supplies, Burnes Chas C hlpr City Welding Co r 257 Printing and Binding 406 Cherry--Tels 74-- 75 (See side lines page 95 and card BD) Heard Burnes James C (Lizzie M) 6 (o) eng C of Burke James C student r 854 Mulberry Ga Ry h 257 Heard (SM) Burke John (c; Dora) h 233 Collins pi Burnett Albert (wid C Y) 1 h 22 Atlantic Vil- Burke John (c; Daisy) firemn City Bd of Water Comrs r 18 Parker lage Burnett Charlotte (wid E C) r 249 Belmont Burke John (c) lab r 403 Craft la Burnett Chas (c) cook Busy Bee Lunch Burke John W School Cynthia Weir prin 2133 Burnett Chas I (Mollie) (o) h 107 Shari (SM) 2d Burnett Chas M (Alice) slsmn Coca-Cola Btlg Burke Leila G Mrs h 854 Mulberry Co h 116 Gordon 1935 Macon Qlty Directory 161 Burnett Chas W prsmn Lyon, Harris & Brooks Burney Henrietta (c) 1 cook J H Baldwin r r RD 2 113 Neal's (V) Burnett Erastus D (Bessie) 1 barber Palm Burney J C (c; Magnolia) h 227 Moughon Barber Shop h 281 Washington (V) Burnett Prances emp Atlantic Cotton Mills r Burney James (c) emp Busy Bee Lunch Room 22 Atlantic Village r 458 Bay Burnett Fritz r 22 Atlantic Village Burney James (c; Savannah) lab Birdsey Burnett Geo emp Atlantic Cotton Mills r 22 Flour Mills h 86 Bay Atlantic Village Burney James A shpg elk Nat Biscuit Co r Burnett Geo (c) lab r 559 Cheatham al 303 Napier Burnett Gordon (c) cook Smithy's Barbecue BUrney Jerome E (Burney Bros Co) r 145 Lunch North Burnett H C Mrs opr Happ Bros Co r 1674 3d Burney Joseph (c) lab h 150 (148) Bowman Burnett Harry Macon supt Ga Fla Mtr Lines Burney Linda M Mrs br mgr Piggly Wiggly r 224 Georgia h 305 Napier Burnett Horace (c) lab Buckeye Cotton Oil Bros Co r! 271 College Co Burney Luther (Lillian) 1 emp Bibb Mfg Co Burnett Ira (c) lab C of Ga Ry h 1144 Broad- h 426 Jackson way Burney Louis P (Virginia) 2 slsmn Burney Burnett J Phelman lawyer 15 Washington Burney Mamie (c) 4 h 218 Division Bldg r 512 Church (EM) Burney Margt r 905 Cherry Burnett J S emp Atlantic Cotton Mills r 22 Burney Margt student r 303 Napier Atlantic village Burney Martha C (wid J H) (o) h 1016 Clinton Burnett James (c) cook Busy Bee Lunch r rd (EM) 458 Bay Burney Mollie (c) cook r 120 (20) Tinsley la Burnett Louise (c) lndrs r 308 (260) Bowman BUrney Nell (Mrs A E) 1 r 104 Cleveland (V) Burnett Luke (c; Louella) 3 (o) emp F S Burney Rachel (c) h 15 (752) Steins al Royster Guano Fcty h 308 (260) Bowman Burney Roberta (c) emp Bibb Mfg Co r 161 Burnett Mamie (c) cook E I Linch r 218 Di- College vision Burnett Mamie (c) hoe hd Idle Hour Nurser- Burney Sadie (c) 3 h 344 Hammond Burney Walter (c; Mary) 7 lab h 101 Telfair ies r RD 1 Burney Wm (c) r 458 Bay Burnett Paul elk Chapman's Pharm Washington r 281 Burney Wm (c) r 126 (3) Cedar (U) Burney Wm (c) Mamie) h 13 (113) Malloy's Burnett Pauline W (wid Louis) 1 night chf opr So Bell Tel, Co r 168 High al Burney Willie (c) lab r 305 e 2d (EM) Burnett Virgil M coir H T Tabor r 512 Church (EM) Burnett Wm (c; Gussie) lab r 135 Hazel Burney Willie M (c) r 251 5th (V) Burnham Hilda E cash Lerner Shops r 3044 Houston Burnett Wm R (Elmer T) slsmn Jax Brewing Co h 300 Anthony rd Burnham James W (Myrtice) 1 (o) mgr Am Optical Co h 607 Winton Burnette Chester A (Eliz) 2 h 620 2d Burnham Richd E C (Carrie G) (o) mach C Burnette Emma L r 341 Carling Burnette Geo S (Clyde) slsmn McCord Mtr Co of Ga Ry h 3034 Houston Burnham Richd W r 3034 Houston (SM) h 117 Brentwood Burnette Gorman r 311 Bond Burnley John L (Eulie) 5 mech Ga Power Co h 340 Central (SM) Burnette Henry waiter Mitchell Williams Drug Co r 1921 2d Burnette Homer L emp C of Ga Ry Burns Alice (c) r 203 Hazel Burns Amy (c) 2 lndrs r 400 Peacock Burns Annie L (wid R E L) r 765 Pine Burnette J Chester (Annie M) 2 slsmn Burden Smith & Co h 209 West End Burnette James A mgr Kingman-Burnett Burns Boot Shoppe Mark Silvers pres Mrs Flora Funkenstein v-p 402 Cherry Burns Chas (c) student r 239 Tindall (SM) Stables res Gray Ga Burnette Mary (c) emp Independent Ldry Co Burnette Vallie (wid H C) 1 mach opr Happ Bros Co r 1921 2d Burnette Wm D (Hallie M) 2 sta opr Stand- Burns Dollie (wid H J) r 125 Piedmont (SM) Burns Estelle (c) 3 r 1304 (384) Dempsey Burns Ethel (c) cook P E Tyler r 126 e Ell Burns Gladys (Mrs H C) supv FERA Sewing Room r 444 New ard Oil Co h 103 Montpelier Burney Andrew (c; Estella) h 120 (20) Tins- ley la Burney Andrew (c) emp The Clinic r 126 (3) Cedar (U) Burney Bertha (c) dom r 228 Hurley la Burney Bookert (c) r 108 (3) Cedar (U) Burney Bros Co (J E Burney) prod 453 5th Burney Claude (c) barber Brown's Barber Shop h 598 Fort Hill Burns Henry B (Ludie) 5 wtchmn Snow's Ldry h 406 Fort Hill Burns Henry C (Gladys) coir A G Rhodes & Son h 444 New Burns Henry K Jr emp Bibb Mfg Co BURNS J CRAWFORD JR (Hernia B), (Par- cel Delivery Co) h 327 Boulevard--Tel 5683 Burns J D (c; Ethel) 1 emp Dempsey Hotel h 126 e Ell Burns J Harry (Mary) (o) dep elk City Court Burney Cleo (c) cook C L Park r 119 Middle Burney Crawford (c; Pleasant) (o) h 230 Grant (V) of Macon h 121 Fort Hill Burns Jesse (c) h 1304 (384) Dempsey Burns Joseph (c) r 400 Peacock Burney Crawford Jr (c) r 230 Grant (V) Burns Julia maid G F Mitchell Burney Ella M (wid R E) (o) h 145 North Burns Kenmore (Florence) pres-genl mgr (NH) Kenmore Burns Inc h 431 (409) Forrest Burney Bbsie M (c) 2 maid M C Atkinson r 337 Earnest Burney Estelle (c) cook r 120 (20) Tinsley la Burney Eva (c) 1 cook r 251 5th (V) (V) Burns Kenmore Jr (Mary O) slsmn Kenmore Burns Inc r 431 (409) Forrest (V) Burns Kenmore Inc Kenmore Burns pres-genl mgr real est 157 Cotton 162 Baldwin's and Telegraph's Burns Ludie (Mrs H B) opr Happ Bros Co r BUrts M Eugene (Viola) (o) trav slsmn h 109 406 Fort Hill Lamar (V) Burns Margt (wid Egan) r 203 Clisb'y pi Burts M Jennille r 109 Lamar (V) Burns Mercer Clara) 1 atndt Brad Wall Serv Burts Milton E (Mildred) 1 trav slsmn r 109 Sta h 345 Central (SM) Lamar (V) Burns Mildred student r 467 Monroe (V) Burns Murray (c; Winnie) 1 h 103 (177) De Busbee Ada M (wid K D) (o) h 2838 Houston Borde (SM) Busbee Allen C (Sara L) 1 Lt CPD h 2635 2d Burns Raymond (c; Annie) 1 pntr h 225 (122) Busbee Benj O (Ethel) 1 tex wkr Willingham Duval Mills h 221 (22) Holt (NHts) Burns Robt B (Bertha) h 823 Main (EM) Busbee Bernice Mrs r 206 Jeff Davis (SM) Bruns Robt B Jr r 823 Main (EM) Busbee Cullen student r 2635 2d Burns Robt L (Mabel) elk Ga Power Co h Busbee Eugenia emp Carling Tile Co r 718 2d 568 Boulevard (NH) Busbee Floyd student r 221 (22) Holt (NHts) Burns Sidney L (Lulie) 1 pres Ga Mtr Finance Busbee Rosa opr Bibb Mfg Co Co h 113 Calloway (V) Busbee Sara C slswn F W Woolworth Co r Burns Susie (c) r 400 Peacock 2635 2d Burns Thos (c; Bessie) r 181 (325) Nuss- Busbee Tavea sten Burden Smith & Co RD 3 baum Bush Albert T (Vennie) 1 h 2220 Broadway Bums Walter r 264 Main (EM) Bush Bessie Mrs r 113 (215) Mill Burns Wm (c; Malinda) 3 lab h 400 Peacock Bush Chas R slsmn Maxwell Bros Furn Co r Burns Wm (c) student r 239 Tindall (SM) 613 Plum Burns Wm C (Mamie C) 2 condr So Ry h Bush Clara (c) h 308 Clarks (V) 669 New Bush Clarence R (Sarah M) 1 (o) acct L D Burns Wm J (Novelar) emp Tatnall Sq Press- Baggs & Co h 1305 Vineville ing Club r 444 New Bush Earl r 2108 Broadway Burns Winnie (c) maid Dempsey Hotel r 103 Bush Edw D (Mary) 4 h 1880 3d (177) DeBorde (SM) Bush Ella (c) (o) h 425 e 2d (EM) Burnside John J (Bertha) emp Bo Ry r 1335 Bush Essie (Mrs Howard) emp Happ Bros Co 3d r 513 Main (EM) Burntley Wesley (e; Leola) 1 emp Cherokee Bush Geo T (Bell) 1 inspr So Ry h 2108 Brick Co h 103 (220) Blount Broadway Burr Cora C bkpr Y W C A r 307 Orange Bush Grady r 2108 Broadway Burr Geo W (o) (Hotel Lanier News Stand) Bush Henry C (Jeanette) emp r 611 2d h 307 Orange Bush Hewey r 2108 Broadway Burr Joseph (c) lab Proctor & Gamble Mfg Bush Howard (Essie) r 513 Main (EM) Co Bush Jas H r 1880 3d Burrell Marion (c) 2 h 307 Clarks (V) Bush Jesse J wheel shop supv C of Ga Ry r Burris Edw D r 1927 2d 568 1st Burris Tullie (Florine) 2 r 316 Chappell (SM) Bush John L timber buyer Sherwood Lbr Co Burriss Chas C (Maude E) emp Met Life Ins r Mikado pi (Iynmore), Co r 254 New Bush John R r 1880 3d Burriss Maude E (Mrs C C) opr Happ Bros Bush Mary W tex wkr Payne Mill r 109 Co r 254 New Washington Apt 4 Burroughs Adding Machine Co O B Lewis Bush Opal student r 7 Hill Park mgr 613 Mulberry Bush Robt sawyer Sherwood Lbr Co r Mika- Burroughs Asa B (Mollie) 5 condr So Ry h do pi (Lynmore) 190 Oakland Bush T Gordon atndt Power Oil Co r 605 1st Burroughs Mattie (c) r 578 Monroe (V) Bush Thos J (Kye) h 7 Hill Park Burrows Marie lab So Crate & Veneer Co Bush Thos S (Laverne) (o) h 136 Hines ter Burrs Wm (c; Marie) 2 lab Birdsey Flour (V) Mill h 213 Elliott Bush Vennie ( Mrs A T) opr Happ Bros Co r Burrus F Edwin (Gertrude) 1 (o) carp h 324 2220 Broadway Carling Bush Walter T student r 7 Hill Park Burrus Claudia (wid G L) 2 r 615 (719) Log Bush Wm (Thelma) 1 lab r 204 Hightower Cabin blvd Burson Home E (Irene) (Vineville Drug Co) (SM) Bush Winona r 1880 3d h 102 Calloway (V) Burt Dow (c) barber Gertrude Smith r RD Business and Professional Women's Club Mrs Ellamae Ellis League pres, meets 1st and Robertson rd 3d Thurs 6:30 P M 200 Baconsfield (NH) Burt Eddie M (c) student r 320 Hazel Burt Geo D W reporter Macon Telegraph res Buskett Mattie W (c) h 811 Dempsey Bussell Wm A (Gertrude) slsmn h 912 Napier Bolingbroke Ga Bussell Wm A Jr r 912 Napier Burt Ola (c) lndrs r 301 Crisp Bussey Annie L (c) h 154 (243) Forsyth la Burt Oscar H furnace wrk r 325 (323) Dan- Bussey Dennis (c; Irene) 6 lab James & nenberg Kingman Lbr Co h 18 Turpin la Burt Oscar H (Helen) mech Holland Furnace Bussey Edw (c) emp Bay St Cash Gro r 18 Co h 315 Vine Burt Pearl (wid H C) tex wkr Willingham Turpin la BUSSEY HARLAN E (ALLENE) 1 (o), Sec- Mills r 325 (323) Dannenberg Treas Macon Shoe Co, h 229 Stanislaus cir Burton Blanche (c) 2 dom Paul Sanford h 146 (145) Sycamore (V) --Tel 2307 Bussey Henry (c) lab James & Kingman Lbr Burton Sara nurse 233 Bond Apt 2 Burton Wm (c) clo presser H A Spivey r 324 Ward (V) Co Bussey Marcus (Henrietta) flgmn So Ry r 218 Georgia Bussey Marion Y (Nell) 2 electrn r 1426 2d Burts Albert W coir Macon Gas Co r 109 La- Bussey Mildred student r 431 Jackson mar (V) Bussey W Parker r 431 Jackson 1935 Macon City Directory 163 Bussey Wm M (Mary A) hlpr h 431 Jackson Buster Bottling Co (R A McCarthy) Murray 111 Busy Bee Lunch (Margt Corr) 1007 Broad- way Busy Corner Lunch Room (Thos Travers) 865 Broadway Busy Corner Lunch Room (c) (Wm Lundy) 206 Industrial Home rd Butcher Albert E (Pearl) hlpr h 355 Walnut Butler Albert (c) asst D T Walton r 314 (326) 2d (EM) ' Butler Allen Y emp Ga Power Co r 369 1st Butler Chas (c) lab Cherokee Brick Co Butler Charles (c) porter Dougles Theater r 408 Monroe (V) Butler Chas S (c) soft drinks 151 5th h 409 Applewood (EM) Butler Clifford (c; Ethel) 2 lab h 202 Toombs Butler Danl F (Mary) 1 elk Dunlap-Peeler Hdwe Co h 722 Napier Butler Denver A 1 tr dr r 206 Hydrolia Butler Doris (c) r 307 Charles Butler Doris S (Mrs H) supv So Bell Tel Co res Walden Ga Butler Dorothy opr elk So Bell Tel Co r YWCA Butler Doshia (c; Rosa L) emp Massey Gin & Machine Wks h 218 Pear Butler E Wayne r 618 Montpelier Butler Earl W (Mary) 3 (o) judge City Court of Macon h 355 College Butler Edgar (c; Fannie) 3 lab C of Ga Ry h 104 Johnson (SM) Butler Edna (c) r 155 e Academy (EM) Butler Ella (c) h 519 (535) Maynard Butler Ellen (c) r 218 Pear Butler Emma (c) cook B C Thigpen r 731 Oc- mulgee Butler Emmett E (c; Lillian) phys r 314 (326) e 2d (EM) * Butler Ethel (c) cook D E McGregor BUTLER FANNIE, Ofc sec Macon Chamber of Commerce, res RD 3 Butler Flossie (c) r 155 e Academy (EM) Butler Frank (c) flgmn M D & S R R r 205 Orange Butler Frank (c; Celia) 2 lab h 318 Jackson Butler Gibson L (Jewell M) 1 farmer h 119 Lamar (V) Butler Guy civ engr Govt r 261 Bond Butler Harden (c) h 208 Coles al Butler Hattie (c) r 216 Garden Butler Hattie (c) r 103 (27) Tinsley la Butler Hattie (c) dom r 854 Hazel Butler Hattie (c) emp Happ Bros Co h 307 Charles Butler Herbert (Roberta) h 214 Cedar (U) Butler Ivey (c; Josephine) 4 carrier P O h 301 Patterson Butler James M (Kath) 2 (o) emp G S & F R R h 110 Piedmont (SM) Butler James M (Beadie J) 1 asst mgr W R Werden Co r 358 Spring Butler Janie (c) maid L S Malone r 434 O'Hara la Butler Jeffie (Mrs W H) smstrs Happ Bros Co r 161 Nelson (SM) Butler John (c; Annie) 2 lab h 7 Taylor al (EM) Butler Kath (c) cook J C Poole r 309 Hen- derson la Butler Lizzie (c) dom h 6 Harris al Butler Louis (c) r 409 Applewood Butler Louise (c) r 3 Chestnut la Butler Louise (c) r 220 Henderson (SM) Butler Mamie (c) maid h 408 Monroe (V) Butler Mamie E (c) drsmkr 20 Spring h do Butler Marie (c) h 119 Edgewood av Butler Mary H Mrs r 106 Park pi Butler Mary T Mrs sten Corbin Sup Co res Grey Ga Butler Matt (c; Janie) hlpr Carling Tile Co h 434 O'Hara la Butler Minnie H (c) (o) tchr Wheatley Sch h 314 (326) e 2d (EM) Butler Minnie L (c) maid Dempsey Hotel r 104 Johnson (SM) Butler Mitchell (c; Sylvia) (o) lab C of Ga Ry h 757 Fort Hill Butler Norman (c) lab C of Ga Ry Butler Ralph r 110 Piedmont (SM) Butler Ranee (c; Mae) emp Cherokee Brick Co h 220 Henderson (SM) Butler Ranee (c; Kath) lab r 309 Henderson la Butler Rendo E mech Adams Buchanan Mtr Co r 140 High Butler Rosa (c) cook F E Norris Butler Sami L (Roberta J) 1 dept formn Ma- con Teleg h 401 Montpelier Butler Thos J (Belle) (o) h 123 Lawton Butler Tommie W Mrs fum rms 253 Broad- way h do Butler Walter C (Ruth H) 2 gro 3011 Hous- ton h 535 Flamingo dr Butler Wm (c; Carrie) 7 h 103 Harris Butler Wm (c; Lou) lab Riverside Lbr Co Butler Wm (c) lab Standard Tool & Handle Co Butler Wm H (Jeffie) 2 auto mech Chapman Garage h 161 Nelson (SM) Butler Wm H (c) auto repr 1801 Broadway r 507 Pebble Butler Wm R tr dr r 206 Hydrolia Butler Wm R A (Frances) tr dr h 206 Hydro- lia Butler Willie B (c) emp Proctor & Gamble Mfg Co r 307 Charles Butt E Florence (wid R F) furn rms 224 Georgia h do Butt Eula (c) cook A M Goodman Butt John W solr Hill's Dry Clng Co r 224 Georgia Butt Moses D mach So Ry r 224 Georgia Butt N Frank agt Morgan & Morgan Ins Agcy r 224 Georgia Butt Richd L (Fay) 1 (o) asst genl frt & pass agt So Ry h 722 Ridge Butt Uriah (c; Jessie L) emp Hotel Dempsey r 117 Telfair (SM) Butts Olton (c)i r 489 Short al (V) Butts Amanda (c) 2 dom E H Forbes h 148 (146) Sycamore (V) Butts Beatrice (c) cook Butts B'enj (c; Mary) carp h 131 4th (V) Butts Christine (c) cook Andrew Thomas r 489 Short al (V) Butts Columbus (c) h 420 Elliott Butts Connie student r 271 Hardeman Butts Danl (c; Rosa) 3 lab h 621 Middle (EM) Butts David M contr h 271 Hardeman Butts E Chas (Mary) tex wkr h 119 Lee (EM) Butts Edith (Mrs W E) waitress Wisteria Cafe r 313 Peachtree Butts Eldna elk Jones, Johnston, Russell & Sparks r, 271 Hardeman Butts Eldna Y (wid David) r 271 Hardeman Butts Essie (c) Indrs r 524 Ross Butts Eug (c) lab r 220 Short la Butts Eula (c) dom r 642 4th (WH) Butts Evelyn(c)cook O H McAfee r 489 Short al Butts Frances (c) r 238 (240) Fargason (V) 164 Baldwin's and Telegraph's Butts Geoffrey I elk Snow's Ldry r 271 Har- Bynes Gibson (e) student r 971 Fort Hill deman Bynes Henry S (c; Sarah) 2 (o) editor Sun- Butts Geo D (Martha E) linemn So Bell Tel day Sch Wkr h 971 Fort Hill Co r 212 Ormand ter Bynes Henry S Jr (c) student r 971 Fort Hill Butts Hattie (c) r 170 College Bynes Mamie (c) sch tchr r 971 Fort Hill Butts John (c; Beatrice) 3 lah' Central Cot- Bynum Eliz (c) r 226 Elliott ton Oil Co h 620 Hammond Bynum Joel C (Annie B) (o) condr C of Ga Butts John H (c; Lula S) h 77 (145) Forest Ry h 103 Hill Crest (V) Byrd AD (c) r 264 Division St la Butts John W (c) lab Proctor & Gamble Mfg Byrd Addie (c) lndrs h 630 4th (WH) Co r 1406 Broadway Byrd Alex (c; Ella) lab h 110 Hazel Butts Joseph (c) lab Buckeye Cotton Oil Co Byrd Alice opr Happ Bros Co h 224 (300) Butts Jos (c) lab Willingham S & D Co r 211 Reid Powell Byrd Amos (c; Irene) 3 h 347 (443) Forest Butts Joseph N (c) r 620 Hammond (V) Butts Lonnie (c; Hattie) mech h 403 (441) Byrd Amy (c) cook H T Allen Forest (V) Byrd Bertha genl sec Y W C A r 257 High Butts Lovie M (c) cook C E Stokes r 527 Byrd Carrie (Mrs F E) opr Adams Mfg Co r Middle (EM) 117 Yates Butts Marsena (c) 2 maid H F Crawford h 489 Byrd Chas (c) r 422 Lawton Short al (V) Byrd Doras (Mrs W E) spooler Bibb Mfg Co Butts Mary (Mrs E C) emp Central Pecan r 14 Lake City (EM) Mfg Co r 119 Lee (EM) Byrd Elsie L (Mrs J M) bkpr Ga Caro Oil Butts Nathan (c; Lois) 4 emp So Cotton Oil Co r 112 Rutherford (SM) Co h 230 Edgewood Byrd Evelyn (c) lndrs r 402 (504) Maynard Butts Nina (c) cook R J Taylor h 157 Lin- Byrd F Clyde (Caroline) 1 printer Macon coln (V) Teleg Pub Co h 111 Ponce de Leon (SM) Butts Pharisee (c) cook B F Lyles r 1216 3d Byrd Ferdinand E (Carrie) emp C of Ga Ry Butts Robt (c) brklyr r 542 e 2d (EM) h 117 Yates Butts Sarah E (wid T L) repr elk So Bell Byrd Florence (c) h 223 Jordan's al Tel Co h 1435 2d Byrd Geo (c; Lucille) 2 lab C of Ga Ry h 502 Butts Walter E (Edith) 1 slsmn h 313 Peach- (129) Cowan tree Byrd Geo H (Nell M) 1 mech Monk's Garage Butts Walton (c; Lovie) 2 h 527 Middle (EM) h 109 Davis (SM) Butts Wm (c; Charity) 2 pastor Seventh St Byrd Georgia (Mrs J M) emp Bibb Mfg Co Baptist ch h 220 Short la 17 Lake City (EM) Butts Wm B (c) porter Union Bus Terminal Byrd Georgia (c) maid L J Lawrence r 84 r 157 Lincoln (V) (133) Forest (V) Buxton John N (Annie L) (o) emp McKes- Byrd H Paul emp C of Ga Ry son-Riley h 133 Rogers (V) Byrd Harry (c; Annie) 3 emp Bibb Mfg Co Buxton Raiford E (Lucile) 1 (o) price mn h 109 Simmons C-M-P Drug Co h 211 Rogers Byrd Hattie L (c) cook J B Harrison r Robert- Byars Beatrice (Mrs Raymond) opr Happ son rd Bros Co r 312 (310) Giles Byrd Helen Mrs 1 r 213 (159) Center (EM) Byars Frances (Mrs R L) opr Happ Bros Co Byrd Hiram V (Bessie) 1 h 117 Yates r 520 (552) Oglethorpe Byrd Howard A (Ruby) 1 electrn h 319 Clin- Byars Geo W (Della) lab h 520 (552) Ogle- ton thorpe Byrd Ida M (wid M A) opr Happ Bros Co h Byars Raymond (Beatrice) 1 opr Happ Bros 428 Main (EM) Co r 312 (310) Giles Byrd Jennie (wid E D) gro 236 (102) Virgin Byars Robt L (Frances) 1 cutter Happ Bros la (V) h do Co r 520 (552) Oglethorpe Byrd John (c) emp Bibb Mfg Co Byas Eug (c; Laura) 2 (o) elk W L Mathis Byrd John M (Georgia) 2 tex wkr Bibb Mfg h 305 Dure (U) Co h 17 Lake City (EM) Byas Garfetta E (c) r 112 Mitchell Byrd John T r 1531 1st Byas James (c; Cleva B) emp C of Ga Ry h Byrd Josephine (c) h 264 Division St la 224 Forest (V) Byrd Julius M (Elsie L) mech Monk's Gar- Byas Laura (c) emp Macon Coca-Cola Btlg age r 112 Rutherford (SM) Co r 305 Dure (U) Byrd Kate (c) dom L W Dunker r RD 3 Byas Roosevelt (c) r 112 Mitchell Byrd Harold atndt Flanagan's Camp r 112 Byce James (c) h 105 (218) Railroad Rutherford (SM) Byers Elbert (c) lab Atlantic Ice & Coal Co Byrd Leonard P r 1823 3d Byers Marvin student r 1157 Elm Byrd Lilia (c) cook Cozy Corner Cafe r 247 Byers Mary (c) cook T W Higgison r 2211 (225) 5th (r) Forsyth rd Byrd M Lilia (wid Clayton) 3 (o) h 112 Ruth- Byers Thos (c; Stella) 1 emp Willingham erford (SM) Mills h 226 (43) Virgin la (V) Byrd Mary (wid W C) r 909 New Byington Benj B barber Brockman's Barber Byrd Mary E (c) 2 dom Vineville h 103 (104) Shop r 205 Fulton (Lynmore) Amos (V) Byington H A Jr emp Rogers Inc r Y M C A Byrd Michl (Ethel) (o) Capt County Convict Byington James W (Margt) 1 slsmn Dr Pep- Force h 390 Clinton per Btlg Co r 421 Beech Byington John E (Ora) 2 mech Carling Tile Co h 1802 2d Byington Robt M (Lucile) mech Acme Weld- ing Co h 205 Fulton (Lynmore) Byrd Mildred Mrs r 217 Broadway Byrd Milton G r 428 Main (EM) Byrd Minnie (wid J F) r 111 Ponce de Leon (SM) Bynes Clara (c) sch tchr r 971 Fort Hill Byrd Oscar (Zelma) 5 tex wkr Bibb Mfg Co Bynes Emerson (c) student r 971 Fort Hill 1 h 6 Lake City (EM) 1935 Macon City Directory 165 Byrd Robt T (Annie) 1 (o) emp So Ry h 133 Maynard Byrd Sam r 224 (300) Reid Byrd Sami wtchmn McCook J W Lbr Co h 940 (942) Elbert Byrd Thos (c) carder Bibb Mfg Co Byrd Thos M (Viola) 2 lab h 1531 1st Byrd Velma r 117 Yates Byrd Walter C (Gladys) 2 emp h 909 New Byrd Will (c) lab C of Ga Ry Byrd Wm (c) emp Fort Hawkins Gro r 502 (129) Cowan Byrd Wm E (Doras) 2 tex wkr Bibb Mfg Co h 14 Lake City (EM) Byrd Wm H r 217 Carling Byron Ada (c) 2 h 14 (563) Witkowski's la Byron Henry L agt Penn Mut Life Ins Co r 468 Walnut Byron Lucy (c) 1 r 14 (563) Witkowski's la Byron Neely (c) cook Willingham S & D Co h 92 Bay Byron Wm (c) (Neely) lab C of Ga Ry h 28 Wall St la Byron Wm E (c; Dorsey M) hlpr C of Ga Ry h 354 Ash Cabiness Edw G slsmn Stewart Oil Co r RD 1 Cadle Geo (Gladys) 1 hide buyer G Bernd Co h 109 Emory (SM) Caesar Chas (c; Ida) tr dr S M Hilliard Dray Line h 216 Hilliard al Cager Andrew (c) h 2 Turkin Cagle Guy N (Marie) 2 formn C of Ga Ry h 810 Mulberry Apt 7 Cagle Guy N Jr student r 810 Mulberry Apt Cam Wm (c) h 568 (509) Chappell (SM) Calbert Lemon (c) cook Virgin Thomas r 209 (155) Center Calder H Allen (Irma) 3 h 865 Walnut Caldwell Albert (c) r 317 Green Caldwell Andrew L (Etta W) 2 carp h 417 (425) Forest (V) Caldwell Annie (c) r 110 Franklin Caldwell Bennett L (Nancy) 3 emp Bibb Mfg Co h 90-91 Green (PM) Caldwell C E condr r Terminal Hotel Caldwell Chas W mach r 607 2d Caldwell Clifford H (Kathleen) emp Jackson Wynn Co h 204 Hill Crest Caldwell Clifford H Jr student r 204 Hill Crest Caldwell Eva (c) 1 h 1 Violet Caldwell F B barber Com Barber Shop r RD 4 Caldwell Herbert G (Ella) 3 linemn Ga Pow- er Co h 760 Cherry Caldwell Howard r 293 Belmont Caldwell James C emp Willingham Mill r 418 Calhoun Caldwell James H repr Stanton Sound Serv r 204 Hillcrest Caldwell James L (Mary) (o) h 26 Melrose (B) Caldwell Kathleen sten H W Elkins r 204 Hill Crest Caldwell Lewis J (Velma) 1 electrn Ga Pow- er Co h 869 Mulberry Caldwell Mary (Mrs J L) gro 133 Bellevue rd r 26 Melrose (B) Cain (see also Kane) Cain Benj (c) bellmn Hotel Lanier r 318 (r) Forsyth Cain C S (Virginia) 1 opr Proeter-Gamble Co r 305 Center (EM) Cain Carl G (Rita D) 2 asst supt CPD h 206 High Cain Caro B emp Southland Knitting Mills r 623 Carling Cain Carrie (c) cook R D Bennor r 221 Haw- kins Cain Cicero S (Josephine) engr M D & S Ry h 120 Fort Hill Cain Edw (c) r 120 Wings Hills Cain Emma (c) lndrs h 9 Plant al Cain Emma K (c) maid Wesleyan C'onseva- tory r 256 Franklin Cain Ethel (c) r 336 Jackson Cain General (c) r 83 Bay Cain Hal C (Nanny B) 1 elk Ry Exp Agcy h 112 Cleveland (V) Cain Hosea B (Bernice) 2 mgr Vineville Packing Co r 608 Forsyth Cain Irene (c) 2 maid r 120 Wings Hill Cain James (c; Sallie M) 1 (o) h 111 Berth- dale dr (V) Cain Jean (c; Lee) 1 tex wkr Atlantic Cotton Mills h 123 4th (V) Cain Joseph (c; Corrie) 1 waiter Hotel La- nier h 56 Spring Cain Kath (c) dom C F Sheridan r 318 (r) Forsyth Cain Lee (c) cook John McCoy r 123 4th (V) Cain Lena (c) 1 ldry h 336 Jackson Cain Lillie M (c) h 32 (26) Reid Cain Louise (c) cook Jones Cafe r 336 Jack- son Cain Lynn (c) r 111 Berthdale dr (V) Cain Minnie (c) 2 h 713 (621) Prince (SM) Cain Paul G slsmn Burns Boot Shoppe r 623 Carling Cain Robt R (Sarah) emp Stroberg Body & Fender Wks h 209 Applewood Caldwell Minnie (wid B F) h 355 Flanders Caldwell Mozell r 114 Rose Pk Caldwell Nancy (Mrs B L) tex wkr Bibb Mfg Co r 90-91 Green (PM) Caldwell Nat mech Bibb Chevrolet Co Caldwell Nellie (c) maid J E Morgan r 112 (525) Craft (V) Caldwell Nellie E (Mrs O L) emp Happ Bros r 1371/j, Park pi Caldwell Otis L (Nellie E) 1 decorator Brown's Book Store h 137% Park pi Caldwell Ruth r 26 Melrose (B) Caldwell Ruth smstrs J N Neel Co r Bellevue rd Caldwell W C r 258 1st Caldwell Woodrow (Kathleen) 1 tex wkr Bibb Mfg Co r 913 2d Calhoun Acquilla (c; Lillie) 1 (o) farmer h 344 4th (U) Calhoun Andrew (c; Allene) 1 lab Sawyer Coal & Ice Co h 214 Walker la Calhoun Beatrice (c) lndrs Macon Hosp r 214 Church al (SM) Calhoun Bernice r 812 2d Calhoun Bertha (c) 1 h 304 Madison (V) Calhoun Bubber (c) lab r 810 (110) Crisp Calhoun Caldwell student r 865 Cherry Calhoun Chas (c; Lula) 1 hlpr Stewart Oil Co h 417 (328) Elizbeth (SM) Calhoun Clifford (c; Annie) firemn C of Ga Ry h 358 Ash Calhoun Clifford F formn Taylor Iron Wks r 305 College Apt 7 Calhoun Crisler D student r 113 Habersham Calhoun Early (c; Ella) 1 (o) farmer h 996 Montpelier Calhoun Edw (Emma S) welder h 976 Mont- pelier Calhoun Edw (c; Adeline) 1 tr dr h 810 (110) Crisp Calhoun Eug (c) jan Alexander Sch No 1 r 1272 Cheatham Calhoun Ellen (c) 2 h 1011 Elbert Calhoun Emma (Mrs Edw) slswn So Dry 166 Baldwin's and Telegraph's Gds Co r 976 Montpelier Calhoun Emma (wid S J) smstrs 812 2nd h do Calhoun Ernest J (c; Lula) (o) pastor Liz- zie's Chapel h 994 Montpelier Calhoun Fredk flgmn C of Ga Ry r 812 2d Calhoun Florrie (c) sch tchr r 1018 Main (EM) Calhoun Geo (c) lab Cherokee Brick Co h 708 (620) Prince (SM) Calhoun Herbert (c) lab r 810 (110) Crisp Calhoun Horace (c) lab K 803 Ocmulgee CALHOUN HORACE C (ANNIE D) 1 (o) (Calhoun & Thomas) h 711 Birch--Tel 5282-W Calhoun Isaac (c; Rosa L) h 111 May (U) Calhoun J C (c) student r 344 4th (U) Calhoun Jesse (c) h 214 Church al (SM) Calhoun John (c; Julia) porter Ry Exp Agcy h 75 (101) Oliver Calhoun Jno C (o) h 3145 Houston Calhoun Jno C Jr dep sheriff Bibb County r 3145 Houston Calhoun Joseph (c) lab So Crate & Veneer Co r 810 (110) Crisp Calhoun Josephine (c) r 15 (8) Malloy's al Calhoun Lavonia (c) 5 (o) h 1805 Dempsey Calhoun Lavonia (c) dom Florence Winship r RD 2 Calhoun Louise D Mrs tel opr Hotel Dempsey r 385 Orange Calhoun Lucy M (c) maid S K Tanner Calhoun Lyman (c; Willie) 2 trkr C of Ga Ry h 202 Tindall Calhoun Martin (c) lab r 206 (333) Bowman Calhoun Mary r 113 Habersham Calhoun Mary E (c) emp So Crate & Veneer Co r 810 (110) Crisp Calhoun Obie D (Alene) 2 elk So Bell Tel & Teleg Co h 672 Hemlock Calhoun Opie emp Willingham Mills Calhoun Ralph r 3145 Houston (SM) Calhoun Richmond (c; Julia) (o) farmer h 1018 Main (EM) Calhoun Rosa L peddler r 111 May (U) Calhoun Ruby Mrs 1 (o) h 113 Habersham Calhoun Sallie (wid G E) r 405 Hill Crest Calhoun Wadie (c) 1 r 114 (776) Nussbaum Calhoun Walter (c; Sallie) lab C of Ga Ry h 206 (333) Bowman Calhoun Willie H (c) dir City Play Grounds r 202 Tindall (SM) Calhoun Wm B (c) delmn Henderson-Turner Co Calhoun Wm C creeler Bibb Mfg Co r 113 Habersham CALHOUN & THOMAS (Horace C Calhoun, Robt O Thomas), Real Estate and Loans, Ca5li6f9f1/C2 aCrlhoesrrWy--rTe4l32106B7eech Califf Harry E (Grace) printer Holt & Hanberry h 477 Spring Califf James P 1 wtchmn h 432 Beech Califf Mary E r 432 Beech Califf Wm M r 262 Broadway Caliber Herbert sta opr Scott Filling Sta r 103 McGee Calk Ellen C (Mrs Fred) 1 nurse 1510 3d r do Callaghan Frank J elk First Nat Bk & Trust Co r 821 New Callaghan Martin J (Mamie) slsmn Macon Cigar & Tob Co h 821 New Callaghan Martin J Jr emp Crescent Ldry r 821 New Callahan Clinton (c) r 111 Powell Callahan Lee (c; Lillie M) 3 hlpr Odom-Kinnet Ice Co h 17 Mulberry la Callahan Pearl student nurse Oglethorpe Private Infirmary r do Callahan Rosa M (c) 1 emp Snow's Ldry r 223 (208) Pear Callahan Viola (c) r 111 Powell Callaway Barber Shop (c) (J H Callaway) 101 Cedar (U) Callaway Claude N (Nita) 3 (o) (Empire Serv Sta) h 100 1st (CP) Callaway Frances student r Terminal Hotel Callaway Handy (c; Clara) lab h 1708 (168) Dempsey Callaway Handy C (c; Ida M) tr dr Wood Peavy Furn Co h 101 May (U) Callaway Henry G (Nora) mgr Terminal Hotel r 301 Cherry Callaway Ida M (c) dom r 101 May (U) Callaway Jack hlpr Cherry St Serv Sta r 100 1st (CP) Callaway John H (c) (Callaway Barber Shop) h 101 Cedar (U) Callaway Louise (c) 2 cook J L Henderson h 109 (111) Brief (V) Callaway Wayne hlpr Empire Serv Sta r 100 1st (CP) Callaway Wm (c; Hettie) hlpr Steve M Solo- mon r 1708 (168) Dempsey Callaway Wm H (c; Sophie) (o) jan 1st M E Church h 858 Foster's al Callianos Peter (Stella) (Plaza Cafe) h 340 Duncan Calloway Annie;. (o) h 707 Vineville (V) Calloway Clark (Lizzie) 2 (o) lab C of Ga Ry h 337 Ernest Calloway Edw (c) r 3-4 Hawkins Calloway Dorothy opr So Bell Tel Co r 460 Spring Calloway Helen (c) maid r 16 Parks Hotel al Calloway Henry (c; Leila) (o) carp h 930 (870) Montpelier Calloway Hettie (c) cook Roy Whitehead Calloway Ida (c) r 229 Jones Calloway Jack (c; Rosa) 3 h 112 Wings Hill Calloway John (c) pntr J D Hardeman h 1160 Ocmuigee Calloway Leonora (c) r 1160 Ocmulgee Calloway Thos (c; Helen) lab h 16 Park Hotel al Calloway Wm (c; Annie) 2 lab Proctor & Gamble Mfg Co h 1343 Broadway Calloway Wm A (Pearl) emp C of Ga Ry h 104 Villa Crest Calvary Free Will Baptist Church Cedar (SM) cor Wyche Calvin Fleming (c) hlpr Buck Ice & Coal Co r 124 Bartlett's la Calvin Lula (c) cook J D Crump h 134 Bart- lett's la Calvin Prentice (c) hlpr Buck Ice & Coal Co r 124 Bartlett's la Calvina V elk Federal Transient Bur r 504 Plum Cameriero M Frances (Mrs Nicholas) gro 418-20 Mulberry 401 Walnut Cameriero Nicholas (M Frances) elk M Fran- ces Cameriero 401 Walnut Cameriero Virgil (Jesse M) 1 meats 418-20 Mulberry 316 American blvd Cameron Alex B (Louise) dept mgr Burden Smith & Co r 473 Duncan Cameron Chas L (Gladys) 3 pntr h 347 Flanders Cameron Ernestine (Mrs T L) 2 h 250 Col- lege apt 3 Cameron J Kenneth librarian Mercer Univ h 401 College apt 5F Cameron Robt R (Essie) 1 slsmn h 109 De Sota pi Cameron Thos L elk C of Ga Ry r 354 Col- lege 1935 Macon City Directory 167 Camp Agnes (Mrs G M) opr Happ Bros Co r 145 Cole Camp E L emp State Hy Dept r 279 College Camp Eliz r 279 College Camp Daisy opr Happ Bros Co r 752 Ander- son (SM) Camp G mack (Agnes) 1 baker Am Bakeries Co h 145 Cole Camp Jay W (Helen) farm supt Methodist Orphans' Home h 351 Pierce (V) Camp Sarah E (wid G W) h 752 Anderson (SM) Campbell Albert B (Addie B) emp C of Ga Ry h 3980 Houston Campbell Albert V (Olive) 2 (o) elk Ry MS r Forrest Hill nr Overlook Campbell Allie J r 557 Woolfolk Campbell Archie waiter Mitchell & Williams Co r 272 Columbus Campbell Belle hskpr Ga Acad for the Blind r do Campbell Boots (c; Pearl) r 522 (428) Pio Nono Campbell Carrie (wid J T) h 130 (126) Grady Campbell C H (Maggie C) (Campbell Gro) h 322 Ward (V) Campbell Chas B (Mollie) (o) gro 316 Plant (SM) h 1537 College Campbell Chas H (K Maude) (o) supt Inde- pendent Ldry h 124 Stonewall pi (V) Campbell Chas R (Mary) (o) emp So Ry h 174 Cedar (SM) Campbell Clarence (c) r 624 Flanders Campbell Cleo (c) maid T H Hall r 233 Mid- dle (V) Campbell Doris r 178 Cedar (SM) Campbell Edw (c; Josephine P) 3 (o) b'rklyr h 63 (102) Forest (V) Campbell Enoch B (Josephine) inspr City h 232 Tatnall Campbell Ethel (Mrs L L) opr Happ Bros Co r 178 Cedar (SM) Campbell Etta C bkpr Taylor Furn Co r 272 Columbus Campbell Eug (Dollie) 2 lab h 557 Woolfolk Campbell Evelyn (Mrs R E) opr Happ Bros Co r 123 Violet Campbell Evelyn C (Mrs R D) sten U S Dist Atty r 1603 Vineville Campbell Fanny (c) r 624 Flanders Campbell Grocery (C H Campbell) 322 Ward (V) Campbell Harvey L (Lucille) 2 (o) hauling contr h 504 Mikado Campbell Henry (c) r 113 Main (S) Campbell Ida r 112 Duncan Campbell Isaac J (Emma) 4 hauling contr h 212 Davis (SM) Campbell J Oscar carp r 130 (126) Grady CAMPBELL JAMES P (Mary), Asst Mgr Sears-Roebuck & Co, r 104 Cleveland (V)-- tel 3591-J Campbell John (Ruby) 3 hlpr h 3 Union Campbell John (c; Cleo) 1 (o) porter Union Dry Gds Co h 233 Middle (V) Campbell Joyce Mrs 2 slswn Art Linen Shop r 915 Walnut apt 7 Campbell Ethel (Mrs L L) opr Happ Bros Co r 178 Cedar Campbell Lloyd L (Ethel) 2 h 178 Cedar (SM) Campbell Lucile slswn Union Dry Gds Co r 174 Cedar (SM) Campbell Lucy (wid H B) r 2169 2d Campbell Margt A (wid Dudley) (o) h 332 American blvd Campbell Marion D r Forest Hill nr Overlook Campbell Mary supt emeritus Oglethorpe Private Infirmary r do Campbell Milledge (c) lab C of Ga Ry Campbell Ophelia (c) 2 lndrs h 303 Crisp Campbell Pearl (c) cook r 522 (428) Pio Nono Campbell R Danl C (Evelyn) 1 (o) lawyer 15 Hardeman bldg h 1603 Vineville Campbell Richd W (Emily) 3 h 272 Columbus Campbell Robt E (Evelyn) 1 pressmn J W Burke Co h 123 Violet Campbell S Margt student r Forest Hill nr Overlook Campbell S Vinton (Gladys) 1 dry clnr Inde- pendent Dry Clnrs h 124 Rogers (V) Campbell Senate L (Annie) 4 r 185 Cedar (SM) Campbell Susie (c) 1 (o) h 624 Flanders Campbell Susie M h 120 Garden Campbell Vest (c) shoe repr Abr Wolf r 211 Orange Campbell Walter (c) butler Thos Drew Col- lege r 851 Ash Campbell Walter C coir Toole Furn Co Inc r 272 Columbus Campbell Wm (c; Annie) lab h 308 Coles al Campbell Wm H (Lillie M) 3 elk So Ry Sys- tem h 134 Tenney (SM) Campbell Wm H (Annie) formn C of Ga Ry h 815 Main (EM) Campbell Wm W elk A&P Tea Co r 134 Tenney (SM) Campbell Willie (c) lndrs r 811 Center (EM) Camper Della r 461 Oak Canada Fredk (c; Beatrice) r 388 (381) Mel- rose Canady Albert J (c) emp Harry's Cafe r 426 (236) Elliott Canady Hamp (c; Mollie) h 426 (236) Elliott Canady John W (c) porter Dupree Barber Shop r 426 (236) Elliott Canady Lula (c) 1 r 607 Telfair (SM) Canady Luther (c) emp Winton's Pharm r 604 Telfair Canady R Emmett (c; Ernestine) emp Win- ton's Pharm r 607 Telfair (SM) Canady Roosevelt (c; Mattie) 1 elev opr Mas- see Apts h 124 (784) Nussbaum Canady Wm L (c; Carrie) 3 r 426 (236) Elliott Canan Take tex wkr Willingham Mills r 109 (46) Holt Cane Annie (c) r 8 Parker al Canfield Sidney F (May) (o) mech R H Mc- Cord Mtr Co h 408 Church (EM) Canipelli Joseph student r 569 College Canipelli Vincent (Theresa) (o) tailor 320% 2d h 569 College Canipelli Vincent Jr emp Ga Power Co r 569 College Cannady Clarence M (Myrtle) 3 tr dr Ivey Turner Ice Cream Co h 267 Orange Cannady Carrie (wid J A) r 868 1st Cannady Eva r 868 1st Cannon Anna L (Mrs Clarence) opr Happ Bros Co r 1511 Broadway Cannon Annie (c) maid M A Michael r 810 Third Cannon Arth (c) r 550 Smith row Cannon Benj H (Jessie M) 2 mtr cycle ofc CPD h 2608 2d Cannon Bertha (Mrs J D) clipper Bibb Mfg Co r 405 Cedar (SM) Cannon Chas L (Esther) 2 (o) emp C of Ga Ry h 302 Buford pi (V) Cannon Clarence (Anna L) 6 mech Central S&D Co h 1511 Broadway Cannon Edwin student r 827 Main (EM) Cannon Geo tr dr Moffett Transit Lines r Americus Ga Cannon Georgia (c) cook T D Groover r 231 Patterson 168 Baldwin's and Telegraph's Cannon J E emp Willingham Mills r RD 4 Cannon Jack C (Cora L) 2 carrier PO r 1530 2d Cannon John D (Bertha) 1 h 405 Cedar (SM) Cannon James P agt Nat L&A Ins Co r 322 Georgia Cannon James P (Lillian) tex wkr Willingham Mills h 211 (27) Holt Cannon Lillian (Mrs J P) tex wkr Willingham Mills r 211 (27) Holt Cannon Maude (wid D F) opr Adams Mfg Co r 1904 2d Cannon Mildred A (wid J W) (o) h 220 Mag- nolia Cannon Piccola maid 651 Ridge (I) r do Cannon Robt L (Grace) 3 mech Huckabee Auto Co h 714 Pine Cannon Shoe Store W A Tait mgr 562 Cherry Cannon Thos J (Susie) tex wkr h 365 (345) Hydrolia Cannon Verna (wid G W) (o), h 105 Thomas (LCHts) Cannon W Jessie (Pearl) barber h 1904 2d Cannon Wm E (Viola) 2 h 827 Main (EM) Canter Bessie (Mrs Nathan) elk Canter Deli- catessen r 869 Cherry Canter Louis elk Dannenberg's r 869 Cherry Canter Nathan (Bessie) 1 (Canter's Delicates- sen) h 869 Cherry Canter Sarah S student r 869 Cherry Canter's Delicatessen (Nathan Canter) 208 Cotton Canty James (c; Mozell) 3 emp Massee Apt h 253 Cowan Canuett Mary registered nurse 521 College r do Cape Geo D (Blanche M) slsmn Dixie Dairies h 410 Hanson (SM) Capel Bessie (c) (o) tchr County Schs h 231 (238) 1st (V) Capers James E (c; Verna; 1 hlpr Maxwell Bros r 508 (505) Martha Capitol Cycle Co (Loyd Newbern) bicycles 506 2d Capitol Hotel A E Weems mgr 560 Plum Capitol Theatre A P Marry mgr 368 2d Capp Wm emp MD&SRR r 568 Walnut Capps Ethel (Mrs W P) 2 (o) h 2001 3d Capps Lucile opr Happ Bros Co r 2001 3d Caraker Minnie (wid T L) (o) slswn h 352 Pierce (V) Carburetor & Electric Service Inc G J Essig pres A W Farres vp 706 3d Card Andrew (c; Fannie) 4 lab So Crate & Veneer Co h 404 (403) Mitchell Card Annie (c) cook J B Eddings Card Booker (c; Lillie) h 203 Yates al Card Boysie (c; Gertrude) 1 lab So Crate & Veneer Co h 406 (405) Mitchell Card Florine (c) r 311 Womack Card Floyd (c) soft drinks 452 Martha h do Card Gertrude (c) lab So Crate & Veneer Co r 406 (405) Mitchell Card Gussie L maid J L Darby Card James (c) lab So Crate & Veneer Co r 404 (403) Mitchell Card Josephine (c) 3 h 512 Womack Card Pleasant (c) smstrs 301 Green h do Card Sallie (c) 2 emp Bibb Mfg Co h 500 Cowan Card Thomas (c; Rosa) lab r 515 (529) May- nard Card Wm B (c) lab So Crate & Veneer Co r 404 (403) Mitchell Cardell Minnie r 101 (1) Balkcom Cardell Minnie E r 121 Comer ter (PM) Cardell Virginia (wid J B) r 101 (1) Balkcom Cardell Wm C h 101 (1) Balkcom Cardwell Laura r 401 College apt 8C Carey Aurie nurse 722 Mulberry r do Carey C Robt r 754% New Carey Effie (wid C A) matron Hosp Nurses Home h 754% New Carey Ernest R (Willella B) 1 mech R A Mc- Cord Mtr Co h 118 Ponce De Leon (SM) Carey James (c; Rosa) (o) porter Ry Exp Agcy h 133 2d (V) Carey Julia (c) r 330 3d (V) Carey Julia M (c) tchr Green St Sch h 330 3d (V) Carey Rosa (c) maid Dr Sledge r 133 2d (V) Cargile Cecil B (Sarah B) 1 opr Happ Bros Co r 616 Oglethorpe Cargile John F (Virginia) bkpr Taylor-Quickel Eng Co r 826 Orange Cargile Johnny M (c) cook R L Moore r 103 (726) Wings al Cargile Lucius (c) hlpr Middle Ga Lbr Co Cargile Rufus (c) hlpr Middle Ga Lbr Co r RD 3 Cargile Thos (c) hlpr Middle Ga Lbr Co Cargill Edw S (Louie) (o) slsmn Toole Furn Co Inc h 103 Lamont (LCHts) Cargill Edw K (Martha) pres-genl mgr South- eastern Broadcasting Co h 305 College apt 7 Carling Tile Co J J Daley sec R E Lowrance genl mgr 116 Poplar Carlisle Alex O (Ruby) 4 (Carlisle Bros) h 103 Marshall av (CP) Carlisle Bros (A O, L W & L E Carlisle) auto reprs 2111 Vineville (V) Carlisle Henry (c) h 101 Harris CARLISLE J DOUGLAS (Carlisle & Bootle), r 239 College--tel 2090' Carlisle James R (c; Mary) r 404 (309) Bartlett Carlisle James S elk Piggly-Wiggly r 165 Vir- ginia Carlisle Joseph Y tr dr Sterehis' r 165 Vir- ginia Carlisle Lester W (Carlisle Bros) r 101 Del Park Carlisle Lewis W (Nellie) 3 (o) (Carlisle Bros) h 101 Del Park Carlisle Mary r 165 Virginia Carlisle Mattie (c) 1 lndrs h 655 Oglethorpe Carlisle Maude Mrs 1 (o) h 165 Virginia Carlisle Roy M (Daphne) ,Macon Feed & Seed Store) r 732 Ridge (I) Carlisle Thos H (Jessie S) emp C of Ga Ry h 771 Blackburn Carlisle Willard A (Dorothy) 2 elk T M Raines Gro Co Inc h 784 Hillyer CARLISLE & BOOTLE (J Douglas Carlisle, Wm A Bootle), lawyers 501-03 Macon Savings Bk bldg--tel 664 (See Page 101) Carlos Wm S (Nora B) 1 ofc mgr Crescent Ldry h 227 Ross Carlton Lonnie (c; Queen) lab Central Cotton Oil Co h 153 Bright al Carmichael E Emory (Ola B) 2 sta mgr Tank Car Serv Sta h 285 Rutherford (SM) Carmichael Ella (wid J T) r 150 Dixie Carmichael Emmett (c; Plenty) emp Bibb Mfg Co h 14 (131) Molloy's ai Carmichael H Grady (Ruby) 2 (o) elk Kingman & Everett Inc h 150 Dixie Carmichael James I (Mary) r 244 Roff Home Carmichael John (Maud) 4 slubber hd Bibb Mfg Co h 20 Lake City (EM) Carmichael Joseph F (Lois) 5 elk Piggly-Wiggly h 606 (350) Woolfoik Carmichael Kath W (Mrs Joseph) chairmn Utility Club Clinic res Shirley Hills Carmichael Leonard N (Mary) meat ctr PigglyWiggly h 105% Cabaniss (EM) Carmichael Maggie emp Willingham Mills 1935 Macon City Directory 169 Carmichael Maud (Mrs John) spinner Bibb Mfg Co r 20 Lake City (EM) Carmichael R Joseph (Hath) 1 (o) sec-treas Central Sash & Door Co h Jackson Spring rd (SH) Carmichael Rollie emp Willingham Mills r 123 (39) Holt Carmichael Ruth (wid Frank S) (o) h 219 Vineville (V) Carmichael Sarah (wid Lemuel) emp Willingham Mills h 123 (39) Holt Carmichael Sarah V (c) cook M R Dixon r 102 Brooklyn (S) Carmichael Wm (c; Sara V) r 102 Brooklyn (S) Carmichael Wm tex wkr Willingham Mills r 123 (39) Holt Carmichael Wm C (Louise) porter Union Dry Gds Co h 108 Pierce Carnegie Abe B (c; Irene) 3 baker Central Ga Bakery h 167 4th (V) Camell Minnie (c) r 364 Hazel earner Estelle (c) slswn r 509 Fort Hill Carnes Hath P librarian Wesleyan Col r 576 College Carolan John L mgr Jake H Wilensky Leather Co r 329' College Carolina Life Insurance Co M N Carroll mgr 504 Grand bldg Carpenter Arth B (Venice I) 3 firemn C of Ga Ry h 202 Duncan Carpenter Clyde O Jr slsmn Ga Power Co r YMCA Carpenter Jessie tex wkr Willingham Mills r 118 Holt Carpenter Marvin Q (Lillie) 3 (o) inspr Co of Ga Ry h 302 Ormond ter Carpenter Melvin 1 tex wkr Willingham Mills r 110-12 (5) Holt Carpenter Minnie (Mrs J W) h 110-12 (5) Holt Carpenter Ralph (Marie) tex wkr Willingham Mills r 110-12 (5) Holt Carpenter Rufus tex wkr Willingham Mills r 110-12 (5) Holt Carr A Eug (Mabel) 3 baker Am Bakeries Co r 125 Yates Carr Annie C (wid A F) tex wkr Happ Bros h 157 1st Carr Benj (c; Bertha) (o) swtchmn C of Ga Ry h 17 Spring Carr C Tracy slsmn Sterchi's h 817 Poplar apt 3 Carr David (c) (o) lab h 144 Bowman Carr Donovan (Eulala) 1 tr dr City Scavenger Dept r 1304 2d Carr Emma S (wid T I) r 291 Rutherford (SM) Carr Geo M (Roscoe) 1 (o) carp h 111 Stone- wall pi (V) Carr Gertrude (Mrs Robt I) opr Happ Bros Co r 112 Yates Carr Guyton M student r 111 Stonewall pi (V) Carr H Eleanor (wid Harry) sch tchr r 401 College apt 4 I Carr Haywood P (Phoebe) slsmn Dahnenberg & Waxelbaum Co r 661 New Carr Homer H r 2 Grand (B) Carr Jno L (Maude) 2 hd bkpr Citizens & So Nat Bk h 103 Edna pi (LCHts) Carr 5ohn L (Emma) 1 tex wkr Willingham Mills h 293 Belmont Carr John M (Eliz) photogr Metro Studio h 1127 Walnut Carrf L Martha Mrs 2 opr Happ Bros r 120 Yates Carr Laura Mrs 1 (o) h 2 Grand (B) Carr Leo r 157 1st Carr Mary (Mrs Patk) tex wkr Bibb Mfg Co r 216 American blvd Carr Mattie L Mrs r 2 Grand (B) Carr Mildred r 601 Carman pi (Lynmore Es- tates) Carr Milton A (Minnie) 3 carp h 601 Carman pi (Lynmore Estates) Carr Otis r 2 Grand (B) Carr Patk (Mary) 1 r 216 American b'lvd Carr Quinton emp Payne Mill r 2 Grand (B) Carr Raphael student r 127 Virginia Carr Robt I (Gertrude) 2 baker Am Bakeries Co r 112 Yates Carr V Ulian (Pearl) 4 (o) emp So Ry h 259 Jeff Davis (SM) Carr Walter L (Lee A) 4 emp Bibb Mfg Co h 225 (23) Clinton Carr Wm R (Linnie M) 1 sta atndt Power Oil Co h 127 Virginia Carriker Eliza (c) h 114 Johnson (SM) Carriker John E (Rosa) flgmn C of Ga Ry r 706 2d Carriker Wm (c) delmn L A Thomas Drug Co r 114 Johnson (SM) Carroll Benj (Mattie) 1 pntr h 866 Elm Carroll Bessie (wid Fred) r 355 Flanders Carroll Chas (c; Audie) (o) firemn MD&SRR h 231 Orange Carroll Edna r 866 Elm Carroll Grace (Mrs M N) cash Carolina Life Ins Co r 877 Mulberry Carroll Henry (Lora) 3 tex wkr h 107 (266) Pearce Carroll J B (Addie B) 3 carp h 200 Antioch rd (Lynmore Ests) Carroll Joseph A (Laura K) r 117 Plant (SM) Carroll Joseph M emp C of Ga Ry Carroll Joseph S (Mattie) 3 h 501 Marion (Lynmore Estates) Carroll M Leola candy elk Carstarphen Inc r 444 New Carroll Martha (wid G R) r 1333 3d Carroll Mason N (Grace) 2 dist mgr Carolina Life Ins Co r 877 Mulberry Carroll S Penny (o) h 363 Clinton Carroll Senora (wid J E) r 877 Mulberry Carroll Sudie (wid Andrew) r 905 2d Carroll Tempie (wid W H) r 225 Belmont Carson Carvel H (Clair S) 2 public sta supv So Bell Tel Co h 402% Forest (V) Carson Eva (c) h 763 Center (EM) Carson J Fred head bkpr First Nat Bk & Trust Co r 521 College Carson James L (c) porter Day's r 302 Plant (SM) Carson Lelia (wid C H) r 402% Forest (V) Carson Lillie M (c) r 401 Prince (SM) Carson Lottie (c) r 302 Plant (SM) Carson Nellie (c) 4 r 951 Pio Nono Carstarphen Inc T J Carstarphen pres Augusta Ga O H Carstarphen vp T T Carstarphen sec-treas whol tob 612 Poplar Carstarphen Mamie (wid T J) r 727 College Carstarphen Orrin H (Mary) 2 (o) vp Carstarphen Inc h 915 Brentwood Carstarphen Taylor T (Essie) 1 sec-treas Carstarphen Inc h 727 College Carstarphen Taylor T Jr (Flewellyn) slsmn Carstarphen Inc r 560 Hillyer Carswell Ada M (c) maid Z H Arnold r 257 Woodliff Carswell Anderson (c; Minnie) 1 porter H L Green & Co r 505 Fulton (EM) Carswell B Stewart (Sarah M) 1 slsmn h 1109 Vineville (V) Carswell Chas (c) r 110 Hill Carswell Clementine (c) maid r 404 (506) Maynard 170 Baldwin's and Telegraph's Carswell Danl W (c; Cora) 1 (o) lab C of Ga Ry h 224 Cedar (U) Carswell Dora Mrs candy wrapper Carstarphen Inc r Arlington Hotel Carswell Eliz r 320 College Carswell Fannie (c) r 117 (298) Craft Carswell Hattie T (wid N T) furn rms 320 Col- lege h do Carswell Hazel T Mrs r 867 Cherry Carswell Henrieta (c) 1 h 418 Hawthorne Carswell Janie (c) cook W E Cobb Carswell Janie (c) maid Wesleyan Conserva- tory r 237 Riley (CP) Carswell James (c) carp h 102 (304) Spring la Carswell James (c; Julia) hlpr Ga Power Co h 853 Ocmulgee Carswell Jesse (c; Rosa L) 1 (o) lab C of Ga Ry h 408 (345) Cowan Carswell John (c; Bessie) 1 h 110 Hill Carswell John Jr (c) bellmn Terminal Hotel r 110 Hill Carswell John (c; Annie) lab r 155 e Academy (EM) Carswell John M (Pauline) slsmn Kingman & Everett Inc h 114 Ninadel dr Carswell Joseph (c; Minnie) 1 lab h 404 (506) Maynard Carswell Kenneth E (Mary H) 1 slsmn Steve M Solomon h 7 Rose pi Carswell Lindsey (c; Clara) 2 hlpr Maxwell Bros h 257 Woodliff Carswell Louise (c) 2 elev opr First Nat Bk bldg 302 (303) Clark Carswell Lucile tchr Miller High Sch r 118 Rogers (V) Carswell Lula (c) Indrs r 609 (100) Elliott Carswell Marshall (c; Fannie) bellmn Hotel Lanier r 120 Hill Carswell Mary L (wid P C) h 118 Rogers (V) Carswell Mattie (c) 1 h 136 Middle (V) Carswell Mattie (c) maid G M Yates h 290 1st (V) Carswell Mattie (c) student r 257 Woodliff Carswell Melvina (c) r 110 Hill Carswell Nathl A slsmn J N Neel Co r 320 College Carswell Otis (c) cook Wesleyan College h 341 Madison (V) Carswell Princess (c) cook W E Bozeman r 404 (506) Maynard Carswell Raymond (c; Janie) 4 lab h 237 Riley (CP) Carswell Robt (c) r 120 Bostic la Carswell Robt E emp Ga Power Co r 320 Col- lege Carswell Roger W (Callie) 1 mech Cliff Walker Co h 128 Holt Carswell Rollins (c) r 404 (506) Maynard Carswell Sallie (c) cook h 816 Elm Carswell Sallie (c) 1 lndry h 104 (235) Elliott Carswell Sanford (c; Mary) (o) shademn Union Dry Gds Co h 250 5th (PH) Carswell Sconyers (c) r 404 (506) Maynard Carswell Sherman (c; Macie) emp Macon Co- operage Co h 271 Tindall (SM) Carswell Ulysses (c) r 110 Hill Carswell Vera I (Mattie) 1 gro 946 (935) Montpelier res Lizella Ga Carswell W Peyton slsmn r 118 Rogers (V) Carswell Wm (c; Ethel) h 103 (112) Powell Carswell Wm (c; Doshie) 2 lab Macon Cooper- age Co r 418 Hammond Cart Edwin J (Hetty A) 1 h 911 Napier Carter Adolphus (c; Carrie) (o) lab h 313 Antioch rd Carter Alene (c) maid Carlisle Earnest Carter Alma elk Macon Hosp r 656 Pine Carter Andrew I firemn Engine hse 6 r 75 Holt Carter Andrew L (c) lab r 440 Chestnut Carter Annette (c) h 102 (12) Cemetery la Carter Annie (c) (o) h 1163 Oglethorpe Carter Benj F (Louise) sgt USMC Recruiting Sta r 278 College Carter Brinson (Jessie) 1 r 119 Emory (SM) Carter Brinson r 971 Oglethorpe Carter Charlotte (c) dom r 104 Adams Carter Charity (c) Idry h 412 Hawthorne Carter Chas (c) r 313 Antioch rd Carter Chas emp City r 125 Rose pk Carter Chas (c; Exie) 1 lab h 301 Short (EM) Carter Chas B (Marie) tex wkr Willingham Mills r 10 (80) Mill Carter Clara (c) r (r) 365 Robinson rd Carter Clarence (c) jan Ga Power Co r RD 1 Carter Claude (c; Carrie) lab h 95 (17) Hazel Carter Cliff (c) dr Dixie Dairies r 128 (7) Hudson Carter Curtis M (Bessie) 2 tex wkr Willingham Mills r 211 (27) Holt Carter D Roy meat ctr Mulberry Mkt r 613 Plum Carter Dell Mrs r 262 Broadway Carter Dolly (c) r 364 Robinson rd Carter Doris (c) Indrs r 803 (816) Cowan Carter Earl F (Pauline) 1 (o) claim agt So Ry h 407 Carling Carter Earl F Jr elk Hall & Block r 407 Car- ling Carter Edw (c; Gussie) 4 tr dr h 2 Mitchell la (EM) Carter Eliz T (Mrs J Holland) elk First Nat Bk & Trust Co r 641 Vineville Carter Ella L (c) cook J H Denning r 107 Berthadale Carter Eloise nurse 168 High r do Carter Etta (c) (o) h 241 4th (V) Carter Fannie (c) h 158 Guernsey la Carter Frances waitress Betsey Ross Coffee Shop r 718 Mulberry CCaarrtteerr1 Frank Frank (c) W lab r 104 (Helen) Adams policemn CPD h 1425 3d Carter Fredk W (Alma) 3 city circ mgr Macon Evening News h 121 Richmond Carter Geo (c; Mary) 2 (o) emp Ga Power Co h 105 Berthadale dr (V) Carter Geo C Jr (c; Jessie F) (o) emp Ga Power Co h 107 Berthadale dr (V) Carter Geo K (Leotis) 2 firemn MD&SRR h 809% Cherry Carter Grace (c) r 14 (305) Hanson (SM) Carter Gus (c; Lucy) 1 lab h 440 Chestnut Carter Hardware & Supply Co Ray Carter pres R T Cline sec-treas 533-55 Poplar Carter Harold r 716 Mulberry Carter Hattie (c) h 20 Parker (V) Carter Havard L (c) r 108 (131) Elizabeth (SM) Carter Helen R (Mrs F W) opr So Bell Tel Co r 1425 3d Carter Henry C (c; Laura) 2 cook Bloodworth's Cafe r 708 Hazel Carter Ida (c) r 108 (131) Elizabeth (SM) Carter Irene r 656 Pine Carter J Holland (Bessie R) emp C of Ga Ry h 216 North (NH) Carter J Wm (Annie) gro 308 Fulton (Lyn- more) h do Carter James S (Sara) slsmn Standard Oil Co h 404 Courtland Carter John J (Clyde L) 2 int dec h 110 Log Cabin dr Carter John L (c; Eliz) 4 h 107 (226) John- son la 1935 Macon City Directory 171 Carter Joseph P elk So Dry Gds Co r 656 Pine Carter Julian r 1920 Broadway Carter Kath (c) (o) h 369 2d (V) Carter Leila (wid J F) r 254 College Carter Leonard W (Pearl) 2 (o) bkpr Stillwell Construction Co h 106 Euclid (I) Carter Levi B (Maggie D) h 656 Pine Carter Lily M (c) cook r 128 Concord Carter Louise nurse Middle Ga Hosp r do Carter Louis (c; Lillie M) lab The Standard Tool & Handle Co h 311 Ash Carter Lucy (c) cook B A Johnson r 440 Chestnut Carter Lula (c) Indrs YMCA Carter Mae E sten L T Gillen r 216 North (NH) Carter Mary E Mrs 1 r 807 Cherry Carter Mary L (c) cook r 209 (75) Craft Carter Marvin E (Geraldine H) 1 slsmn Fire- stone Auto Sup & Serv Stores r 716 Mul- Carver Ralph elk A&P Tea Co r 128 Williams (SM) Carvest Edgar (c) r 618 Hazel Carvest Edw C (c; Maude) (o) brklyr h 618 Hazel Carvest Willie (c) r 618 Hazel Carwell Estella (c) maid r 214 Collins pi Cary Emory P (Jeanette R) 1 ins solr Murphy Taylor & Ellis h 202 Berkley dr (I) Cary Jesse H (Mamie) emp GS&FRR h 406 Napier Cary Robt F (Roselyn) 1 shpg elk C-M-P Drug Co h 724 College Caserio Grocery Co (Lucretia Caseiro, Mariet- ta De Fiore) 251 Washington Caserio Leonard (Kathleen) 2 h 239 Wasington Caserio Lucretia (o) Caserio Gro Co) furn rms 103 Washington h 253 do Casey John W (Madge) 2 train dispr C of Ga Ry h 112 Brentwood berry Carter Minnie (c) r 108 (131) Elizabeth (SM) Carter Minnie (c) maid Rialto Theatre r 115 (15) Alabama Carter Pearl (Mrs L W) sten Ry Exp Agcy r 106 Euclid (I) Carter Perue (Margt E) 2 h 347 Hanson (SM) Carter Ralph (Pauline) 1 hlpr r 525 Jackson Casey Joyce student r 112 Brentwood Casey Louise student r 112 Brentwood Cash Bessie (c) r 518 e 2d (EM) Cash Ethel (c) sch tchr r 220 Jones Cash Frank (c) waiter Our Place r 104 Gustin Cash Frank C (c; Ethel) sch tchr r 220 Jones Cash Geo W (c; Lucy) (o) lab h 302 Dure (U) Cash John (c) lab C of Ga Ry Carter Ray (Frances) 2 pres Carter Hdwe & Sup Co h 226 Riverdale dr (I) Cash Mary (c) maid r 116 (16) Wise (V) Cash Wm (c; Mary L) 2 (o) h 116 (16) Wise Carter Reverend (c) lab r 841 Main (EM) (V) Carter Roscoe (c; Aurilla) barber G W Hatfield Caskin C R Joseph (Ruth) trav slsmn Happ h 321 Middle (V) Bros Co r 165 Virginia Carter Roscoe (c; Rosa) 1 lab Maxwell Bros h Caskin Ruth (Mrs C R J) bkpr Harris Loan Co 730 (640) Prince (SM) Carter Sarah (c) cash Atlanta Life Ins Co h r 165 Virginia Caslin Chas (c; Bertha) (o) emp So Ry Shops 501 (553) Broad (EM) Carter Sallie Mrs opr Happ Bros Co r 971 h 234 Telfair Cason Claud S (Loulie L) vp Burden Smith & Oglethorpe Co Inc h 172 High Carter Sami (Eula D( (o) h 143 Magnolia Cason Edwd J (Mamie) (o) h 102 Coleman Carter Sara J (Mrs J S) case wkr FERA r 404 Cason Geo T (Bert E) 2 USN h 2217 Forsyth rd Courtland Carter Thos (c) r 108 (131) Elizabeth (SM) Carter Tumlin (c) lab r 313 Antioch rd Cason John r 1023 Ash Cason Lenore student r 102 Coleman Cason Leveati (c) 4 h 215 Tharpe Carter W F route formn Independent Ldry Co res Fort Valley Ga Carter Wm (c; Sarah) (o) h 501 (553) Broad Carter Wm (c) r 14 (131) Molloy's al Carter Wm J stm ftr r 809% Cherry Cason Louise tchr Burke Sch r 120 Coleman Cason Moses (c) lab Irby Bros h 46 Harris Cason Rosa M elk Bd of Public Education r 102 Coleman Cass Patrick E (Eliz) (o) carp h 205 Hartley Carter Wm M (Ella) 2 h 120 Chappell (SM) Cartwright Chas B (Essie) 3 h 256 Church (EM) (CP) Cassidy Ala E sten HOLC r 546 Orange Cassidy Anita r 668 1st Cartwright David (c; Mamie) 1 emp Atlantic Ice & Coal Co h 3 Alabama (SM) Cassidy Bridget (wid S E) r 654 1st Cassidy Cecile sten FERA r 668 1st Cartwright Wm (c; Ada) 2 hlpr Maxwell Bros Cassidy Cecile M (wid W J) 3 (o) mgr Cassi- r 117 (15) Wise (V) dy's Garage h 668 1st Caruthers Anderson C (c) r 23 (523) Clay- Cassidy Francis T bkpr Crescent Ldry r 546 ton (V) Orange Caruthers Eliz student r 130 Piedmont (SM) Cassidy Hannah (Mrs Dennis) (o) h 658 1st Caruthers Emmie (c) Indrs h 23 (523) Clay- Cassidy Mae (Mrs Michl) emp Sears Roebuck ton (V) r 658 1st Caruthers Felton elk Chapman's Pharm r 130 Cassidy Michl J (May) asst funeral dir Hart's Piedmont (SM) Mortuary r 658 1st Caruthers Geo W (Sara) 5 (o) bus opr Ga Cassidy Patk J h 546 Orange Power Co h 130 Piedmont (SM) Cassidy Wm student r 668 1st Caruthers Thos (c; Daisy) 1 emp C of Ga Ry Cassidy's Garage Mrs W J Cassidy mgr reprs h 212 Roosevelt (V) 409 Mulberry Caruthers Thos Jr (c) lab r 212 Roosevelt (V) Cassini Columbia r 620 Carling Carver Archie S (Annie L) 2 slsmn Gills Cassini John B (Mary) 1 tile contr h 255 Win- Bakery h 152 Lamont (LCHts) ship Carver Chas H (Nell) 4 h 128 Williams (SM) Cassini Lena student r 255 Winship Carver Chas H Jr elk Great A&P Tea Co r 128 Williams (SM) Cassini Louis (Mary) 1 (o) tile str h 620 Carling Carver Gail L (Nettie P) (o) prof Mercer Cassini Louise student r 255 Winship Univ h 796 Patterson Cassini Orlando L r 620 Carling Carver Martha E opr Happ Bros Co r 128 Williams (SM) Casson Adeline C (wid R E) (o) h 110 Boulevard (NH) 178 Baldwin's and Telegraph's Casson R Habenicht lawyer 215 Casualty bldg Causey Mattie L (c) carder Payne Mill r 119 r 110 Boulevard (NH) Casteel Jones B (Mary) 2 slsmn Macon Shoe (334) 3d (U) Causey Robt H engr Bibb Mfg Co h 310 Church Co r 687 College (EM) Castellaw Elwyn C (Lucile) 1 carp r 505 Causey Steph B serv sta 989 Montpelier h do Mikado Causey Thos W (c) clnr Bibb' Mfg Co Castellaw J Wilton (Alene) 1 hlpr h 306 Simmons (SM) Causey Wm (c; Mattie L) 2 h 119 (334) 3d (U) Causey Wm (c; Hester) 2 (o) farmer h 393 Castellaw Louie A (Annie M) dept mgr Carling Robinson rd Tile Co h 107 Cabaniss (EM) Causey Wm H (Margt E) 3 emp C of Ga Ry h Castellow Bernard elk A&P Tea Co r 3909 311 Forsyth Houston Castellow Betty sten r 422 Johnson Castellow G Edw (Bessie) 1 (o) carp h 3909 Cauthen Carolyn nurse 129 Rembert r do Cauthen John C (Lucile) rep Internat Corres- pondence Sch h 920 College Apt 3 Houston Castellow Meta W (wid C A) h 422 Johnson Cauthem Lucile (Mrs J C) tchr Burke Sch r 920 College Apt 3 Castelow Sallie (c) maid r 405 (307) Charles Castleberry Dora (wid W B) r 722 College Cavas James r Hotel Gordon Cawley Biddie r 636 Forsyth Cater Albert (c; Mary) (o) h 230 Telfair Cater Buford (c; Annie) 3 h 3 Bright al Cecil Florence (c) cook 2320 Forsyth rd Cedar Grove Baptist Church (c) 132 Brewery Cater Fletcher S Jr elk Bibb Mfg Co r 716 al (PH) Napier Centenary M E Church J A Harmon pastor 940 Cater James C (c; Roberta) ( 813 Daisy (SM) Cater Kath C student r 210 Coleman College Central Bedding Co A I Blum pres-treas Morris Cater Kathleen B (wid F S) h 716 Napier Cater Louise W Mrs 2 (o) slswn Union Dry Michael v-pres mattress mfrs 325 Oglethorpe Central Church of Christ 710 Orange Gds Co h 127 Buford pi (V) Cater Mary L (c) maid Ga Acad for the Blind r 230 Telfair Central City Auto Parts Co (Henry Koplin) 854 Broadway Central City Bag Co H W Quin pres J P Galle- Cater Roberta (c) cook Jennie Andersen r 813 more v-p 5th cor Mulberry Daisy Central City Chapter No 28 Order Eastern Star Cater Thos (c; Hattie) lab Buckeye Cotton Oil Mrs Hattie Martin sec meets 2d & 4th Thurs- Co h 310 (309) Campbell (SM) days 7:30 p m 111 Cotton Cater Thos J (Maybell) (o) ofc asst County Tax Receiver h 210 Coleman Cater Thos J Jr chemist r 210 Coleman CENTRAL CITY COLLEGE (c), J H Gadson Pres, Junior College P O Box 233, 1035 Clinton rd--Tel 5143 (See Page 78) Cates John G (Clemmie) h 660 Forsyth CENTRAL CITY FUNERAL HOME (c) (Ruth Cathcart Johannah (c) (o) h 470 Broad Catherwood S C emp C of Ga Ry r Central Hotel P and Riohd E Hartley), Funeral Directors and Morticians 530 Cotton--Tel 57 Central City Park 7th at river Catholic Club House 521 New Cato Thos (c) Jab Buckeye Cotton Oil Co Cato Velma sten Dempsey Hotel r 855 Mulber- ry apt 404 Catron Howard S sgt instr Lanier High Sch Central Cotton Oil Co E G McKenzie pres, E D Black vp-treas, L G McGriff sec 652% 3d plant ft Poplar Central Georgia Baking Co (Henry Merkel) 216 Cotton for Boys r Forest Hill Catron Lillian S (Mrs) sten Adams Buchanan Mtr Co r White Oak Mineral Wells CENTRAL HOTEL, J Mote Watts Mgr Broadway at Mulberry--Tel 1961 (See Page 88) Central of Georgia Railway W W Hackett div Catsup Robt (c; Annie) 1 wtchmn Elkan StoneTile Mfg Co r do Causey Annie Mrs 3 h 125 Roff Home la Causey Arth F (Hattie) 1 (o) emp Willingham Mill h 248 Roff Home Causey Arth L (Flossie) 2 emp C of Ga Ry h 100 Crisp pass agt 101-05 Terminal Sta, W J Poole chf spec agt 118 Terminal Sta, W E Stewart asst genl frt agt 107 Terminal Sta, J B Neighbors claim agt 215 Terminal Sta, M B Smith (Macon div) supt 206 Terminal Sta, W R Golson (Macon div) engr 202 Terminal Sta, W L Chandler chf dispr 214 Terminal Sta, Causey Dona M Mrs emp Willingham Mills h E B De Merritt engr signal dept 216 Termi- 190 Patterson nal Sta, S G Roney trainmstr 212 Terminal Causey Earl F tex wkr Willingham Mills r 248 Roff Home Causey Edw (c) emp Adams Mfg Co r 106 (71) 3d (U) Causey Emory C (Frankie) radio repr Maxwell Bros r 206 (306) Pio Nono Sta, A M Dodd supvr of bridges and bldgs 220 Terminal Sta, O L Ellis supvr of tracks 220 Terminal Sta, R G Barnes record dept 220 Terminal Sta, J C Wyche frt agt 5th at Pine, A J Flowers mstr mech shops Pine at 7th, L H Harper supt creosote plant 1906 (r) Vineville Causey Flora Mrs opr Happ Bros r 559 2d Central Sash & Door Co T M Willingham pres Causey Griffin (c; Jennie) h 1301 Dempsey A R Willingham vp R J Carmichael sec-treas Causey Irene tex wkr r 125 Roff Home la Causey James (c; Willie) h 627 (2) Gilmer 354 2d plant Waterville rd nr Steele Central Sign Co (J R Holt Jr) 313% 3d Central Tire Co (B S Fitzpatrick Jr) 405-09 Causey Jesse A (Margt) 3 candy mkr McAfee Poplar Candy Co r 526 Edgewood Cephas Benj (c; Frankie) 4 h 706 Hazel Causey John (c) lab Buckeye Cotton Oil Mill h 626 (3) Gilmer Cephus Berry (c; Pearl) h 406 (505) Prince (SM) Causey John C (Lillie M) 1 tr dr St Clair Oil Co h 2129 Forsyth rd Cephus Nathl (c; Annie B) 3 pastor Magnolia Baptist Ch h 238 Telfair Causey Louise Mrs winder Payne Mill h 109 Washington Apt 4 Chaffin Hubert H (Jessie) 1 mech r 742 College 1935 Macon City Directory 173 Chaffin Sami T (Frances) elk C of Ga Ry r 811 Napier Chailan Chas P (Jeffie) (o) linemn City Elec Dept h 1548 College Chalker Howard (Ruby M) chf elk Hotel Dempsey r Hotel Dempsey CHAMBER OF COMMERCE (See Macon Chamber of Commerce) Chamberlain Blanche N Mrs 1 r 221 Bond Chamberlain Cainey (c) h 214 (256) Plum- Chambliss Amos (c) r 461 Douglas (V) Chambliss Andrew carp r 106 Montpelier Chambliss Annie B (c) cook r 412 Ward (V) Chambliss Benj Z sten Kenmore Burns Inc r 494 Orange Chambliss Erie S chf elk MD&SRRCor 494 Orange Chambliss Ethel (c) 2 r 118 (18) Tinsley la Chambliss Eula (c) maid Macon Hosp r 570 Elm mer's al Chambers Avner (Anne) (o) Lumber Co h 571 College pres Chamber Chambliss Florence (c) cook B P O'Neal r 218 Summit Hill (S) Chambliss Frank (c; Mollie) 1 lab C of Ga Ry Chambers Booker T (c; Alberta) chauf B P O'Neal r 214 Madison Chambers Danl W wtchmn Yates & Tabor Gro h 118 (18) Tinsley la Chambliss Gladys (c) emp Bibb Mfg Co r 158 Ernest l3< Co r 262 Broadway Chambliss Gussie L (c) cook r 203 Roosevelt Chambers Edw (Mary R) 3 meat ctr PigglyWiggly h 131 Appleton Chambers Emma (Mrs F E) nurse Macon Hosp r 553 Orange Apt 1 Chambers Fred E (Emma) slsmn h 553 Orange (V) Chambliss Hollis (c) picker Payne Mills r 297 1st (V) Chambliss James W r 294 Belmont Chambliss John (c; Rosa) r 160 Sycamore (V) Apt 1 Chambliss John (c; Azzene) emp C of Ga Ry h Chambers Grover H student r 131 Appleton 753 Elm Chambers Hester (c) r 408 (720) Campbell Chambliss Joseph (c; Marion) 1 chauf Eva (SM) Harris r 208 Fargason (V) Chambers Howell C (Rosa L) 3 emp C of Ga Chambliss Joseph (c) student r 203 Roosevelt Ry h 97 (143) Colquitt m Chambers Hugh (Eliz) (o) judge Municipal Chambliss Joyce student r 347 Hines ter (V) Court h 1406 Vineville (V) Chambliss Julia B (c) cook U T Winslett r 203 Chambers J B student r 131 Appleton Roosevelt (V) Chambers Jas C (Claudia M) br mgr Rogers Chambliss Lizzie (c) r 117 Jordan Stores r 757 Pine Chambliss Loris C (Chambliss Gro Store) r 294 Chambers James J (Julia) (o) slsmn h 465 Belmont Napier Chambliss Lucille (c) cook C H Campbell Chambers John (c; Lillie) lab Atlantic Ice & Chambliss Mamie I (c) cook E L Sandefur r Coal Co h 1025 3d 203 Roosevelt Chambers Lumber Co Avner Chambers pres Chambliss Market (L C Chambliss) 300 (228) 150 Railroad Pio Nono Chambers Mary W r 172 North (NH) Chambliss Mittie (c) 1 h 203 Roosevelt (V) Chambers Sami (Lorene) tex wkr Bibb Mfg Chambliss Oscar L (Maggie) 3 carp h 106 Har- Co r 16 Bibb rold Chambers W Ross (Mary W) (o) emp Region- Chambliss Patrick V (Kate)l detective CPD al Agricultural Credit Corp h 172 North (NH) r 294 Belmont Chambers Woodfin C (Minnie) sta atndt Chambliss Paul (o) mgr Chambliss Mkt h 294 Standard Oil Co h 139 Daisy pk Belmont Chamblee C Robt (Stanley) 1 mgr Otis Eleva- Chambliss Pearl Mrs 1 r 114 Madden tor Co h 108 Cleveland (V) Chambliss Robt (c; Rosa L) 1 h 461 Douglas Chamblee Ula (c) 2 maid Macon Hosp h 137 e (V) Ell Chambliss Robt B (Thelma) 2 pntr h 759 Hem- Chambler Aurelia (c) r 137 e Ell lock Chambless A Louie brklyr r 721 Pine Chambliss Rosa (c) maid W C Blount Jr 10 Chambless Annie P Mrs lab r 532 Telfair (SM) Sycamore Chambless C Eug (Annie L) 2 emp Wesleyan Chambliss Roscoe (c) emp So Crate & Veneer Conservatory h 759 Mulberry Co h 117 Jordan Chambless Clarence C (Fannie O) 1 chauf Cud- Chambliss Roy auto repr 364 1st r Gray Ga ahy Pkg Co r 619 Oglethorpe Chambliss Sanford (c; Isabel) lab Bibb Mfg Co Chambless Doris elk Newberry's r 759 Mul- h 214 (217) Summitt Hill (S) berry Chambliss Thelma (Mrs R B) mach opr Happ Chambless Dorothy elk Newberry's r 759 Mul- Bros Co r 759 Hemlock berry Chambliss Vivian (c) r 1018 Ocmulgee Chambless O Wm (Lucille) brklyr r 721 Pine Chambliss Walter F (c; Laura) hlpr Macon Chambless R Lonie dr Yellow Cab Co r 721 Peanut Storage Co h 1018 Ocmulgee Pine Chambliss Wm (c; Mary) h 109 (5) Braswell Chambless Sami E (Clara) 1 pressmn Am la Printing Co r 759 Mulberry Champion Andrew J Jr (Pearl) 1 tex wkr Will- Chambley Bessie spooler Bibb Mfg Co r 138 ingham Mill h 110 Bell Comer ter (PM) Champion B Jeff serv sta 970 1st r 555 New Chambley Grady creeler Bibb Mfg Co r 138 Champion Cora (c) 7 lndrs h 420 Lawton Comer ter (PM) Chambley Ida (Mrs J A) tex wkr Bibb Mfg Co r 139 Comer ter (PM) Chambley Jesse A (Ida) 1 doffer Bibb Mfg Co h 139 Comer ter (PM) Chambliss Albert (c) emp Coleman Meadow & Pate Drug Co r 203 Roosevelt (V) Champion Frank solr Independent Ldry Co r Capitol Hotel Champion Isaac N (Beatrice) (o) supt Bankers H & L Ins Co h 338 North Champion Jack M slsmn Collins Baking Co 719 Log Cabin blvd Chambliss Alice (c) emp Proctor & Gamble Champion Thos (Fannie) 2 emp Willingham Mfg Co r 1325 Broadway Mill h 107 Roff Home 174 Baldwin's and Telegraph's Champion Thos G (Clara) 1 tr dr r 202 Lyn- Chaney Preston (c; Lillie B) 1 h 124 (239) more Railroad Champion Wm (c) hlpr Muecke Art Craft Stu- Chaney Stonewall (c) emp G Bemd Co r 177 dio r 72 Oliver 2d (V) Chance Albert R (Lillie M) 1 patrolmn CPD Chaney Thos (c; Willie) r 227 Jefferson h 424 Cleveland Chaney Wm A (c; Zeadean) 1 (o) elk Ry MS Chance Clara (c) r 902 Elbert h 312 Forrest Chance Erin Mrs slswn Union Dry Gds Co r Chaney Willie (c) cook P H Williams r 227 131 Cole Jefferson Chance J Edgar (Ethel) 2 (o) eng C of Ga Ry Chaney Willie L (c) 1 dom r 154 Ernest la h 1542 3d Chanin Auto Parts & Bottle Supply Co (Harry Chance James F (Mary E) 1 (o) brkmn C of Chanin) 768-70 Broadway Ga Ry h 101 Ormond ter Chanin Barnett (Ida G) (o) gro 652 Poplar h Chance Joseph M (Ethel E) (o) civ eng h 3808 805 Orange Houston Chanin Eva (wid Sami) 2 (o) gro 1072 Ogle- Chance Wm (c; Rosa) 2 lab h 114 (48) New thorpe r 1068 do St la Chanin Harry (Chanin Auto Parts & Bottle Chancellor Allan Y (Birdie E) 1 sten FERA Sup Co) r 1068 Oglethorpe r 90 Lawton Chanin Isadore r 805 Orange Chancellor Chas L (Emma) gro 1026 Main Chanin Isadore slsmn Chanin Auto Parts & (EM) r 1120 Elm Bottle Sup Co r 1068 Oglethorpe Chancellor Edw (Alma) 2 slsmn Sunshine Chanin Moses student r 805 Orange Creamery h 260 Jeff Davis (SM) Chanin Sami elk Barnett Chanin r 805 Orange Chancellor Floyd H (Julia) 2 sec-treas Ga Seed Chaplain Maude F tchr Wesleyan Conserva- Store h 118 Ormond ter tory r do Chancellor Jewett A (Cora) 1 h 1120 Elm Chaplin Arth W (Rosalie) osteo 219 Bibb bldg Chancellor Wm A (Miona) 2 plmbr Millirons r 82 Arlington pi Plmbg & Heating Co h 247 Williams Chaplin Maude F prof Wesleyan Col r do Chancey Geo (c; Leona) lab Elkan Stone Tile Chaplin Rosa (Arlington PI Kindergarten) h 82 Mfg Co h 362 Bay Arlington pi Chancey Hubert C shpr Bibb Mfg Co Chapman Allie r 159 Jeff Davis (SM) Chancy Betty opr Cherry Beauty Shop r 220 Chapman Carl F (Vincent S) 2 (o) dep elk New County Tajc coir h 410 Napier Chandler Alva R (Willie M) 1 (o) sgt So Ry Chapman Carlton (c; Ruby) lab h 130 Army h 407 Forest Hill lot Chandler Carter E (Marilou) chf opr WU Teleg Chapman Carrie M (c) r 133 McKay's al Co h 106 Overlook (I) Chapman Chas (c) r 230 (130) Cowan Chandler Cornelius B (Helen) atndt Red Star Chapman Chas (c) r 14 Gustin Serv Sta r 871 Cherry Chapman Chas L (Ruby L) 1 (o) aud Dannen- Chandler Emmie D student r 407 Forest Hill berg's h 217 Villa Esta Chandler Gussie L (c) cook W C Slocumb r CHAPMAN CHESTER G (Lilia B) (Chap- Pleasant Hill man's Garage; Drive It Yourself Co) r Cen- Chandler Helen W (Mrs C B) sten Jones, tral Hotel Johnston, Russell & Sparks r 871 Cherry Chapman Claude (c; Missie) emp Bibb Mfg Chandler Henry H (Margt G) cred mgr Mtr Co h 159 Coles al Parts Corp h 129 Clisby pi Chapman Clyde A mech Chapman's Garage r Chandler Kyle slsmn Swift & Co r 385 Orange 519 Walnut Chandler Marilou (Mrs C E) opr WU Teleg Chapman Collie C (c) instr Central City Col Co r 106 Overlook, (X) r 1035 Clinton rd Chandler Myrtie (wid A D) r 106 Overlook (I) Chapman Corene nurse FERA r 864 Mulberry Chandler Nell (c) 1 r 152 Walker la apt G1 Chandler Phyllis (c) 1 h 216 Division Chapman Dean (c; Lizzie) atndt Stewart Oil Chandler R Moye (Thelma) 1 supv h 211 Co r 116 (554) Magnolia la Hines ter (V) Chapman Dora (e) r 301 (204) Colquitt CHANDLER SAM S (Hettie H) 3 (o), Pres Chapman Dora B (c) r 609 (100) Elliott Chandler & Strickland Co h 112 Summit-- Chapman Edw C (c; Lillie) emp Tank Car tel 6290 Serv Sta h 301 (204) Colquitt Chandler Sol (c; Emma) h 205 (128) Jones Chapman Eliz (c) cook H D Chapman r 568 St la Monroe (V) Chandler Wm L (Maude) chf dispr C of Ga Chapman Emma (c) dom h 711 (r) Broadway Ry h 316 Linden Chapman Eug J (c; Essie) (o) taxi dr Colored Chandler Willis (c) porter O C Tripp Cab h 962 (1007) Montpelier CHANDLER & STRICKLAND CO Sam S Chapman Georgia (Mrs W C) opr Happ Bros Chandler Pres, Earle H Strickland Sec-Treas, r 1704 2d Genl Ins 206-07 Ga Casualty bldg--tels 426- Chapman H D & Co (HD Chapman, H M 427 (See Back Cover Supp and Page 89) Reid) whol lbr 203-05 Grand bldg Chaney Annie (c) dom Ingleside h 100 Pond Chapman H Morris (Mary) r 910 Orange (V) Chapman Harriet student r 305 Adams Chaney Henry (c; Mary) (o) lab h 596 (108) Chapman Harry D (Annie C) (o) (HD Chap- Norris man & Co) h 305 Adams Chaney James (c; Ella) lab C of Ga Ry h 318 Chapman Hattie (e) maid Eliz Hodges r 421 Calhoun (r) Oak Chaney Marian (c) maid Ruth Carmichael r Chapman Henry W (Ida M) b'r mgr Piggly- 135 Roosevelt Wiggly r 666 College Chaney Marie (c) r 475 Chestnut CHAPMAN HOLT (Anne T) 1 (o) (Chapman's Chaney Maynard (c; Mamie L) lab Idle Hour Pharm) h 204 Clisby pi--tel 4195 Club h 135 Roosevelt (V) Chapman Homer J (Maysie) 2 elk Birdsey Flour Chaney Mose (c) lab r 303 Forest (V) Mills r 119 (7) Myrtle (EM) ' 1935 Macon City Directory 175 Chapman Hubert E (Esther) supt plant GaCaro Oil Co r 246 Jeff Davis Chapman James T (Beatrice) 4 swtchmn C of Ga Ry h 2018 2d Chapman John (Minnie) h 608 Main Chapman John A (Ella) (o) (Chapman's Gro- ceteria) h 3032 Houston (SM) Chapman Joseph (c) emp Bibb Mfg Co r 127 (229) Nussbaum Chapman L Hubert (Ann) h 811 Poplar apt 12 Chapman Laura (c) r 75 (82) Schofield Chapman Leo (c; Ida) lab Maxwell Bros r 512 (112) Elliott Chapman Leonard (c; Nettie) farmer h 972 Montpelier Chapman Lester H (Willie) 1 coroner Bibb County h 121 Holt Chapman Lewis C r 100 Putnam (SM) Chapman Lila M student r 305 Adams Chapman Lillie B (c) cook E G Fields r 301 (204) Colquitt Chapman Lilia B (Mrs C G) sten Bibb Mfg Co r Central Hotel Chapman Louis P (Louise) 1 (The Yellow Jacket) h 116 Summit Chapman Louise (Mrs L P) bkpr Empire Furn Co Inc r 116 Summit Chapman Margt student r 410 Napier Chapman Martha (c) cook Penelope Edward's h 4 Alabama (SM) Chapman Mary (Mrs R R) opr Adams Mfg Co r 862 New Chapman Mary (Mrs H M) opr Adams Mfg Co r 910 Orange Chapman Maysie (Mrs H J) winder Bibb' Mfg Co r 7 Myrtle Chapman Merle E (Esther) 2 pastor Seventh Day Adventist Ch h 1420 Oglethorpe Chapman Milton (c; Carrie) emp Goodyear Serv Sta r 104 Spring Chapman Minnie (c) 3 lab So Crate & Ve- neer Co h 4 Mitchell la (EM) Chapman Nellie L (c) r 820 Montpelier Chapman Nettie (c) maid Louise Klein r 972 Montpelier Chapman Philip R (c) (o) farmer h 820 Mont- pelier Chapman Randolph R (Mary) solr Independ- ent Ldry r 862 New Chapman Ruby (c) maid J L Walker r 130 Army lot Chapman Seaborn (c; Daisy) 1 lab Macon Co- operage Co r 112 Ash Chapman Silas (c; Rosa L) r 104 Rock Chapman Virginia student r 910 Orange Chapman Walter B (Victoria)' 1 (o) car repr So Ry h 207 Newberg (SM) Chapman Washington (c; Tommie) 2 lab Ma- con Coca-Cola Btlg Co h 209 Plant Chapman Wesley C (Georgia) sta opr Power Oil Co r 1704 2d Chapman Wm F (Alma) hlpr h 600 Main (EM) Chapman Wm H (Eliz) emp So Ry h 910 Orange CHAPMAN'S GARAGE (Chester G Chapman), Auto Repairing, Batteries, Tires, Gasoline, Oil, Wrecker & Drive It Yourself Service, 413-19 Mulberry--tel 2951 (See front cover supp and cards BD) Chapman's Groceteria (J A Chapman) 3102 Houston (SM) CHAPMAN'S PHARMACY (Holt Chapman), 574 Mulberry--tels 1860-1-62 Chappel Annie M (c) h 518 e 2d (EM) Chappel Belle (c) 2 cook C L Collins h 115 (122) Phillips la Chappel Geo W (c) lab r 518 e 2d (EM) Chappel Mattie (c) r 111 (187) May Chappell Amelia (c) r 824 Edgewood (SM) Chappell Amos (c) (o) lab h 316 (340) Tindall (SM) Chappell Clarence J (o) elk Bibb Mfg Co h 716 Forsyth Chappell Essie (c) maid r 302 Crisp Chappell Henry (c) 1 lab h 302 Crisp Chappell Isaac H (Jannice) bkpr G G Harde- man Co h 333 Hines ter Chappell Jannice (Mrs I H) sten Ga Power Co h 333 Hines ter Chappell John (c; Iona) 5 tr dr Empire Furn Co Inc h 172 Northwest Boundary Chappell Lizzie Baptist Church (c) 126 Bart- letts la Chappell Logan S student r 716 Forsyth Chappell Nora A (wid A E) (o) h 2516 Forsyth rd Chappell Sami (c; Bessie) h 100 Kitchens Chappell W Allen (Golda H) slsmn Bibb Mfg Co r 2520 Forsyth rd Chappell Walter (c; Georgia L) sta atndt Woco Pep Oil Co h 304 Woods al Chappell Wm (c) student r 172 Northwest Boundary Chappie Alf B (Sonia) 1 serv sta 113 Napier h 156 Hugenin Chappie Amelia (c) cook Lizzie Couey r 824 Edgewood Chappie Elmo C sta atndt A B Chappie r 106 Napier Chappie Frances student r 106 Napier Chappie Georgia tchr Winship Sch r 106 Napier Chappie James A hlpr Armour & Co r 224 Georgia Chappie Margt student r 106 Napier Chappie Wm E (Maggie H) 1 (o) farmer h 106 Napier Charis Corp Mamie Whitehead mgr corsets 606 Grand bldg Charles Sourie Mrs mus tchr 520 Orange apt 2 r do Charleston Equilla (e) nurse 243 Jones r do Charleston Forest (c; Ollie) lab r 320 Mon- roe (V) Charlie's Place (C A Smith) serv sta 2447 Broadway Chason Eleanor opr So Bell Tel Co r 168 High Chason James H (Rosa) dispr C of Ga Ry h . 121 Washington Chastain Geo S (Jessie M) 1 tex wkr Bibb Mfg Co h 746 Oglethorpe Chastain Jessie M (Mrs G S) tex wkr Bibb Mfg Co r 746 Oglethorpe Chastain Lawrence spinner Bibb Mfg Co r 35 Bibb Chasteen B Frank (Grace) emp Collins Bakery r 811 Hemlock Chasteen Bert M (Ina) 1 miller Birdsey Flour Mills h 720 College Chasteen Robt fountain atndt Mitchell & Wil- liams Co r 720 College Chasteen Virginia r 720 College Chatfield Belle (wid J P) h 335 College Chatfield Benj student r 335 College Chatfield Henry (c; Essie) 2 r 1413 1st Chatfield Minnie B (c) 3 h 127 Wyche Chatwick Alberta r 121 Vista cir (I) Chatman, See Chapman Cheatham Bertie M (Mrs R S) tel opr Macon Hosp r 132 Highland Cheatham David R r 256 Bankston Cheatham Elbert H (Lucille) 6 private detec- tive h 360 Church (EM) Cheatham Ellen L student r 360 Church 176 Baldwin's and Telegraph's Cheatham Ernest W (Mallory) 5 tr dr Atlantic Ice & Coal Co h 213 Reid Cheatham Grace T Mrs 1 elk Bibb Relief h 147 Daisy Park Cheatham Iola (wid Wm) 1 (o) h 91 Lawton Cheatham Louise r 91 Lawton Cheatham Margt (Mrs G C) 1 r 421 Forest (V) Cheatham Oscar (c; Shelley) 2 firemn r 51 Parker (V) Cheatham Rufus S (Bertie M) 1 emp Macon Telegraph h 132 Highland Cherry Nettie H Mrs sten Martin, Martin & Snow r 123 Culver Cherry Ruth (Mrs Joshua) smstrs Bibb Mfg Co r 8 Bibb Cherry Sami r 421 Calhoun Cherry Street Service Station E B Harris mgr 673 Cherry CHERRY W COMER (Frances G) Mgr Macon Credit Bureau, h 356 Pierce (V)--tel 4194-W Cherry Wm (c; Dovie) 1 emp Bibb Mfg Co h 521 (501) e Academy (EM) Cherry Wm F (Grace) 2 plmbr r 1016 2d Cheatham Sidney F elk Piggly-Wiggly r 147 Daisy Park Cheatham Wallace D (Inez) 1 (o) piano tuner h 256 Bankston Cheek Aldine L (Maude) (o) patrolman CPD h 197 Oakland Cheek Benj T elk Willingham Auto Co r 242 Jeff Davis (SM) Cheek Cary H hlpr Macon Storage Battery Co r 242 Jeff Davis Cheek Herbert H cash The Southeastern Opti- Cherry Wm H (Jewell) 1 slsmn Carter Hdwe & Sup Co r 723 1st Cherrydale Apartments 818 Cherry Cheshire Bertha student r 101 Yates Cheshire Jos E (Minnie) 7 tex wkr Bibb Mfg Co h 101 Yates Chester Alberta (wid H A) 1 drs mkr 742 College r do Chester Alice L (wid J T) h 1229 2d Chester Earl r 119 Yates Chester Guy B (Annie M)1 emp card rm Bibb cal Co r 375 College Cheek Mattie M (wid H T) 3 r 242 Jeff Davis (SM) Cheek Oda (wid D C) r 229 (233) Ayers rd (B) Mfg Co h 35 Bibb Chester Herman D emp John Hainline r 119 Yates Chester Hansford D (Pollie) 6 h 119 Yates Cheese Rosa M (c) 1 r 608 (321) Charles Cheeseman's Ice Cream Shops Inc Melvin Aston mgr 355 3d Cheeves Albert (c; Leila) 1 (o) h 237 Woodliff Cheeves Albert Jr (c) r 237 Woodliff Cheeves Anderson A (c; Minnie L) 2 r 116 Ward (V) Cheeves Jos P (Edna) 1 with Gulf Refining Co r 504 Beech Cheeves Leila (c) seh tchr r 237 Woodliff Chester Idus (c; Eliz) 1 lab C of Ga Ry h 724 Edgewood Chester Melba r 119 Yates Chestney B Ruffin (Ruth) 1 div mgr Ga Power Co h 103 Osborne pi (I) Chestney Percy (Mamie J (o) supt PO h 128 2d Chestnut Amelia (c) cook Kate Gilbert r 230 Neal Chestnut Harriet (c) h 160 e Academy (EM) Chestnut Joseph (c; Amelia) carp h 230 Neal Cheeves Rodney W bkpr Chapman's Garage r (V) 619 Spring Cheney Eugenia r 99 Vineville apt Cl Cheney Frank (Thelma C) elk Harris Loan Co r RD Miller Field Cheney J Wm r 99 Vineville Apt Cl Chestnutt J L (Willie M) 2 sausage mkr T&T Pkg Co r 714 Pine Chestnutt Owen M ins rep So Bell Tel Co r Southland Hotel Chestnutt Wm T (Montine) 2 slsmn Ga Power Cheney John J (Georgia L) (o) lino opr Macon Teleg h 526 Montpelier Cheney Julius P (Renee S) flgmn h 115 (109) Co h 207 Brentwood Cheves David C tex wkr Willingham Mills r 317 Morgan Montpelier Cheney Thelma Mrs sten Carter Hdwe & Sup Cheves Emily student r 307 Center (EM) Cheves Jesse R (Annie F) 2 elk h 135 Culver Co Cheney W Hood (Allene) div supt So Ry h 99 Vineville apt Cl (V) Cheves John H r 317 Morgan Cheves John L (Minnie) 2 (o) h 307 Center Cheney Willa L (c) cook E J House r Bartletts Crossing Cherokee Barber Shop (D L Ross) 803 Montpelier Cherokee Brick Company K W Dunwoody pint (EM) Cheves John W (Mary) 1 (Cheves Serv Sta) h 619 Walnut apt 7 Cheves Joseph P (Cheves Serv Sta) r 504 Beech supt plant end Waterville rd Cherokee Heights Baptist Church W F Hines- ley pastor 718 Napier Cheves Rodney W bkpr Chapman's Garage r 619 Spring Cheves Service Station (J P & J W Cheves) Cherokee Heights ME Church J R Webb pas- 207 2d tor 670 Napier Cheves Wm H (Annie L) h 317 Morgan Cherokee Pharmacy (J M McGaw) 801 Mont- Chew Tullia G (Mrs WH) r 56 Marion pi pelier CHEW W HUBERT (Dorothy), 1 Mgr Day's h Cherrio The (C M Rankin) beer 220 Cotton 56 Marion pi--tel 3844-J Cherry Andrew J wtchmn Gantt Mfg h 1314: 3d Chew Walter S coir Citizens & So Nat Bk r Cherry Beauty Shop (Mrs Iver B Tronce) 605 Cherry Cherry Eunice (wid H G) 1 h 1016 2d 56 Marion pi CHICHESTER HELON L (Jeanette M) 2 (o) (Chichester Tatnall Sq Drug Store; College Cherry Frances G (Mrs W C) bkpr D H Adams Hill Pharm; Ingleside Pharm; Wesleyan Mtr Co r 356 Pierce (V) Cherry Grace (Mrs W F) smstrs Bibb Mfg Co r 1016 2d Pharm), h 304 Corbin (V)--tel 1054-J CHICHESTER'S TATNALL SQUARE DRUG STORE (H L Chichester) 601 Linden--tel Cherry Henry T (Nettie) slsmn Freeman Dent 382-383 Sullivan Co h 123 Culver (V) Childers David T (Daisy) slsmn Lee & Smith Cherry Henry T Jr student r 123 Culver (V) Mule Co r 220 New Cherry John r 421 Calhoun Childers John L (Lina) h 280 (r) Main (EM) Cherry Joshua (Ruth) 4 emp Bibb Mfg Co h Childes James T (Eliz) 2 hosemn CFD r 153 8 Bibb Magnolia 1935 Macon City Directory 171 Childree Allen (Fannie) 1 tex wkr h 8 Roff Home pi Childree Harold L r 220 Reid Childress Virginia ofc sec US Dept of Agr r 826 Orange Childs Benj F emp C of Ga Ry Childs Beulah (c) 1 r 324 Ballard (EM) Childs Chapel (c) 110 2d (U) Childs Chas (c) emp G Bernd Co r 714 May- nard Childs Ella Mrs opr Happ Bros Co r 459 New Childs Ellen (wid J B) gro 670 Ash h do Childs Flossie C (wid Jesse) sten r 438 Vine- ville Childs Georgia (c) h 334 Dempsey Childs H Walter (c; Daisy) carp h 815 May- nard Childs Hattie L (c) r 215 Northwest Boundary Childs Ida (c) h 324 Ballard (EM) Childs J Archie (Jewel) slsmn r 438 Carling Childs James R (Minnie) 1 emp Dixie Cafe & Commissary h 753 Mulberry Childs John (c) delmn Jacobs Pharm r 215 Northwest Boundary Childs John D (Pallie) gro 1119 Ash h do Childs Kate (c) maid Oglethorpe Private In- firmary r 1225 3d Childs Mamie R r 459 New Childs Myrtice mach opr Happ Bros Co r 753 Mulberry Childs Raymond (c) tchr Hazel St Sch r 334 Dempsey Childs Rhoda (c) h 114 Ballard (EM) Childs Sallie (c) h 7 (3564) Duffeys al Childs Seymore (c; Sadie) 5 h 215 Northwest Boundary Childs Seymore Jr (c) r 215 Northwest Boun- dary Childs Thos O (Cora) 3 plstr h 433 Ross Childs Wm C (Ida) r 136 Cole CHILDS WYATT B (Lillian) 3 (o) Orthodon- tist 701-04 Ga Casualty bldg--tel 4341, h 106 Corbin (V)--tel 4690 (See Page 104) Chiles Benj (c) r 122 (52) Walls al Chiles Clementine student r 161 Daisy Park Chiles Mack S (Clem) 1 (o) condr GS&FRR h 161 Daisy Park Chiles Mamie (c) dom r 108 (102) Pringle Chiles Mary (c) h 122 (52) Walls al Chillers Carrie (c) 3 cook h 203 (604) Williams (EM) Chillers Robt L (c; Ida) emp r 203 (604) Williams (EM) Chillers Walker (c; Lucile) lab h 701 Maynard Chirbas Chas S (Hettie) 2 (Philadelphia Hat Cleaning Co) h 124 Academy Chiropractic Health Home A W White pres 501 College Chitty Leo E (Georgia) 2 hlpr Maxwell Bros h 514 Oglethorpe Choates Essie (c) cook E L Scarborough Christian G Robt emp Bell's Pharm r 319 Johnson Christian Glover L (Nannie M) hlpr Houston Av Vulcanizing Shop r 518 Oglethorpe Christian Henry J (Betty) emp Washburn Whse h 903 Clinton Christian Jeanie (wid F R) r 960 1st Christian Joseph (Louise) emp Willingham Mills r 26 (88) Mill Christian L Nora student r 338 Clinton Christian Lavinia tchr Alex Sch No 3 r 338 Clinton Christian Leila B (Mrs C T) ins agt Liberty Nat Life Ins Co r 402 Ingleside Christian Leola (c) maid G H Bridgers Christian Mildred L r 319 Johnson Christian Nannie M (Mrs G L) opr Happ Bros Co r 518 Oglethorpe Christian Oscar C wtchmn r 903 Clinton Christian Patricia r 456 Oak Christian Raiford (Thelma) pntr h 2023 3d Christian Robt C (Carrie) 1 h 622 Hawthorne Christian S Percy (Alma L) 1 h 338 Clinton Christian Sara D r 419 Duncan Christian Science Reading Room Mrs Margt Penn librarian 314 Ga Casualty bldg Christian Wm L r 622 Hawthorne Christie J E (Dorothy) 1 serv sta supv Stand- ard Oil Co h 401 College apt 4C Christmas J Roy pntr City r 2721 Houston (SM) Christmas Jeanette slswn Silvers r 2721 Houston (SM) Christmas Roy (Mabelle) 2 emp City r 361 Church (EM) Christodoulo Theo emp Bibb Mfg Co r YMCA Christopulos Ella Mrs h 761 Poplar Christopholus Nick r Fickling Hotel Church of Christ 501 Giles apt 4 Church of Christ (c) 501 Henrietta Church of Christ Jack McElroy pastor 145 Knott Church of God Graham Oglesby pastor 116 American blvd Church of God (c) 103 Grant (V) Church of God (c) 129 Woodliff Church of God in Christ (c) 823 Ash Churchill Bernice r 768 Mulberry Churchill Ella Mrs r 768 Mulberry Churchill John R (o) (Clinton Cash Mkt) h 304 Jones (EM) Churchwell D Lee (Katie K) lawyer 2 Wash- ington bldg h 515 Vineville Churchwell James L plstr r 121 Emory (SM) Churchwell Sidney H student r 121 Emory (SM) Churchwell W Henry (Susie) 4 (o) h 121 Emory (SM) Churchwell Wm C mech r 121 Emory (SM) Citizens Loan Co C H Jones mgr 217 Bibb bldg Chrisman Wm W (Selma) 1 (o) phys 210 Doc- CITIZENS & SOUTHERN NATIONAL BANK, tors Bldg h 112 Corbin Mills B Lane (Savannah Ga) Chairman of Christ Episcopal Church Mortimer Glover pastor 520 Walnut the Board, Wm Murphey (Savannah Ga) Pres, John E Wallace (Savannah Ga) Asst to Christ Episcopal Church (parish house) 518 Pres, T Irving Denmark Vp, E Cleveland Walnut Scott Vp and Trust Officer, Pierce G BUtch Christian Alma L (Mrs S P) opr Happ Bros r Cashier, Compton H Usina Asst Cashier, W 338 Clinton D Anderson, W E Dunwoody, Dr C C Har- Christian Alma N (wid Thos) sten Auto Banx r Columbus rd Christian Bertha (c) dom Mamie J Whitehead r 955 Hazel Christian Curtis T (Leila B) 1 (o) pharm Alf Mack's Pharm Inc h 403 Ingleside (I) rold, R J Taylor, McKibben Lane, B P O'Neal and T J Stewart Directors, 461 Cherry--tel 4671 (See Page 46) CITY BANK & TRUST CO, T Rad Turner Pres, P T Anderson Vp, R H Kingman Jr Vp, G G Abney Cash, 617 Cherry--tels 17551756 Christian Curtis T Jr (Mary) slsmn r 403 Ingleside (I) CITY DIRECTORY OFFICE 450-452 Cherry-- Tel 6500 178 Baldwin's and Telegraph's CITY DIRECTORY PUBLISHERS--See Baldwin Directory Co Ino City Finance Co J B Harrison Jr mgr loans 406 Poplar CITY HALL, Poplar bet 1st and Cotton City Investment Co J Clay Murphey pres S T Coleman sec-treas real est loans 470 Cherry CITY OF MACON (See Macon--City of) City Storage Garage J N Wood Jr mgr 411- 17 Poplar City Welding Co ( MW Howard) 721 Broadway Claiborne Julia (c) r 168 (124) Plummers al Claiborne Randolph R Jr pastor St James Epis- copal Ch r 460 Hill Chest Claire Maxie (wid Wm) r 411 Forest Hill Clance Carroll (Eunice G) 2 elk Edw Smith's Gro h 117 Crisp Clance Ethel A opr Happ Bros Co r 3040 Houston Clance Evelyn opr Happ Bros Co r 3040 Houston Clance J Edw (Mary J) 2 slsmn h 721 Pine Clance James M (Thelma) 1 slsmn Union Dry Gds Co h 928 Walnut Clance Mary J (Mrs J E) opr Happ Bros Co r 721 Pine Clance Missouri (wid W C) h 3040 Houston (SM) Clance Ruby r 3040 Houston (SM) Clance Rufus (Eunice) mach Willingham S&D Co r 854 Hemlock Clance Rubye opr Happ Bros Co r 3040 Hous- ton Clanton Ozell H (Nattie L) 4 emp Willingham Mills h 315 (112) Dannenberg Clapp Dorland L (Lucy) jwlr Matthews Jewel- ry Co h 138 Virginia Clarington Alice (c) clnr Payne Mill r 410 Roye Clarington James (c; Sadie) lab So Crate & Veneer Co r 307 Gilmer Clarington James lab So Crate & Veneer Co h 410 Roye Clarington Mary (c) dom G H Coleman r 410 Roye Clark Agnes (c) cook H T Brown r 235 Riley (CP) Clark Alma Mrs opr Bibb Mfg Co r 37 Taylor Clark Alvin (c) student r 306 Green Clark Anderson (Jane) slsmn Davis & Birch h 102 Pursley (V) Clark Ann student r 112 (192) Buckingham pi Clark Annie (c) cook Odessa Brice r 770 Ocmulgee Clark Arth S (Agnes) 2 hlpr h 105 Enter- prise Clark Augustus H (Thos J) (o) condr C of Ga Ry h 107 Hill Crest Clark Augustus H Jr student r 107 Hill Crest Clark Austin (c; Ola) 1 emp Jeffreys-McElrath Mfg Co h 204 Summit Hill (SM) Clark Berry (c; Druie K) 1 (o) swtchmn Ter- minal Sta h 208 Grant (V) Clark Bertha (c) cook L A Clarke r 487 Short (V) Clark Bessie K (c) maid r 100 (3400) Lynmore Clark Bud student r 112 (192) Buckingham pi Clark Chas (c) hlpr Middle Ga Lbr Co Clark Claude C (Clifford) 2 tr dr h 369 Wor- sham (Lynmore Estates) Clark Claudie L r 369 Worsham (Lynmore Es- tates) Clark Cleveland (c; Katie) h 306 Green Clark Cleveland M (Jessie) 3 tex wkr Atlantic Cotton Mills h 14 Atlantic Village Clark Clinton C hlpr V V Mosley r 369 Wor- sham (Lynmore Estates) Clark Delia (c) h 178 5th (V) Clark Della (c) h 609 Strayers al Clark Delores (c) r 410 Gilmer Clark Dock (c; Lula) cook Bon Ton Cafe h 104 Roberts Clark Edgar A Lodge No 174 Ladies Auxiliary Order Ry Condrs Mrs Hattie Martin sec meets 1st & 3d Wednesday 3pm 408 Poplar Clark Edw C (c) 3 h 410 Gilmer Clark Eliza (c) (o) h 209 4th (V) Clark Eliz A r 219 Lawton Clark Eliz P (Mrs W M) slswn Dannenberg's r 116 Stonewall pi Clark Ellis Y sls/m Larus Bros Tobacco Co r 350 Hines ter (V) Clark Emma (c) cook Annie S Deaust r 123 Holt Clark Emma A (wid H V) h 131 High Clark Emory G (Myrtice) aud Happ Bros h 597 Hillyer Clark Emory G Jr student r 597 Hillyer Clark Ernest (c; Sallie) 3 lab h 983 Montpelier Clark Etta (c) maid Dempsey Hotel h 412 Gilmer Clark Eug O (Elsie) 2 tchr Lanier High Sch. for Boys h 160 English Clark Frances (c) h 108 2d (V) Clark Francis G (Eliz N) r 105 Oak (I) Clark Geo (c; Annie R) emp Ga Industrial Home r 108 Simmons Clark Geo (c; Amanda) lab C of Ga Ry h 129 (125) Williams la Clark Geo A (Edith D) meterologist US Weather Bur h 417 Ridge (I) Clark Geo B r 3.77 Hill Crest Clark Gilliam (Macie L) 1 dentist 711 Bibb Bldg h 350 Hines ter (V) Clark Gus r 555 New Clark Harry (Ruth L) 4 lab h 303 Rutherford (SM) Clark Henry D (Mary) 1 bus opr Ga Power Co h 219 Lawton Clark Hoke (c) r 412 Gilmer Clark Ida (c) maid I H Chappell r 235 5th (V) Clark Ida S (Mrs L A) ofc sec Nat Reemployment Serv h 114 (194) Buckingham pi Clark Irma M (wid M A (o) h 301 Hardeman Clark J Holmes (Mildred) 3 (o) slsmn Nat Biscuit Co h 1 Drury (I) Clark James (c; Willie) 5 h 212 Green Clark James (c; Lonia) 1 emp r 100 (205) Amos (V) Clark James L (c) 2 h 1 Fordville la Clark Jennings r 107 Hill Crest CLARK JOHN B (Lillie P) (o), Dean Mercer University, h 685 Napier--tel 2128-J Clark John B (Maude M) 1 tr dr h 102 Melvin pi (Lynmore Estates) Clark John C r 14 Atlantic Village Clark John D student r 219 Lawton Clark John H (c; Hattie) emp F S Royster Guano Co h 703 Cowan Clark John L (c; Mattie) 1 emp Birdsey Flour Mill h 113 (600) Pringle Clark Johnnie B (c) lab Bibb Mfg Co h 714 (624) Prince (SM) Clark Joseph (c) butler W R Chambers r 609 4th (PH) Clark Joseph B (c) waiter Busy Corner Cafe r 455 Arch Clark Josephine A (Mrs W P) elk Newberry's r 1703 2d Clark L Milam atndt Shell Petroleum Corp r 264 Columbus Clark Lalla A (o) h 76 Arlington pla Clark Laura elk Prudential Ins Co r 112 (192) Buckingham pi 1935 Macon City Directory 179 Clark Lemuel tchr Lanier High Sch for Boys r 600 Napier Clark Leon P (Laura) 1 r 241 Belmont Clark Leonard D chauf CFD h 608 1st Clark Leroy (c; Beatrice) h 482 Short al (V) Clark Lester C (Hattie M) 3 (o) blksmth So Ry System h 125 Tenney (SM) Clark Lillie E r 1150 Napier Clark Lillie M (c) student r 306 Green Clark Louise presser Hill Dry Cleaning Co r RD 2 Clark Mack L (Alma) 2 emp Bibb Mfg Co h 37 Taylor Clark Mae r 111 Jefferson Clark Mae E (wid C J) (o) (Ingleside Oil Co) h 2502 Forsyth rd Clark Margt emp Macon Cafeteria r 160 Eng- lish Clark Martha (c) tchr Hazel St Sch r 802 H&zol Clark Mary (c) cook G L McDonald h 163 Tel- fair (SM) Clark Mary tex wkr Atlantic Cotton Mill r 14 Atlantic Village Clark Mary L (c) r 1223 Broadway Clark Mandy (c) cook r 129 (125) Williams la Clark Mattie (c) dom G L Richter r 113 (600) Pringle CLARK MEMORIALS INC, Hamilton Holt Pres, Russell H Clark Sec, W Egbert" Clark Treas, 2200 Forsyth rd--tel 3616 Clark Merle J (Lula) h 864 Elm Clark Minnie (c) cook L A Shirley Clark Nathan (c; Cora) lab h 227 Orange Clark Osgood (Ida) mgr Idle Hour Club' r 194 Buckingham pi Clark Overton P (Stella) 2 (o) supt JeffreysMcElrath Mfg Co h 619 Log Cabin blvd Clark Pearl (c) 4 student r 703 Cowan Clark Perry (c) swtchtndr Terminal Co Clark Perry (c) 5 tr dr Atlantic Ice & Coal Co h 301 Antioch rd Clark Quinton r 369 Worsham (Lynmore Estates) Clark Reuben (Jeanette) atndt Bob Stevens' Serv Sta r 116 Park pi Clark Robt (c; Lizzie) 1 lab r 855 Willow Clark Robt A (Emmie) (o) cement contr 311 (100) Ingleside (I) h do Clark Robt C (c; Estella pastor h 267 (358) White al Clark Robt E (o) h 1150 Napier Clark Robt E (Jeffie M) 2 tex wkr Atlantic Cotton Mills h 104 English Clark Robt G (c) butler L M Happ r RD 2 Clark Robt W (Christine C) asst to pres Willingham S&D Co h 177 Boulevard (NH) Clark Rosa (c) (o) cook J A Hall h 118 Brooklyn (S) CLARK RUSSELL H Sec Clark Memorials Inc, r 2502 Forsyth rd--tel 68 Clark Ruth tchr Winship Sch r 76 Arlington pi Clark Sarah C (wid A Q) r 110 Clayton (V) Clark Seth E (Dora) bus opr Ga Power Co h 264 Columbus Clark Sophie (c) 3 h 609 4th (V) Clark Stanley student r 597 Hillyer Clark Thos (c; Mary) r 126 Bright al Clark Thos D student r 107 Hill Crest Clark Thos H (c) student r 212 Green Clark Verna tchr Burke Sch r 301 Hardeman Clark W E (Belle) 2 patrolmn CPD h 2606 2d CLARK W EGBERT (Mary M), Treas Clark Memorials Inc, h 99 Vineville apt E 4--tel 1566-J Clark Wallace R (Frances J) mgr Singer Sewing Mach Co h 112 Rogers (V) Clark Walter (c; Annie) chauf Ellis Goldstein h 770 Ocmulgee Clark Walter B (Effie M) (o) linemn So Bell Tel Co h 713 Adams CLARK WALTER F (Minnie L), prop shoe dept Herbert Smart Clo Co Inc, h 109 Appleton--tel 2123-W Clark Wendell H sta mgr Shell Serv Sta r 264 Columbus Clark Willard M (Betty P) 2 auto mech McCormick Deering Store h 116 Stonewall pi (V) Clark Wm (c) r 410 Gilmer Clark Wm B (c) jan The New Yorker r 609 4th (V) Clark Wm J (c) pin str Lucky Strike Bowling Alleys r 212 Green Clark Willie B (c) r 164 Bay Clark Winnie (c) lndrs h 3 Park Hotel al Clarke A Turner (Emilie) 2 slsmn Wholesale Produce Co h 120 Crisp Clarke Albert E Jr (Shelverton-Bayne Drug Co) r Lanier Hotel Clarke Alice r 512 Walnut Clarke Annie tchr Alex Sch No 3 r 215 Spring Clarke Berta W bkpr Dessau Realty & Ins Co r 362 College Clarke Bessie (Mrs H H) opr Adams Mfg Co r 425 Mikado Clarke Birdie M (c) maid J N Mathews Clarke Chas R (c) r 616 Fort Hill Clarke Clifford E (Ella) (o) chf elk So Ry h 185 Hendley Clarke Dora Mrs h 619 Oglethorpe Clarke Dovie (wid J N) r 559 Oglethorpe Clarke Edw (c; Marie) emp Bibb Mfg Co h 260 Willingham la Clarke Erin O student r 211 Clayton (V) Clarke Eva (Mrs W E) opr Happ Bros Co r 559 Oglethorpe Clarke G Clisby (Erin O) (o) agt Conn Mut Life Ins Co h 211 Clayton (V) Clarke Gertie Lee (c) maid 519 Walnut Clarke Harry H (Bessie) 2 emp C of Ga Ry h 425 Mikado Clarke Henry C condr GS&FRR r 771 1st Clarke Hill E (Gertrude) 8 condr C of Ga Ry h 612 Log Cabin blvd Clarke James R (Opal P) emp Met Life Ins Co h 107 (158) Parkwood Clarke John B Jr student r 685 Napier Clarke Josephine (Mrs W P) elk J J New- berry Co r 1703 2d Clark Lula (c) r 616 Fort Hill Clarke Mae B nurse Macon Hosp r do Clarke Mae C (wid G P) r 726 Forsyth Clarke Marjorie M r 612 Log Cabin blvd Clarke Oliver W r 425 Mikado CLARK R L CO, Robt L Clarke Mgr, Hard- wood Floors, Screens, Weather Strips, Venetian Blinds, Dealers for Az Rock Floor and Wall Tile, 1218 Broadway--tel 5274 (See Page 88) Clarke Robt B (Ophelia) 5 h 126 (102) Charles CLARKE ROBT L (Mary V), Mgr R L Clarke Co, h 711 College--tel 2765-J Clarke Turner student r 685 Napier Clarke W Paul (Josephine) mach Bibb Mfg Co r 1703 2d Clarke Wm E (Eva) mech h 559 Oglethorpe Clary Cleo C mus tchr Appleton Ch Horne r do Clary Cliobel nurse The Clinic r do Clary Geo E (Ruby M) 1 executive sec S Ga Conference Bd of Christian Education h 21 Arlington pi Clary Geo E Jr student r1 21 Arlington pi Clary Walter M slsmn Sands & Co Inc r 663 Plum 180 Baldwin's and Telegraph's Clary Wm R stockrrui Newberrys r 321 1st Cleaveland Robt E (Augusta) (o) ice cream Clavand Carrie (c) r 88 Bay mkr Dixie Dairies h 407 Ridge (X) Clay Alberta (c) tchr r 561 Monroe (V) Cleckley Moody D emp St Hwy Dept r 125 Clay Alex (Alice) 3 hlpr h River rd (NH) Rose pk Clay Alonzo (c) h 107 (108) 8th (B) Clegg B Harrelson (Vera) hlpr C of Ga Ry h Clay Arth (c; Ledona) lab James & Kingman 245 Bond apt 1 Lbr Co h 10 Fordville la Clematis Neva (c) r 509 Straight (U) Clay Berry (c; Alberta) h 561 Monroe (V) Clemence Jack C r 451 Duncan Clay Calder B (Emma D) 2 (o) mgr Cotton Clements Anthony (c; Mary) lab h 319 Maple States Fertilizer Co r 365 Cherokee Clements Camilla (c) h 321 Short (EM) Clay Carrie (c) (o) h 116 (175) Bell Clements Chas E (Bessie) 4 routemn Crescent Clay Cary student r 156 Parkwood (B) Ldry h 1224 (1234) College Clay Clarence H (Mamie T) 2 formn Cotton Clements Clara (Mrs D F) restr 450 Giles r do States Fertilizer Co h 1021 Montpelier Clements Delmas F (Clara) printer Coggin & Clay Edw D (c; Ella) 2 (o) emp Dannenberg Mann h 450 Giles Co h 119 Walls al Clements Eugenia student r 1224 (1234) Col- Clay Edw D Jr (c) r 119 Walls al lege Clay Eliz Mrs r 237 Washington Clements F Larcus (Ora) 3 lawyer 15 Harde- Clay Ella (c) dom P T Anderson r 119 Wall man bldg r 356 Masonic Home rd (NH) St al Clements Florence opr Adams Mfg Co r 822 1st Clay Elmo (Annie) 2 (o) hlpr h River rd (NH) Clements Geo (Mildred) 2 r 506 Giles Clay Eloise (c) sch tchr PQ r 119 Walls al Clements Geo M (Ruby) 2 shpg elk Yates & Clay Geo sash mkr Willingham S&D Co Tabor Co Inc h 104 Ingleside (I) Clay Geo r 204 Tatnall Clements J Monroe (Florence B) 1 (Bob's Bar- Clay Georgia (wid N H ) h 205 Tatnall B-Q Pit) h 822 1st Clay Harold student r 759 Poplar Clements Jesse C (Iola) 1 engr So Ry h 506 Clay J Emory (Lena C) 2 (o) phys 567 Wal- Giles nut r 116 Hines ter (V) Clements Leroy (Peggy) opr Happ Bros r 856 Clay Jake P (Alene M) 2 (o) (Clay's Garage) Orange h 204 Grenada ter Clements Lillie M (c) h 125 Hall (EM) Clay James (c) pntr r 561 Monroe (V) Clements Mabel r 506 Giles Clay Jennings (Essie Mae) 2 (o) h River rd Clements Margt L student r 105 Emory (SM) (NH) Clements Mary (Mrs J M) emp Adams Mfg Co Clay John H (Evelyn) 2 mgr Golden Eagle r 822 1st Store r 1011 Montpelier Clements Mattie (wid I J) 1 r 430 Jackson Clay Joseph (Frances) (o) h River rd (NH) Clements Mattie M (c) maid 208 Corbin (V) Clay Julian r 204 Tatnall Clements Mildred (wid R W) tchr Fort Hawk- Clay Lamar (Mary H) r 583 Boulevard ins Sch r 421 Forest Clay Lamar Jr (A Christine) 1 repair serv A Clements Ollie (c) cook 910 Ridge (I) S Hatcher Co h 1017 Clinton rd (EM) Clements Ollie L (Maggie) 5 routemn Crescent Clay Mamie Mrs slswn Charis Corp r RD 2 Ldry h 105 Emory (SM) Clay Margt J (wid W R) 1 (o) h 156 Park- Clements Peggy (Mrs Leroy) opr Happ Bros r wood (B) 856 Orange Clay Valeria E (wid J G) h 583 Boulevard Clements Will G pntr r 3808 Houston (NH) Clements Wm student r 506 Giles Clay Walter R Jr slsmn r 156 Parkwood (B) Clements Wm (c; Addie) lab h 702 Prince (SM) Clay Wm r 204 Tatnall Clements Wm E elk Macon's Pharm r 124 Clay Wm P (Agnes) 1 r 218 American blvd James (LCHts) Clay Zettler C (c; Alvia G) 3 (o) firemn C of Clemons Chas (c) r 112 (7) Fulton la Ga Ry h 219 (136) Grant (V) Clemons Chas R (Lula) 2 lab r 553 Edge- Clay's Garage (J P Clay) reprs 615 Broadway wood Clayborne Cornel (c) lab So Crate & Veneer Clemons Edith (c) sch tchr r 952 Ocmulgee Co Clemons Edw (c) lab r 314 (326) Short (EM) Clayton Ada (c) r 120 e Ell Clemons James (c) r 314 (326) Short (EM) Clayton Alberta (c) 2 r 331 (r) Hammond Clemons Jefferson H (c; Mamie) (o) gro 107- Clayton Arth (c) lab James & Kingman Lbr 111 Franklin r 104 Spring Co Clemons John (Odessa) r 218 Jenkins Clayton Cleveland (c; Ella) lab h 710 Daisy Clemons Mamie (c) mus tchr 104 Spring r do (SM) Clemons Mary J (c) 1 h 174 College Clayton Emanuel (c) r 543 Calhoun Clemons Odessa (Mrs John) spooler Paynes Clayton James (c; Pinkie) 3 jan Municipal Mill r 218 Jenkins Auditorium h 126 4th (V) Clemons Sidney (c; Pearl) 3 lab h 314 (326) Clayton James (c; Carrie) 2 (o) lab h 205 Short (EM) 2d (U) CLEMONS SOL C (c; Addie) (o) Bonds, Loans, Clayton Joseph (c; Lillie) 2 h 358 Stripling al Rentals and Real Estate, 465 Cotton--tel 465, Clayton Joseph (c; Theresa) (o) cook h 723 h 952 Ocmulgee--tel 670 Daisy (SM) Clement Apts 602 3d (V) Clayton Harold (c; Viola) 1 lab h 543 Calhoun Cleveland Ada B (c) r 424 (421) 3d (V) Clayton Lillie M (c) cook James Ezell r 358 Cleveland Beulah (c) 1 lndrs r 408 Crisp Stripling la Cleveland Bradley C (c; Mabel) pastor Trinity Clayton Rosa (c) 1 r 303 (205) Waterville rd AME Ch r 418 (432) North Clayton Stanley (c) lab Proctor & Gamble r 327 (235) Division Clayton Wm (c) h 111 (726) Nussbaum Cleveland Carrie (c)i r 351 Hammond Cleveland Chas (c; Carrie) 4 lab h 317 Division Cleveland Cornelius (c) lab C of Ga Ry Cleveland Curtis (c) lab So Crate & Veneer Clayton Willie M (c) maid r 543 Calhoun Co r 1220 3d Cleaveland Augusta B (Mrs R E) teller First Cleveland David (c; Annie) lab Ga Caro Oil Co Nat Bk & Trust Co r 407 Ridge (I) h 415 Monroe 1935 Macon City Directory 181 Cleveland Dennis (c; Daisy) 3 lab h 405 (124) Henderson (SM) Cleveland Drusilla (c) cook J N Steed r 424 (421) 3d (PH) Cleveland Ernest (c) r 424 (421) 3d (V) Cleveland G Gordon (c) (o) h 424 (421) 3d (V) Cleveland Grover C (Florede V) 2 mldr Taylor Iron Wks h 105 Crisp Cleveland Helen tchr Bellevue Sch r 315 Buford pi (V) Cleveland James (c) emp Gilmans Gro r 405 Clinton Cash Market (J R Churchill) 467 (455) Clinton Clisby Helen L r 726 Forsyth Clisby Joseph R bkpr City Bank & Trust Co r 726 Forsyth Clisby Joseph School F Ruth Allen prin 570 Vineville (V) Clisby Joseph W (o) h 726 Forsyth Clitte Lucile (c) cook Hyman Marshall r 164 Bartlett Closson C E (Carroll) 2 emp Maxwell Bros Inc (124) Henderson (SM) h 479 Orange apt 6 Cleveland Marvin (c; Lillie) 3 lab r 106 (306) Amos (V) Closson Kitty sten r 479 Orange apt 6 Closson Wayne bkpr So Oil Co r 479 Orange Cleveland Minnie (c) Indrs h 803 Ocmulgee apt 6 Cleveland Rosa (c) 2 h 147 Pecan Cleveland Sarah (c) 1 h 351 Hammond Cloud Annie P Mrs mgr Peggy Hale Inc r 866 Mulberry Cleveland Simeon Jr (c; Maxie M) 4 emp So Cloud Cleveland (c; Endie) porter J W Burke Ry h 1220 3d Co r 108 Spring Cleveland Sims (c) 1 r 1223 Broadway Cloud James (c; Willie) 3 lab So Crate & Ve- Cleveland Thos (c; Emma) 1 h 713 (711) neer Co r 217 Madison (V) Elbert Cloud Wm asst mgr Marilyn Slipper Shop r 866 Cleveland Viola (c) maid Irma M Clark r 147 Mulberry Pecan Clover Josephine (c) h 317 Madison (V) Cleveland Wm (c) lab Cherokee Brick Co Clowers Alonzo (c; Bertha) 3 chauf h 108 Cleveland Wm (c) r 405 (124) Henderson (SM) Mitchell Cleveland Wm A (Willie) 1 (o) (Dixie Pea- Clowers Benj (c; Tidy) h 121 Walls al nut Co) h 215 Buford pi (V) Clowers Bessie (c) gro 201 Telfair r 215 do Cleveland Wm A Jr student r 215 Buford pi (V) Clowers Charlotte (c) 2 cook h 104 Cowan Cleveland Willie (Mrs W A) asst mgr Dixie Clowers Early W (c) r 104 Gustin Peanut Co 215 Buford pi (V) Clowers Ellis (c; Anna) h 104 Gustin Cliett Albert (c; Victoria) farmer h 444 Log Clowers Ernest (c; Elsie) 2 h 154 Lynwood (V) Cabin dr Clowers Ernest (c; Eudora) 3 (o) h 416 Cliett Alice (c) r 308 2d (WH) Peachtree Cliett Andrew (c; Alice) lab h 937 Pio Nono Clowers Ernest (c; Geneva) 2 hlpr Kash & Cliett Andrew Jr (c) r 937 Pio Nono Karry Mkt h 106 (207) Short (EM) Cliett Clara (c) Indrs r 937 Pio Nono Clowers Eug (c; Alleen) 1 hlpr Bibb Mattress Cliett Henry (c) emp Bibb Mattress Co r 113 Co r 1331 1st (558) Fulton la Clowers Frances (c) 1 emp Independent Ldry Cliett Lonnie (c; Annie) (o) 1 h 1802 Dempsey Co h 76 Spring Cliett Lonnie (c; Annie L) 1 brklyr h 98 Key Clowers Geo (c; Bessie) (o') h 215 Telfair , (Cork & do Cork, h 350 Orange--Tel 687 Copeland Wm R asst shpg elk Willingham S & D Co r 109 St James Copes Geo D dr Dixie Dairies Coplan Junk Co Inc M D Coplan pres J M Hirsh v-p M S Putzel sec-treas 816-18 Broadway Coplan M David (Esther) (o) pres Coplan Junk CORK CHAS M (Josephine) 3 (o), (Cork & Cork, h 123 Madden--Tel 2234-W Cork Harriet H r 350 Orange CORK & CORK (Chas D S Cork, Chas M Cork), Lawyers 601 Ga Casualty Bldg--Tel 1 Co Inc h 870 Orange Corker Alleen (c) lndrs Crescent Ldry r 220 Coplin Geo (c) barber r 213 Ocmulgee Division 190 Baldwin's and Telegraph's Corker Gordon (c; Allene) trkr C of Ga Ry h 220 Division Corley Mary A mimeograph opr The Letter Shop r 14 Drury (I) Corley Robt M (Malda) 1 slsmn r 531 Georgia Corley Thos A (Mary) (o) condr So Ry h 14 Drury (I) Corley Thos C (c; Clara) lab r 223 e 2d (EM) Corley Wm (c) r 66 (135) Forest (V) Corn Ernest (Pauline) 4 (o) phys 301 Doctors Bldg h 109 Courtland, Cornelius Albert (c) emp Bibb Mfg Co r 49 (54) Green's al Cornelius Allen (c; Carrie) h 716 (131) Hall (EM) Cornelius Annie (c) 2 h 272 (310) White al Cornelius Bernard (c) elk Wm Davis r 258 Madison (V) Cornelius C Wm (c; Mary) farmer h 100 (3400) Lynmore Cornelius Cath (c) cook J P Cowart r 117 1st (U) Cornelius David (c; Mattie) r 526 Calhoun Cornelius Doris T (c) student r 716 (131) Hall (EM) Cornelius Eliz (c) r 106 (204) 3d (U) Cornelius Henry (c; Emma) 3 jan Wesleyan College h 109 4th (U) Cornelius Henry (c; Mabel) 3 marble ctr h 258 Madison (V) Cornelius John (c; Marie) plster h 123 Ritchey Cornelius Joshua (c; Rose) 1 lab C of G Ry h 925 Pio Nono Cornelius Laura (c) h 329 Cedar (U) Cornelius Lillian (c) r 258 Madison (V) Cornelius Lizzie (c) r 700 (702) 3d (V) Cornelius Lizzie (c) 6 maid r 189 Davis al Cornelius Mabel (c) dom R M Davis r 258 Madison Cornelius Margt J (wid J C) h 620 Pine Cornelius Marshall (c) maid A R Willingham r 109 Woodliff Cornelius - Milton (c) ydmn May B Mullenix r 258 Madison Cornelius O'Neal (c; Kath) 3 lab So Crate & Veneer Co h 109 Woodliff Cornelius Orange (c; Cora) tr dr Atlantic Ice & Coal Co h 504 (455) Alabama (SM) Cornelius Rilla (c) cook F H Chancellor r 702 3d (V) Cornelius Robt (c; Clara) 2 (o) emp C of Ga Ry h 117 1st (U) Cornelius Robt (c; Lois) (o) firemn C of Ga Ry h 126 1st (WH) Cornelius Roberta (c) r 73 (80) Schofield Cornelius Roberta (c) cook r 239 Jefferson Cornelius Rose (c) cook F E Market r 925 Pio Nono Cornelius Sandy (c; Ella) lab h 115 e Ell Cornelius Thos (c; Leila M) 2 emp Maxwell Bros r 224 (717) Pear Cornelius Tillman C (c; Ethel) 4 porter Ga Seed Store h 6 Woodliff Cornelius Trent P (c; Willie) 5 mach C of Ga Ry h 331 Jackson Cornelius Tully (c; Charity) 2 emp C of Ga Ry h 117 (227) Elliott Cornelius Walter (c; Floriest) 2 jan Greater Wesleyan h 332 Madison (V) Cornell James (c; Addie) 2 h 413 Bay Cornell-Young Co W A Young pres Geo S Jones & G P Jones v-prests Ruby Harrison sec-treas genl contrs 502-04 First Nat Bk Bldg Corr Kath sten r 112 Boulevard (NH) Corr Margt (wid J D) 2 opr Busy Bee Cafe h 112 Boulevard (NH) Corson Steph T (Mary L) 4 emp Ga Power Co h 1536 3d Corthorn Henry (Evelyn) hlpr r 424 American blvd Cosby Caesar (c) r 6 Gunn's al (V) Cosby Emma L (c) maid J I Beck r 933 Pio Nono Cosby Essie I (wid J R) h 114 Magnolia Cosby Hattie (c) h 6 Gunn's al (V) Cosby Idalene case wkr FERA r 110 Corbin (V) Costa F Joseph (Costa Ice Cream Co) h 401 College Apt 1 B Coswell John H (c; Lidie) farmer h 305 (207) Waterville rd Cotter J Stacy (Letha) 2 slsmn Swife & Co h 873 Winton Cottingham Caroline nurse Macon Hosp r do Cottingham Josie (wid Harry) clerical aide Macon Transient Bur r 108 Magnolia Cotton Aquie r 117 (820) Forest (B) Cotton Bowman C (Velma) emp C of Ga Ry Shop r 103 Hartley (CP) Cotton Emma (c) r 230 Madison (V) Cotton H Herman elk Piggly-Wiggly r 2013 Vineville Cotton Harold W (Vesta) (o) br mgr Rogers Stores h 414 Ridge (I) Cotton Idena (c) nurse W A Wommack r 811 Davis Cotton Inez (c) cook J S Strozier r 811 Daisy Cotton James C (c; Mattie) h 412 Ward (V) Cotton Jay C agt Life Ins Co of Va r 2013 Vineville Cotton Lifus L slsmn Buster Btlg Co r 2013 Vineville Cotton Linda nurse 516 Orange r do Cotton Mattie (c) cook B C Snow r 412 Ward Cotton Mattie M (wid A Q) 1 h 2013 Vineville Cotton Osie (c; Zudie) 6 h 811 Daisy (SM) Cotton Ozora (c) cook C D McAfee r 811 Daisy Cotton Rachel (c) (o) h 118 Roff Home Cotton Robt (Mamie) r 516 Orange Cotton States Fertilizer Co C B Clay pres-mgr D D Kinnett sec W J O Shaughnessey treas 310 Ga Casualty Bldg plant ft Poplar Cotton Vesta (Mrs H W) sten Bibb Mfg Co r 414 Ridge (I) Cottrau John D (Reba) 1 slsmn h 864 Mulberry Apt 1 A Couch Adele Mrs opr Happ Bros r 207 Fort Hill Couch Clarence r 207 Fort Hill Couch Clarence E (Nannie) (o) emp Ga Power Co h 730 Walnut Couch Clifford A (Ida M) 1 fruits 1706 Vineville (V) h 1707 do Couch Dorothy opr Happ Bros r 206 Fort Hill Couch Edw L (Dorothy) 2 tr dr City St Dept h 103 Maynard Couch Eliz elk H S Kress & Co r 317 Church (EM) Couch F Jerome (Margt) 3 (o) (Couch & Woodall) h 721 Main (EM) Couch Fredk L (Irma) emp C of Ga Ry h 617 2d Couch Geo E (Mollie) h 553 Roff Home Couch Joseph L (Lona) emp C of Ga Ry h 317 Church (EM) Couch Nellie Mrs doffer Bibb Mfg Co Couch Olena (c) r 5 Pear's al Couch Robt B (Hester) 1 emp Macon Mattress Co h 401 Fort Hill Couch Ruel C (Ethel) 5 evangelist h 554 Roff Home Couch Sami T wtchmn Birdsey Flour Mills r 206 Fort Hill 1935 Macon City Directory 191 Couch & Woodall (F J Couch H F Woodall) gros 701 Main (EM) Couey Clifford C (Mamie) 2 tr dr Power Oil Co h 302 Jenkins Couey Lizzie (wid G W) h 770 Oglethorpe Couey Opalene winder Bibb Mfg Co r 770 Oglethorpe Couey Spurgeon spinner Bibb Mfg Co r 770 Oglethorpe Couey Wesley r 302 Jenkins Couey Wyolene emp Bibb Mfg Co r 770 Ogle- thorpe Coulter Rosa L Mrs 5 h 115 Enterprise (SM) Coulter Wm R (Anna M) 3 wtchmn h 309 Rutherford (SM) Council Clayborn (c; Alma) 3 (o) emp So Ry h 253 (653) Womack Counter Robt J (c; Eloise) lab Macon Mill- ing Co h 477 Chestnut Country Market (Mrs Ethel S Bond) prod 471 3d COUNTY GOVERNMENT (See Bibb County) Coursey Frank A (Goldie) 4 florist J A Porter h 166 Spring Coursey Leslie M (Nellie) (Broadway Top & Body Shop) r 105 Feb Coursey Nellie (Mrs L M) opr Happ Bros Co r 105 Feb Coursey Wm L (Eura M) 1 supt Life & Cas- ualty Ins Co h 716 Holt Courson Lucy opr Happ Bros Co j 107 School Court House 2d nw cor Mulberry Courtney Annie M (c) cook h 447 (707) Mid- dle (EM) Cousins Wm J (Doris) 2 condr C of Ga Ry h 762 Hemlock Covert Thos (Mary) r 105 Forest (B) Covington Beatrice (c) dom W J Ernest r 202 (191) Grant (V) Covington Edw (c) emp C of Ga Ry h 202 (191) Grant (V) Cowan Eva (Mrs Paul) emp Bibb Mfg Co r 14 Schell (EM) Cowan Evelyn L waitress Woolworth's r 601 Woolfolk Cowan Henrietta (c) dom h 316 Division Cowan John D (Ollie) mach C of Ga Ry r 311 Bond Cowan Lillie M (wid H B) (o) h 615 (301) Woolfolk Cowan Loney (c) 1 lndrs h 117 Stripling al Cowan Louise A slswn Woolworth's r 601 Woolfolk Cowan Margt student r 814 Napier Cowan Minnie L (c) 2 h 108 Woodliff Cowan Olive M (Mrs J D) supv So Bell Tel Co r 311 Bond Cowan Paul (Eva) wtchmn r 14-16 Schell (EM) Cowan Richd B (Gertrude) 1 (o) emp C of Ga Ry h 814 Napier Cowan Richd W asst dist engr FERA h 615 (301) Woolfolk Cowan T Walker (Annie Mae) 1 lab h 601 Woolfolk Cowan T Walker Jr student r 601 Woolfolk Cowan Wm (c) tr dr r 104 Cowan Cowan Wm M (Lula) (o) supt Macon Peanut & Storage Co h 722 Main (EM) Coward Elsie (Mrs G C) emp Willingham Mills r 326 (330) Dannenberg Coward G Cleveland (Elsie) emp Willingham Mills r 326 (330) Dannenberg Cowart Albert (Ethter) r 107 (47) Holt Cowart Bessie nurse Macon Hosp r do Cowart Ethter (Mrs Albert) emp Willingham Mills r 107 (47) Holt Cowart Frances Mrs smstrs Dannenberg's r 122 Magnolia Cowart Geo W (Scheley) elk C of Ga Ry r RD 3 Cowart Jackson E (Laura M) 1 cash City Bd of Water Comrs r 100 Summit Cowart James emp Willingham Mills r 107 (47) Holt Cowart John P (Margie) 1 asst to U S Dist Atty h 897 Hillyer Cowart June Mrs 2 emp Willingham Mills h 107 (47) Holt Cowart Robt H slsmn Carstarphen Inc r Arlington Hotel Cowherd Ralph O (Anna E) (o) miller h 260 Winship Cowser Lizzie r 910 Oglethorpe Cox Alice M (Mrs W M) sch tchr r 3447 Hous- ton (SM) Cox Alton L routemn Macon Linen Sup Co r Hotel Gordon Cox Benj (Ida) 2 h 5 Grand (B) Cox Delilah (wid J J) r 2308 Broadway Cox Dorothy student r 124 Napier Cox Dorsey M r 100 Villa (B) Cox Edw L (Katie) (o) mstr mech. C of Ga Ry h 205 Hill Crest Cox Edw L Jr student r 205 Hill Crest Cox Effie (wid J A) r 415 Montpelier Cox Elijah J r 215 (211) Park (B) Cox Ella r 202 (103) Grand (B) Cox Geneva slswn H L Green & Co r 947 Mont- pelier Cox Hobart C chiro 505 Bibb Bldg r 1145 Milledgeville rd Cox James M (Mattie) (o) slsmn R A McCord Mtr Co h 475 Duncan Cox Jennie A Mrs r 736 Patterson Cox Jewell student r 53 Davis (PM) Cox John T (Margt) (o) C of Ga Ry h 1145 Milledgeville rd Cox Julia (c) 1 cook H P Fleming r 416 Ward (V) Cox Leon r 100 Villa (B) Cox Mack student r 947 Montpelier Cox Maggie (wid S T) h 131 Roff Home la Cox Mary Mrs emp Happ Bros Co r 610 Plum Cox Mary F (wid E M) r 407 American blvd Cox Marvin R (Helen) farmer r 1145 Milledge- ville rd Cox Maude E waitress Woolworth's r 411 American blvd Cox Nora (c) 2 (o) lndrs h 13 Parker (V) Cox O Eug Jr r 411 American blvd Cox Oliver E (Fannie L) 4 carp h 411 AmeriCocxanOtbhlovdB: (Eldie C) 1 slsmn D H Adams Mtr Co h 415 Montpelier Cox Owen r 335 Winship Cox Pearlie tex wkr Atlantic Cotton Mills r 131 Roff Home Cox Raynelle R sten Am Nat Ins Co r 947 Montpelier Cox Thos E (E Fay) 4 (o) bus opr Ga Power CO h 947 Montpelier Cox Willie (Eliz) 3 tex wkr r 6 Roff Home pi Cox Wilmer M (Alice M) (o) (North Pole) h 3447 Houston (SM) Coyle Cula (wid J B) 1 beauty opr R S Thorpe & Sons h 746 Walnut Cozine John E (Gwendolyn) 1 sis mgr Macon Gas Co h 113 Culver (V) Cozy Corner Cafe (Gus Thomas) 400-02 Mul- berry Crabtree Guy E (Jessie) 4 emp So Ry h 908 Walnut Craddock Carrie (wid H W) r 413 Spring 192 Baldwin's and Telegraph's Craddock Harry W dentist 567 Walnut r 413 Spring Craft Felton (c) emp Bibb Mfg Co r 852 Ash Craps Pauline (Mrs W M) opr Happs Bros r 209 Log Cabin dr Craps Wm M (Pauline) wtchmn Bibb Clay Craft T Fisher (Emily) 2 (o) elk Birdsey Flour Mills h 107 Brentwood Craft Wm C (c; Sara) (o) firemn So Ry h 852 Ash Craft Willie M (c) r 822 Ash Craig Eliz (wid Geo) h 680 College Craig Genevieve r 680 College Craig Howard W 1 whsemn Ruan & Co r 680 College Craig Howard W Jr r 680 College Craig Lindsey (c; Adel) lab C of Ga Ry h 9 (167) Waterville rd Craig Louis (c) lab r 9 (167) Waterville rd Craig Middie (c) seh tchr r 9 (167) Waterville rd Craig Mildred sten Bibb Chevrolet Co r 390 Suwanee Craine Robt L waiter B F Lyles r 554 Mul- berry Products Co h 209 Log Cabin dr Cravey Marion dog catcher City r 242 Wash- ington Cravey Wiley J (Julia) 2 emp Dempsey Hotel r 242 Washington Crawford Albert (c) lab James & Kingman Lbr Co Crawford Albert (c; Mozel) lab r 122 (r) Di- vision St la Crawford Alvin (Edna) 1 florist Idle Hour Nurseries r 415 New Apt 3 Crawford Annie (c) emp Dempsey Hotel r 455 e Academy (EM) Crawford Archie D (c) cook C H Brooks r 1004 Broad Crawford Eula (Mrs C B) emp Southland Knitting Mills r 440 Ross Crawford Freeman (c; Nancy) carp h 813 Cen- ter (EM) Crambes Peter S (Adeline) (o) (Ingleside Elec Co) h 105 McGee (CP) Cramer Danl (c; Gussie) lab C of Ga Ry Creosote Plant h Henderson (B) Crandall John R emp Sterchi's r 140 Georgia Crandall Mamie (wid R L) (o) h 153 Summit Crandall Mary L (wid F R) 3 (o) sten Bibb County Relief h 102 Rogers (V) Crane Co W T Turlington mgr plmbg sups 500 Broadway Cranford Augustus M (Pearl) 1 saw filer h 2308 Broadway Cranford Barner C (Marie) 2 truckmn r 2308 Broadway Cranford Beaufort C doormn Rialto Theatre r 203 Plant (SM) Cranford Carlton (Eliz) r 708 Main (EM) Cranford Claudia (Mrs J C) emp Willingham Mills r 17 Randolph pi Cranford Edw F slsmn Adams Buchanan Mtr Co r Cross Keys Ga Cranford Eliz (Mrs Carlton) opr Happ Bros r 708 Main (EM) Cranford Estelle r 20 (85) Mill Cranford Ethel (Mrs Wm) spinner Bibb Mfg Co r 531 Jackson Cranford Ethel H (Mrs I C) slswn Dannen- berg's r 515 Boulevard Cranford I Clyde (Ethel H (o) del elk Dan- nenberg's h 515 Boulevard Cranford Isaac H (Pearl) 1 tex wkr Willing- ham Mills h 20 (85) Mill Cranford Jewel (wid W G) 2 h 110 Willingham Cranford John C (Claudia) h 17 Randolph pi Cranford John S r 2308 Broadway Cranford John T (Florence) 1 emp Bibb Mfg Co h 665 Elm Cranford Julian E (Margt) dairy 340 Grenada ter h do Cranford L Frank (Cleone B) 3 (o) proof read- er J W Burke Co h 203 Plant (SM) Cranford L Frank Jr emp Snow's Ldry r 203 Plant (SM) Cranford Lois (Odessa) 2 h 861 Hillyer Cranford Louis D (Lucile) 1 (o) emp So Ry h 219 New Cranford Marie (wid R F) r 237 Carling Cranford Odessa (Mrs Lois) opr Col Beauty Salon r 861 Hilliard Cranford Roy slsmn Standard Oil Co r Cross Keys Ga Cranford W Lafayette (Emma) (o) emp C of Ga Ry h 708 Main (EM) Cranford Wm r 2308 Broadway Cranford Wm (Ethel) 2 h 531 Jackson Cranford Wm G student r 110 Willingham Crawford Girvis E emp Williams Wagon Wks r 1531 Broadway Crawford Henry (c; Emma) 1 h 146 (459) Army Lot Crawford Herbert F (Julia V) br mgr Great A & P Tea Co h 1211 Vineville Crawford Imogene (Mrs T F) opr Happ Bros r 912 2d Crawford James (Emma) r 2109 Broadway Crawford James B (Crawford's Barbecue Lunch) r 722 Walnut Crawford James C (c) swtchmn C of Ga Ry r 358 Ash Crawford James W (Minnie) 3 mach opr At- lantic Cotton Mill r 207 Rogers (V) Crawford John J (Beulah) 4 hlpr h 204 Sim- mons (SM) Crawford John L (c; Archie) lab Doctor Pep- per Btlg Co h 1004 Broad Crawford Leslie J (Mamie O) 4 barber Gay Barber Shop r 557 1st Crawford Lillian (wid John) h 457 Arch Crawford Lillie (c) dom G G Toole r 102 Em- pire (V) Crawford Lizzie (wid G G) 2 emp Bibb Mfg Co r 563 Hawthorne Crawford Lois (c) cook h 105 (48) Tracey's la Crawford Lozia Mae (c) maid H F Hall r 114 (341) Rock Crawford Luella (c) maid Anna Stubbs r 714 Hawthorne Crawford Luther elk Fickling Hotel r do Crawford Mary (c) r 433 Pio Nono Crawford Nathl elk H P Vincent r 505 (400) Crisp Crawford Osmon delmn S W Abel r 117 (121) Colquitt Crawford Phoebe (c) 1 h 124 Tatnall la Crawford Pringle formn Riverside Lbr Co r RD 2 Crawford Sara (c) r 320 Hazel Crawford Thos (c; Savannah) lab Orlando Tile Co r 423 Damour la Crawford Thos F (Imogene) emp James & Kingman Lbr Co h 912 2d Crawford W Reid (Irene) 1 mach opr Atlan- tic Cotton Mill r 207 Rogers (V) Crawford Wallace G (Nellie) 2 wtchman C of Ga Ry h 232 Ross Crawford Wm (c) lab C of Ga Ry r 1315 Broadway Crawford Wm A (Nellie H) tr dr J S Waldorf & Son r RD 2 Crawford's Barbecue Lunch (J B Crawford) 677 Broadway Crawley Benj (c; Lizzie) h 127 (505) Holmes 1935 Macon City Directory 193 Crawley Chas (o) h 309 Jenkins Crawley Chas E (Annie) (o) h 868 Mulberry Crawford Benj (c; Annie) emp Balkcom's Pharm h 455 e Academy (EM) Crawford Clarence E prod 500 Oglethorpe r 509 Arch Crawford Chas B (Eula) mech Central S & D Co r 440 Ross Crawford David M (Lollie) 1 (o) slsmn r 302 Ell (SM) Crawford Edw (c; Nancy) 1 (o) lab Ga Pow- er Co h 904 (883) Maynard Crawford Ellen r 117 (121) Colquitt Crawley Marie r 309 Jenkins Crawley Pearl Mrs opr Happ Bros Co r 568 1st Crawley Robt H emp Maxwell Bros Inc r 309 Jenkins Cray Beulah (c) cook C N Wasden r 229 Jones Cray Delacy (c) student r 229 Jones Cray Ethel (c) elev opr Terminal Hotel r 229 Jones Cray Floyd (c; Beatrice) dr Colored Taxi Co r 229 Jones Cray Marie (c) 3 maid Alfrid Senna r 127 Woodliff Cray Mary (c) h 229 Jones Creamer Benj L (Hazel) mech Macon Mach Shop r RD 4 Creamer Eldora (Sue) emp Willingham Mills r 25 (63) Mill Creamer Ethelyn opr Happ Bros Co r 623 Walnut Creamer Forrest (c; Flossie) 2 brkmn C of Ga Ry h 1223 Broadway Creamer Gertrude Mrs h 25 (63) Mill Creamer Julian J (Ethel) 1 opr Happs Bros Co r 505 Bailey Creamer Marvin (Mabel) 3 whsemn Central City Bag Co r 103 Washington Creamer Mary Frances Mrs opr Happ Bros Co h 623 Walnut Creamer Sue (Mrs Eldora) emp Willingham Mills r 25 (63) Mill Creamer Thos opr Happ Bros Co r 623 Walnut Crenshaw Edw W (Kath) 1 h 185 Cedar (SM) Crenshaw Gussie (Mrs Wm) tex wkr Payne Mill r 20 Brigham (PM) Crenshaw John T (Beatrice) 3 emp Willing- ham Mills h 203 (31) Holt Crenshaw John W (Anna) h 227 Lawton Crenshaw Lois emp Willingham Mills r 203 (31) Holt Crenshaw Robt L shpg elk A S Hatcher Co r 227 Lawton Crenshaw Wm (Gussie) 2 speeder hd Payne Mill h 20 Brigham (PM) CRESCENT LAUNDRY CO, Aristide A Bene- detto Pres, High Grade Laundry and Dry Cleaning, 519 2d--Tel 16 (See page 91) Cressville School (c) Ida M Brown prin 109 6th (B) Creter Frances sch tchr r 714 Holt Creter Louis P (Kath) slsmn McCommon Bros h 714 Holt Creter Stuart A cash Nat Biscuit Co r 714 Holt Crew Inez (c) 2 lab Macon Cooperage Co r 1231% Broadway Crew Nelson (c; Ida) lab Macon Cooperage Co h 110 (134) Wings al Crews Dutch (Vera) mech Bibb Body & Fender Wks r 619 Pine Crews James (c; Georgia) peddler h 17 (135) Malloy's al Crews James S (Merbo), genT mgr M D & S R R h 360 College Apt 3 Crews Ruby nurse Middle Ga Hosp r do Cribb Albert R hlpr Dixie Dairies r 314 Randolph Cribb Cordelia (wid Clyde) hskpr J F Lloyd r 1071 Walnut Cribb Hazel Mrs 1 sten Burden Smith & Co r 401 Duncan Cribb Henry (Nell) 1 h 915 Walnut Apt 2 Cribb' Jos L (Flewellyn) 1 (o) slsmn Whitefield Gro h 758 Plum Cribb Kath L student r 314 Randolph Cribb M Alice (wid H R) h 314 Randolph Cricket The (C S Smith) restr 620 Poplar Crimmins Edna C student r 118 Summit Crimmins Jerry A student r 118 Summit Crimmins T E Sign Co (T E Crimmins) 618 Cherry Crimmins Timothy E (Martha Y) 6 (o) (T E Crimmins Sign Co) h 118 Summit Cripe Fredk H (Thelma) 4 opr Happ Bros Co h 354 Center (EM) Crisfield Vinita C Mrs case wkr FERA r 140 Georgia Crisp J Kibler (Elsie O) 2 jwlr Kernaghan- Goodman Inc h 203 Ponce de Leon Crissey Edw wtchmn W S Dickey Clay Mfg Co r Clinton rd RD 5 Criswell A Frank (Douida V) 1 (H W & A F Criswell Co) h 313 Forsyth Criswell A Frank Jr hlpr H W & A F Criswell Co r 313 Forsyth Criswell James M student r313 Forsyth Criswell HW&AFCo (HW&AF Criswell) plmbrs 509 Cotton Criswell Harold (Edith) with Crescent Ldry r 140 Appleton Criswell Harvey W (Hattie) V) 1 (H W & A F Criswell Co) h 427 (415) Forest (V) Criswell R Wilburn agt Life Ins Co of Va r 427 (415) Forrest Criswell Roy (Estelle) 1 h 291 Morgan Criswell Stella (wid W V) r 291 Morgan Crittendon James (c) delmn Broadway Cash Mkt r 228 Turpin Crittle Pocahontas (c) sten County Relief Admn 124 Broad Crittle Walter (c; Bessie) mech r 264 (664) Hall (EM) Crocker James W (Ruby) barber Gay Barber Shop r 555 2d Crocker Paul elk Federal Transient Bur r 504 Plum Crockett John C (c; Sara) pntr r 321 McClain la CROCKETT ROY W (Sally W) (o), Real Est Loans and Ins, 610 Mulberry--Tel 2141 h 1401 Ridge (I)--Tel 82 Crockett Sarah (c) maid Geo Bedingfield r 321 McClain la Crockett Vera M tex wkr Bibb Mfg Co r 758 Oglethorpe Crofter Lillie (c) maid G G Toole r 102 Empire Croft Inez S (Mrs John) winder Bibb Mfg Co No 2 r 865 3d Croft John (Inez S) 1 florist J A Porter h 865 3d Croft Mary A slswn Darling Shop r 103 Inverness Cromer David (Lydia E) 5 slsmn h 2214 2d Cromer Ferrel (June) 1 emp Fish Hatchery r 1427 2d Cromer Ruby waitress r 2214 2d CROMWELL JAMES O (Helen O) (o), Traffic Mgr Macon Chamber of Commerce, h 324 Buford pi (V>--Tel 3024-W Cromwell Mary (c) cook R D Russell r 138 Brooklyn (S) Cromwell Mattie (c) 1 cook J J McKay r 403 (819) Cedar (U) 194 Baldwin's and Telegraph's Cromwell Robt (c; Hestime) (o) h 138 Brook- Crowder Danl (c) lab Rose Hill Cem r 210 lyn (S) Green Crook Bashie (wid Wm) h 403 Spring Crowder Edna Mrs 1 r 1024 2d Crook Chas E (Carol) slsmn h 362 College Crowder Elnora (c) h 122 Thomas (EM) Crook Claude P elk Piggly Wiggly r 427 Cal- Crowder Horace opr Happ Bros Co r Y M C A houn Crowder James (c) lab h 189 Davis al Crook Mary r 362 College Crowder James M (Lucy) pntr r 1531 2d Crook Wm B (Sarah M) slsmn Singer Sewing Crowder Jesse (c; Easter) (o) lab C of Ga Ry Mach Co h 117 Stonewall pi (V) h 114 (154) DeBorde (SM) Crook Wm M slsmn Sunlite Electrik Bake Crowder Jessie M (c) cook W H Thorpe r 148 Shop Inc r 403 Spring Middle Crook Wm M Jr r 403 Spring Crowder John L emp Atlantic Cotton Mills r Croom Clara Mrs opr Happ Bros Co h 134 Wil- 110 Roye liams (SM) Crowder John R (Annie) 2 h 110 Roye Croom Clifford J (Pauline M) asst mgr Met Crowder Johnnie tex wkr r 110 Roye Life Ins Co h 316 Cherokee Crowder Maxie (c) maid S H Buck r Stinson- Croom Pauline M (Mrs C J) tchr Winship Sch ville r 316 Cherokee Crowder Minnie L r 110 Roye Croom Robt J (Hattie) (o) h 2505 2d Crowder Nancy E (c) r 303 (198) Lincoln (V) Cropper Handy J (Mollie) r 223 Coleman Crowder Theo (c; Ophelia) 2 jan h 303 (198) Cropper R C Co (R C Cropper) agrl imple- Lincoln (V) ments Mulberry cor 7th Crowder Thos O collr So Investment Co r Cropper Raymond C (Beulah) 2 (o) (R C Crop- Y M C A per Co) h 223 Coleman Crowe Bertie (Mrs T W) tex wrk Happ Bros Crosby Andrew r 915 New r 360 Fairview Crosby Hemmie K Mrs opr Happ Bros Co h Crowe Ned elk First Nat Bk & Trust Co r 521 915 New College Crosby Hugh student r 915 New Crowe Thos W (Bertie) 1 h 360 Fairview Crosby James (Avie) emp Bibb Mfg Co h 662 Crowell David A (Frances) emp Ga Power Co Hawthorne Crosby James P r 528 Telfair (SM) r 774 Mulberry Crowell John M (Alice) formn Go Power Co Crosby Leon emp M D & S R R r 915 New Crosby M Ellis (Mattie) 3 lab r 528 Telfair h 157 Bailey Crowley Thos J (Mary L) 1 (o) (Roberson (SM) Realty Co) h 109 Elizabeth pi (V) Crosby Mary opr Happ Bros Co r 915 New Crowley Thos J Jr student r 109 Elizabeth pi Crosby Otis r 915 New (V) Crosby Troy r 915 New Crowther Frank (Gertrude) 1 sis mgr South- Crosby W I elk Hotel Lanier r do eastern Broadcasting Co r 278 College Cross Annie (c) ldry wkr h 710 Ash Crumbley James (c) lab h 108 Bennett's la Cross Elnora (c) r 519 Monroe (V) Crumbley Rebecca (c) 1 cook C L Anderson h Cross Fayette B (c) sch tchr r 206 Grant (V) 119 Woodliff Cross Henry (c) porter J N Neel Co r 107 Em- Crumbliss Lennie R winder Bibb Mfg Co r 607 pire (V) Woolf oik Cross Keys Baptist Church C A Forrester pas- Crumbliss Raymond H (Hazel) 1 hlpr Dixie tor Cross Keys Dairies r 870 2d Cross Marie (c) typist County Relief Admn Crumbliss Sewell H (Nell) 1 miner h 607 Wool- 501 Forsyth folk Cross Moses (c) chauf Hubbard Funeral Home Crumley James H elk Federal Transient Bur r r 655 Clinton 504 Plum Cross Ned (c) peddler r 806 (820) Cowan Crump Chas (Clarice) 3 hlpr h 654 Elm Cross Rosa (c) 1 h 107 Empire (V) Crump James (Lucile) speeder hd Payne Mill Cross Willie M (c) 2 h 444 Peter's al (EM) h 317 Melrose (B) Crossley Julian M (Saxon) 1 mach supv C of Crump John D (Jennie R) 1 (o), Pres Macon Ga Ry r 1134 College dr Federal Saving & Loan Assn, Mgr McKesson Crossley Margt sten J E Wilson & Son r 537 Riley, h 364 Cherokee--Tel 4543 Boulevard Crump Lucile (Mrs James) spinner Payne Mill Crossley Philip M (Julia D) (o) h 537 Boule- r 317 Melrose (B) vard (NH) Crumplar Cecil shpg elk Bearing Sup Co r 298 Crouse James E (Gertrude P) (o) state rep Belmont Scott Foresman & Co h 241 Boulevard (NH) Crumplar Estelle student r 201 Pierce (V) Crow Aaron C (Ruth C) 1 (o) (Crow's Toggery Crumplas Mae (Mrs R S) opr Happ Bros Co r Tailors) h 116 Boulevard 398 Belmont Crow Chas elk Rogers Inc r 204 Appleton Crumplar Reuben S (Mae) slsmn r 398 Bel- Crow Clinton M (Frances) 2 slsmn h 204 Ap- mont pleton Crumpton Evion (c) r 244 5th (V) Crow Clinton M Jr wtchmkr The Watch Shop r Cruse Alonzo (c; Cynthia) 1 brklyr h 455 (468) 204 Appleton Broad Crow James (Isabel) tex wkr r 5 Roff Home pi Cruselle Wm emp Greyhound Lines r Central Crow Jimmie L sten Washburn Storage Co r Hotel 204 Appleton Crutchfield Anderson B (Roy's Serv Sta & Gro) Crow John emp Atlantic Cotton Mills r 5 Roff h Clinton rd extd (EM) Home pi Crutchfield Calder B (Frances L) elk Macon Crow Susie (wid F B) tex wkr h 5 Roff Home Evening News h 163 Spring Apt 4 CrPoiw's Toggery Tailors (AC Crow) 309 Cherry Crowder Annie (Mrs JR) emp Atlantic Cotton Mills r 110 Roye Crutchfield Jack E (Genevieve ( doormn Rita Theatre h 307 Forsyth Crutchfield John mech r 620 2d Crutchfield L Roy (Roy's Serv Sta & Gro) r Clinton rd extd (EM) 1935 Macon City Directory 195 Crutchfield R Lamar meter reader City Bd of Water Comrs r 617 Carling Crutchfield Robt H (Hilda M) 1 mach C of Ga Ry r 618 Montpelier Crutchfield Roscoe tr dr Power Oil Co res Round Oak Ga Crute W F (Hattie) formn Macon Teleg Pub Co r Bloomfield rd RD 2 Cubbege Etta M (wid Clarence) r 140 Georgia Cubby Nancy (c) r 721 Whitehead al Cubie Annie (c) 1 h 234% Woodliff Cuby Nancy (c) cook 906 Orange Cudahy Packing Co The S V Anderson mgr whol meats 336 Poplar Cuey Dean (Jewel) tex wkr Bibb Mfg Co r 118 Yates Culbertson Georgia L opr Happ Bros Co r 202 Newberg (SM) Culbertson Lizzie (wid C C) r 202 Newberv (SM) * Culbreath Anna r 201 Clisby pi Culins Irvin (c; Annie) lab h 1 Barfield al Cullen Grace (c) r 361 (3) 7th Cullen L J Co The J J Story mgr farm loans 418-19 First Nat Bk bldg Cullens Edw (c) r 108 (193) Richard (U) Cullens Juanita (c) r 108 (193) Richard 2 (o) Sec-Treas Dowdell Louise (c) r 348 Flanders Murphy Taylor & Ellis Inc, h 115 Bucking- Dowdell Oda M (c) clnr Snow's Ldry r 103 ham pi--Tel 4583 Rose Crest Dotson Harry A (Hazel H) mgr Beverage Sis Dowdell Robt (c) r 348 Flanders Co r Terminal Hotel Dowdell Sam (c) lab Willingham S&D Co r Dotson Hazel H (Mrs H A) asst mgr Bever- 310 2d (V) age Sis Co r Terminal Hotel Dowdy Robt G slsmn r 318 New Dotts Howard F (Pauline) 2 flgmn M D & S Dowell James (c) jan Macon Hosp r 310 2d R R h 141 Piedmont (SM) Doty J Cone (Corinne) 2 carp r 553 Walnut (WH) Dowell Kane M (wid Alex (o) h 316 Hill Crest Dotty Henry J (Edith) (o) h 210 Park (B) Dowell Luther (c; Lilly) 6 lab h 310 2d (WH) Dougherty John bkpr Masonic Home of Ga r Dowell Sami (c) lab r 310 2d (WH) 768 Cherry Doughtie Claude H (Lucille E) 1 emp Otis A DOWELL SPRIGHT (Camille) Pres Mercer University, h 501 Adams--Tel 2238 Murphy Co h 99 Vineville (V) Apt C 4 Dowell Spright Jr hlpr Hart's Mortuary r 755 Douglas A Lawson bkpr Macon Bldg Loan Co Cherry r Y M C A Dowell Willie L (c) r 310 2d (WH) Douglas Anice ofc elk Lanier High Sch for Downey Gertrude E X-ray tech Middle Ga Boys r High Point Mineral Wells Hosp r 553 Orange Douglas Bessie (c) 2 (o) cook h 417 e Academy Downie Bros Circus Central City Pk (EM) Doyle Andrew (c; Nettie B) 3 (o) caulker City Douglas Cortez r 100 Pineview Douglas Dorothy G (c) cook A T Alfriend r Bd of Water Comrs h 635 4th (WH) Doyle Chas (c) r 635 4th (WH) 520 Monroe (V) Doyle Clifford E (Mary W) 2 (o) slsmn h 306 Douglas Eliz r 100 Pineview Buford pi (V) Douglas Frances student r 1986 3d Doyle Edw B (Reba P) U S Marshall h 304 Douglas Irene marker Snow's Ldry r 658 1st Buford pi (V) Douglas James (c) r 1220 Reynolds al Doyle Frances (c) r 582 Monroe (V) Douglas John W Jr (Lucile) (o) h 100 Pine- Doyle Miriam J student r 304 Buford pi (V) view Doyle Robt O U S Dep Marshall r 304 Buford Douglas Lillie B (c) cook W E Scott r 417 e Academy (EM) pl (V) Doyle Walter F student r 304 Buford pi (V) 210 Baldwin's and Telegraph's Dozier Claudie r 519 Pine Dozier Ellie R winder Bibb Mfg Co r 763 2d Dozier Eug R (Leola) 2 (o) asst wire chf W U Teleg Co h 424 Log Cabin blvd Dozier Eug R Jr (Frances) 2 r 163 2d Dozier Geo (c) hlpr W H Davis r RD 1 Dozier Herbert W (Muriel) 1 elk Herbert-Tur- ner r 424 Log Cabin blvd Dozier Joseph L tr dr Armour & Co r 224 Georgia Dozier Mae (Mrs W C) slswn Macon Memorial Pk 855 New Dozier Mary L r 434 Log Cabin blvd Dozier Nettie R (c) smstrs Oglethorpe Private Infirmary r 620 Spring Dozier Rosa (c) cook J W Oberry Dozier W Edw (Frankie) 1 agt Penn Mut Life Ins Co r 424 Log Cabin blvd Dozier Warren C (Mae) (o) eng C of Ga Ry h 855 New Dozier Warren C Jr r 855 New Dozier Wm (c; Nettie R) orderly Oglethorpe Private Infirmary r 620 Spring (E) Dozier Wm H (Bertha) 3 slsmn h 125 Carlisle Drake Archie A Jr (Mary B) 2 (o) sec-treas Bibb Mfg Co h 327 Hill Crest Drake Estil S (Mrs W N) opr So Bell Tel Co r 707 Adams Drake Irene (Mrs R M) mus tchr 210 Berkley dr (I) Drake Raleigh M (Irene) 2 prof Wesleyan Col- lege h 210 Berkley dr (I) Drake Wm (Pearl) lab h 315 Melrose (B) Drake Wm F (Hattie) (o) pres h 131 Rose pk Draughon Wm N farmer r 947 Montpelier Drawdy Sherman L (Winell) slsmn Sterchi's r 918 New Drawhorn Eula (Mrs I J) opr Happ Bros Co r 1329 3d Drawhorn Ira J (Eula) 2 h 1329 3d Drawhorn Wm C h 229 Reid Drawhorne B J (Hazel) mldr Willingham S & D Co res Lizella Ga Drawhorne Hazel (Mrs B J) waitress Wool- worth's res Lizella Ga Drawhorne O T (Amanda) mldr Willingham S & D Co res Lizella Ga Drayford Wm (c; Rose) 1 lab Buckeye Oil Co h 116 Tindall (SM) Drayton Eug (c; Annie M) h 315 (312) Wo- mack Drew Arth (Abbie) 1 cbntmkr Willingham S & D Co r 324 Cleveland (SM) Drew Barbara student r 914 New Drew Emma Mrs matron Methodist Orphans Home r do Drew Marie r 914 New Drew Martha r 914 New Drew Thos A (Edna) guard City St Dept h 914 New Drew Thos C (Sallie) (o) h 751 College Drew Thos H (Mae B) 1 (o) eng So Ry Sys- tem h 115 (109) Montpelier Drewery Lora clnr Bibb Mfg Co Dreyford Wm (c; Rosie) 1 hlpr Buckeye Oil Co h 112 (116) Tindall Driggars Annie B (Mrs S B) elk FERA r 136 (102) Colquitt Driggars Jack D (Recie) 2 atndt Standard Oil Co h 157 1st Driggars Margt r 1005 Oglethorpe Driggars Seymore B (Annie B) 2 h 136 (102 Colquitt Driggars Seymore B (Annie B) 2 h 136 (102) Colquitt Driggers Lorella spinner Bibb Mfg Co r 25 Bibb av Driggers Pearl (wid K L) 1 emp Bibb Mfg Co h 25 Bibb Drinnon Everett S (Mattie) 1 slsmn Yates & Tabor Co h 131 (165) Parkwood (B) Drinnon James R carrier Macon Evening News r 97 Clayton (V) Drinnon Nell C elk Gill's Bakery r 97 Clayton (V) Drinnon Wm C (Mamie A) 6 dep elk County Tax Coir h 97 Clayton (V) Drinnon Wm M (Callie E) elk Macon Evening News h 137 Culver (V) Driskell Allen (c; Minnie) h 407 (208) Henderson (SM) Driskell Bernice (e) 4 h 754 Center (EM) Driskell Claudia M (c) 1 r 750 Center (EM) Driskell Elmer (c; Mamie) 1 hlpr So Ry r 116 5th Driskell Hattie (c) Indry wkr h 201 Oemulgee Driskell Ida (Mrs Nathl) spooler Bibb Mfg Co r 233 (4) Forest (B) Driskell Jacob (c; Amy) 7 emp Lanier Hotel h 597 (503) Smith (EM) Driskell James (c) porter Union Bus Terminal r 137 2d (U) Driskell Jesse E (Allie M) 1 (o) signalmn C pf G Ry h 110 Ormond ter Driskell Lillie M (c) r 605 Telfair (SM) Driskell Nathl (Ida M) 2 tex wkr Payne Mill h 233 (4) Forest (B) Driskell Robt (c; Willie) 1 hlpr So Ry h 187 Hatfield al Driskell Viola (c) maid r 3 Woodliff Drive It Yourself Co (Chapman's Garage) 413 Mulberry Driver Chas (c; Mattie B) h 607 (683) Elbert Driver Marshall tchr Masonic Home r 209 1st Driver Mary (c) emp Snow's Ldry Driver Mattie B (c) maid Avalon Beauty Shoppe r 607 (683) Elbert Drosini Estella L Mrs case supv Macon Tran- sient Bur r 853 Cherry Dryer Sara (c) r 1232 Broadway Duberry Regina (c) cook r 1008 Main DUBLIN L ROY (Leva S) (o) Mgr Western Union Teleg Co h 122 Boulevard--Tel 4960-M Dublin Leva S (Mrs L R) br mgr W U Tel Co 122 Boulevard Dubose Alma (Mrs J H) spooler Bibb Mfg Co r 9 Lake City (EM) DuBose Betty B student r 713 Cherry DuBose E Austin (Ida M) coir Macon Teleg Pub Co h 424 Calhoun DuBose Ella (wid J S (o) h 713 Cherry Dubose Ernest (Martha) 3 h 319 Chappell (SM) DuBose I Boyd (Marie A) condr C of Ga Ry h 713 Cherry DuBose I Flemon (Nellie) 1 tex wkr Payne Mill h 55 Davis (PM) DuBOSE J H & SON (J H & W H DuBose) Junk Dealers and Used Auto Parts 121-41 Poplar--Tel 652 DuBOSE JAMES H (Mary C) (o) (J H DuBose & Son) h 765 Mulberry--Tel 5260 Dubose John A r Lake City (EM) Dubose John H (Alma) 1 tejc wkr Bibb Mfg Co h 9 Lake City (EM) Dubose Louis (Maggie) 2 h 320 Chappell (SM) Dubose M Geo r 319 Chappell (SM) Dubose Marie A (Mrs I B) dir City Play Grounds r 713 Cherry Dubose Matthew (c; Clara) (o) carp h 105 May DuBose Nellie (Mrs I F) tex wkr Payne Mill r 55 Davis (PM) DuBose Theo P (Hasseltine) pharm Vineville Drug Co r 124 (140) Pierce (V) DuBOSE WINSTON H (Sarah) 3 (o) (J H DuBose & Son) h 202 Pierce (V)--Tel 4983 1935 Macon City Directory 211 Duck Carl (e) r 816 Ash Duck Cosby (c) dishwasher Plaza Cafe r 816 Ash Duck Tommie (c) maid r 816 Ash Duck Wm (c) delmn D E Hudson r 816 Ash Duckett Sara (c) sch tchr r 114 Tatnall Duckworth Annie Laurie student r 467 Duncan Duckworth Jesse M (Annie B) 2 chf fire inspr CFD h 467 Duncan Duckworth Malcolm L (Virginia) laddermn CFD r 467 Duncan Duckworth Mary Eliz r 2009 2d Dudley Albert (c; Fannie M) tr dr r 603 (106) Straight (U) Dudley Andrew (c; Indiana) 1 lab Proctor & Gamble Mfg Co r 1130 Broadway Dudley Averilla (wid Walter) (o) h 219 (120) Cutters la (EM) Dudley Carey (c; Martha P) h 138 Roosevelt (V) Dudley Eliz (c) r 158 Birch (U) Dudley Elijah (c; Pearl) 1 lab' Taylor Iron Wks h 1236 Broadway Dudley Frank (c; Ree) emp Bibb Mfg Co r 1236 Broadway Dudley Geo L (c; Mattie) 2 auto repr 1016 Main (EM) h do Dudley Indiana (c) emp Snow's Ldry r 1130 Broadway Dudley Joseph (c) lab r 657 Hazel Dudley Joseph (c; Ida) 3 h 158 Birch (U) Dudley Lenora T (wid M S) (o) h 594 Duncan Dudley Lila (c) cook h 420 Hawthorne Dudley Maggie (c) h 657 Hazel Dudley Mary (c) 1 maid r 1029 Pio Nono Dudley Mattie P (c; Mrs Carey) lndrs r 138 Roosevelt (V) Dudley N Macon (Susie) receiver Fourth Nat Bk ofc 516 First Nat Bk Bldg h 310 Buford pi (V) Dudley Pearl (c) maid Katie F Fried r 1236 Broadway Dudley Polly (c) lndrs h 210 Roosevelt (V) Dudley Robt (c; Carrie T) 4 chauf J D Crump r 204 Grant (V) Dudley Rosa (c) r 421 North Dudley Sue r 310 Buford pi (V) Dudley Zella (c) cook h 204 Grant (V) Dudney A Donald emp Bibb Mfg Co r 598 Boulevard (NH) Duff Cash Grocery (A B Dover) 942 (940) Elbert Duffell Richd S (Eliz) (o) vet 557 Plum h 1502 Vineville (V) Duffell Richd S Jr r 1502 Vineville (V) Duffell John T r 302 Rutherford (SM) Duffell Wm O (Ruby A) 5 h 302 Rutherford (SM) Duffern Mae (Mrs H) r 818 3d Duffey Alonzo (c) hlpr C G Tyner r 371 Chestnut Duffey C Louise tchr Joseph Clisby Sch r 225 Masonic Home rd (NH) Duffey Robt G (Clara L) (o) elk McCommon Bros h 225 Masonic Home rd (NH) Duffy Frances (wid P C) r 653 2d Duffy Paul A confr 672 Cherry r 218 High Dugan Henry (c; Lela) h 235 Woodliff Dugan Lela (c) maid Ga Academy for the Blind r 235 Woodliff Dugard Carmi M (Mrs C W) tex wkr Payne Mill r 108 Green (PM) Dugard Chas W (Carmi) 1 tex wkr Payne Mill h 108 Green (PM) Duggan Chas A elk Hotel Lanier r do Duggan Robt S elk Ry M S r Jeffersonville rd Dugger Dudley B elk R H Matthews Inc r 519 Johnson Dugger James G (Mamie) wtchmn h 519 Johnson Dugger James G Jr elk Rogers Stores r 519 Johnson Dugger Lee (c; Minnie) h 2 Violet Dugger Sarah L sten Dun & Bradstreet Inc r 519 Johnson Dugins Irvin (c; Rosa) lab h 118 (5) Spring la Duhart Anderson (c; Mary) 4 h 268 1st (V) Duhart Annie (c) cook J T McGehee r 211 (79) Craft Duhart Asa (c; Bertha) lab Macon Cooperage Co r 268 1st (V) Duhart Ezra (c; Annie) 1 hlpr Macon Cooper- age Co r 211 (79) Craft Duhart James (c) r 228 Grant Chapel al Duhart Marion (c) lab So Crate & Veneer Co Duhart Rivers (c) 5 h 228 Grant Chapel al Duke Beulah M tex wkr Payne Mill r 154 Com- er ter (PM) Duke David (c; Lillie) 3 (o) blksmth h 267 (663) Hall (EM) Duke Fredk C (Rebecca) h 154 Comer ter (PM) Duke Joseph Z mech S E Greyhound Bus Lines r 321 1st Duke L M tex wkr Payne Mill r 154 Comer ter (PM) Duke Nicholas (White House Weiner Stand) r Gordon Hotel Duke Patk electrn Hotel Lanier r do Duke U Nelson (Nora E) 2 stone ctr Clarke Memorial Inc h 106 Highland (LCHts) Dukes Alton r 248 Main (EM) Dukes Gertrude Mrs emp Bibb Mfg Co h 741 Hawthorne Dukes James P (Jennie L) 3 tex wkr Payne Mill h 147 Comer ter (PM) Dukes John emp Bibb Mfg Co r 741 Hawtorne Dukes John H (Willie) gro 248 Main (EM) h do Dukes M Josephine r 258 Hydrolia Dumas Annie R r 420 Calhoun Dumas Chester M (Lucy B) gro 704 Haw- thorne h 859 2d Dumas Clement student r 420 Calhoun Dumas Danl (c; Mamie) 1 dr Taylor Trans Co h 220 Telfair (SM) Dumas E B (c) bus boy De Luxe Cafe Dumas Easter (c) r 807 Edgewood Dumas Fannie (c) nurse r 150 Washington Dumas Gussie M r 420 Calhoun Dumas Hamlet H (Marcella) 1 restr ft Poplar r 420 Calhoun Dumas Helen (c) r 5 White al Dumas Isaac (c; Willie K) baker r 310 (328) e 2d (EM) Dumas James (c) r 61 Craigs la Dumas John (c) lab Barfield Feed Mills Dumas Josephine (c) emp So Crate & Veneer Co Dumas Katie (c) cook Geo Poulos r 328 2d (V) Dumas Laura (c) maid Macon Hosp r 1011 Elbert Dumas Louise (c) 4 dom h 603 (106) Straight (U) Dumas Mary (c) r 113 (118) Adams Dumas Nicodemus D (c; Lillian) 1 porter Alf Mack's Pharm h 369 Flanders (EM) Dumas Nora (c) (o) h 150 Washington Dumas Ora sten Ga Power Co r 533 Orange Dumas Peavy (Laura) 1 lab h 117 (5) Fulton la Dumas Robt (c) lab Barfield Feed Mills Dumas Sallie (c) cook r 174 Northwest Boundary Dumas Susie (c) lab So Crate & Veneer Co Z1Z Baldwin's and Telegraph's Dumas Thos (c; Sallie) h 174 Northwest Boundary Dumas Thos (c; Gertrude) (o) emp C of Ga Ry h 143 (203) Nussbaum Dumas Viola (c) emp The Clinic Dumas W Carl (Maude) 3 engr C of Ga Ry h 420 Calhoun Dumas Wm C (Lillian) 1 firemn C of Ga Ry r 723 College Dumas Wm P (c; Fannie) hlpr The Schwab Co r 150 Washington DUN & BRADSTREET INC J A Murray Mgr, mere agey 109-10 Bibb bldg--tel 2263-2264 Dunagan Glen elk Gamble Mtr Exp r 224 Georgia Dunaway Emmett E (Mary C) 2 mech h 203 Fulton (Lynmore) Dunbar Chas C (Eliz) h 209 Williams (SM) Dunbar John G (Julia) h 108 2d Dunbar John W (Stella) 1 emp C of Ga Ry h 166 Virginia Dunbar Sarah H. (c) (o) h 61 Spring Duncan Annie B (c) maid O G Gillon r 225 Watson al Duncan Arth (c; Blanche) hlpr So Crate & Veneer Co h 113 Rose Crest Duncan Bessie (c) h 853 Edgewood Duncan Beulah (wid D S) r 756 New Duncan Carrie (c) maid r 207 Madison (V) Duncan E Herman (Ollie) supt Adams Mfg Co h 102 Cleveland (V) Duncan Esther (c; Viola) emp C of Ga Ry h 520 Hawthorne Duncan Frances M r 207 Vista cir (I) Duncan Gussie (c) cook C H Goldstein Duncan H Levi (c; Emma L) h 125 Ward (V) Dunean Henry S opr Happ Bros Co r Hotel Macon Duncan Herman Jr emp Adams Mfg Co r 102 Cleveland (V) Duncan James D (c) lab So Crate & Veneer Co r 104 Bay Duncan Lillian (e) maid W F Drake r 422 (538) Henrietta (SM) Duncan Malachi (c; Geneva) 2 hlpr C of Ga Ry h 105 (222) Hendrix al Duncan Malachi Jr (c) delmn Ard Cash Gro r 105 (222) Hendrix al Duncan Marshall (c; Annie) hlpr Ga Roofing & Sup Co h 225 Watson al Dunean Mary F (c) maid S A Stearman Duncan Millard S (c) case aide County Relif Admin r 852 Ocmulgee Duncan Myrtle F r 207 Vista cir (I) Duncan Odessa (c) cook C J Toole Duncan R Lee (c; Arizona) carp h 201 (309) Ward (V) Duncan Rosa (c) 1 emp Maxwell Bros r 317 Harris la Duncan Sallie M (c) cook R E Atwater r 151 (216) Nussbaum Duncan Sarah (c) maid J M Clements Duncan Seabron (c) r 728 (628) Prince (SM) Duncan Talton (c; Maggie) blksmth h 511 (311) Hall (EM) Duncan Wm (c; Hattie) h 815 Elbert Duncan Wm (c; Pearl) porter D H Adams Mtr Co h 133 Jones Duncan Wm B (c; Lillian) h 422 (528) Hen- rietta (SM) Duncan Wm W (Myrtle) supt F S Royster Guano Co h 207 Vista cir (I) Dungan Lloyd G agt Gamble Mtr Exp r Capitol Hotel Dunham Alvin C (c; Bertha S) atndt Hubbard Funeral Home r 203 (118) Bowman Dunham Chas L (Evelyn) 1 hlpr C of Ga Ry h 757 Poplar Dunham Dennie (c) lndrs h 203 (118) Bowman Dunham Eliz emp Ivey-Turner Ice Cream Co r 1057 Walnut Dunham Hilburn emp Atlantic Ice & Coal Co r 1057 Walnut Dunham Howard H (Ethel) 4 printer Macori Teleg Pub Co h 1057 Walnut Dunham Margt (c) 1 r 203 (118) Bowman Dunham Wm (c; Charity) lab h 12 Toombs (SM) Dunker Leroy W (Sadie Y) signalmn So Ry System h 2648 Houston (SM) Dunklin Lee r 219 High Dunlap Josephine student r Jackson Spring dr (SH) DUNLAP KINLOCH F (Marie W) Mgr Dunlap Roofing Co h Anola pi (V)--tel 5357-M DUNLAP KINLOCH F Jr (Nell B) (Dunlap Roofing Co) r Anola pi (V)--tel 5357-M Dunlap Mary (c) tex wkr Payne Mill r 119 Bartlett's la Dunlap-Peeler Hardware Co A M Peeler pres, C W Johnson sec-treas T L Funderburk genl mgr 357 Cherry DUNLAP ROBT C (Annie) 1 (o) Pres Bibb Chevrolet Co, vp The First Nat Bk & Trust Co In Macon, h Jackson Spring rd (Shirley Hills)--tel 129 DUNLAP ROOFING CO (K F Dunlap Jr) 266 5th--tel 1400 (See back cover supp) DUNLOP TIRE & RUBBER CO, G Mac Jordan Mgr, 611 Broadway--tel 3016 Dunlap Wm H slsmn Dunlap Roofing Co r Anola pi (V) Dunlavey G Thos (Southern Investment Co) r RD 2 Dunn Addie M (c) cook O L McKinney h 211 Holmes Dunn Annie (c) emp Bibb Mfg Coi r 771 Ash Dunn Bernice (Mrs E L) spinner Bibb Mfg Go r 338 Calhoun Dunn Chas (Jessie) tex wkr Payne Mill h 137 Comer ter (PM) Dunn Daisy (c) r 334 Hammond Dunn Eliza (c) drsmkr 511 e 1st (EM) r do Dunn Ellis H (Myrtice) mach C of Ga Ry h 218 Georgia Dunn Elvy L (Bernice) 1 emp Bibb Mfg Co h 338 Calhoun Dunn Emma (c) 4 h 506 (119) Elliott Dunn Frances student r 116 Tenney (SM) Dunn Geo H (c; Willie) (o) r 611 3d (V) Dunn Henrietta (c) elk County Relif Admin r 702 (700) 3d (V) Dunn Janie (c) emp Proctor & Gamble Mfg Co r 100 (500) Campbell (SM) Dunn Jesse W (Mary) 1 tr dr City Scavenger Dept h 440 Edgewood Dunn John H (Annie) 1 cbntmkr C of Ga Ry h 116 Tenney (SM) Dunn John H (c; Janie) 2 (o) emp C of Ga Ry h 449 4th (U) Dunn Jos (c; Louella) 4 porter J S Waldorf & Son h 630 Pebble Dunn Julia cook A L Nims Dunn Leon (c; Aurelia) 1 (o) cook h 1102 Ocmulgee Dunn Lila student r 107 Oliver (LCHts) Dunn Lucille (c) maid r 132 (202) Green Dunn Mary (Mrs J W) opr Happ Bros Co r 440 Edgewood Dunn Myrtice H (Mrs E H) furn rms 218 Georgia r do Dunn Rachel (c) r 105 (112) Powell Dunn Roy L (Helen D) 2 (o) h 108 Curry pi Dunn Sol (c; Eliza) (o) lab h 511 e 1st (EM) Dunn Wilbur L (Martha) r 107 Oliver (LCHts) 193S Macon City Directory 213 Dunn Wilbur L Jr student r 107 Oliver (LCHts) Drum Wm H (c) 2 repr Stanton-Sound Serv r 611 3d (V) Dunson Cornelia (c) cook Wm Floyd r 587 (20) Siam Dunson Mary (c) emp Central of Ga Bkg Co r 117 (15) Wise Dunwody Bessie C (wid R R) r 212 Spring Dunwody Danl D (Mary) 2 (o) County Tag Receiver h 214 Corbin (V) Dunwody Howard R (Margt) 2 ofc engr City Engng Dept h 185 English DUNWODY ISAAC L, Permanent Tax Asses- sor City of Macon, r 212 Spring--tel 2139-J Dunwody Jane student r 212 Spring Dunwody Kate (wid F L) 1 (o) h 212 Spring Dunwody Kenneth W plant supt Cherokee Brick Co res Rivoli Ga Dunwody W Elliott Jr (Mary B) archt 460 Broadway and pres Standard Brick & Tile Co res Rivoli Ga Du Pree Ada r 274 Columbus Dupree Barber Shop (Carrie Dupree) 510 2d Dupree Carrie (Dupree Barber Shop) r 755 Poplar Dupree Dolly (c) maid r 345 Bright (SM) DuPree Doris H (wid E J) 1 (o) tchr Pearl Stephens Sch h 124 Glynn Dupree Edw (Beatrice) r 160 Broadway DuPree Eliz cash Stewart Oil Co r 3809 Houston Dupree Eliz opr Happ Bros Co r 755 Poplar Dupree Ernest (Lonie) 1 r 160 Broadway DuPree Ernest L (Nora U) bkpr Bankers H&L Ins Co h 103 Capital (Mikado pi) Dupree James T h 206 Duncan Dupree Jesse (Ida) r 160 Broadway DuPree Jesse F (Alma) 1 blrmkr C of Ga Ry h 274 Ell (SM) Dupree Luther (c) r 117 (13) Frank al Dupree Luther E (Wastella) 2 tr dr h 103 (264) Pearce Dupree Marie tex wkr Willingham Mills r 206 Duncan Dupree Morgan (Lonie) h 3 Holt (NHts) Dupree Nannie marker Independent Ldry Co r 853 Cherry Dupree Nora tex wkr Willingham Mill r 206 Duncan Dupree O Harold tex wkr Willingham Mill r 206 Duncan DuPree Prentice E (Maidie) emp C of Ga Ry h 113 (137) Charles DuPree Rufus J (Eliza) (o) farmer h 3809 Houston Dupree Thelma r 206 Duncan Dupriest Chas H auto mech City Storage Garage r 322 Orange Dupriest Hiram H (Myrtle) h 322 Orange Durden A Lucille sten Swift & Co r 723 1st Durden Aileen (Mrs E A) tex wkr Payne Mill r 79 Short (PM) Durden Albert H hlpr r 501 Fort Hill Durden Alsey F (Minnie L) (o) yd condr So Ry h 424 Mikado Durden Amos (Margt) 3 r 3 Roff Home pi Durden Andrew B (Pearl) mech Art Furn Co h 125 Piedmont Durden Andrew C supt Ga Industrial Home r do Durden Arth (Annie M) hlpr r 1318 3d Durden Benj W (Nellie) 3 (o) h 312 (313) Melrose (B) Durden Carl B (Marie) 1 mach MD&SRR h 258 Church (EM) Durden Chas H (Cora) 8 emp Willingham Mills h 860 Hazel Durden Clarence (c) farmer r 805 (804) Charles Durden Danl' B (Mattie) h 369 Marion (Lynmore Estates) Durden Danl B Jr emp Art Furn Mfg Co r 369 Marion (Lynmore Estates) Durden Eldora (wid J H) r 129 Knott (SM) Durden Elmer A (Aileen) 2 tex wkr Payne Mill h 79 Short (PM) Durden Emma (c) cook J J Leslie r 5 Alabama Durden Esther (c) cook T A Jacobs r 207 (73) Craft Durden Evelyn emp Southland Knitting Mills r 7 Randolph pi Durden Geo (c) cook Smittys Barbecue Lunch r 5 Alabama Durden Geo T (Mary L) 1 elk GS&FRR r 305 Church (EM) Durden Gus (c; Emma) h 5 Alabama (SM) Durden H Walter (Louise) (Durden & Son) r 216 Lynmore Durden Helen O student r 399 (411) Montpelier Durden Henry L r 216 Lynmore Durden Horace F (Ruby) tex wkr Bibb Mfg Co h 108 Highland (LCHts) Durden Irene (Mrs L F) clerical supv FERA r 420 Mikado Durden James L (Alice) (Durden & Son) h 510 Orange Durden John r 34 Melrose (B) Durden John L (Stella) 1 (Durden & Son) h 216 Lynmore Durden Jno L (Mary) 4 engr Buck Ice & Coal Co h 506 Ridge (I) Durden John M (Jennie) h 7 Randolph pi Durden John R (Emma) 1 (o) hlpr h 501 Fort Hill Durden John R Jr (Sarah) 1 emp Leah S At- kins r 501 Fort Hill Durden Joseph M r 399 (411) Montpelier Durden Leon F (Irene) 3 (o) emp So Ry h 420 Mikado Durden Lula H (wid G H) r 413 Ross Durden Mae Mrs 4 r 134 Schell (EM) Durden Marie (Mrs C B) slswn Union Dry Gds Co r 258 Church Durden Martha N (wid J J) h 1807 3d Durden Mary L r 258 Chuch (EM) Durden Mattie J (c) dish washer Macon Cafe- teria r 229 Telfair Durden Nannie (wid H T) r 103 Pearce Durden Ruby Mrs 3 tex wkr h 1016 Ogle- thorpe Durden Ruby (Mrs H T) tex wkr Bibb Mfg Co r 108 Highland (LCHts) Durden Rufus (c; Lula) 1 lab h 133 (121) Wood Durden Spencer (c; Callie) emp Cherokee Brick Co h 804 (805) Charles Durden Susie (o) h 502 Fort Hill Durden Thelma emp Adams Mfg Co r 312 (313> Melrose (B) Durden Tillman (c; Esther) tr dr Crane Co h 207 (73) Craft Durden W Morgan (Odessa) 1 (o) serv mgr Bibb Chev Co h 399 (411) Montpelier Durden Wesley T emp Willingham Mills r 860 Hazel Durden Wiley h 34 Melrose (B) Durden Wm (c) 1 lab; h 805 (804) Charles Durden Wm O (Josephine) gro 670 Hazel h 68 Cedar (SM) Durden Wm O (Gertrude) 1 (o) mach So Ry h 423 Log Cabin blvd Durden & Son (J L & H W) whol fish 216 Lynmore Dure G L (Nell) broker r Hotel Southland Dure Nela h 533 Orange apt 8 m Baldwin's and Telegraph's Dure Leon S pres Leon S Dure and pres South- Dyche Eva L r 1 Villa (B) land Knitting Mills Inc h 520 Orange apt 3 Dyche Jack L h 201 Grand (B) Dure Leon S Co L S Dure pres W V Davis sec- Dyche Lonnie r 608 Main (EM) treas investments 321 Mulberry Dyche Mell B (Molly) 3 h 176 Palace (B) Dure Leonard C elk The Nat Cash Register Co Dyche Nello tex wkr Payne Mill r 176 Palace r 625 Adams `(B) Dure & Beeks Co L S Dure pres W H Beeks Dyche Tinie Mrs h 1 Villa (B) sec treas ins 321 Mulberry Dyche Wm L r 1 Villa (B) Durham Allen (c; Lula) 2 lab h 103 Tindall Dye Eva (Mrs T W) waitress r 716 2d (SM) Dye John (c; Annie) emp Bibb Mfg Co h 245 Durham Alma (c) 2 r 954 Hazel Watson al Durham Anna (c) maid H D Walker r 106 Dye Kath H Mrs 1 sten Southland Knitting Tindall (SM) Mills r 426 Forsyth Durham C Joseph (Leona) 2 dairy inspr City Dye Leila (c) r 523 Academy al (EM) Bd of Health h 33 Marion pi Dye Robt E (Myrtle) 1 emp Gantt Mfg Co h Durham Chaney (c) r 178 Lincoln (V) 121 Stratton Durham Clifford (Dorothy) agt Norfolk So Ry Dye Taylor W (Eva) 2 tex wkr h 716 2d h 478 College apt 6 Dyedell Cath (c) maid C L Willingham Durham Egbert B (Emma) (o) pres Wood- Dyer Alex (c; Jessie) 1 emp Atlantic Ice & Peavy Furn Co h 648 Hillyer Coal Co h 731 Edgewood Durham Elbert B (Kath) 1 slsmn Wood-Peavy Dyer Benj H (Susie) gro 765 3d h do Furn Co h 661 Hillyer Dyer Beulah (Mrs J A) opr Happ Bros Co r Durham Fannie (c) 1 h 522 (240) Northern 2224 Broadway Durham Henrietta (c) h 423 Peachtree Dyer Chas W (Josie C) 1 (o) eng So Ry Sys- Durham John (c; Mabel) 2 r 301 (302) Tin- tem h 3042 Houston (SM) dall (SM) Dyer Crawford W (c; Elestine) (o) phys St Durham John (c; Johnnie M) h 1217 3d Luke Hosp h 117 Tatnall Durham Johnnie M (c) maid First Nat Bk Dyer E L pntr Proctor & Gamble Mfg Co r bldg r 1217 3d RD 3 Durham Julia (c) sausage linker T&T Pkg Co Dyer Edna r 2224 Broadway Durham Junior (c; Annie) (o) emp Barfield Dyer Elestine (c) supt St Luke Hosp r 117 Feed Mills h 411 (352) Maynard Tatnall Durham Lilia (c) cook M H Hood Dyer Ernest (o) emp Proctor & Gamble Co h Durham Lillian (c) r 106 Tindall (SM) 208 Hightower Durham Mabel J (c) emp Snow's Ldry r 113 Dyer Estelle r 110 Enterprise (159) Elizabeth Dyer Estizer (c) student r 117 Tatnall Durham Marie cook r 9 Magnolia la Dyer Harold r 208 Hightower Durham Otis (c) porter Am Oil Co r 113 (159) Dyer Ida M opr Adams Mfg Co r 1800 3d Elizabeth Dyer Jessie (c) cook r 731 Edgewood Durham Roberta (c) emp Dixie Cafe & Com- Dyer John A (Beulah) 1 elk Lackey & Lackey missary r 131 (12) Bay h 2224 Broadway Durham Rufus (c; Henrietta) 1 shoe repr G R Dyer Marie V student r 3042 Houston (SM) Schelling h 138 Lincoln (V) Dyer Mattie (wid A L) r 215 Ormond ter Durham Sallie (c) 1 h 603 Pebble Dyer Stewart E slsmn Karsten & Denson Co Durham Thos (c; Nancy) 3 emp So Ry h 301 res RD 2 (302) Tindall (SM) Dyer Thos r 2224 Broadway Durham Tommie (c) r 301 (302) Tindall (SM) Dyer W C (Tina) slsmn L P Price Merc Co r Din-ham Tommie M (c) r 206 (407) Campbell 620 2d (SM) Dyer Wm G (W Ann) elk Mulberry Mkt r Durham Watson (c) emp Atlantic Ice & Coal 101 3d Co r 301 (302) Tindall (SM) Dyes Evangeline Mrs smstrs r 708 Pine Durham Wiley (c) delmn Herschel Merchant Dyes John (c; Carrie) 2 lab r 620 Hammond Tailor r 320 Hammond Dyes S Lee 2 gro 202 Crisp h do Durham Wm (c; Ada) 2 emp So Ry h 106 Dykes Andrew J (Bernice) 2 h 52 Cedar (SM) Tindall (SM) Dykes Anna (c) r 162 Lincoln (V) Durham Willie M (c) r 106 Tindall (SM) Dykes Carl tex wkr Willingham Mills r 23 Durloo Louise Mrs hostess Macon Better Hsg (64) Mill Program h 856 Pine Dykes Chas tex wkr Willingham Mills r 23 Durr Ralph N (Maggie M) 3 (o) (Durr's (64) Mill Creamery) h 318 Log Cabin dr Dykes Collis W (Elise) agt Carolina Life Ins Durr's Creamery (Ralph M Durr) 800 Mont- Co r 771 1st pelier Dykes Cora L Mrs 2 tex wkr Bibb Mfg Co r Dushane B Alf (Era) 4 h 343 Columbus 253 Broadway Dutton Ella (c) 1 r 623 Division Dykes Henry (Ethel) 3 tex wkr h 623 Church Duvall Fanny B supt Appleton Ch Home r cfb (CH) Duval Paul (c; Lutitia) (o) (Paul Duval & Son) Dykes Hubert E (Hildred) 1 r 914 Orange h 337 3d (V) Dykes J Robert hlpr Clark Memorials Inc r Duval Paul Jr (c; Addie) 2 (Paul Duval & Son) 743 Ridge (I) r 237 3d (V) Dykes James student r 52 Cedar (SM) Duval Paul & Son (c) (Paul & Paul Duval Jr) Dykes Jessie L tex wkr Willingham Mills r furn reprs 460 Cotton 23 (64) Mill Duval Robt (c; Mamie) lab h 221 Pond (V) Dykes John D (Hattie) emp Dixie Dairies h Dwight Mamie (c) maid r 110 e Ell 914 Orange Dwyer Philip R (Mary G) 2 tchr Lanier High Dykes Julia Mrs h 23 (64) Mill Sch for Boys h 117 Nottingham dr Dykes Louis (c) emp Swift & Co Oil Mill r Dwyer Verna G sten G L Blossom r 126 303 Edgewood North (NH) Dykes Robt (Gertrude) r 233 (4) Forest (B) Dyald Forrest L (Alice) 3 h 104 The Prado Dykes Thelma student r 52 Cedar (SM) 1935 Macon City Directory 215 Eady Ender (c) r 120 (20) Tinsley la Eady Hubert A (Molly) sawyer R L James r 300 (317) Log Cabin dr Eady James (Annie) 4 h 202 Reid Eady Mattie (c) maid h 572 Chappell (SM) Eady Paul W (c; Maggie) 1 hlpr Rose Hill Cemetery h 42 (50) Schofield Earl Betty (c) maid r 431 O'Hara la Earl John 2 (o), Mgr Nat Life & Accident Ins Co of Nashville Tenn, h 1308 Vineville--Tel 1922-M Farrar Sarah A student r 1308 Vineville (V) Farrar Steven (c; Maggie) lab Buckeye Oil Co h 354 Church al (SM) Farrell Edw (Juanita) 3 h 30 Bellevue rd Farren Adeline (c) maid P H Rawlins Farren John J (Irene) (o) decorator Union Dry Gds Co h 797 Hillyer Farren John J Jr student r 797 Hillyer Farrer Chas (c) h 315 Gilmer Farrer Marguerite E student r 1308 Vineville , Vp Indepen- dent Ldry Co, h 118 Callaway (V)--Tel 3592 FLATAU ISAAC JR, Mgr Independent Linen Serv, r 118 Callaway Phys 411 Ga Casualty Bldg, h Sunset dr (SH)--tel 6121 Fountain James M (Ada E) (o) h 253 Church (EM) Fountain James M bus dr So Stages Inc r 533 Orange apt 7 Fountain Jesse L (c) r 53 Craigs la Fountain Joseph F (c; Idella) 1 emp A B Lee h 208 (211) Henrietta (SM) Fountain LaVerne (Mrs A S) tex wkr Happ Bros r 306 Center (EM) Fountain Leola (Mrs M L) elk Bibb Mfg Co r 321 Randolph Fountain Marvin L (Leola) emp So Crate & Fox Benj (c; Fannie) (o) h 102 Mason Fox Harold W r 289 Winship Fox Henry A (Mae L) 2 slsmn Cooks Beer Co h 3007 Houston Fox Julia (Mrs W H) (Coffee Cup) r 372 Clinton Fox Lizzie r 372 Clinton Fox O'Hara B h 204 Washington FOX RICHD K (Willie M) 1 Asst Mgr Bibb Brokerage Co, h 102 Highland (NH) Fox Sallie (wid W C) (o) h 372 Clinton Fox Wm H (Julia) 1 asst supt Royster Guano Plant r 372 Clinton Foxworth John E (Belle) emp Willingham Mills h 4 (77) Mill Foy H W (Sara) elk Dunlap-Peeler Hdwe Co r Columbus rd Foy Mary L (c) h 2 (530) Sparks al Fragers Peter (c; Josephine) r 165 (237) Veneer Co h 321 Randolph Fountain Mattie G (c) r 208 (211) Henrietta (SM) Fountain Miller A (c; Hattie) pastor Stewarts AME Ch h 653 Spring Fountain Myrtle nurse 185 Magnolia r do Fountain Otis (c) r 53 Craigs la Fraley Fate (c; Amelia) tr dr Paul Wil- liams Co Fraley Lecarnia (c) cook E C Moore r 224 Tharpe (B) Fraley Lilia (c) emp Bibb Mfg Co r 79 Wilder (SM) , ,,^ Fountain Robt E mach Bibb' Mfg Co r 353 Center (EM) Fraley Malachi (c; Annie) 4 lab Shell Petroleum Corp h 114 (201) 4th (B) Fountain Rosie (wid D S) 1 h 476 Ash Fountain Rosina (wid E L) r 678 Courtland Fountain Susie (wid Ernest) 1 emp Bibb Mfg Co h 200 Cole Fourth National Bank Receiver M M Dudley receiver 516 First Nat Bk bldg Fraley Malachi L (c) barber T Ellen Jackson h 224 Tharpe Fraley Martha (c) 2 h 108 (114) 6th (B) Fraley Minnie (c) h 411 Arch Fraley Mollie (c) r 216 Hilliard al Fralick Lucile slswn Day's r 810 Spring Fowler Benj J lawyer 415 Ga Casualty bldg r 298 College Fowler Billie student r 114 Buford pi (V) Fowler Boise (c; Mamie) 3 h 634 Hammond Fowler Calloway (c; Mildred) 1 emp Bibb Mfg Co r 113 (9) Jordan Fowler Chas r 556 Ocmulgee Fowler Chas J (Georgie A) 4 emp Willingham Mill h 224 Duncan Fowler F Alton (Mary C) 1 waiter Crawford's France Ernest H (Edith) (o) (E H France Granite Co) h 2455 Forsyth rd France Sidney (Bernice G) 1 emp France Stone Co r 623 Vineville (V) Francis Antonio gro 518 2d h do Francis Essie M (c) r 112 Wyche Frank Geo (c) 2 lab r 121 (76) Braswell la Frank Helen slswn Darling Shops r 855 Mul- berry apt 204 Frank Joseph (c; Mattie) hlpr Bibb Mfg Co Barbecue Lunch r 458 Carling Fowler H C Lumber Co (H C Fowler) 1900 Vineville Fowler Harry C (Annie L) (o) (H C Fowler Lbr Co) h 114 Buford pi Fowler Hazel R student r 669 Courtland Fowler Ida M (c) h 157 Clara h 111 (302) Craft Frank Michaux (c) r 244 Garden Frankley Lillecott (c; Cora) r 85 Wilder (SM) Franklin Ada (c) r 359 (2) 7th Franklin Alwilda Mrs r 102 Grand (B) Franklin Bertha (c) dom W T Haden Franklin Bertha L (c) emp Snow's Ldry r 123 Fowler James hlpr r 563 Hawthorne Fowler Jesse (c) lab F S Royster Guano Co Fowler John C (Ethel) 1 r 630 Forsyth Fowler Joseph (c; Eva) atndt Flanagan's Camp h 508 O'Hara la Fowler Julian T emp Bibb Printing Co r 669 Courtland Fowler Julian W ofc asst R J Reynolds Tob Co r 1301 Vineville Fowler Margt nurse Macon Hosp r do Fowler Mary (c) dom r 232 (236) Fargason (V) Fowler Mary sch tchr r 114 Buford pi (V) Fowler Nora (wid J M) r 108 Magnolia Fowler Otto T mach Bibb Mfg Co Fowler Pierce (c) r 205 (123) Mutual (V) Fowler Sallie (wid S M) emp Bibb Mfg Co h 563 Hawthorne Fowler Sophronia (c) drsmkr 953 Ocmulgee r do Ash Franklin Blanche (Mrs J A) slswn Dannen- berg's r 379 Orange Franklin Carey J (Ruby) (o) formn C of Ga Ry Creosote Plant h 102 Grand (B) Franklin Cath (c) maid Johnson G M r 160 Lincoln Franklin Chandler (Minnie) r 619 2d Franklin Chas (c; Elnora) lab C of Ga Ry r 123 Jones Franklin Clifford (c) cook F O Schofield r 144 Sycamore (V) Franklin Easter (c) h 136 e Ell Franklin Edw (c) 1 r 601 (1270) Elbert Franklin Edw (c; Beatrice) 1 lab C of Ga Ry h 211 Tharpe Franklin Elmore (c; Susie) 1 (o) h 337 (363) Robinson rd Franklin Emma (c) r 105 Spring Fowler Thos E (Ida) condr MD&SRR h 669 Franklin Fannie (c) dom r 447 Ballard (EM) Courtland Fowler Wallace J emp Willingham Mill r 224 Duncan Fowler Walter G custodian Alex Sch No 2 r 108 Magnolia Fox Adah (o) sten Macon Memorial Park h 289 Winship Franklin Fronie (c) maid J L Edwards r 12 Ross St pi Franklin Glover (c; Eliz) 1 tr dr City r 241 Church la (SM) Franklin Grace (c) emp Macon Hosp Ldry r 328 McClain la ns Baldwin's and Telegraph's Franklin Herbert (c) hlpr Clark Memorials Inc r 308 Industrial Home rd Franklin J Allen (Blanche) trav slsmn h 379 Orange Franklin James (c; Islean) lab h 865 Edgewood Franklin Jennie (c) lndrs r 220 (12) Virgin la Franklin Jennie (wid J C) r 666 Napier Franklin John L (c; Maggie) firemn C of Ga Ky h 209 Calhoun Franklin Josey X-ray technician J C Fountain h 810 Mulberry apt 5 Franklin Levornia (c) hlpr Clark Memorials Inc r 308 Industrial Home rd Franklin Lodge No 2 Independent Order Odd Fellows W I Spikes sec meets Thursdays 8 p m 502% 2d Franklin Lonnie (c; Clifford) (o) emp C of Ga Ry h 144 Sycamore (V) Franklin Mack (c; Lula) 3 lab r 246 Willingham al Franklin Mamie (c) 3 maid C E Doyle h 112 (220) Green (V) Franklin Morgan (c) emp Snow's Ldry r 123 Ash Franklin Nettie M (c) maid r 534 Flanders Franklin Pete (c) hlpr Buster Btlg Co r 123 Jones Franklin Rachel (c) r 124 Roosevelt (V) Franklin Sarah M (c) cook J C Tarver r 515 Forsyth Franklin Sophronia (c) cook J L Edwards r 12 Ross St pi Franklin Susie maid J A Thomas r Robinson rd Franklin Thos (c) stone ctr Clark Memorials Inc r 308 Industrial Home rd Franklin Walter (c) dr Colored Taxi Co 3 Walls al Franklin Wm (c; Carrie) lab Cherokee Brick Co h 400 (461) Alabama (SM) Franklyn Bertha (c) r 101 2d (B) Franklyn Clarabelle (c) lab Bibb Mfg Co r 101 2d (B) Franklyn Dolline (c) r 101 2d (B) Franklyn Leroy (c; Clarabelle) lab E H France r 101 2d (B) Franklyn Thos (c) lab E H France h 101 2d (B) Franks Ada (c) r 379 Middle (V) Franks Carrie (c)'h 379 Middle (V) Franks Doshia Lee (c) cook r 110 Antioch rd Franks James (c; Lillie) hlpr Riverside Cemetery h 64 Schofield Franks John (c) emp Riverside Cem r 64 Schofield Franks Lillie (c) maid Mrs R D Maddox r 64 Schofield Franks Lizzie (c) lab So Crate & Veneer Co r 450 Martha Franks Loyal (c) r 379 Middle (V) Franks Sallie (c) 1 lndrs r 303 Womack Franks Warren (c) h 476 Clinton Fraternal Order of Knights of America C A Odom pres W I Stotesbury see-treas meets 1st Monday at 8 p m 402% Mulberry Frayser Rose (c) r 250 1st (V) Frayser W Neale (c; Rose) 2 (o) phys 400 Knights of Pythias bldg h 250 1st (V) Frazier Albert (c) brkmn MD&SRR r 229 Orange Frazier Alice (c) sch tchr r 508 (458) Hall (EM) Frazier Arline (c) cook r 816 Elm Frazier Chas (c; Bertha) 4 lab C of Ga Ry h 1606 1st Frazier Clara (c) hair dresser h 91 (124) Forest (V) Frazier Doris (c) student r 701 (608) Crisp Frazier Eleanor (c) tchr r 817 Daisy (SM) Frazier Fate (c; Armelia) 4 emp Paul Williams Co h 1425 Broadway Frazier Grace emp Macon Linen Sup Co r 821 Curd Frazier Ira (Iris D) woodwkr Central S&D Co r 821 Curd (SM) Frazier Jean (c) r 820 Elbert Frazier Joshua W (c; Florence) lab Cherokee Brick Co h 143 Evergreen la Frazier Lonnie J (Mamie) emp Willingham Mill h 101 Cutro al Frazier Lucile emp Macon Linen Sup Co r 821 Curd (SM) Frazier Lula (c) 1 lndrs Crescent Ldry h 339 Gilmer Frazier Luther F (Clarice W) doffer Bibb Mfg Co h 420 Montpelier Frazier Marion (c) hlpr Hightower Serv Sta r 143 Evergreen la Frazier Mamie emp) Willingham Mills r 101 Cutro al Frazier Martha winder Bibb Mfg Co r 750 Oglethorpe Frazier Mary (c) (o) peddler h 300 (207) 3d (U) Frazier Robt (c; Mattie) lab S E Compress & Whse Co h 203 Ocmulgee Frazier Taft (c) mgr Hubbard Funeral Home r 468 Cotton Frazier Wm (c; Racheal) hlpr Bateman Bar- ber Shop r 539 Calhoun Frazier Wm P (Cora) 2 carp h 821 Curd (SM) Frederick Abr (c; Rosa) 1 (o) lab h 340 Taylor (EM) Frederick DeWitt T (Kate) 1 emp MD&SRR h 819 Walnut Frederick DeWitt T Jr student r 819 Walnut Frederick Emanuel (c) farmer r 111 Bertha- dale dr (V) Frederick Emma (c) (o) h 203 (185) Grant (V) Frederick Fannie O r 456 Pio Nono Frederick Felder (c) r 340 Taylor (EM) Frederick Frances sten Murphy Taylor & Ellis r 819 Walnut Frederick Jettie (c; Annie W) jan Wesleyan College r 203 (185) Grant (V) Frederick Julian V mgr College Hill Pharm r 220 Adams Frederick Mamie (wid J V) r 220 Adams Frederick Martha (c) 1 h 312 Telfair Frederick Robt C solr Buck Ice & Coal Co r 819 Walnut Fredonia Apartments 213 Bond Free Lloyd T opr Postal Teleg Cable Co r Hotel Gordon Free Methodist Church R J Milligan pastor 220 Belmont Freeman A C dep elk Bibb County r 907 Clinton Freeman A Kell hlpr Sterchi's r 712 2d Freeman Alma G (Mrs C B) emp Bibb Mfg Co r 137% Park pi Freeman Arizona (c) r 345 Edison Freeman Beatrice (c) 1 maid r 354 Madison (V) Freeman C B (Alma) formn Ga Roofing & Sup Co r 137 % Park pi Freeman Carl (c; Lizzie) 1 emp C of Ga Ry h 174 (415) Nussbaum Freeman Charity (c) dom W R Golsan r (101) 1 Braswell la Freeman Carrie (c) cook Elmon Dixon r 120 Broad (SM) Freeman Cleveland J (Velma) speeder Bibb Mfg Co h 142 Comer ter (PM) Freeman Clifford (c) cook J C Rousseau h 205 Linden Freeman Clifford (c) 1 lab C of Ga Ry r 219 Woodliff 1935 Macon City Directory 333 Freeman Cora (c) maid J W Shine r 103 (217) Johnson la Freeman-Dent-Sullivan Co R H Freeman Jr pres-genl mgr J L Sullivan vp J T Dent sec- treas prod whol 451 5th Freeman Drucilla (Mrs L K) 1 smstrs 712 Second r do Freeman E N lawyer 564% Poplar r do Freeman Edw r 138 Knott (SM) Freeman Elmo (c; Kath) lab Idle Hour Club r RD 1 Freeman Emmett (c) lab Willingham S&D Co r RD 5 Freeman Eunice formn City r 295 Ruther- ford (SM) Freeman Fannie (c) h 753 3d Freeman H Lewis (Irene) emp r 153 Park pi Freeman H Wm USN r 112 Yates Freeman Harry H (Ruby lone) 3 carp h 138 Knott (SM) Freeman Hattie (c) h 859 Broadway Freeman Hattie (wid A P) h 122 Cedar (SM) Freeman Helen M student r 712 2d Freeman Ida r 611 Holt Freeman Ida O (wid J R) h 405 Duncan Freeman Izetta (c) 3 h 258 5th (V) Freeman J Buford (Frances) 1 asst to scales inspr C of Ga Ry r 701 Napier Freeman James (c; Pearl) 1 emp Meaders Mat- tress Co h 523 e Academy (EM) Freeman James (c; Annie B) 3 lab Willingham S&D Co lab r 86 Bay Freeman James (c; Ethel) lab C of Ga Ry r 301 (421) Elizabeth (SM) Freeman Jewell r 138 Knott (SM) Freeman John (c; Irene) 3 emp Independent Ldry Co r 608 Hammond Freeman John (c; Hattie) mldr Willingham S&D Co r RD 5 Clinton rd Freeman John B (Eunice S) 5 car inspr h 295 Rutherford (SM) Freeman John D prof Mercer Univ r 120 Coleman Freeman John F (Kathryn V) 1 slsmn Sterchi's h 764 Hemlock Freeman John H (Juanita) 1 speeder hd Bibb Mfg Co r 715 Pine Freeman John S (Myrtle) 1 (o) store kpr So Bell Tel Co h 154 Oakland Freeman John T (Laura) 1 emp So Ry h 236 Bacon Freeman Johnnie (c) dom O W Marshall r 607 4th (WH) Freeman Kath (c) hoe hd Idle Hour Nurseries r RD 1 Freeman Leonard K (Drucilla) 1 coir h 712 2d Freeman Lizzie (c) Indrs h 139 Linden Freeman Lula (c) h 904 Hazel Freeman Maria (c) cook Sarah V Minter h 116 (272) Singleton la FFrreeeemmaann1 Mary (c) h 219 Woodliff Mary elk Mitchell & Williams Inc r 860 Mulberry Freeman Mary (c) presser Crescent Ldry RD 6 (EM) Freeman Minnie G (wid R W) 1 h 104 Montpelier Freeman Morrison F (Irene) 1 pressmn Lyon Harris & Brooks r 712 2d Freeman Ocie L (c) maid C A Washburn r 74 Spring Freeman Ollie (c) (o) Indrs h 710 (128) Hall (EM) Freeman Oscar (c; Johnnie M) 2 emp C of Ga Ry h 607 4th (WH) Freeman Otis (c; Eva) lab Empire Coal Co h 1029 Broadway Freeman Richd H Jr pres-genl mgr FreemanDent-Sullivan Co r Central Hotel Freeman Roe S (Bonnie E) mech Ga Power Co r 318 New Freeman Robt S (Marie) (Freeman's Beauty Salon) h 502 Walnut Freeman Sami (c; Ocie L) 1 r 74 Spring Freeman Velma (Mrs C J) speeder hd Bibb Mfg Co r 142 Comer ter (PM) Freeman Will (c; Ola) (o) h 516 (537) Maynard Freeman Wm (c) porter C of Ga Ry Freeman Willie (c; Lethia) lab Willingham S&D Co r RD 5 Freeman Willie M (c) 2 r 300 Crisp Freeman Wilson student r 112 Yates Freeney Agnes L (wid Ernest) (o) treas Bibb County h 100! Summitt Freeney Clara (wid PA) 1 opr Happ Bros Co h 120 Florence Freeney Emma (wid H C) 1 waitress Bon Ton Cafe r 146 Magnolia Freeney Geo A (Molly) 2 h 720 Plum Freeney Geo W (Fannie) lab State Fish Hatch- ery h 115-17 Brookdale (B) Freeney Leroy W (Naomi) 1 emp Sunshine Creamery r 1716 2d Freeney Louise r 120 Florence Freeney Marie r 120 Florence Freeney Molly (Mrs G A) opr Adams Mfg Co r 720 Plum Freeney Naomi opr Happ Bros Co r 1716 2d Freeney Rozier (c; Willie Mae) hlpr r 706 Elm Freeney Willie M (c) maid Wilton Holland r 706 Elm Freeney Henry W lab So Ry h 216 Dorothy (Lynmore Estates) Freeny Mamie B Mrs r 216 Dorothy (Lynmore Estates) Fretwell Mattie L (wid Wm) r 99 Clayton (V) Frey Fred D (Geraldine) 1 h 401 College apt 3A Frick Cath r 155 2d Frick Geo E (Mary C) slsmn Ga Power Co h 155 2d Frick Geo E Jr (Constance) hlpr Dixie Dairies r 400 Forsyth Frick J Benj (Olive W) 1 emp Swift & Co r 155 2d Frick Jean reprmn Morris Putzer r 155 2d Fried Bertha emp Fried's Garage r 752 Hem- lock Fried Esther F (Mrs T D) (Betty-Jane Shoppe) r 107% Pierce Fried Eva (Mrs Harry) slswn Beverly Dress Shop r 752 Hemlock Fried Harry (Eva) 1 trav slsmn r 752 Hemlock Fried Hattie K (wid J H) h 855 Mulberry apt 305 Fried Irving emp Fried's Garage r 752 Hemlock Fried Katie F (wid J R) (o) h 752 Hemlock Fried Leon J r 752 Hemlock Fried Milton R (Fried's Garage) r 752 Hemlock Fried Nettie r 752 Hemlock Fried Theo D (Esther F) 2 (o) (Betty Jane Shoppe) h 107 % Pierce FRIED'S GARAGE (M R Fried) Gasoline, Oil, Tires, Batteries and Storage, 352 Broadway --tel 5486 Friedman Sidney L (Schuster) 1 mgr Maysons h 135 Beverly pi Frieman John (c) lab Procter & Gamble Mfg Co Friendship Baptist Church (c) W M Goolsby pastor 1304 1st Frierson Fleming S (Sue) condr C of Ga Ry r 379 Orange Frierson John N slsmn Happ Bros r 129 Culver (V) 234 Baldwin's and Telegraph's Frierson, Margt H sch tchr r 129 Culver (V) Fuller Chas H (Ines) 1 slsmn Jax Brewing Co Frierson Mary N (wid H R ) 1 tutor 129 Culver h 865 Mulberry h do Fuller Clifford emp Willingham Mills Frink Peter H slsmn Sparks Mtr Co r 514 Fuller Dave (c) carp h 498 Hill Crest Oglethorpe Fuller Elmarene student nurse Oglethorpe Pri- FROBES C DAVID (Morgan & Morgan Ins vate Infirmary r do Agcy) r 361 Cherokee--tel 5332 Frost Decie (wid M S) r 247 Winship Fuller Geo (c; Christine) mus h 775 Reynolds al Fuller Grant P (Myrtle) (Brown's Book Store) Frost Sallie R waitress Hickey's Coffee Shop h 931 Orange r 754 Cherry Fuller Ines (Mrs C H) opr Happ Bros Co r Fruitticher James C (Virginia) slsmn Sands 865 Mulberry & Co Inc r 659 1st Fuller J Cliff (c) r 498 Hill Crest Fruitticher Virginia (Mrs J C) slswn W T Fuller Jewel (wid J B) 2 h 119 Williams (SM) Grant Co r 659 1st Fuller John H (c; Clara) (o) lab C of Ga Ry Fruitticher R Lawrence slsmn Bibb Chevrolet h 510 (530) Maynard Co r 415 New apt 4 Fruittiker Beverly student r 415 New apt 4 Fuller Jones B (Esther) 1 inspr h 1202 Ridge (I) Fuller Joseph 4 emp Southland Knitting Mills Fruittiker Christopher C elk Quality Food Store r 415 New apt 4 h 1 Gustin pi Fuller Ollelia opr Adams Mfg Co RD 4 Fruittiker Lila (wid J C) h 415 New apt 4 Fruittiker Lila supv So Bell Tel Co r 415 New apt 4 Fruittiker Oliver elk Quality Food Store r 415 New apt 4 Fry Bros (D G Fry) bicycles 403 Poplar Fry Corine (c) cook W R Grant h 7 (308) Hanson Fry Dave G (Fry Bros) h 131 Napier Fry Gladys r 131 Napier Fry Isaiah (c; Cora) lab Idle Hour Nurseries res RD 1 Forsyth rd Fry Lena (c) h 227 Patterson Fry Louise student r 131 Napier Fry Mary (c) cook B T Goldman r 227 Patter- son Fry Mary (c) cook M C Mitchell r 134 (24) Williams la Fry Mary student r 131 Napier Fry Mary N (wid H W) r 9 Bibb Fry Minnie (c) hoe hd Idle Hour Nurseries r RD 1 Fry Nottingham (c; Mollie) 4 lab C of Ga Ry h 419 (540) Henrietta (SM) Fry Sarah student r 131 Napier Fry Walter (c; Corine) hlpr Middle Ga Lbr Co h 7 (308) Hanson (SM) Fry Wm (c; Mary) 1 porter The Red Front h 134 (24) Williams la Fry Willie (c) r 227 Patterson Frye Fredk slsmn h 401 College apt 3F Fryer Milton (c) r 404 (315) Industrial Home rd Fryer Rose L nurse Clinic Hosp r 260 Winship Fryer Susie (c) cook W T Hendley Fudge John E (c; Clara) (o) emp So Ry h 711 Daisy (SM) Fulford Foy W (Effie) 2 h 208 Reid Fulford Herman O (Nettie) lamp lighter So Rv h 560 Oglethorpe Fulford Herman O Jr (Fulford's Pharm) r 560 Oglethorpe Fulford's Pharmacy (H O Fulford Jr) 739 College Fulghum Bertha (c) emp The Clinic FULGHUM J WALTER (Caroline B) 2 (o) Vp Taylor Iron Wks & Sup Co, h 205 Hines ter (V)--tel 1215 Fulghum Robt L (Sara M) 1 slsmn Taylor Iron Wks r 185 Boulevard (NH) Fuller Annie B sten Eves Elec Co r 405 Montpelier Fuller Bessie M (c) cook C A Phillips r 498 Fuller Marie (c) r 498 Hill Crest Fuller Thos D (c; Linconia) 3 porter Kema- ghan-Goodman Inc h 968 Ocmulgee Fuller Thornton (c) carp r 498 Hill Crest Fuller W Mike (Clara G) (Small Animal Clinic) r Camp Wheeler rd RD 4 Fuller Wm (c; Carrie) firemn C of Ga Ry h 12 Hawkins Fuller Wm K (Nettie) 2 emp Leaptrot's Dry Clnrs h 1223 2d FULLER WM L (Stella B) Clk Calhoun & Thomas, h 438 Vineville--tel 5134 Fuller Winfred E (Mattie) h 401 Fort Hill Fullington A Frances slswn S H Kress Co r 425 Forsyth Fullington Annie (wid L L) furn rms 763 Cherry h do Fullington Benj H (Lula) 2 supt Ga Casualty bldg h 448 New Fullington Benj H Jr emp Colored Taxi Co r 448 New Fullington Dorothy student r 448 New Fullington E Lewis formn Proctor-Gamble Co h 425 Forsyth Fullington Estelle r 448 New Fullington Felder auto mech McCormick- Deering Store r 425 Forsyth Fullington J Kent (Carrie M) custodian USPO r 425 Forsyth Fullington Jane emp I Silver Bros Co r 448 New Fullington Louis L Jr r 763 Cherry Fullington M Melba student r 425 Forsyth Fullington Mary E (wid R M) r 425 Forsyth Fullyn Nettie (c) h 135 Adams Fulmore Arthur (c) lbr r 1218 (r) 3d Fulmore Oscar (c) lab So Crate & Veneer Co Fulmore Virgil G (c) (o) pntr h 289 1st (V) Fulmore Wm B (c) emp So Crate & Veneer Co r 1218 (r) 3d Fulton Baptist Church (c) 506 Hawthorne Fulton Etta (c) maid Kath M O'Connell r 324 Monroe (V) Fulton Marie (c) r 324 Monroe (V) Fulton Mary (c) h 324 Monroe (V) Fulton Mary A (wid L M) r 355 New Fults Annie (c) lndrs h 505 (192) Lexington Fults Clifford (c) 2 emp C of Ga Ry Shops h 520 (120) e Academy (EM) Fults Homer (c; Viola) h 228 Lynwood (V) Fultz Bernard (c; Leila) lab So Crate & Ve- neer Co h 804 Maynard Hill Crest Fultz D V (c; Maggie L) 2 firemn C of Ga Ry Fuller Carrie (c) 1 h 124 (21) Tinsley la r 206 (276) Astor Fuller Cath opr Adams Mfg Co r RD 4 Fuller Chas (c; Addie) h 724 (8) Reynolds al Fuller Charles (c; Jennie M) 5 emp Hotel Dempsey h 714 Hawthorne Fultz Fredk (c) emp Maxwell Bros r 804 Maynard Fultz Maggie (c) smstrs H A Spivey r 206 (276) Astor 1935 Macon City Directory 235 Fultz Robt (c; Florrie) 2 emp Maxwell Bros r 804 Maynard Fulwood Hill (Thelma) serv dept Burden Smith & Co h 105 Feb Fulwood Lucy nurse 467 Monroe (V) r do Fulwood Susie sten Wesleyan Col r 467 Monroe (V) Fulwood Thelma (Mrs Hill) opr Happ Bros Co r 105 Feb Fulwood Vernon H opr Happ Bros Co r 467 Monroe (V) Funderburg Geo r 605 Carling Funderburke Addie sch tchr r 410 Forest (V) Funderburke Benj F (Helen C) emp Bibb Mfg Co r 114 Magnolia Funderburke Eliz E (Mrs T M) sten Macon Gas Co r 105 Lawton Funderburke Helen C (Mrs B F) sten Notting- ham & Nottingham r 114 Magnolia Funderburke Julian B trav slsmn r 410 Forest (V) Funderburke Thos L (Julia Z) (o) genl mgr Dunlap- Peeler Hdwe Co h 410 Forest Funderburke Thos M (Eliz) slsmn S Jones Co r 105 Lawton Fundinger Walter A (Lottie) elk H C Fowler Lbr Co r RD 2 Funkenstein Flora (wid Louis) (Burns Boot Shoppe) res Brunswick Ga Funkenstein Louis emp Ga Power Co Furches Waid B emp So Crate & Veneer Co Furney Mae Mrs 1 r 267 Washington Fuss Florrie M (Mrs J P) opr W U Teleg Co r 1436 College Fuss Harvey r 533 Orange apt 19B Fuss John P (Florie) 1 serv mgr Goodyear Serv Inc h 1436 College Fuss Leroy (Susan) (o) h 171 Mary (Artope Hts) FUSS OTIS, Asst Seo-Treas Co-operative Fire Ins Co of the State of Ga, r 171 Mary (Artope Hts)--Tel 1543-W Fuss Reba r 171 Mary (Artope Hts) Fuss Ruth r 171 Mary (Artope Hts) Futch Claudine student r 201 Pierce (V) Futch Lonnie B (Ida M) 1 emp C of Ga Ry r 772 Montpelier Futch Willie B student r 201 Pierce (V) Futral Susie r 113 American blvd Futz Stella (c) h 455 4th (V) Futz Tessie (c) r 455 4th (V) GAB School of Commerce (R L Wilson pres, J A Knott vp-sec) 565^-67 Mulberry Gable Albert E (Phoebe) (o) h 258 Washington GABRIEL FREDK B (Lula B), Mgr Postal Telegraph-Cable Co h 111 Oak (I)--Tel 2918-W Gabriel Roy (Ruby) 1 slsmn Sears-Roebuck & Co r 569 1st Gaddy Hubert (Essie) 2 h 1123 College dr Gaddy Maggie (wid Frank) h 313 Orange Gaddy Martha sten Macon Teleg & News r 313 Orange Gaddy Paul C (Maude) starter Yellow Cab Co h 310 Washington Gadson Della M (c) instr Central City College r 1035 Clinton rd GADSON JAMES H (c; Della M), Pres Central City College, h 1035 Clinton rd--Tel 5143 Gafford Elma (Mrs G B) tchr Ga Acad for the Blond r 100 Corbin (V) Gafford Gordon B (Elma) mech So Ry r 100 Corbin (V) Gaillard Margt student r 405 Napier Gaillard W Palmer (Margt H) (o) associate tax assessor City of Macon h 405 Napier Gailmard Alfred B cash Cudahy Pkg Co r 250 Columbus Gaines Chas M Jr (Iris) 2 (o) emp Happ Bros Co h 2106 Broadway Gaines Cora (c) h 113 Jones Gaines Edmund P (Clara M) 1 mgr H L Green Co r 379 Orange Gaines John (c; Carrie) 2 h 120 (212) Railroad Gaines Jos M (Laura) lab r 558 Edgewood Gaines Kath (Mrs TP) emp Happ Bros Co r 164 New Gaines Manley opr Happ Bros Co Gaines Mattie (wid W P) r 164 New Gaines T Pearman (Kath) emp Happ Bros Co h 164 New Gainey Forest (c) sta atndt Brad Wall r 411 Applewood Gainey Taylor (c) lab F S Royster Guano Co Gaither Andrew (c; Mamie) 1 barber h 622 (620) 4th (V) Gaither Lillie (c) r 622 (620) 4th (V) Gale James (c) student r 700 (519) Colquitt Gale Lucille (c) emp Independent Ldry Co h 700 (519) Colquitt Galkin Benj tailor Herbert Smart Clo Co h 776 Walnut Gallaway Chas (Dell) emp Terminal Sta r 335 College Gallaway Dell (Mrs Chas) emp Terminal Sta r 335 College Gallaway Eliz nurse Macon Hosp r do Gallaway Eliz (c) emp Independent Ldry Co Gallemore Clara H (wid J L) (o) h 865 Orange Gallemore Elydia (c) (o) h 436 Flanders Gallemore James P (Fannie M) 1 (o) v-p Cen- tral City Bag Co h 808 Courtland Gallemore Johnnie L student r 865 Orange Gallemore Levi L (Nora) trav slsmn r 903 Orange Gallemore Lois slswn W T Grant Co r 903 Orange Gallemore Ruth r 865 Orange Gallemore Sara slswn W T Grant r 865 Orange Gallemore Epsie (c) 3 h 509 Harris Gallimore Floyd (c; Mary) emp So Ry h 512 Calhoun Gallimore Georgiana (c) ldry wkr h 155 Coles al Gallimore Ira (c) lab M D & S R R Gallimore James W (c; Lucy) lab M D & S R R h 99 Smith (EM) Galloway Chas M mgr Union News Co r 335 College Galloway Claudia M (c) student r 212 Mutual (V) Galloway Delle R Mrs waitress Union News Co r 335 College Galloway Horace (c; Mary L) lab h 212 Mu- tual (V) Galloway Mary F (c) student r 212 Mutual (V) Galloway Mary L (c) cook Florence Me Elrath r Mutual Galloway Wiley (c) r 212 Mutual (V) Galry Alonzo J (c; Mattie) 2 (o) emp Cherokee Brick Co h 302 Antioch rd Galt Robt H (Vivian B) 1 bacteriologist Macon Hosp h 115 Stonewall pi (V) Gamble Geo (c; Janie) ldrymn Mercer Univ r 217 Jefferson Gamble Lee C (Ruby P) 1 mgr Gamble Mtr Exp h 104 Academy Gamble Mildred tchr Virgil Powers Sch r 173 Cherokee Gamble Motor Express L G Dungan agt 756 Broadway Gamble Robt L student r 104 Academy Gamble Robt M sis promotion mgr Happ Bros Co r 111 Buford pi (V) 236 Baldwin's and Telegraph's Gambrell Harriett (wid P H) (o) h 268 Harde- Gardner J H tchr Lanier High Sch for Boys r man Houston rd Gammage Agnes dietitian Ga Acad for the Gardner John A pntr r 1023 2d Blind r do Gardner Lena (c) student r 430 (329) Straight Gammage Angie (wid N C) r 109 Washington (U) apt 3 Gardner Leroy (c; Nettie) 1 emp So Crate & Gammage Carlton D (Nita) mech D H Adams Veneer Co h 134 Army Lot Mtr Co h 335 Winship Gardner Mable (c) cook Alice Herrington r 303 Gammage E Thos elk City Ct h 109 Washing- Coles la ton apt 3 Gardner Mamie (c) 1 r 401 Bay Gammage lone elk S H Kress Co r 109 Wash- Gardner Murray R (Sue) 2 supt Bibb Mfg Co ington apt 3 No 2 h 630 Oglethorpe Gammage Nita (Mrs C D) slswn Union Dry Gardner Paul E dispatch elk Macon Gas Co Gds Co r 335 Winship r 209 1st Ganaway Anna (c) r 164 4th (V) Gardner Perry agt Morgan & Morgan Ins Agcy Gander Authur (c) emp Jeffreys-McElrath Mfg r 129 Richmond Co Gardner Rufus (c; Irene) emp Bibb Mfg Co Gann Lizzie (wid C K) h 112 Capital h 1226 1st Gann Viola L emp Bibb Mfg Co r 112 Capital Gardner Ruth r 1111 Ash Ganns Robt (c; Ida) (o) emp C of Ga Ry h 503 Gardner Ruth (c) maid Middle Ga Hosp r 361 Fulton (EM) (339) North Gans Adele H r 811% Cherry Gardner Ruth F (wid E E) matron Methodist Gans Alf N (Bettie) 1 (Frieds Garage) h 2320 Orphans Home r do Forsyth rd Gardner Sadie (o) h 262 Washington Gans Bettie (Mrs A N) beauty opr Bakman Gardner Walter B 4 pntr h 1111 Ash Barber Shop r 2320 Forsyth rd Garfield Alf (c) agt Pilgrim Health Life Ins Gans Floy B (wid M N) h 718 Mulberry Co r 419 (468) 3d (V) Gans Nathan A sports editor Macon Evening Garfield Annie C (Mrs C H) mgr lunch rm La- News r 818 Cherry nier High Sch r 706 Pine Gans Sanford N 1 slsmn h 811% Cherry Garfield Beatrice (c) tchr P S r 419 (468) 3d Gant Charlie L (c) r 4 West Boundary (V) Gant Lee (c) 2 emp Macon Cooperage Co h 4 Garfield Chas H (Annie C) (o) slsmn h 706 West Boundary Pine Gantt Blanche (c) tchr Hudson High & In- Garfield Howard R (Sara) 2 elk Ga Power Co dustrial Sch r 329 Madison h 200 Brentwood Gantt Harrison (c) delmn Ard Cash Gro r 7 Garfield Jeanette bkpr R C Cropper Co r 209 Frank la Brentwood Gantt James T (Blanche E) (o) pres Gantt Garfield Kate (wid L H) (o) smstrs h 209 Mfg Co h 424 Vineville (V) Brentwood Gantt Lee (c; Willie M) lbr h 701 Ash Garfield Leonard H (Carrie M) 1 slsmn R A Gantt Mfg Co J T Gantt pres, W S Smith sec- McCord Mtr Co r 100 Corbin (V) treas, agrl implts Bay cor Elbert Garfield Mary (c) sch tchr r 419 (468) 3d (V) Gantt Margt (c) 1 maid J D Hooks r Washing- Garfield Will (c; Gertrude) (o) porter Wood- ton Peavy Furn Co h 419 (468) 3d (V) Gantt R Blanche (c) tchr Hudson Industrial Garland Benj (c; Mabel) 2 lab h 129 McKay's Sch r 329 Madison (V) al Gantt Rosalie E (c) (o) h 329 Madison (V) Garland Cora (c) cook Mrs Katie F Fried r 106 Gantt Willie M (c) maid Alexander Sch No 2 Lexington r 701 Ash Garland Janie (c) r 405 e 1st (EM) Garcia Lillian (c) nursei 161 College r do Garland John (c) emp Chambliss Mkt Pleas- Garcia Pedro (c) shoe repr h 161 College ant Hill Garden Harry (Evelyn) bkpr Macon Typewriter Garland John T (Susan L) (o) h 108 Buford & Ofc Sup Co h 784 Holt Garden Perry r 784 Holt Garder Silas (c; Annie Lee) lab r 403 (344) pi (V) Garlington Cecil G (Susie M) 3 signal dept C of Ga Ry h 136 Flamingo dr Maynard Garmon Annie (c) cook T H Winchester r 301 Gardiner G Alf (Roberta) 1 (o) supt Snow's Ldry h 229 Riverdale dr (I) Gardiner Geo A (Clara) (o) supt Proctor & Green Garmon Carrie (c) (o) lndrs h 803 (816) Cow- an Gamble Mfg Co h 223 Riverdale dr (I) Garmon Carson (c) porter Ry Exp Agcy r 85 Gardner Amanda (c) dom C H Yates r 760 Ash Gardner Chas (c; Willie) lab Sawyer Coal & Ice Co h 401 Bay Dempsey Garmon Emma L (c) presser Union Dry Gds Co r 1240 Broad Gardner Clara r 119 Richmond Garnder Emmett (c) chauf Mary M Lowe Gardner Dorsey M (wid J K) h 1023 2d Garner Alice (c) maid T O Hand r 147 Pecan Gardner Edgar R. ice cream mkr Swift & Co r 769 Mulberry Garner E E (Annie Belle) baker Collins Baking Co r 2528 2d Gardner Ella F (c) (o) nurse 120 Green h do Gardner Fredadelle (Mrs F P) opr Happ Bros Co r 119 Richmond Gardner Fredk P (Fredadelle) (o) pntr h 119 Richmond Ga^?nr Fl-edk P Jr emp Macon News r 119 Richmond Gardner Geo G (c; Mandy) r 760 Ash Gardner Grace nurse Macon Hosp r do Gardner Henry J (c) r 242 Woodliff Garner Eliz Mrs 1 tex wkr Bibb Mfg Co r 755 Clinton Garner Jessie L (c) dom r 316 Green Garner Mary V prof Wesleyan Col r do Garner Mattie (c) 1 h 254 5th (V) Garner Oscar (c) lab S E Compress & Whse Co h 217 Chestnut Garner Patience (c) tchr East Macon Sch r 217 Chestnut Garner Rufus (c) emp Bibb Mfg Co 1935 Macon City Directory 337 Garner Wm M (Emily) 1 carp h 142 Knott (SM) Garrafa Camillo B watchmkr Williams Jewelry Co r 533 Orange apt 22 Garrett Addie Mrs 3 r 116 Chappell (SM) Garrett Annie (wid D) r 303 Hines ter (O Garrett Bessy L (Mrs T E) opr Hotel Dempsey r 540 Boulevard Garrett Clyde 2 (Nettie) 2 (Garrett & Laven- der Gro) h 308 Church (EM) Garrett Chas H (Edith) (o) County solr Gen- eral h 924 Vineville (V) Garrett E Geraldine student r 924 Vineville (V) Garrett Edw (Sarah) 1 emp Happ Bros r 920 Elm Garrett Emmett F (Nettie) opr Happ Bros Co r 431 Jackson Garrett Ettie (wid R H (o) h 250 Winship Garrett Eug E (o) mgr Macon Lbr Co h 3005 Forsyth rd Garrett Eug E Jr lawyer r 3005 Forsyth rd Garrett Eunice (c) maid D G Mitchell r Spring Garrett F Elijah (Ellen M) 1 carp h 420 Jack- son Garrett G Clarence (Thelma) coir A G Rhodes & Son h 1704 2d Garrett Geo (c) jan Mamie Holmes h 4 (427) Sparks al Garrett Harry P bkpr Murphy Taylor & Ellis r 254 Appleton Garrett Jos F (Martha) 2 slsmn Freeman- Dent-Sullivan Co r 279 College Garrett Joseph (Clara) 2 r 3005 Forsyth rd Garrett Leonard M slsmn Thom McAn r 3005 Forsyth rd Garrett Lucy tex wkr Bibb Mfg Co h 16 Lake City (EM) Garrett Madison shpr Bibb Mfg Co Garrett Martha sten Mercer Univ r 279 College Garrett Nettie (Mrs E M) opr Happ Bros Co r 431 Jackson Garrett O Layton solr Elec Dry Cleaning Co r 116 Chappell (SM) Garrett Onie r 3005 Forsyth rd Garrett Robt L (Pearl) marker Crescent Ldry h 254 Appleton Garrett Sarah (Mrs "Edw) emp Happ Bros Co r 920 Elm Garrett Talmadge E (Bessie) chf of detectives CPD h 540 Boulevard (NH) Garrette Eliz (wid J B) 2 slswn r 761 Hemlock Garris Randall (c; Agnes) lab h 356 Haw- thorne Garrison A M r Y M C A Garrison Florence N r 2301 2d Garrison Jas W (Mary) farmer r 2301 2d Garrison Paul H shpg elk Am Bakeries Co h 2301 2d Garrison Roscoe C (Ruth) (o) condr MD&SRR h 121 3d Garrity Mary (wid W J) (o) h 341 Vista cir (I) Garvin Anastasia elk FERA r 103 Capitol Garvin Ellis E (Annie B) 1 slsmn Collins Bak- ing Co h 2528 2d Garvin Etta Mae (c) cook W L Stallings r 115 Orange Garvin Fredk elk Minnie G Scott r 608 Holt Garvin Jimmie (Mrs W F) (My Own Restr) r 1219% Broadway Garvin John (Anna S) 4 slsmn Atlantic Ice & Coal Co h 103 Capitol Garvin S Gladys elk Newberry's r 723 1st Garvin Wm F (Jimmie) emp So Ry h 1219% Broadway Gary Annie (c) 2 h 114 (515) Johnson al Gary Annie (c) dom L C Josey r 117 Tindall Gary Chas (c; Bobby Lou) emp Kingman & Everett Gary Ella (c) r 307 Henderson la Gary John (c; Mattie) blksmth Kinnett-Odom Co Gary Joseph (c; Clanzie) r 163 Phillips la Gary Kelly (c) r 242 Woodliff Gary Laura (c) r 966 Pio Nono Gary Maggie (c) cook r 104 (4) Henry (SM) Gary Marie (c) r 319 Norris Gary Mary (c) cook C E Eubanks r Tindall field Gary Mattie (c) h 264 1st (V) Gary Maude (c) 1 h 659 Hazel Gary Moses (c) chauf Lillian Stevens r 526 3d Gary Robt N (c) r 501 (553) Broad Gary Sami D (c; Annie) (o) chauf L O Stevens h 526 3d (V) Gary Sol (c; Hattie) lab Macon Cooperage Co h 701 Hammond Gary Willie D (c) tex wkr r 501 (553) Broad Gaskin Henry (c; Evelyn) firemn C of Ga Ry r 760 Ash Gaskins Elbert (c) porter Lane's Hotel r 143 2d (EM) Gassaway Chas (c; Anna) 1 delmn Smith's Mkt h 441 Gilmer Gassaway John S buyer Swift & Co r 1508 Vineville Gassett Buford F tr dr City St Sweeping Dept Gassett Geo F (Ruth) 2 stone ctr Clark Memorials Inc h 229 Cedar (SM) Gassett Mason hlpr City Scavenger Dept Gassett Thos G (Lucile) 1 emp Procter & Gamble Mfg Co r 2451 2d Gassett Wm Q (Mary F) 1 formn Proctor & Gamble Mfg Co h 102 Heard (SM) Gaston Eliza (c) h 113 Main (S) Gaston Gary G emp Goodyear Serv Sta r 860 Mulberry Gates Addie (c) cook Howard Noble r 357 Flanders (EM) Gates Albert (c; Rosa L) peddler r 119 (112) Green (V) Gates Cleo (c; Doris) res RD 2 Montpelier Gates Duncan (c; Mary L) 1 (o) peddler h 333 Ernest Gates John D bkpr Ga Peach Growers Exch r 149 Summit Gates John T (c) r 220 Woodliff Gates Josephine sten Bibb Mfg Co r 115 Rem- bert Gates Josephine (c) maid J H Smith r 1219 3d Gates Louise (c) student r 333 Ernest Gates Martha V student r 315 Vineville (V) Gates Mary R (wid W H) dir City Play Grounds h 149 Summit Gates Nettie (c) r 333 Ernest Gates Otis A (c; Addie) h 357 Flanders Gates Paul G (Reba J ) (o) dentist 1005 Ga Casualty Bldg h 315 Vineville (V) Gates Rich P student r 149 Summit Gates Robt (c; Josephine) emp Taylor Iron Wks h 1219 3d Gates Rosa L (-wid O H) (o) h 1126 College dr Gates Rosa L (c) maid R W McCrum r 119 (112) Green (V) Gates Thos G (c; Mary A) (o) gro 987 (978) Montpelier h 985 (975) do Gates Walter S (c; (Annie) 1 (o) hlpr So Ry 935 Broad Gates Willa M tel opr So Bell Tel Co r 115 Rembert Gatewood Leomi (c) r 130 (6) Tinsley la Gatliff James L (Agnes) 1 hlpr h 267 Washing- ton Gatliff Mellie opr Happ Bros Co r 971 Ogle- thorpe 238 Baldwin's and Telegraph's Gatson Wm L (c) pntr h 224 1st (V) Gattie Barney (Mary) 2 emp City r 900 Main (EM) Gattie Louise r 353 Flanders Gattie Perry (Lula Mae) 4 tr dr City St Sweep- ing Dept h 353 Flanders Gattie Perry Jr r 353 Flanders Gattling Magnolia (c) 1 emp Independent Ldry Co r 111 Lynwood (V) Gould Mary (wid G B) 1 r 1314 3d Gaultney E Thos (Gertrude) 3 lbr inspr li 520 Johnson Gaultney Edmond student r 520 Johnson Gaultney Pauline asst cash S H Kress Co r 520 Johnson Gaultney Robt (Lena) carp r 105 Cleveland SM) Gaultney Virginia student r 520 Johnson Gautier Jack student r 115 Buford (V) Gavin Chas M (Estelle) 2 (o) slmn Ga Caro Oil Co h 509 Ridge Gay Barber Shop (Pierce Davenport) 458 3d Gay Beulah (c) dom h 260 Broad Gay Clothing Co Pierce Davenport mgr 458 3d Gay Eleanor (c) student r 1233 3d Gay Essie (c) dom Clara K Stribling r 508 Academy Gay Glenn (c; Sarah) porter Idle Hour Billiard Parlor r 337 Elbert Gay Hettie (c) r 601 Broad Gay Homer (c) waiter Dempsey Hotel r 260 Broad Gay John H (c) emp Armour & Co r 1233 3d Gay Johnnie L r 311 (321) Shamrock Gay Lois sten W B Childs r 261 Georgia apt C 2 Gay Malley L (Lucy) 1 lbr mn r 103 Troup Gay Owen V (Vera) 2 opr County h 402 Church Gay Sami (c; Essie) 1 lab r 508 e Academy (EM) Gay Vera (Mr3 O V) tex wkr Bibb Mfg Co r 402 Church Gay Willie M (c) dishwasher DeLuxe Cafe r 105 (504) Campbell Gaynor Ernest (c) r 220 Patterson Gebara Chas (Ft Hill Cash Mkt) h 639 Fort Hill Geeder Fannie M (c) r 1017 Pio Nono Geeder Seaton (c; Ella) h 1009 Pio Nono Geeslin Benj F (Ola) 1 jan Bibb County Ct Hse h 202 1st Geeslin Emmie L sec Ga Ret Lbr & Bldg Sup Assn r 216 Adams Geeslin James W (Radio Serv Sound Co) r 216 Adams Geeslin Lois Mrs r 767 Walnut Geeslin Louise (wid W F) r 220 Adams Geeslin Michl student r 216 Adams Geeslin Mildred sten A S Grinalds r 220 Adams Geeslin Pearl L (wid J N) (o) h 216 Adams Geiger Jessie sten Macon Better Housing Pro- gram r 769 Mulberry Geigers Quillian (c; Hannah) 2 lab C of Ga Ry h 309 Jefferson Gelders Albert reporter Macon Telegraph r 811 Poplar apt 15 General Reduction Co K R Slocum genl mgr clay products ft of Poplar Genone J Ernest (Lillian) 1 (o) (Genone's Bar- ber & Beauty Shop) h 106 Buena Vista dr Genone J Ernest Jr student r 106 Buena Vis- ta dr Genone Jack (Jessie A) proof reader Macon Evening News r 106 Beuna Vista dr Genone Rose (wid Jos) r 106 Beuna Vista dr Genone's Barber & Beauty Shop (J E Genone) 568 Mulberry Georghegan Brooks (Vera) (Geoghegan & Norris) r 401 College apt 8 C Geoghegan Roy (Dora) asst bkpr FERA r 111 Jefferson ter Geoghegan & Norris (Brooks Geoghegan, A L Norris) cert public accts 504 Macon Savings Bk Bldg George Amelia (c) r 440 Liberty (SM) George Andrew (c) emp North Highland Gro r 102 Woolfolk George Annie (c) r 100 Smith (EM) George Austell (c) carder Bibb Mfg Co George Benj (c) h (306) Strayers al George Berry (c; Leila) 3 emp So Ry h 263 (667) Hall (EM) George Bertha (c) cook W N Huhn r 407 e 2d (EM) George Clifford (Araminta) 3 h 40 Melrose (B) George Daisy (c) h 27 7th George Daizel C (c) (o) h 336 3d (V) George Durward F (Belle) 2 condr C of Ga Ry h 9 Marion pi George Edgar (c; Virginia) lab h 340 Middle (V) George Estella (c) 3 maid r 102 Woolfolk George Evelyn sten Swift & Co r 9 Marion pi George Hattie (c) 1 h 94 Harris al George Helen S (Mrs J G) pres Macon Fish & Oyster Co Inc r 103 Ross George James F r 9 Marion pi George John G (Helen S) 3 (o) sec-treas Ma- con Fish & Oyster Co Inc h 103 Ross George Joseph B (c; Bertha) (o) hlpr Birdsey Flour Mill h 407 e 2d (EM) George Julia (c) maid Wesleyan Consevatory r 5 5th (V) George Julia M inspr Snow's Ldry r 918 Ogle- thorpe George Luther (c; Lula M) 6 lab City St Dept h 609 4th (WH) George Mae (c) r 235 5th (V) George Mattie (c) dom L W Rutland h 101 Cheatham al George Ostel (c) tr dr Webb Coal Co George Paul elk Macon Fish & Oyster Co Inc r 103 Ross George Roosevelt (c; Jessie) 3 lab h 120 Bos- tic la George Ruby H r 9 Marion pi George Wm (c; Louise) 8 lab Atlantic Ice & Coal Co h 311 Harris la Georgia Academy for the Blind G F Oliphant supt 1501 Vineville (V) Georgia Academy for the Blind (c) J A Wil- liams prin 247 Madison (V) Georgia Aerie No 977 Fraternal Order of Eagles H R Shealy sec meets Wednesdays 8:00 p m 454% First Georgia Auto Co (R B Domingos) reprs 517 Plum Georgia Cafe (Bertha Russell) 2998 Houston (SM) Georgia-Carolina Oil Co R W Jones pres J R Maddox v-p oprs Power Oil Co 603 Hammond Georgia Casualty Building B H Fullington supt 516-22 Mulberry Georgia Casualty Sandwich Shop (Mrs Lena M Huey) 102 Ga Casualty Bldg Georgia Highway Express G R Barfield Jr agt mtr frt 103 Cherry Georgia Industrial Home A C Durden supt end Industrial Home rd Georgia Inspection Rating Bureau J C Hale spec agt 314 Bibb bldg GEORGIA LOAN & TRUST CO Oliver A Coleman Pres, Tolar H Boone VP- Genl Mgr, Wm V Williams Sec, Walter S Boone Treas, 1935 Macon City Directory 339 Mortgage Loans 802-09 First Nat Bk Bldg Tel 259 Georgia Market House (J W Young, E L Mann) 460 2d ,, Georgia Motor Finance Co S L Burns pres B H Fincher sec-treas 111 Ga Casualty Bldg Georgia National Guard Armory 506 1st Georgia Oil Corp J E Flournoy pres B B Odom sec-treas 100 Walnut Georgia Peach Growers Exchange W C Bewley genl mgr 313 First Nat Bk Bldg Georgia Power Co B R Chestney div mgr ofc 179 Cotton, serv dept 667 Cherry, garage 1024 Ocmulgee Georgia Radiator Co H E Howell reprs 614 3d Georgia Railroad R F Wynne Jr div frt agt 605 Bibb Bldg , Georgia Railroad (frt depot) J C Wyche frt agt 5th at Pine & Oak Georgia Retail Lumber & Building Supply Assn Avner Chamber dir Emmie Li Geeslin sec 5 Hardeman Bldg ,, GEORGIA ROOFING & SUPPLY CO Bar- rett Approved Roofers", Albert E Sheridan Mgr, 306 Oglethorpe--Tel 3121 (See right top lines and page 98) Georgia Seed Store R H Kingman Jr pres F H Chancellor sec-treas 465 3d Georgia Service Station (H L Dennard) 2846 Houston (SM) _ ,, Georgia Southern & Florida Railway Co O G Prentiss frt agt frt depot Plum cor 5th Georgia State Exposition E R Jordan mgr 321 3d GEORGIA-STATE OF _ , ... Highway Board Division No 2 E Jack Smith div eng Court House Income Tax Office L S Radford in charge Court House National Guard Armory 506 1st National Guard Co C 121st Infantry (Floyd Rifles) Capt D C Harris Jr commanding 454 2d National Guard Co D 121st Infantry Capt M A Meath commanding 506 1st National Guard Headquarters Co 1st Bat 121st Infantry (The Macon Guards) Lt W F Geeslin commanding 506 1st National Guard Instructors Capt J E Gra ham in charge 413 Ga Casualty Bldg National Guard Service Co Capt C F Chap- man commanding 506 1st National Guard 1st Battalion 121st Infantry Headquarters Maj J W Barnett command- ing 506 1st National Guard 30th Division Headquarters Maj-Gen H D Russell commanding 506 1st National Guard 59th Brigade Headquarters Co Capt M A Hilsman commonding 506 1st National Guard 121st Infantry Headquarters Lt-Col F A Whitaker commanding 413 Ga Casualty Bldg National Guard 121st Infantry Medical De- tachment Maj R C Goolsby commanding Germany Frank (c; Sallie) (o) chauf J W Mc- Cook Lbr Co h 1603 1st Germany Sallie (c) maid Y M C A r 1603 1st Gerner J Haines (Kath) 1 chf elk Macon Gas Co h 99 Vineville apt B 2 GERRELL CHAS A (Bon Art Studio) r 862 2d--Tel 3826 Gerson John O (Margt) 1 supt transportation Ga Power Co h 425 Beech Gertrell Lillian r 457 Oak Geston Carrie (wid C J) (o) gro 300 (319) Log Cabin dr h do Getson Mabel r 300 (317) Log Cabin dr Getters James (c; Pauline) r 103 (726) Wings al _ Getty Barney hlpr City Scavenger Dept Getty Perry tr dr City St Sweeping Dept Geurin Eliz student r 141 (139) Oakland Gewin Christopher C (Dora A) rate elk So Ry h 161 Magnolia Gewinner Hazel B tchr Clisby Sch r 1205 Vine- ville Gewinner Holt J Jr r 1205 Vineville (V) Gewinner Napoleon G phys 1205 Vineville (V) h do Gholson Chas A (Eliz R) (Gholson's Cash Gro) r 1030 Clinton rd (EM) Gholson Eliz R (Mrs Chas) slswn The Dime Store r 1030 Clinton rd (EM) Gholson Julius agt Willingham Loan & Trust Co r 165 Ell (SM) Gholson Richd L (Bessie) 1 (o) reclamation supt C of Ga Ry h 165 Ell (SM) Gholson's Cash Grocery (C A Gholson) 408 Main (EM) Gibbons Bessie (c) student r 414 (446) Womack Gibbons John (c) lab So Crate & Veneer Co Gibbons Leslie (c) maid Gibbons Mary (c) student r 414 (446) Womack Gibbons Prince (c) emp So Crate & Veneer Co r 414 (446) Womack Gibbons Rosa (c) lndrs Crescent Ldry r 414 (446) Womack Gibbons Thos (c; Ellen) (o) farmer h 414 (446) Womack Gibbons Wm (c) student r 414 (446) Womack Gibbs Arth G (Gladys) tex wkr Willingham Mill h 12 Roff Home pi Gibbs Burke (c; Ruth E) 1 gro r 306 Douglas (V) Gibbs Caesar (c) 2 bellmn Hotel Lanier h 229 Moughon (V) Gibbs Carolyn (c) r 312 (323) Bowman Gibbs Chas (c; Pearl) (o) emp So Ry h 312 (323) Bowman Gibbs Clara slswn W T Grant Co r 613 1st Gibbs Eliza (c) r 229 Moughon (V) Gibbs Erasmus E (c; Josephine) (o) pullman porter h 806 3d (V) Gibbs Gladys (Mrs A G) emp Willingham Mills r 12 Roff Home pi Gibbs Kath slswn W T Grant Co r 613 1st Gibbs Lizzie (Mrs W L) tex wkr Payne Mill r 117 (820) Forest (B) Gibbs Margt r 897 Winton 222% Cotton Gibbs Walter D (Daisy) slsmn h 897 Winton GEORGIA UNDERWRITERS INC, Luther A Gibbs Wm B (Lizzie) 3 h 117 (820) Forest (B) McCrary Pres, T Ayer, Hatcher Sed-Treas, Insurance and Real Estate 508 Mulberry Tel 6186 Georgiades Alice (Mrs Europides) slswn Penney's r RD 2 Bloomfield rd Gibins Mary L (c) maid r 112 (113) Glen Gibins Nancy (c) 3 lndrs h 112 (113) Glen Gibson Addie (c) 2 (o) lndrs h 322 (86) Bow- man Georgian Apartments 813 Poplar Gibson Agnes P (wid J J) r 533 Orange apt 18 Georgian Terrace Apartments 261 Georgia Gibson Bessie (c) 1 lndrs Snow's Ldry r 708 Gerald Christine (Mrs E B) opr Happ Bros Co (620) Prince (SM) r 758 Cherry Gerald Eug B (Christine) waiter Dinty Moore s Lunch Room r 758 Cherry Gibson Carolyn K tchr Bruce Sch r 404 Forest Gibson Cecil L (Ruby) r 4001 (4095) Houston 340 Baldwin's and Telegraph's Gibson Clifford B (Mae T) 1 mech Jack Mann's Gibson Thos B (Viola) 3 emp C of Ga Ry h Battery Co h 717 1st 126 Virginia Gibson Daisy L (c) 4 h 530 Clinton Gibson Van (c; Libby) (o) mail carrier h 917 Gibson Delia (c) cook C M Preston r 308 Ward Pio Nono Gibson Dollie (c) r 917 Pio Nono Gibson Van (c) gro 518 Pio Nono r 623 do Gibson Eleanor (c) maid r 93 Violet Gibson Vinegar Works (H A Gibson) 149 5th Gibson Eliz (Mrs O C) opr Happ Bros r 110 Gibson W S (Marion) emp Williams Serv Sta Lee (Lynmore) r High Gibson Elijah (c) h 173 (168) Plummer's al Gibson Will (c; Annie M) lab Central S & D Co Gibson Ella L (c) (o) h 333 Middle (V) r Henry Gibson Emma M (wid D L) r 533 Orange apt Gibson Wm (c) r 801 (181) Colquitt 18 Gibson Willing S student r 107 Hartley (Lyn- Gibson Ethel J (c) r 405 Charles more) Gibson Eug C emp Ga Power Co r 404 Forest Gibson Willis W elk Gibson Vinegar Wks r 404 (V) Forest (V) Gibson Fannie (c) h 141 Forsyth la Giddens Danl B (Maud) 4 tex wkr Payne Mill Gibson Frances (c) lndrs r 322 (86) Bowman h 58 (59) Davis (PM) Gibson Geo G (Lula B) swtchmn C of Ga Ry Giddens Earl tex wkr Payne Mill r 58 (59) h 107 Hartley (Lynmore) Davis (PM) Gibson Geo W (Bessie) (o) gro 327 (328) Dan- Giddens Isbon A (Crawford L) 1 (o) welder nenberg h do Taylor Iron Wks h 219 Jones (EM) Gibson Glen N (Agnes) 2 condr C of Ga Ry r Giddens Nell tex wkr Payne Mill r 58 (59) Da- 109 Heard (SM) vis (PM) Gibson Harry A (Marie A) (o) (Gibson Vinegar Giddens Robt (Irene) 3 soda elk Wistera Cafe Wks) h 249 Boulevard (NH) h 336 6th (SM) Gibson Hattie W Mrs (o) h 404 Forest (V) Giddens Vernon W r 117 Lee (EM) Gib'son Helen V tchr Clisby Sch r 533 Orange Giddens Wallace tex wkr Payne Mill r 68 (59) Gibson Homer (c; Lera) 3 emp C of Ga Ry h Davis (PM) 69 (138) Forest (V) Gibson Isaac (c; Johnnie) elev opr Dempsey Hotel r 115 4th (V) Gibson James (c; Pearl) h 165 May (U) Gibson James (c) emp Masonic Home r 756 (477) Center (EM) Gibson Jeff (c; Laura) hlpr W C Watson h 118 (133) n Holt Gibson Joeanna (c) tchr Unionville Sch r 917 (623) Pio Nono Gibson Josephine (c) maid r 322 (86) Bowman Gibson John C r Hotel Macon Gibson John M (Mary) agt Standard Oil Co r 341 College Gibson John T ( Ida W) 2 emp Bibb Mfg Co h 433 (407) Forest (V) Gibson John W (c; Elmira) (o) farmer h 334 Robinson rd Gibson Hath (c) r 429 Ward (V) Gibson Lawrence H (c; Nellie) 2 ins agt h 130 (18) 5th (V) Gibson Levi (c; Fannie) 1 lab So Ry Shop h 206 (432) Alabama (SM) Gibson Lillie Mrs tel opr City r 127 Holt Gibson Louise (c) 3 cook r 127 (27) Clara Gibson Mamie (c) 1 r 108 Antioch rd Gibson Mary r 812 3rd Gibson Nell student r 717 1st Gibson Nellie (c) cook W C Bewley r 18 5th Gibson Obadiah C (Willie) h 254 Hardeman (o) phys 3621/2 2d Gibson Oliver C (Eliz) (o) elk Macon Cigar & Tob Co h 110 Lee (Lynmore) Gibson Oscar (c; Delia) bill poster Packer Adv Corp h 308 Ward (V) Gibson Rachel (c) h 93 Violet Gibson Ruby (Mrs C L) cash r 4001 (4095) Houston Gibson Sami (c) emp Masonic Home r 756 (477) Center (EM) Gibson Sami Jr (c; Carrie) 1 h 756 (477) Cen- ter (EM) Gibson Simon (c; Susie E) 5 h 337 2d (U) Gibson Simon J (c) chauf Parcel Del Co r 333 Miller (V) Gibson Tabitha B Mrs h 175 Gardner (PM) Gibson Thos (c) restr 934 Montpelier h 200 (300) 2d (U) Gibson Thos A (Willie A) 5 emp Sunshine Creamery h 208 Tatnall Giddens Wm (c; Leila) (o) h 257 Antioch rd Giddens Wm G (Nora) 2 waiter Smitty's Bar- becue Lunch r 818 Hemlock Giger Quillie (c) lab C of Ga Ry Giglio Cecilia W h 800 Orange Gignilliat Arth M (Eliz) 1 tchr Lanier High Sch for Boys h 1307 Ridge (I) Gignilliat Geo W Jr prof Wesleyan Col res Rivoli Gilbert Annie (c) r 204 e Ell Gilbert Callie (c) r 106 (4) Fulton la Gilbert Corine (c) 3 cook G H Tharpe r 3 Haw- kins Gilbert Crawford (c; Rosa) h 7 Hawkins Gilbert Danl W (Emmie) mech Huckabee Auto Co Gilbert Frances sten Oglethorpe Infirmary r 335 College Gilbert Frank I (Estelle) (o) line formn So Bell Tel Co h 191 Oakland Gilbert Geo (c; Victoria) swtchmn C of Ga Ry r 417 Ward (V) Gilbert Geo (c) emp Bibb Mfg Co Gilbert Harry (c) r 413 Ward (V) Gilbert Helen (c) r 520 Monroe (V) Gilbert Henry (c; Marjorie) firemn Crescent Ldry r 232 Jones Gilbert Herschel (c; Laurine) 7 emp C of Ga Ry h 602 (119) Charles Gilbert Irene (c) cook C F Lanier h 108 (299) Craft (V) Gilbert Irma R (o) tel opr City Hall h 115 Lawton Gilbert James F (Della) (o) emp C of Ga Ry h 1333 3d Gilbert Jerry (c; Josephine) 1 h 102 (2) Hen- drix al Gilbert Jesse (c) r 537 Grant Chapel al Gilbert Julia (c) h 724 Murray al Gilbert Kate (wid R M) tchr Winship Sch h 130 Cleveland (V) Gilbert Kath A r 191 Oakland Gilbert Lizza (c) r 217 Madison (V) Gilbert Lloyd H (Frances) instr GAB Sch of Commerce r 335 College Gilbert Lula (c) maid Florine B Davis r 675 Dunlap la Gilbert Luther (c; Gussie) 1 r 633 Pebble Gilbert Madeline elk Wesleyan Conservatory Gilbert Malachi (c) r 566 Hammond 1935 Macon City Directory m Gilbert Maria (c) r 426 (423) 3d (V) Gilbert Mary (c) maid Greater Wesleyan r 520 Monroe (V) Gilbert Mattie (c) lndrs h 413 Ward (V) Gilbert Maud (c) miad Nancy Parkerson r 757 Sparks la Gilbert Mildred (e) (o) sten P O h 118 Lyn- wood (V) Gilbert Mollie (c) r 515 Monroe (V) Gilbert Oscar (c; Leola) r 633 Pebble Gilbert Thos (Rosa) 1 formn GS&FRR h 685 Hillyer Gilbert Willis L (Annie P) 2 mach C of Ga Ry h 3606 Houston Gilchrist Hattie B (c) (2) maid Jos Haskm r 211 Linden Gilchrist Ida (c) h 640 Hammond Gilder Eliz r 355 Walnut Gilder Jordon T (Lillian) 1 h 110 Emerald Gilder Opal r 110 Emerald Giles Alice E (wid W W) h 207 Rogers (V) Giles Andrew J r 921 (1989) Log Cabin blvd Giles Anna opr Happ Bros Co r 556 Hemlock Giles Binder H r 921 (1989) Log Cabin blvd Giles Chas W elk Ry MS res Byron Ga Giles Foster (c) barber 205% 5th r do Giles J Carl msngr Postal Teleg-Cable Co r Dunlap Hill (EM) Giles James H asst mgr Cassidy's Garage h 469% 2d Giles John B (o) electrn C of Ga Ry h 921 (1989) Log Cabin Giles Mae bkpr Atlantic Cotton Mills r 207 Rogers (V) Giles Manton msngr Postal Teleg-Cable Co r Dunlap Hill (EM) Giles Margt sec Am Legion r 322 Georgia Giles Nelle I r 207 Rogers (V) Giles Olive B (wid J W) sten Bloodworth & Bloodworth r 209 1st Giles Sanford L elk E C Davis r RD 1 Giles Wm M (Lucile S) 2 int dec J N Neel Co h 135 Daisy pk Gilfield Primitive Baptist Church (c) Pierce Killen pastor 92 (85) Hazel Gilham Carrie (c) 5 maid h 130 4th (V) Gilham Eula (c) 1 maid h 814 Ocmulgee Gilham Henry (c; Helen) 1 (o) lab Charin Auto Parts & Bottle Sup Co h 202 (124) Bowman (EM) Gilham Sarah maid r 910 Clayton Gilham Sylemon (c) r 130 4th (V) Gill Arth (c; Laura) 1 h 347 Hammond Gill C Earl emp C of Ga Ry Gill Effie Mae (wid Ernest) 3 (o) h 031 Peachtree Gill Ernest emp C of Ga Ry r 301 Peachtree GILL JOHN J (Lena B) 1, (Gills Bakery) h 314 Buford pi--Tel 2508-R Gill John J student r 314 Buford pi (V) GILL'S BAKERY (John J Gill) 813 Vineville --Tel 777 Gillam Forrest J (c; Sarah) 1 cook r 10 (910) Clayton (V) Gillam Claudia (c) cook W A Waldorf r 921 Ocmulgee Gillard Clifford (c; Sarah) 1 tr dr h 612 (212) Edison Gillard Leola (c) r 809 Elbert Gilleland Addie (o) h 250 Ell (SM) Gilleland Augustus (Loretta) 2 (o) car mn C of Ga Ry Shop h 415 American blvd Gilleland Dillard msngr C of Ga Ry Shop r 415 American blvd Gilleland E Lucille elk Dannenberg's r 113 Grady Gilleland Elsie elk Mary Eliz Shop r 250 Ell (SM) Gilleland Harry student r 415 American blvd Gilleland Lena A r 113 Grady Gilleland Marguerite ofc sec Dr E R Respess r 250 Ell (SM) Gillen; Jack coir L T Gillen r Y M C A GILLEN L THOS "PAT" (Kate Mikel), law- yer 318-20 Bibb Bldg--Tel 5050, r 635 Vineville--Tel 3528 (See page 102) Gillespie A Marvin (Maggie) slsmn r 1713 2d Gillespie Bessie (Mrs J M) opr Happ Bros Co r 1713 2d Gillespie G Emery (Inez) elk C of Ga Ry Gillespie James M (Bessie) shpg elk Happ Bros r 1713 2d Gillespie Rebecca slswn r Arcadia Hotel Gillespie Robt T emp Fried's Garage r 855 Mulberry apt 106 Gillette Wm J (Geneva) mgr Wagner Brewing Co r 484 Orange Gilley J M speeder hd Bibb Mfg Co Gilliam Claudia (c) cook r 921 Ocmulgee Gilliam Irvin (c; Claudia) mech Bibb Mfg Co r 921 Ocmulgee Gilliard Joseph (c; Ruby) waiter Southland Coffee Shop h 170 College Gilliard Julius (c; Eliz) hlpr City h 152 Broad Gilliard Sarah (c) dom W B Dove h 410 e 1st (EM) Gilliard Vinie (c) 1 lndrs h 20 Gustin Gillis Beulah tex wkr Bibb Mfg Co r 2 Flanders Gillis Tippie (Beulah) tex wkr Bibb Mfg Co r 2 Fl3iiid6rs Gillon A Elaine student r 905 (925) Napier Gillon M Virginia sten Met Life Ins Co r 905 (925) Napier Gillon O Grady Jr student r 905 (925) Napier Gillon Oscar G (Arlyn L) (o) lawyer 5 Washington Bldg h 905 (925) Napier Gillman Eliz (c) 8 h 47 White (SM) Gilman Grocery (O F Gilman) 315 Rutherford (SM) Gilman Jesse P (Aline) 2 coml agt L&NRR Co h 842 Courtland Gilman Lessie (c) 1 cook Mrs L R Wright h 140 Pecan Gilman Lizzie (Mrs F E) gro 507 (415) Crisp h do Gilman Onnie F (Jessie B) 1 (o) (Gilman Gro) h 315 Rutherford (SM) Gilman Thos D (Louise) slsmn Mayo Clothing Store r 257 Orange Gilman Thos H (Mollie) bus opr Ga Power Co h 257 Orange Gilman Thos H r 507 (415) Crisp Gilman Wm r 507 (415) Crisp Gilmore A Ellison Jr (Edith J) 1 lawyer 215-17 Ga Casualty Bldg h 361 Orange Gilmore Annie (c) lndrs h 175 Lincoln (V) Gilmore Bishop (c; Daisy) 2 lab h 124 Glen Gilmore Cath (c) dom James Lowe r 175 Lincoln (V) Gilmore Geo (c) r 302 (438) Alabama (SM) Gilmore J G emp J W McCook Lbr Co Gilmore James R emp C of Ga Ry Gilmore Jimmie turner Bibb Mfg Co Gilleland Clarence L (Eva) 2 routemn Crescent Gilmore Lillie (c) h 316 (318) Monroe (V) Ldry h 116 Chapel (SM) Gilmore Marianna (c) 1 maid Arcadia Hotel h Gilleland Cleara L emp Liberty Candy Co r 113 158 4th Grady ,, ,, Gilleland Dempsey (Cleara L) 3 (o) emp C of Ga Ry h 113 Grady Gilmore May M (wid J G) r 252 Orange Gilmore Mozelle (c) student r 124 Glen m Baldwin's and Telegraph's Gilmore Starling C (Pearl) 3 emp C of Ga Ry Glass' Pharmacy (A W Glass) 302 Broadway h 1132 College dr Glauson Raymond A (Elise) slsmn Gulf Refin- Gilmore Willis (c) lab r 124 Glen ing Co r 218 Spring Gilreath Edw (Jean) emp Maxwell Box Co r Glawson Beatrice (c) lndrs h 109 O'Neal's al 151 2d Glawson Ethel elk Wesleyan Conservatory Gilreath Pearl R (Mrs Z H) tchr Alex Sch No Glawson Harry (c; Irene) emp So Crate & Ve- 2 r 602 Carling neer Co h 815 Fort Hill Gilreath Zebulon H (Pearl R) (o) meter repr Glawson Jesse (c; Bessie) (o) emp C of Ga Ry City Bd of Water Comrs h 602 Carling h 902 (882) Maynard Gilreath Zeb H Jr slsmn Central Tire Co r 602 Glawson Joseph slsmn Yates Mtr Co res Gray Carling Ga Gilstrap O J opr Proctor & Gamble Mfg Co Gleason Eliz (wid E; D) h 718 2d Gilstrap Olin J (Eliz) 1 flgmn So Ry r 120 Fort Gleason Ovella M dentist 723 Bibb Bldg r 718 Hill 2d Gilyard Julius (c) lab City Scavenger Dept Gleaton Mary (wid E D) 1 opr Genone's Bar- Gioldas Nicholas (Nu-Way Wenier Stand) r ber & Beauty Shop r 114 Cole apt 1 727 Orange GLENDENN1NG DON C (Violet S) (o) Li- Giovanni Mary Mrs r 501 Giles apt 1 cense Inspr City of Macon, h 219 North-- Girardeau Marvin A emp Sunshine Creamery . .Tel 3991-J r 7 n Arlington pi Glendenning Louis student r 219 North (NH) Girardeau Robt T (Elvie) shpg elk Willingham Glenn Arna (c) cook J E Tyler r 304 Strait S&D Co r 7 n Arlington pi Glenn Ella (Mrs Walter) emp Bibb Mfg Co r Girdner Katie (c) r 3 Center (EM) 867 New Girl Scouts of America Margt Murphy execu- Glenn Helen I student r 232 Belvedere dr (I) tive ofc City Hall Glenn Harry J (Edna M) (o) mgr Ritz Theatre Givens Curtis (c) r 92 (119) Forest (V) h 232 Belvedere dr (I) Givens Dorothy (c) r 92 (119) Forest (V) Glenn Harry J Jr emp Bibb Mfg Co r 232 Bel- Givens Raymond (c) jan The Grand Bldg h 92 vedere dr (I) (119) Forest (V) Glenn Joseph (c; Gertrude) lab T & T Packing Givens Raymond Jr (c; Eliz H) 1 delmn Pea- Co h 83 Bay cock's Pharm h 106 Ruby (V) Glenn Sara (c) r 505 Gilmer Givens Robt emp Greyhounds Lines r Central Glenn Susie (c) maid Hotel Glenn Thos elk Rogers Inc r YMCA Gladin Ivy D (Mary E) br mgr Atlantic Ice Glenn Thomas (c; Cherry) 1 (o) lab h 112 & Coal Co h 421 Duncan Woolfolk Gladin Jos r 421 Duncan Glenn Walter (Ella) emp Smithy's Barbecue Gladin Margt r 421 Duncan Lunch h 867 New Gladman Clarence (c) (Vineville Branch Press- Glenn Walter (c; Rosa) 1 emp Macon Hosp r ing Club) r 519 Monroe (V) 225 Middle Gladness Jessie tex wkr Willingham Mills r Gliggs Rebecca Mrs r 515 Napier 122 (13) Holt Glisson H Felton (Ethel H) 1 br mgr Piggly Glanton Geo (c) pin str Lucky Strike Bowling Wiggly h 108 Burton Alleys r 529 Cotton Glisson Laura A r 405 Burton Glanton Robt (c; Sadie) hlpr Cent Oil Co r 104 Glisson Mary (wid S E) (o) h 405 Burton Spring Glisson Sami E Jr r 405 Burton Glanton Sadie (c) sch tchr r 104 Spring Glisson Sidney L r 405 Burton Glasco Alvin L (c; Volie) (o) (Glasco's Barber Glisson Wm J (Minnie) 4 (o) refinisher Odom Shop) h 226 1st (V) Variety Wks h 255 Clinton (EM) Glasco John F (c) tr dr Richardson Whol Prod Globe Dress Shop The (Max Weinstein) 404 3d Co Glosson Annie (wid G C) 3 h 108 Appleton Glasco Nineva (c) case aide County Relief Glosson Benj (c; Liscar) peddler h 309 Wo- Admn r 226 1st (V) mack 1 Glasco's Barber Shop (A L Glasco) 406 Mul- Glosson Geo (c; Helen) 1 emp C of Ga Ry r berry 245 Cowan Glass Albert W (Eliz H) 2 (o) (Glass' Pharm) Glosson L Eliz (c) student r 309 Womack h 125 Nottingham dr Glover Albert (c; Odessa) 2 emp Collins Bak- Glass Barney L (Harriet E) 2 tex wkr Will- ing Co h 111 Harris ingham Mills h 103 (49) Holt Glover Alfred (c; Sarah H) 2 (o) farmer h Glass Danl tex wkr Willingham Mills r 216 (19) 1012 (1135) Clinton rd (EM) Holt Glover Allen (c) porter Kaybee Clo Store r 224 Glass Harriet E (Mrs B L) tex wkr Willing- Tindall ham Mills r 103 (49) Holt Glover Annie (c) 1 dom A W Marshall r 311 Glass Helen tex wkr Willingham Mills r 131 Norris (EM) (35) Holt Glover Annie B (c) 4 lndrs r 510 (456) Hall Glass Lelia (Mrs R C) tex wkr Willingham (EM) Mills r 131 (35) Holt Glover Beatrice (c) maid R L Anderson res Glass Lucile (Mrs Wm) tex wkr Willingham Stinsonville Mills r 127 (37) Holt Glover Bessie M (c) bag mkr Central City Bag Glass Lula E (o) h 103 Academy Glass Nannie M r 216 (19) Holt Co r 224 (717) Pear Glover Beulah (c) 1 emp Independent Ldry Co Glass Raymond C (Lelia) 5 tex wkr Willingham Mills h 131 (35) Holt Glass Sallie (Mrs Emmett) h 216 (19) Holt Glass T Edw (Rebecca) tex wkr Atlantic Cot- ton Mills h 5 Atlantic Village r 76 Spring Glover Beulah (c) lab So Crate & Veneer Co Glover Callie (c) maid A S Hanson r 100 1st (V) Glass T Edw Jr r 5 Atlantic Village Glover Carrie L (c) cook L F Eachern r 142 Glass Wm (Lucile) 1 tex wkr Willingham Pecan Mills h 127 (37) Holt " 'G lover1 1Ca r'l (c) r 232 4th (V) ' ? 1935 Macon City Directory m Glover Clara B (c) maid Lucy Abel r 107 Tindall Glover Claude (Della) (c) lab h 1006 Main (EM) Glover Clifford (wid G Z) (o) h 119 Coleman Glover Cecil (c; Mary) 1 r 127 (229) Nuss- baum Glover Daisy (c) maid W K McCrea r 731 Oc- mulgee Glover Eddie M (c) maid J H Otto r 1006 Main Glover Edna M (c) cook A J Johnson Jr r 408 Monroe Glover Edw (c; Willie M) emp Bibb Mfg Co h 721 Fort Hill Glover Eliz V H (wid F W) mus tchr 520 Orange apt 2 h do Glover Ernest (c; Clemntine) 5 bill poster Parker Adv Serv h 221 Chestnut Glover Ernest Jr (c; Annie M) 2 porter X V Clothes Shop r 221 Chestnut Glover Estella (c) 1 cook J D Blair r 514 e 2d (EM) Glover Eug (c) r 221 Chestnut Glover Frazier C (Gertrude) r 421 Lawton Glover Fredk (c) h 114 (552) Tinsley la Glover Freman (c; Della) 1 dishwasher Hotel Lanier r 118 Hill Glover Genie (c) 7 lndrs Independent Ldry h 104 (216) Short (EM) Glover Geo (c; Mary) So Crate & Veneer Co h 224 (717) Pear Glover Geo waiter Nu-Waw Weiner Stand r 185 Magnolia Glover Geo Z (Bibb News Co) r 119 Coleman Glover Gertrude (Mrs F C) tex wkr Willing- ham Mill r 421 Lawton Glover Hamp (c) r 10 (750) Sparks al Glover Hamp (c) r 232 4th (V) Glover Hattie (c) lndrs Independent Ldry h 805 Fort Hill Glover Henry (c; Emma) 1 h 232 4th (V) Glover Henry (c; Sallie) 3 lab Cent Sash & Door Co h 204 (405) Campbell (SM) Glover Henry Jr (c) r 204 (405) Campbell (SM) Glover James (c; Eva) r 120 Broadway Glover James (c) r 142 Pecan Glover John (c; Eliz) 3 lab h 301 Henderson la Glover John T (c; Carrie) hlpr Standard Oil Co r 110 Powell Glover John W (c; Mattie) 2 lab r 163 Hazel Glover John W (c) lab r 419 Hazel Glover L Ruth (wid L H) 4 (o) h 218 Maynard Glover Leonard (c; Fleta) lab Independent Ldry Co h 27 Stewart Glover Luther (c) emp Bibb Mfg Co r 916 Ocmulgee Glover Maggie (c) 1 cook Mary L Carswell r 213 5th (V) Glover Mary (c) 4 h 502 (481) Charles Glover Mary A (c) 2 bag mkr Central City Bag Co h 528 Academy al (EM) Glover Mary L (c) 1 h 1 Lennox la Glover Mary O (c) cook J K Ryles r 655 Clin- ton (EM) Glover Mattie (c) clnr Bibb Mfg Co Glover Mun (c) tr dr h 102 (54) Davis la Glover Mose (c) waiter Hotel Lanier r 731 Ocmulgee Glover Mortimer (Gladys) 5 (o) pastor Christ Episcopal Ch h 129 Pio Nono Glover Nannie (c) r 528 Academy al (EM) Glover Norma T student r 185 Magnolia Glover Northern (c; Callie) r 100 <101) 1st (V) Glover O Clarence (Georgia) 2 swtchmn MD&SRR h 185 Magnolia Glover Reese (c) r 311 Norris Glover Rosa (c) 1 r 311 Norris Glover Sarah (c) tex wkr Bibb Mfg Co h 311 Norris Glover Sylvester (c) hlpr Odom Candy Mfg Co 528 Academy Glover Thos (c) r 232 4th (V) Glover Thos (c; Anna) 1 lab h 103 (253) Clara Glover Tobe B (c; Mary) 1 hlpr Bibb Mfg Co h 504 e 2d (EM) Glover Ulysses (c) lab So Crate & Veneer Co Glover Wiley G (c; Gladys) (o) tchr Hudson High & Industrial Sch h 606 (593) Cowan Glover Wm (c) r 502 (481) Charles Glover Wm (c) emp Mercer Univ r 1159 Ogle- thorpe Glover Wm (c; Marietta) 4 hlpr Coca-Cola Bottling Co r 513 Forsyth Glover Wm (c; Lucille) 3 lab h 229 Riley (CP) Glover Wm (c; Zimmia) waiter Lanier Hotel h 731 Ocmulgee Glover Wm N (Olive) (Bibb News Co) r 119 Coleman Glover Willie N (c) maid R R Cameron r 177 Lincoln Glover Willie P (c) 1 maid J P Hair r 1006 Main (EM) Glover Zimmie (c) cook R A Stephens r 731 Ocmulgee Gober Ernestine M sten-bkpr Geo F Yetter Inc r 777 Blackburn Gober Fletcher C shpg elk Am Bakeries Co r 777 Blackburn Gober Frank D (Thelma) 2 driver Power Oil Co h 131 Rembert Gober Hiram A (Ruth) 2 condr C of Ga Ry h 808 Orange Gober J Fletcher (Essie) (Gober's Serv Sta) h 777 Blackburn Gober J Forest (Thelma) firemn So Ry h 415 Virginia Gober J Ralph atndt Gober's Serv Sta r 777 Blackburn Gober Randolph W (Sara S) (o) cr mgr Ga Caro Oil Co h 730 Napier Gober Sara S (Mrs R W) sten First Nat Bank & Trust Co r 730 Napier Gober Thelma (Mrs F D) cash Kinnett-Odom Co r 131 Rembert Gober's Service Station (J T Gober) 501 Mont- pelier Godbee Beulah (wid B W) r 267 Washington Godbee Bracton W msngr Postal Teleg-Cable Co r 267 Washington Godbee Hilda r 267 Washington Godbee Sallie L r 267 Washington Goddard Calvin (c; Ida) h 303 (203) Cowan Goddard Candus (c; Esther) (o) chauf B E Willingham h 215 Jones Goddard Edgar (c) delmn Bell's Pharm r 620 4th (WH) Goddard Esther (c) r 215 Jones Goddard Florine (c) r 620 4th (WH) Goddard Jim (c; Alice) tr dr Central S&D Co r 910 Elbert Goddard Lizzie (c) h 132 (131) Clark (EM) Goddard Ola Mae (c) lndrs Crescent Ldry r 303 (203) Cowan Goddard Sami (c) 3 lab h 620 4th (WH) Goddard Walter (c; Ola M) r 303 (203) Cowan Goddard Wm (c) r 420 Elliott Goddard Wm (c; Mary) lab F S Royster Guano Co h 640 4th (WH) Goddard Willie M (c) 2 lndrs h 812 Ocmulgee Godfrey B Annie (c) 1 lab Central City Bag Co h 7 Parker al Godfrey Henrietta V (wid A C) h 1159 Elm Baldwin's and Telegraph's Godfrey Luke D (Ida) tex wkr Willingham Mills h 21 (65) Mill Godfrey Roscoe A (Lilia) 2 (o) projectionist Ritz Theatre h 1004 Walnut Godfrey Tressie opr Avalon Beauty Shoppe r 360 New Godwin Cora (c) dom J R Fried h 406 (106) Lexington Godwin Hardy C (Gladys P) 2 barher R S Thorpe & Sons h 805 Orange Godwin Mamie r 308 Ridge (1) Goepp Helen mus tchr r 389 Orange Goepp Roudolph (Jessie) (o) mgr Southland Barber Shop h 389 Orange Goeite Fredk W Jr (Naomi) 1 (o) pres Stew- art-Goette Elec Co h 126 Stonewall pi (V) Goette Maria Mrs (o) h 128 Academy Goette Philip W (Eliz) 4 tailor Dannenberg's h 304 Fairmont (B) Goforth Vida K (Mrs W M) elk W U Teleg Co r 202 Log Cabin dr Goforth Wm M (Vida) 2 emp W U Teleg Co h 202 Log Cabin dr Goggins Frank (c) lab Cherokee Brick Co Goggins John (c) lab Idle Hour Nurseries r RD 1 Goggins Nonie B (Ruth) 1 (o) mach C of Ga Ry h 923 Log Cabin blvd Goins Alma F (Mrs R W) elk W E Goins & Son r 342 Duncan Goins Filmore (c; Cornelius) 1 (o) emp h 297 1st (V) Goins Geo W (Lelia) gro 204 (96) Holt h do Goins John W (Amelia) (meat mkt) r 569 Boulevard (NH) Goins Robt W (Alma F) (W E Goins & Son) h 342 Duncan Goins W E & Son (W E & R W) gros 200 (56) Holt Goins Walter E (Georgia) (o) (W E Goins & Son) h 326 (330) Dannenberg Golden Arth (Ellen) h 231 Cedar (SM) Golden Arth (c; Angia) 1 emp Swift & Co h 614 Ross Golden Chas E (Daisy S) store kpr So Ry h 863 Cherry Golden Eagle Co J H Clay mgr auto part 473 Broadway Golden Julia (c) h 617 3d (V) Golden Vinson E r 231 Cedar (SM) Golden Wm (c; Mary) 5 (o) shoe repr 203 (159) Peacock h do Goldgar Annie S (Mrs B M) agt Penn Mut Life Ins Co r 102 Hill Crest Goldgar Benj M (Annie S) 1 (o) slsmn Mar- shall Furn Co h 102 Hill Crest Goldgar Bernard (Eva) (o) (Goldgar Furn Co) h 502 Napier Goldgar Furniture Co (Bernard Goldgar) 518 Poplar Goldgar Harry student r 102 Hill Crest Goldgar Myriam student r 102 Hill Crest GOLDMAN BENJ (Minnie) (o), mgr The Re- liable Outfitters, h 305 Hill Crest--Tel 5791 Goldman Irma student r 305 Hill crest Goldman Joseph asst mgr Reliable Outfitters r 305 Hill Crest Goldman Lizzie (wid Geo) (o) h 764 Cherry Goldman Mortimer G (Minnie) mgr L Gold- man Pawn Shop h 818 Cherry apt 2 Goldman Pawn Shop Mortimer Goldman mgr 318 3d Goldsby Beatrice atndt Ivy-Turner Ice Cream Co r 1337 Edgewood Goldsby Boykin W waiter The Cricket r 1337 Edgewood GOLDSTEIN CHAS (Tillie) 2 (Economy Shoe Reprs & Dry Clnrs) h 845 Patterson--Tel 6382-W Goldstein Ellis (Mamie) 1 h 401 College apt 7 D Goldstein Jay r 401 College apt 7 D Goldstein Mack (c) lab City Bd of Water Cmrs r 7 Woodliff Goldwire Arlyn V student r 336 American blvd Goldwire Bessie B (o) h 336 American blvd Goldwire H Mitchell Jr r 1701 3d Goldwire Hal M (Nannie R) (o) eng So Ry h 1701 3d Goldwire Wm S Jr r 336 American blvd Goler Fannie (c) Indrs r 411 Short (EM) Golsan Wm R (Frances) (o) engr Macon div C of Ga Ry h 794 Courtland Golsan Willard R Jr phys 811 Ga Casualty Bldg r 794 Courtland Golstein Cecil (c) r 257 4th (V) Gonder Alf (c; Lula) 1 h 206 Fargason (V) Gonder Arth (c) h 224 (219) Fargason (V) Gonder Alvin (c) r 113 Lynwood (V) Gonder Edw (c) hat blkr Economy Shoe Reprs r 206 Fargason Gonder Geo '(c) r 113 Lynwood (V) Gonder Gladys (c) dom r 113 Lynwood (V) Gonder Robt (c; Mollie W) h 224 (219) Far- gason (V) Gonder Wm (c) barber Gertrude Smith h 113 Vinewood Gonder Wm B (c) r 113 Lynwood (V) Gooch E L (c) lab City St Dept Gooch Emma (c) carder Bibb Mfg Co r 209 (207) Industrial Home rd Gooch Roxie (c) r 202 Douglas (V) Goodall Julia r 554 Orange Goodall Minnie r 554 Orange Goodall Wm S (o) h 554 Orange Goode Boise (c) lab F S Royster Guano Co Goode Florence (c) Indrs h 404 Applewood Goode Hattie (c) r 509 Fort Hill Goode Mattie (c) maid H I Smart r 122 Syca- more (V) Goode Robt (c; Mattie) lab Proctor & Gamble Mfg Co r 122 Sycamore (V) Goode Sol (c; Georgia) 1 (o) bellmn Dempsey Hotel h 108 Ward (V) Gooden Albert (c; Dolly) emp C of Ga Ry h 114 Cowan Goodin Andrew (c; Cath) emp Cherokee Brick Co h 300 Charles Goodin Chas (c; Fannie) r 224 Jordan's al Goodin Claude (c) r 301 (300) Charles Goodin Henry C (Jessie) car inspr So Ry h 3706 Houston Goodin Hurley (c) emp Proctor & Gamble Co r 301 (300) Charles Goodin Ida (wid J J) h 2097 3d Goodin John R slsmn Sears-Roebuck & Co r 3706 Houston Goodin Paul F student r 3706 Houston Goodin Rose M r 203 Highland (LCHts) Goodin Rudolphus (c) r 301 (300) Charles Goodin Sami (c; Grace) 1 h 224 Jordan's al Goodin Wm C r 104 Rock Creek rd Gooding Dolly (c) dom P M Crossley r 114 Cowan Gooding James K (Inez E) mgr Hub Fish & Oyster Co h 2211 Forsyth rd Gooding Thelma E tchr Alex Sch No 4 r 2211 Forsyth rd Goodloe Eddie emp Chambliss Mkt r 163 Roye Goodloe John (c) hlpr r 163 Roye Goodloe Leila M (c) cook Tom Davis r 163 Roye Goodloe Lester C (Eunice) 2 asst mgr Macon Better Hsg Program h 134 Rembert 1935 Macon City Directory gia Goodloe Liela (c) maid N A Avant h 163 Roye Goodlow Ella M (c) maid C H Edwards r 246 Plant GOODMAN ALEX M (Fielder B) J'an h 402 (15) Hal1 ingham Mills h 71 Mill Green Wylene (c) r 142 (140) Sycamore (V) Green's Tabernacle (c) 201 Toombs (SM) Green Alf r 732 Montpelier Jreenway Lois L (Lillian) 1 tex wkr Willingham Mills h 2 (76) Mill 'reenway Marie (Mrs R L) emp Willingham Mills r 1 (75) Mill Gr8fie4?5" CBoeunrjtlWand(Gladys) (o) phys Bibb Bldg h reenway Nellie M (Mrs J E) emp Willingham Mills r 71 Mill 1935 Macon City Directory 351 Greenway Robt L (Marie) 2 tex wkr Willing- ham Mills h 1 (75) Mill Greenway W Clinton (Cora L) tex wkr w W;ill1l- ingham Mills r 250 Greenwood Fannie (c) Wr 7in7sh(i1p74) Oliver (SM) Greenwood Louise (c) student r 300 Antioch rd Greenwood Nelson (c; Josephine) (o) emp C ot Ga By h 300 Antioch rd Greer Alvin E (Jewell B) 1 agt Met Life Ins Co h 1115 Walnut Greer Aminzer (c) r 220 Jones Greer Annie (c) maid h 307 Monroe (V) Greer Annie L (c) h 111 Main (S) Greer Anna M (c) cook Collins Baking Co Greer Boisy (c) lab Cherokee Brick Co Greer Cecil (c; Maggie) 2 emp So Crate & Ve- Gregory Robt K tex wkr Willingham Mill r 233 Duncan , Gregory T Felton (Nancy Lee) tex wkr Will ingham Mills Gregory Wm C h 240 (Alene) D3uhnca10n1 J?ufTenm Gregory Wm C (Lucile) (o) h 766 New Gregory Wm O (Gertrude H) mgr radio dept Sterchi's h 101 Euclid ~ Greigs J B emp Greyhound Lines r Central Hotel ,, Grenade Tom barmn Hotel Dempsey Grenon Alida (wid Augustine) h 416 Lawton Grenon Flora J r 416 Lawton Grennsted Unas Mrs 1 r 1307 3d , Gresham Albert W dental tech Dixie Dental Laboratory r 715 American blvd Gresham Eldridge (c) lab C of GaRy 26 (21, w Gresham Ferdinand W (Pearl L) h 118 Ruther ford (SM) . Greer Ella (c) cook Mrs S B Wilson r Colum- Gresham Hazel Mrs opr Happ Bros Co r 544 Forsyth ,, Greer Essex (c; Mattie) (o) h 202 (107) Gib- Gresham Lizzie (c) 2 r 213% Elliott Gresham Louise opr Happ Bros Co RD 2 Greer Eva M (c) maid Sami Shier 315 Norris Greer Fannie (c) cook C H Fuller Greer Geo G (Eula) (o) h 437 (504) Log Cabin Gresham Martha opr Happ Bros Co r 760 New Gresham Milton I watch repr Kernaghan- Goodman Inc r 715 American blvd Gresham Nellie opr Happ Bros Co RD 2 Greer Ivan I (Hazel) 3 slsmn r 617 (1753) Log Cabin blvd ,,, , Greer Jesse W (Mattie O) 1 slsmn h 164 High Greer Josephine (c) maid r 402 Stevens (SM) Greer Hath (c) 3 r 111 Main (S) Greer Lizzie (c) dom r 531 e 2d (EM) Greer Louise student r 2444 Broadway Greer Mary L (c) cook r 115 Roff Home Greer Monroe (c; Eula) 6 lab h 402 Stevens (SM) Greer Nadine r 2444 Broadway Greer Paul emp Swift & Co r 278 College Greer Robt (c) emp Macon Milling Co h 137 (157) Nussbaum . __ . Greer Robt L (Annie) (o) car inspr So Ry h 2444 Broadway ^ . Greer Robt L Jr .Annie) (o) sta atndt Tank Car Serv Sta h 2444 Broadway Greer Sandy (c) emp Tank Car Serv Sta h 319 Short (EM) ,, .. Greer Sara E student r 617 (1753) Log Cabin Gresham Pearl L (Mrs F W) opr Happ Bros Co r 118 Rutherford (SM) Gresham Richd B (Jeffie) custodian Jaques Bldg h 715 American blvd Gresham Robt (Sarah) 1 farmer r 420 Jackson Gresham Ruby opr Happ Bros Co r 760 New Gresham Ruth r 544 Forsyth Gresham Sarah T (Mrs Robt) spooler Bibb Mfg Co r 420 Jackson . . Gresham School Claudia R Jones prin 102 Forsyth Gresham Walter G (Mary) h 257 New Gresham Wm (Lelia B) 1 opr Proctor & Gam- ble Mfg Co h 760 New Grey John (c) lab C of Ga Ry Creosote Plant Grey Josie H (wid W P) 1 r 436 Ross Grey Lewis (c) brklyr h 602 Mitchell Grey Sara (c) maid Macon Hosp r 5 5th Grey Susie (c) semtrs H A Spivey r 324 Green Greyhound Sandwich Shop C W Roberts mgr 320 Broadway ,, ,,,,,,,, Grice Benning M (Grice & Grice) r 1013 Vine- Greer*Wm H (Annie L) (o) h 120 Winship Greer Willie (c; Lizzie) hlpr Bibb Mfg Co h 531 e 2d (EM) ^ ^ Greer Wilmer L emp State Highway Dept r 2444 Broadway Gregorie Chas H dentist 161 Cotton r do Gregory C Edward (Lulu V) tex wkr Willing ham Mills r 240 Duncan Gregory C Richard delmn r 240 Duncan Gregory Clara opr Happ Bros Co r 116 School Gregory Clarence (Alline) 3 r 1231 College Gregory Glenn (Birdie Mae) emp Central Bak- ing Co h 429 Duncan Gregory Guy T (Sophia) slsmn Economy Shoe Shop h 212 Central (SM) Gregory Felton emp Willingham Mills Gregory Hannah (wid W M) h 116 School Gregory Homer F (Mattie) 2 emp C of Ga Ry h 107 School Gregory Jack student r 243 Hardeman Gregory Jas T (Claude E) 4 emp Willingham Mills h 233 Duncan Gregory Jessie O tex wkr Willingham Mills r 233 Duncan ,,., . Grlc^Elia sten Grice & Grice r 1013 Vineville Grice Ruth Mrs slswn Burden Smith & Co r 1013 Vineville (V) Grice Sami R elk Willingham Mills r 1013 Vineville (V) _. . . Grice Warren (Clara R) (o) (Grice & Grice) h 1013 Vineville Grice & Grice (B M & Warren) lawyers 716 Ga Casualty Bldg m ._ Griegs Lucius (c) 1 jan City Bk & Trust Co r 1322 1st Grier Alex (c) (o) lab h 102 Woolfolk Grier Anna (c) maid B P O'Neal Grier Annie M (c) h 432 Chestnut Grier Aretha (c) r 103 (217) Johnson la Grier Caesar (c) lab So Crate & Veneer Co Grier Carolyn student r 604 Holt Grier Carrie (c) r 108 Amos (V) Grier Carrie (c) r 105 (144) Adams Grier Carrie (c) h 9 (1) Paradise al Grier Celia (c) 1 cook L N Denard h 127 e EU Grier Chas (c) tr dr Empire Dixie Coal Co Inc r 205 Coles al Gregory L Glenn (Bertie M) baker Central of Grier Clarence (c; Carrie) h 197 Elliott Ga Bkg Co r 422 Duncan Grier Cornelius (c) r 2 Bear's al Gregory Minio H (Maggie) 3 h 243 Hardeman Gregory R Carl (Juanita H) 1 elk Ga Casualty Sandwich Shop h 102 Lamar (V) Grier Dora (c) emp Mrs Rosa Putzel Grier Ernest (c) trkr C of Ga Ry r 69 New 252 Baldwin's and Telegraph's Grier Essy (c; Gertrude) 3 h 103 (217) Johnson la Grier Frances (c) 1 r 429 Chestnut Grier Frank (c) lab Macon Cooperage Co r 612 (17) Gilmer Grier Geo W (Bertha) 1 (o) div agt So Ry h 604 Holt Grier Geo W Jr slsmn J N Neel Co r 604 Holt Grier Harry (c) r 503 Hazel Grier Horace (c; Lillie) 1 r 503 Hazel Grier Hubert (c; Margt) lab Proctor & Gam- ble Mfg Co r 205 (212) Henrietta (SM) Grier James (c; Annie) 2 emp So Cotton Oil Co h 311 Henderson la Grier Jennie L (c) r 2 Bear's al Grier John (c; Minnie) h 106 Antioch rd Grier Julia M (c) maid h 109 (6) Magnolia la Grier Lillie M (c) cook L L Woodson r 127 e Ell Grier Lizzie (c) dom C L Ridley h 403 Craft la Grier Lobie (wid J T) r 2125 Broadway Grier Maggie (c) lab So Crate & Veneer Co Grier Margt (c) r 108 Amos (V) Grier Mary L (c) cook 125 (38) Holt Grier Mattie (c) h 612 (17) Gilmer Grier Nell bkpr Firestone Auto Sup & Serv Stores r 604 Holt Grier Nettie (c) h 69 New Grier Roxie (c) tchr Bibb County Schs r 102 Woolf oik Grier Sandy (c; Arlena) 1 lab So Cotton Oil Co r 115 Linden Grier Sarah (c) student r 102 Woolfolk Grier Selie (c) cook H L Dennard r South Ma- con Grier Tenie (c) h 105 (114) Adams Grier White (c; Willie) 1 h 2 Bear's al Grier Wm (c) r 612 (17) Gilmer Grier Wm (c) emp Bibb Mfg Co Grier Wm (c; Fannie) 1 emp C of Ga Shops h 372 Monroe (V) Grier Willie L (c) maid Helen Pritchard r 2 Bear's al Grierson Rose E (o) h 765 New Griffin Alpha (Mrs J H) slswn Sears-Roebuck r 119 Log Cabin dr Griffin Arth P elk Lane's Hotel r 555 Broad- way Griffin Artie (c) cook h 122 (227) Railroad Griffin Bernice (c) typist County Relief Admn r 807 3d (V) Griffin Bernice C (Mary E) 1 (o) coir Sterchi's h 123 Heard (SM) Griffin Berry L (Gertrude) 2 (o) flgmn C of Ga Ry h 108 Rutherford (SM) Griffin Bessie (c) r 244 Division St la Griffin Carrie Mrs winder Bibb Mfg Co Griffin Carrie C nurse Macon Transient Bur r 202 Appleton Griffin Cecil slsmn r 111 Jefferson Gr2*17nOCrhmaasnWd te(Ar llie F) 1 (o) coir Sterchi's h Griffin Claude r 359 Clinton Griffin Dave (c) emp Bibb Mfg Co r 235 Tel- fair Griffto David (c; Millie) emp C of Ga Ry h 130 6 Ell Gry,ffiooDoaTid J (EUa) 1 () chf fire inspr CP Griffin DeWitt (Lillian) 2 repr O K Shoe Sb r 818 2d (SM) Griffin Dorothy T r 2132 Broadway bTMn Doshia (c) dom A C Baggarly r 121 Griffin Edw (c; Rosa) 1 emp C of Ga Ry h 309 Wood al Griffin Effie L elk Jo Jo's r 127 Birch (NHts) Griffin Ethel (c) 2 emp Bibb Mfg Co h 235 Telfair Griffin Fleta (c) sten colored dept The Macon Teleg r 807 3d (PH) Griffin Frances student r 210 Winship GRIFFIN GEO W (Grace C) (o), Managing Editor The Macon Evening News, h 127 Birch (NHts)--Tel 1664 Griffin Gladis F (Jessie) 2 dept mgr Adams Buchanan Mtr Co h 208 Grenada ter Griffin H Minter (Lizzie) 3 harness mkr h 119 Garden Griffin Hardy (c; Lottie) 1 (o) jan First Nat Bk Bldg h 511 (109) Norris Griffin Helen (Mrs J T) elk Jo Jo's r 503 Napier Griffin Henrietta (c) (o) h 610 Clinton Griffin Henry L (Tillie) engr So Ry h 131 Fort Hill Griffin Horace (c; Mary) 2 lab C of Ga Ry h 550 Hazel Griffin I Henry emp C of Ga Ry Griffin James (c; Gertrude) 1 (o) firemn C of Ga Ry h 807 3d (V) Griffin James (c; Lila) porter r 137 2d (V) Griffin James A (Carrie B) 1 electrn h 123 Fort Hill Griffin James A Jr student r 123 Fort Hill Griffin Jessie (c) student r 120 (212) Railroad Griffin Jewel r 119 Garden Griffin John B (Glenda) 5 pntr h 220 Chappell (SM) Griffin John H (Alpha) 2 (o) hlpr Macon Teleg Pub Co h 119 Log Cabin dr Griffin Jones L emp City Stockade r 663 Walnut Griffin John S r 127 Birch (NHts) Griffin Joseph (c; Rosa) 6 h 228 Jefferson Griffin Joseph T (Helen) (Jo Jo's) 503 Napier Griffin Julian C hlpr A J Coffee & Son r 7 n Arlington pi Griffin L Felton (Willie M) elk G J Jones r 3044 Houston (SM) Griffin Lee (c; Edna) 5 lab h 120 (212) Railroad Griffin Lewis A (Annie M) agt Bankers H & L Ins Co h 254 New Griffin Lewis H (Jewel) 1 emp Ga Power Co h 127 Fort Hill Griffin Lois (c) cook r 103 (224) Long la Griffin Lyman E (Nellie) 1 overseer Appleton Ch Home Farm r do Griffin Major (c) lab So Crate & Veneer Co Griffin Mangham E (Etta) 2 (o) mech Adams Buchanan Mtr Co h 118 Richmond Griffin Marvin tex wkr Payne Mill r 2334 2d Griffin Mary (c) tchr r 826 (830) 3d (V) Griffin Minnie L (c) 3 r 205 Grant (V) Griffin Murray L emp Dixie Dairies r 907 New Griffin Morris r 119 Garden Griffin Paul R mgr meat mkt Rogers Inc Griffin Penelope M Mrs h 111 Jefferson Griffin Peter (c) h 204 Collins pi Griffin Ralph W E (Mildred) 4 (o) emp C of Ga Ry h 2134 Broadway Griffin Richd M tex wkr r 123 Fort Hill Griffin Robt L (Georgia V) h 907 New Griffin Roscoe (c) cook r 103 (224) Long la Griffin Sami B (Myrtice C) 1 slsmn Standard Oil Co h 209 Heard (SM) Griffin Sami B 2 r 220 Chappell (SM) Griffin Susie tchr r 465 Napier Griffin Verna r 131 Fort Hill Griffin W Cecil elk Ga Peach Growers Exch r 111 Jefferson ter m Griffin W Reid elk S Jones Co r 907 New Grimes John H (Sibyl) 2 sales mgr Met Life Griffin Walter (c) r 114 Ballard (EM) Ins Co h 728 Ridge Griffin Walter D (Mary V) (o) bldg contr h Grimes L Hope emp Swift Packing Co r 116 210 Winship (130) Charles Griffin Walton (c; Jane) 2 h 222 Fargason (V) Grimes Morris C (Lessie) 3 wtchmn Upbridge Griffin Warren L (Virginia) 2 mgr W T Grant Mfg Co h 102 Dover (B) Co h 261 Georgia apt 2 A Grimes Noah (c) student r 205 Forest (V) Griffin Wm (c) 1 auto ldry 210 3d Grimes Simon (c; Lura L) (o) h 205 Forest Griffin Wm (c; Annie Lou) 1 emp Art Fum (V) Mfg Co h 148 e Ell Grimes Val G (c; Alvonia) 1 tr dr Goldgar Griffin Wm R slsmn S Jones Co r 907 New Furn Co h 149 Pecan Griffis Clarence A (Trudie) 2 slsmn Willing- Grimes Wm C r 102 Dover (B) ham S&D Co r 467 Spring Grimmett T Wallace (Florence) 1 train dispr So Griffis James F (Martha) 2 tex wkr Willing- Ry h 119 Birch apt 1 ham Mills h 12 (81) Mill Grimsley Alma r 102 St John (EM) GRIFFITH ARTH (Derrelle) r H12e3n%rietCtaott(oSnM) Guerry Fannie (wid Du Pont) r 600 Napier 1935 Macon City Directory Gwaltney Eug C (Marion J) emp Bibb Mfg Co h 322 College Gwaltney Marion r 322 College m Gwyn Herbert (c) groom Rivoli Riding Club r Haden W Tommie (Inez) 2 (o) adv slsmn Ma do con Teleg Pub Co h 138 Lamont (LCHts) Haas Albert A (Olive) engr C of Ga Ry h 102 Hadley Earl (Lucy) 1 emp Ga Power Co r 554 Holt (V) 1st Habersham Jacob lab Bldrs Lbr Co r RD 5 Haffey James P (Mamie) engr C of Ga Ry h 83 Hackett Eleanor r 401 College apt 7 B Arlington pi Hackett Frances emp Y W C A r 401 College Hagan Erma (Mrs H M) opr Happ Bros Co r apt 7 B 301 Ell (SM) Hackett Francis r 240 Hardeman Hagan Henry M (Erma) 2 h 301 Ell (SM) Hackett Frank L (Kath) 1 lbr slsmn h 401 Hagan James O ins agt Liberty Nat Life Ins College apt 7 B Co r Columbus rd RD 2 Hackett James r 4 Astor pi Hagans Kate (c) h 204 e Ell Hackett Kath r 401 College apt 7 B Hagans Thos W (c) lab r 204 e Ell Hackett Kathryn cash Whitehead Serv Sta r Hagin Margt (wid F L) 2 r 620 (520) Mikado 782 Courtland Hahn Willard J (Katie M) 4 carp h 105 Kemp- Hackett Pearl sch tchr r 240 Hardeman er Hackett Wm M (Alice R) 1 h 4 Astor pi Haines (see also Hanes) Hackett Wm W (Isabel H) (o) div pass agt C Haines Agnes (Mrs H M) elk Scott's Gro Store of Ga Ry h 240 Hardeman r 608 Holt Hadarits Alex J slsmn Middle Ga Lbr Co r Haines Fay waitress The New Yorker r 220 1st 3003 Houston Haines H Milton (Agnes) slsmn Jordan's Dairy Hadarits Ernest E yd formn Middle Ga Lbr Co r 60 Holt r 3003 Houston Haines Mable opr Happ Bros Co r 905 New HADARITS JOSEPH P (Mary M) 2 (o) (Mid- Haines Porter E elk Ga Power Co dle Ga Lbr Co) h 3003 Houston--Tel 2158-M Haines Ralph (Annie) opr Happ Bros Co r 415 Hadarits Louise V bkpr Middle Ga Lbr Co r New apt 4 3003 Houston Haines Rosalyn sch tchr h 533 Orange apt 23 Hadarits Wm A emp Middle Ga Lbr Co Haines Ruth waitress The New Yorker r 220 Hadaway Geo hlpr Swith & Co r 605 1st New Hadaway Geo W agt Mut Life Ins Co of N Y Hainline John L int dec 559 Mulberry r Fick- r RD 6 Cross Keys ling Hotel Hadaway Jessie H student r 116 De Sota pi Hair John P (Nettie M) 2 elk P O h 409 Spring Hadaway Joseph L (Sarah A) 1 (o) slsmn Haire Florine H (Mrs J C) 2 tchr John W Swift & Co h 116 De Sota pi Burke Sch r 846 College Hadaway Lillie M Mrs opr Happ Bros Co r 611 Hairston Peter (c; Ola) 8 hlpr C of Ga Ry h 2d 416 e 1st (EM) Hadaway Roy H (Alice M) slsmn Cudahy Pkg Haisten Annie L (wid C C) 1 forwn Happ Bros Co r RD 4 Co r 119 Plant (SM) Hadaway Sarah A (Mrs J L) ofc sec The Clinic Haisten Hazel student r 727 Orange r 116 De Sota pi Haisten Lelia Mrs h 727 Orange Hadaway Sophie P r 116 De Sota pi Haisten Neville opr Happ Bros Co r 119 Plant Hadaway Virgil L (Oleda) mech Cassidy's (SM) Garage r 202 Church (EM) Hale Bertha W (Mrs Roy) dental asst Dr R H Haddock Bessie (c) 2 Indrs h 6 Wall St la Mason r 320 Hill Crest Haddock Henry (c) r 517 (531) Maynard Hale Carline (c) 1 tchr r 552 Broad Haddock James E (Louise D) asst skpg elk Hale Frances (Mrs J C) (o) h 200 Log Cabin Sterchi's r RD 6 dr Haddock James L (Nora L) tex wkr Bibb Mfg Hale Irene R Mrs h 101 (50) Holt Co h 19 Lake City (EM) Hale J Crowder spec agt Ga Inspection Rating Haddock Jerry W emp Bibb Mfg Co r 19 Lake Bur res College Pk Ga City (EM) Hale James S (Eva) h 331 Carling Haddock John H (Miriam) 2 (o) cash So Crate Hale Jesse L bkpr Snow's Ldry r 403 Spring & Veneer Co h 119 Habersham Hale Louise elk First Nat Bank & Trust Co r Haddock John W (c) porter Brown's Barber 331 Carling Shop r 517 (531) Maynard Hale Rosa tex wkr Willingham Mills r 101 (50) Haddock Leila (Mrs Wm) emp Bibb Mfg Co Holt r 215 Clinton Hale Roy (Bertha W) teller Citizens & So Nat Haddock Louise Mrs sten Macon Cigar & Tob Bk r 320 Hill Crest Co Hales Leonard L (Laura) 5 (o) carp h 622 Haddock Nora A (wid S H) r 124 Glynn Church (CH) Haddock Nora L (Mrs J L) tex wkr Bibb Mfg Haley Franklin (Margt) 1 bkpr h 476 College Co r 19 Lake City (EM) apt 5 Haddock Otis (c) r 517 (531) Maynard Haley Mamie H (wid Herbert F) (o) h 104 Bu- Haddock Rachel (c) 4 (o) Indrs h 517 (531) ford pi Maynard Haley Walter (c) lab Buckeye Cotton Oil Co Haddock W S (Charity C) agt Life Ins Co of Hall Addie (c) h 506 e Academy (EM) Va r RD 3 Houston rd Hall Addie Mrs mach opr Happ Bros Co r 271 Haddock Wm (Leila) 2 emp Bibb Mfg Co h 215 Washington Clinton Hall Albert (c) lab So Ry r 112 (7) Fulton la Haddox Harvey (c; Leila) r 229 (112) Disroon Hall Albert L student r 109 Cabaniss (EM) al Hall Algie (Mrs Eug) elk College St Gro r 325 Haddox Leila (c) cook r 229 (112) Disroon al Haden Annie F Mrs h 162 Jeff Davis (SM) Adams Hall Alinda (c) dom Clinton rd r 303 (583) Hall (EM) Haden Inez (Mrs W T) slswn Suzanne Hat Hall Amelia (wid W A) r 126 Laurel Shop r 138 Lamont Hall Annie (c) Indrs h 401 (735) Hall (EM) Haden Joel A (Florence A) ptrnmkr Taylor Hall Annie M (c) r 1163 Oglethorpe Iron Wks r 138 Lamont (LCHts) Hall Archie (c) r 222 (165) Grant (V) ?56 Baldwin's and Telegraph's Hall B Campbell student r 231 High Hall Basil W student r 97 Osborne pi (1) Hall Berry (c; Emma) 5 (o) lab Cherokee Brick Co h 206 (121) Gibson Hall Bertha (c) r 204 (255) Bowman Hall Bessie r 223 (122) Cutters la (EM) Hall Bessie opr Adams Mfg Co Hall Carrie (c) r 509 Monroe (V) Hall Cary H student r 707 Holt Hall Cero G (Myrtle) 2 h 1922 Broadway Hall Charity (c) lab S E Compress & Whse Co Hall Chas r 170 Virginia Hall Chas H (Mabel) 1 (o) engr C of Ga Ry h 101 Hill Crest Hall Chas H lawyer 619 Ga Casualty Bldg r 97 Osborne pi Hall Chattie (c) emp Southeastern Compress Co h 319 Gilmer Hall Cicero (c; Mattie) 2 lab h 96 (103) Hazel Hall Clarence S (Ruby J) 3 elk P O h 708 Pine Hall Cleo r 509 Main (EM) Hall Clifford (c) 2 emp Snow's Ldry h 812 Edgewood Hall Cora T Mrs h 239 Bond Hall Daisy (c) clnr Bibb Mfg Co Hall David (c; Lena) 5 tr dr Atlantic Ice & Coal Corp h 642 Hammond Hall E Clyde (Mildred) 3 (o) mach Happ Bros Co h 350 Edna pi (LCHts) Hall Edna Mrs spooler Bibb Mfg Co Hall Edna P r 101 Hill Crest Hall Ella (c) h 14 Gustin Hall Ella L (c) h 66 Schofield Hall Elmer (Ida) h 316 Chappell (SM) Hall Emma (wid L M) r 104 Buena Vista Hall Emory M (Betty W) tex wkr Bibb Mfg Co r 163 2d Hall Ethel R (Mrs W R Jr) emp McKesson- Riley r 199 Laurel Hall Eug (e;Nell) h 214 Jefferson Hall Eug student r 110 Montpelier Hall Fannie (c) maid Lalla A Clark r 227 1st Hall Ferol L r 239 Bond Hall Francis K inspr HOLC 231 High Hall G Sherman bldg contr h 170 Virginia Hall Geo C (Winnie) h 116 Brentwood Hall Gladys (c) r 803 Curd (SM) Hall Grover T (Kathleen) slsmn Am Bakeries Co h 135 Park pi Hall Harris F (Doris) h 261 Georgia apt C4 Hall Hattie (c) r 117 Spring Hall Henry (c; Rosa) lab r 822 Montpelier Hall Henry C (Reba) 7 emp State Fish Hatch- ery h 109 Willingham Hall Hubert H (Cora) refnshr A G Rhodes & Son h 239 Bond Hall Ida (c) lndrs r 1163 Oglethorpe Hall Iona (c) r 314 (66) Plummers al Hall Irving E (Pearl N) 3 emp So Ry h 707 Holt Hall J Alex (Nora C) (o) mgr Power Oil Co Inc h 573 Ingleside (I) Hall J Ellsworth (May K) 1 (o) h 231 High Hall J Ellsworth Jr (Louise C) 1 (Hall & Block) h 218 Hines ter Hall Jack J (Olive) 3 slsmn h 222 Magnolia apt 2 Hall James (c; Christine) 1 delmn College Hill Pharm h 754 Ocmulgee Hall James B (Julia) 1 h 35 Arlington pi Hall James M (Nettie) 1 mech Bibb Chevrolet Co r 117 Lawton Hall James S (Nell) cab dr r 3 Gustin pi Hall James W emp C of Ga Ry Hall Janie (c) cook David Yaunis h 318 Ham- mond Hall Jarrell r 761 Courtland Hall John I phys 818 Ga Casualty bldg 231 High Hall Julia A elk Newberry's r 239 Bond Hall Katie (c) cook R B Irby r 455 Colquitt Hall Kenneth H (Ollie) dept mgr Dannen- berg's h 806 Hemlock Hall L Emmett (Drew) 2 (o) slsmn Yates & Tabor Co Inc h 124 Merritt Hall Laura (c) r 228 Jones Hall Leila student r 124 Merritt Hall Lelia (c) r 114 (646) Hicks al Hall Lelia (c) cook G P Murrow r 803 Curd (SM) Hall Lennie (c) h 508 Broad Hall Lenora (c) r 341 Madison (V) Hall Louise (c) maid Max Zarks r 54 Spring Hall Lucius (c; Alice) 3 hlpr Buckeye Cotton Oil Co h 112 Johnson (SM) Hall Luellen (c) dom h 302 e 1st (EM) Hall Mabel (c) maid r 603 Pebble Hall Maggie Mrs opr Happ Bros Co h 109 Cabaniss (EM) Hall Mansfield P (Mamie L) (o) lawyer h 150 Georgia Hall Marie (c) 1 maid Dannenberg's h 226 Elliott Hall Martha (wid I A) r 1743 Broadway Hall Mary (c) r 12 Murray al Hall Mary E (wid W J) r 632 Anderson (SM) Hall Mary L (c) h 803 Curd (SM) Hall Mattie (c) h 66 Turpin Hall Mattie (c) cook Lillian D Wimbish r RD 1 Hall Mattie (c) lab Buckeye Cotton Oil Co Hall Mattie (c) maid P E Willingham Hall Melinda (c) dom E W Elder Hall Missie (c) cook W O Durden r 202 (174) Roye Hall Morris (Lillie) 1 r 127 Williams (SM) Hall Olive (Mrs J J) slswn Darling Shops r 232 Magnolia apt 2 Hall Ollie (Mrs K H) emp Dannenberg's r 806 Hemlock Hall Ozey lab Buckeye Cotton Oil Co Hall Reba (c) emp Proctor & Gamble Mfg Co r 215 Turpin Hall Rosa (c) emp Independent Ldry Co Hall Rosa (c) maid r 822 Montpelier Hall Roy doffer Bibb Mfg Co Hall Silas S (Minnie) 3 engr Atlantic Ice & Coal C'0 h 622 Carling Hall Simeon G (Mamie) h 669 2d Hall T Eug (Algie) (College St Gro) r 325 Adams Hall Talmadge L slsmn Dannenberg Co r 239 Bond Hall Talmadge W (Mary B) 3 hlpr h 218 (217) Maynard Hall Thos (c; May) h 215 Turpin Hall Thos (Bob's Bar-B-Q Pit) r 109 Burton Hall Thos H (Marie) (o) auto repr h 829 Burton HALL THOS H (Carolie E) (o> Phys 413-16 Grand Bldg--tel 4216, h 117 Oak Haven-- tel 905 Hall Thos H III (Mildred B) 1 (o) real est 169 Cotton; and sis mgr Huckabee Auto Co h 97 Osborne pi Hall Vannie (c) r 503 Pebble Hall Voila (c) r 16 Gustin Hall Virginia supv Pub Schs r 35 Arlington pi Hall W Clarence (Irene) 1 emp Bibb Mfg Co r 509 Main (EM) Hall Warren (c; Lillie) emp C of Ga Ry h 209 College Hall Wm (c) h 611 3d (V) Hall Wm (c; Bouise) 2 jan Bibb bldg h 54 Spring 1935 Macon City Directory 257 Hall Wm A mach hlpr Am Bakeries r 135 Park pi Hall Wm F (c) r 401 (735) Hall (EM) Hall Wm H (c; Lula) (o) h 321 Plant (SM) Hall Wm H (c; Julia) latf h 652 Ross Hall Wm M (c; Ethel) (o) pastor Mt Moriah Baptist Ch h 529 Clinton Hall Wm O (Lillie M) 2 lab h 509 Mam (EM) Hall Wm R (Ina F) (o) real est h 199 Laurel Hall Wm R Jr (Ethel R) emp McKesson Riley r 199 Laurel Hall Willie C (wid S M) r 517 Napier Hall Willie M (c) r 1163 Oglethorpe Hall Winkfield F (c; Lillie) 1 (o) gro 1010 Main (EM) h do Hall Winnie (c) r 302 Turpin Hall & Bloch (J E Hall, C J Bloch) 614 Ga Casualty bldg Halliburton Julian student r 259 Boulevard Hamilton Albert L (Corinne) firemn Pump Co No 2 h 150 Tenney (SM) Hamilton Anna E (wid A J) (o) h 494 Orange Hamilton Annie W (wid G E) h 217 1st Hamilton Chas trav slsmn r 217 1st ,, Hamilton Daisy C Mrs mgr Southland Coffee Shop r Southland Hotel Hamilton Emanuel (c; Mamie) (o) porter Cudahy Pkg Co h 543 e 2d (EM) Hamilton Ethel (c) r 113 (600) Pringle Hamilton Eugenia (c) (o) tchr East Macon Sch h 55 Spring Hamilton Florence r 150 Tenney (SM) Hamilton Harry emp Bibb Mfg Co r 217 1st Hamilton John R (Alice S) 2 emp Bibb Mfg Co h 303 Clayton (V) Hamilton Martha opr Happ Bros Co r 119 School Hamilton Mary (c) smstrs Barfield Feed Mills Hamilton Mattie (c) emp Snow's Ldry 306 Halliburton Lizzie L (wid T H) (o) h 259 Boulevard (NH) , ,, Halliburton Maymie (Mrs R L) (o) solr W D Griffith & Son r 531 Georgia Halliburton Regina student r 531 Georgia Halliburton Robt L (Maymie W) (o) slsmn Kingman & Everett Inc h 531 Georgia Halliburton Thos H Jr emp Central Bag Co r 259 Boulevard (NH) Halligan & McLellan Inc C C Arnett mgr lbr 602 Bibb bldg Halloway James (c) cook Plaza Cafe r 234 Telfair . , Halsey Edna W Mrs nurse 128 Grady h do Halstead Della (c) h 17 Fordville la Ham Annie (wid J H) furn rms 233 Wash- ington h do Ham Bessie L opr Happ Bros Co r 406 Ross Ham Carrie (c) cook A S Roberson r 639 Elm St la Ham Edna (Mrs Jack) opr Happ Bros Co r 1728 3d. Ham Emma A (wid J B) r 114 Boulevard (NH) Ham Felix (Mattie B) gro r 2345 2d Ham Jack (Edna) opr Happ Bros Co r 1728 3d Ham James F (Lillie) 1 h 406 Ross Ham Joseph (c; Carrie) lab Atlantic Ice & Coal Co r 639 Elm St la Ham Lillie (Mrs J F) opr Happ Bros Co r 406 Ross Ham Martha r 406 Ross Ham Wm H hlpr r 233 Washington Haman Julia (Mrs C C) 1 r 605 1st Hambrick Alf (Ethelene) 2 emp Willingham Mills h 1231 2d Hambrick Edw C (Bessie) wtchmn Taylor Iron Wks h 2011 Broadway Hambrick Ethelene (Mrs Alf) spinner Bibb Mfg Co r 1231 2d Hambrick Evelyn r 1411 Edgewood apt 3 Hambrick Horace tr dr Melton Gro Co r 1411 Edgewood apt 3 Hambrick Joseph S r 2011 Broadway Hambrick Ludie (wid J R) 3 h 1411 Edge- wood apt 3 Hambrick Martha r 1411 Edgewood apt 3 Hambrick Paul C (Rebie) 2 pipe ftr Proctor & Gamble Mfg Co r 121 Knott (SM) EliZ8/l3Gtll Hamilton Noble R (Sara S) genl formn C of Ga Ry h 261 Georgia apt A1 Hamilton P Thos (Daisy) 1 emp GS&FRR h 119 School Hamilton Pearl (c) 1 h 225 Long St la (SM) Hamilton Savannah (c) r 409 (311) Charles Hamilton Walter r 119 School Hamilton Wilburn (c) r 400 Tindall (SM) Hamilton Wm (c; Katie) 1 h 601 Broad Hamilton Wm T (Ruby) ftr Macon Gas Co r RD Thomaston rd Hamlin Beatrice r 654 New Hamlin Bessie Mrs 3 opr Happ Bros Co r 952 Oglethorpe Hamlin C Hubert (Daisy) 1 (o) mach MD&SRR h 3607 Houston Hamlin Carl A (Martha) supmn City Engng Dept r RD 3 Hamlin Cath B (Mrs Fred) opr Happ Bros Co r 3502 Houston Hamlin Cecil L (Hazel) emp Art Furn Mfg Co h 126 Grady Hamlin Edw slsmn r 509 Arch Hamlin Ellavea sten Terrell Auto Elec Co r 505 Bailey Hamlin Emma (wid H A) r 130 (126) Grady Hamlin Fred (Cath B) packer Art Furn Mfg Co r 3502 Houston Hamlin Georgia (c) 2 maid Leon Bennett r (444) Liberty (SM) Hamlin Gretchen Mrs 1 sten J T Shropshire r 1021 Hazel Hamlin Houston V (Nell) 1 shpg elk Art Furn Mfg Co r 100 Davis (SM) Hamlin Hubert H (Daisy) 1 emp Meaders Mat- tress Co h 417 Arch Hamlin J Long (Ruby) (Hamlin Sheet Metal Wks) r RD 3 Hamlin James O (Jessie V) (J O Hamlin Plmbg Co) h 614 Holt Hamlin Jasper H emp C of Ga Ry Hamlin Jessie V (Mrs J O) dept mgr Union Dry Gds Co r 614 Holt Hamlin Jesse W (Ethel L) 2 (o) slsmn J F Heard h 135 Flamingo dr Hamlin John (c; Gertrude) 1 emp Birdsey Flour Mills h 338 Maple Hamlin John E (Georgia) carp h 654 New Hambrick Rebie (Mrs P C) opr Happ Bros Co Hamlin Joseph W (Martha) 2 metal wkr Ham- r 121 Knott (SM) lin Sheet Metal Wks h 2615 2d Hambry Wm R (c; Maxie L) 1 emp Dempsey Hamlin Julian E (Mabel) 2 (Hamlin Sheet Hotel r 456 (460) Clinton Metal Wks) r RD 3 Hamburg Emmett M (Louise) peddler h 1106 Oglethorpe Hamburg Louise (Mrs E M) fruits 1100 Ogle thorpe r 1106 Oglethorpe Hamby Elias (c) tire vulc r 1062 Ocmulgee Hamlin Lewis (c; Ruby) 3 hlpr Armour & Co h 359 (446) Alabama (SM) Hamlin Lovett C (Daisy) 2 emp State Fish Hatchery h 104 1st (SM) 258 Baldwin's and Telegraph's Hamlin Major (c; Annie) h 361 (460) Alabama (SM) Hamlin O Eug radio repr A G Rhodes & Son r 612 Holt Hamlin Pearl h 99 Vineville apt B4 Hamlin R Floyd (Fannie) 1 (o) h 121 Grady Hamlin R Lee (Mary) r 2908 Houston Hamlin Sarah r 654 New Hamlin Sheet Metal Works (J E & J L Ham- lin) 27 Wall Hamlin Susan (wid J L) 1 (o) h 505 Bailey Hamlin W Edw gro 326 Main (EM) h 373 Clinton Hammack Chas E (Emmie R) (o) slsmn h 467 Boulevard (NH) Hammack Dora (wid W H) r 3308 Josey Hammack Eunice B (Mrs F L) opr Genone's Barber & Beauty Shop r 1114 Walnut Hammack Frank L (Eunice B) coir Kinnett- Odom Co r 1114 Walnut Hammack Gussie M (wid F H) (o) h 1114 Walnut Hammack H Louis (Lavia A) h 425 New Hammack H Wyatt (Coryne) 1 carp h 3308 Josey Hammack Louia A (Mrs H L) sten Jones, Johnson, Russell Sparks r 425 New Hammers Chester B (Alma) mach C of Ga Ry h 860 Hemlock Hammett Dorothy C elk Prudential Ins Co r 130 High Hammett J Ray elk C A Couch r 172 Magnolia Hammett James T (Ophelia) 3 (o) opr Bibb Mfg Co h 303 Atlantic (B) Hammett John R (Victoria B) trav slsmn r 130 High Hammett Mary (wid L H) r 303 Atlantic (B) Hammett Ophelia (Mrs J T) winder Bibb Mfg Co r 303 Atlantic (B) Hammett Ray (Helen) 1 candy wrapper Car- starphen Inc r 771 1st Hammock Ada (c) clnr Bibb Mfg Co h 224% Powell Hammock C L opr Happ Bros Co r RD 4 Hammock Emory opr Happ Bros Co r RD 4 Hammock Evie (wid Geo) opr Happ Bros Co r 813 Main (EM) Hammock Geo M mech S E Greyhound Lines Hammock Marion J (o) h 223 Applewood Hammock Martha r 106 Ingleside (I) Hammock Olin (Laura) 1 h 109 Dewitt Hammock Patience (c) emp Independent Ldry Co r 104 Smith (EM) Hammock Paul H (L Geneva) 2 route formn Independent Ldry Co h 98 Nelson (SM) Hammock Sami T (Allene) 2 emp R L Clarke Co r 754 Spring Hammock Sara tchr Chas H Bruce Sch res Dunbar Ga Hammock Wm J (Bonnie) gro 1101 Main (EM) h do Hammond Alberta (Mrs Obediah) opr Happ Bros Co r 134 Steele Hammond Andrew J (Julia A) piano tuner h 283 Rutherford (SM) Hammond Andrew J Jr coir A G Rhodes & Son r 283 Rutherford (SM) Hammond Bruce (c) presser Neat Dry Clean- ing Co r 354 Monroe (V) Hammond Claude (c) shoe shiner G W Hat- field r 354 Monroe (V) Hammond Florence (c) maid h 401 (301) Charles Hammon Geo (c) lab Proctor & Gamble Mfg Co h 323 Hammond Hammond James (c) lab r 354 Monroe (V) Hammond John H msngr Postal Teleg-Cable Co r 312 Cleveland (SM) Hammond Naomi sten City Bd of Water Comrs r 811 Poplar apt 9 Hammond Obediah (Alberta) pntr h 134 Steele Hammond Paul (Mary L) 3 r 911 Walnut Hammond W A & Son (W A Hammond) sheet metal wkrs 516 2d Hammond Wm (c) r 430 Cedar (U) Hammond Wm A (Gertrude) 1 (W A Ham- mond & Son) h 312 Cleveland (SM) Hammonds Ledner (c) r 410 (557) Henri- etta (SM) Hammonds Lewis (c; Millie) 5 h 410 (557) Henrietta (SM) Hampshire Frank (c; Mary) lab h 905 Fort Hill Hampshire Mary (c) emp Barfield Feed Mills r 905 Fort Hill Hampton Annie Bell (c) cook H H Headden r Columbus rd RD 2 Hampton Chas (c) lab Cherokee Brick Co r 360 Elm Hampton Clifford (c; Pearl) 8 lab h 401 (301) Waterville rd Hampton Drunell (c) r 208 (306) Elizabeth (SM) Hampton Eug (c; Mattie) 5 h 208 (306) Elizabeth (SM) Hampton Florence (c) cook E E Bateman r 81 Wylie Hampton Hattie (c) r 120 (117) Bell Hampton Henry (c; Geneva) emp So Ry h 414 Curd (SM) Hampton Henry (c; Mattie) (o) gro 205 4th (V) h 272 3d (V) Hampton Jane (c) 1 r 401 Charles Hampton Lillie M (c) dom r 120 (117) Bell Hampton Mary (c) r 126 4th (V) Hampton Mattie (c) 3 cook h 4 (904) Clay- ton (V) Hampton Mattie (c) emp Snows Ldry r 208 (306) Elizabeth (SM) Hampton Minnie (wid P G) 2 h 397 Belmont Hampton Nora (c; Lila M) 1 dom h 106 (21) n Holt Hampton Preston G Jr emp C of Ga Ry r 397 Belmont Hampton Reliford (c; Carrie) 1 h 120 (117) Bell Hampton Susan (c; wid Wade) h 123 (121) Tatnall Hampton Susie (c) r 272 3d (V) Hampton Quincy (c; Florence) 2 h 133 Wilder (SM) Hamrick Horace C (Ida E) (o) slsmn J Lafay- ette Davis h 107 Napier Hamrick Horace C Jr sta opr Amoco Serv Sta r 107 Napier Hamrick Raymond C emp Macon Evening News r 107 Napier Hamsley James W (Ollie) r 310 Cedar (SM) HANBERRY RICHD L (Beulah G) 2 (Holt & Hanberry) h 808 Napier--tel 4954-W Hancock Ada student r 107 Ninadell dr Hancock Alf J (Linda) r 869 Mulberry Hancock Clarence H (Bertha J) 1 (o) engr Pump Co No 6 h 421 Montpelier Hancock David E (Bessie) 2 mstr mech Car- ling Tile Co h 107 Ninadell dr Hancock Edith (Mrs O A) sten E S Davis r 120 Magnolia Hancock Ernest H slsmn Richardson Whol Prod Co r 459 New Hancock Hilda sten FERA r 613 Orange apt 4 Hancock J Inez opr So Bell Tel Co r 459 New Hancock Jesse (c; Sally) 1 (o) cranker C of Ga Ry h 598 (110) Norris Hancock Jesse M (Cora) 1 (o) emp C of Ga Ry h 121 Charles 1935 Macon City Directory J559 Hancock John L (Ola) 1 h 459 New Hanks Mitchell (c; Roberta) 2 lab i 212 Hancock John M (Pearl) 1 (o) lawyer 1 Wash- Yates al ington bldg h 315 Johnson Hanks Sidney (c) hlpr G Bernd Co r 120 Hancock John M Jr; student r 315 Johnson Powell Hancock John W (Emilie) (Bibb Printing Co) Hanks Viola (c) maid Central Hotel r 120 h 1121 Walnut Powell Hancock John W Jr emp Bibb Printing Co r Hann Hazel (c) maid T M Jones 1121 Walnut Hanna Hugh G (Leone) h 811 Poplar apt 4 Hancock Lawrence (Rose) agt Bankers H&L Hanna Leone (Mrs H G) slswn Union Dry Ins Co r 712 1st Gds Co r 811 Poplar apt 4 Hancock M A slsmn Nu-Icy Btlg Co h 613 Hannah Ruth (c) smstrs h 501 Fulton (EM) Orange apt 4 Hanner Minnie Mrs sten Toole Furn Co r 759 Hancock Mamie r 613 Orange apt 4 Pine Hancock Mirian W student r 459 New Hanse Carroll F (Gladys) 3 elk FERA r 804 2d Hancock Oris A (Edith) 2 h 120 Magnolia Hanse Geo A (Nellie D) (o) elk C of Ga Ry Hancock Sidney L student r 315 Johnson h 804 2d Hancock Theodosia (wid Green) r 121 Charles Hanse Lee A (Zona) electrn Ingleside Elec Co Hancock Wilburn C (Mary) plmbr Geo F r 101 Highland (NH) Yetter Inc res Lizella Ga Hansel Sami (c) lab So Crate & Veneer Co r Hancock Wm H (Louise) 4 (o) bkpr S Jones 370 Flanders Co h 124 Pinson (SM) Hansford Abner M emp C of Ga Ry Hancock Wm L (Dessie) 2 Warper Bibb Mfg Hansford Louis O emp C of Ga Ry Co h 600 Hill Crest rd Hansford Theo (c) emp Bibb Mfg Co Hand Agnes (Mrs Jefferson) winder Bibb Mfg Hanson A Sidney (Bessie L) 2 (o) mgr South- Co r 852 Elm land Knitting Mills h 2503 Forsyth rd Hand Deborah (c) maid J E King Hanson Bernice (c) 1 r 587 (20) Siam Hand Dempsey C (c) delmn Farmers Trading Hanson Corinne r 409 Elm Post Hanson Frank hlpr r 409 Elm Hand Eva (c) nurse r 240 4th (V) Hanson Geo W hlpr r 409 Elm Hand Jefferson (Agnes) 3 emp Bibb Mfg Co Hanson Hazel L student r 308 Cherokee h 852 Elm Hanson James W (Jennie L) (o) genl mgr Hand Joseph emp So Stages r Central Hotel Southland Knitting Mills Inc h 426 Forsyth Hand Lee (c; Dolly) emp Kinnett Odom Ice & Hanson Lemuel r 409 Elm Coal Co r 710 Ash Hanson Robt (Mable) 4 h 409 Elm Hand Leone E nurse Macon Hosp r do Hanson Wesley L (Nettie) (o) vp Southland Hand Mercie D (c) dom r 258 2d (U) Knitting Mills Inc h 308 Cherokee Hand Pearl (c) cook R L McKenney h 85 (130) Happ Bros Co (L M & Pinkus Happ, Morris Forest (V) Michael) clothing mfrs 674 Broadway Hand Thos (c) tr dr Buck Ice & Coal Co Happ Frank M traffic mgr Carling Tile Co r Hand Thos O (Kath) cash Morgan & Morgan 811 Poplar apt 16 Ins Agcy h 559 Orange apt 4 Happ Frank R (Alma) 1 (o) pres Art Furn Hand Twymer (c; Willie) emp Dunlap Roofing Mfg Co h 908 Vineville Co h 138 Pecan Happ Frank R Jr student r 908 Vineville (V) Hand Walker (c; Mamie) 2 (o) farmer h 258 Happ Josephine T student r 904 Vineville (V) 2d (U) Happ Lee M (Tatum) 1 (o) (Happ Bros Co) Handley Clara (wid D M) 2 h 2602 2d h 904 Vineville (V) Handley Eliz (Mrs M L) waitress Woolworth's Happ Pinkus (Marion) (Happ Bros Co) r r 115 Rose pk Hotel Dempsey Handley Frances r 2602 2d Handley Geo D (Martha) 1 tr dr Atlantic Ice & Coal Co h 128 Ell (SM) Happoldt Bessie (c) opr Adams Mfg Co h 1120 Walnut Happoldt Chas E (Madelene) 2 barber Flynt Handley Louise (wid J A) r 120 Grady Handley Melvin L (Eliz) churnmn Swift & Co Barber Shop h 131 Tenney (SM) Haralson Ethel (Mrs J C) spinner Bibb Mfg r 115 Rose pk Handley Robt D (Minnie L) 2 mach C of Ga Ry h 207 Heard (SM) Co r 202 Mercer Haralson James V (Alice) 1 exp msngr h 116 Ponce de Leon (SM) Handy Geo gro 268 Main (EM) h 114 Pearce Handy Gertrude emp Carling Tile Co r 114 Pearce Haralson Jesse C (Ethel) h 202 Mercer (B) Haralson Mary L r 105 Crumps Park (CP) Haralson Perry F (Lula) 1 h 105 Crumps Handy Josephine emp Carling Tile Co r 114 Pearce Park (CP) Harbert Fredk (Ruth) 3 slsmn Sparks Special- Handy Katrina emp Carling Tile Co ty Co h 202 Henry (Lynmore) Handy Mamie Mrs 1 elk Geo Handy r 114 Pearce Harbin Dewey (Mae) 3 hlpr h 1133 Walnut Harbour C Byrd (Mary) 4 pastor First St ME Hanes (See also Haines) Ch h 861 1st Hanes Gussie r 17 (67) Mill Harbour Luther (c; Frances) h 126 (22) Hanes Sami R (Emma) 1 tex wkr Willingham Tinsley la Mills h 17 (67) Mill Hardaway Madge elk Mrs Ernest K Johnson Hanks Anna (c) lndrs h 841 Main (EMj r 321 Montpelier Hanks Jefferson (c; Viola) hlpr G Bernd Co h 120 Powell Hanks John (c; Rosebud) hlpr G Bernd Co h 619 Shoals al Hanks Lester F (Mary K) h 153 Magnolia Hardaway R Gordon (Lillian K) elk Mrs Ernest K Johnson r 321 Montpelier Hardaway Ralph L barber Roy W Long r 321 Montpelier Hanks Lizzie (c) maid Mrs Mary Gleton h 238 Hardaway Ruth W slswn S H Kress Co r 321 Calhoun Montpelier Hanks Lot (c) lab r 17 (6) Paradise al Hardeman B A (c) emp Jeffreys-McElrath Hanks Lucy (c) h 113 Shoals la Mfg Co 260 Baldwin's and Telegraph's Hardeman Barbara N sten A S Hatcher Co r 106 Clisby pi Hardeman Building 105 Cotton Hardeman Callie M (c) dom S A Elkan r 607 Center Hardeman Columbus (c; Berta M) 2 lab h 108 Tindall (SM) Hardeman Daisy I (wid W G) r 114 Clay- ton (V) Hardeman Eva (c) 1 maid Maude G Comer r 28 (528) Clayton (V) Hardeman Frank S Jr teller City Bk & Trust Co r 104 Hill Crest Hardeman G G Co G G Hardeman pres I L Domingos sec treas real est & genl ins 563 Mulberry Hardeman Geo W (Emma) batterymn Stewart Oil Co h 101 Edna pi (LCHts) Hardeman Giles G (o) ptres G G Hardeman Co h 305 Bond Hardeman Gordon I (Mamie) (o) sec-treas So Western RRCoh 106 Clisby pi Hardeman Jesse lab So Crate & Veneer Co Hardeman John W (Irene) h 388 Morgan Hardeman John W Jr (Grade) 2 opr Happ Bros Co r 388 Morgan Hardeman Joseph student r 388 Morgan Hardeman Lulu h 340 Hardeman Hardeman Margt slswn Burden Smith & Co r 106 Hill Crest Hardeman Nell student r 204 Napier Hardeman Prentice (c) student r 125 Forest (V) Hardeman Robt H (Bessie M) (o) slsmn Standard Oil Co h 1508 Vineville (V) Hardeman Robt U (Nell) trav slsmn h 204 Napier Hardeman Theo (c; Maude) lab Willingham S&D Co h 160 Sycamore (V) Hardeman Wm G (Ruth R) 1 coir G G Hardeman Co r 114 Clayton (V) Harden Amos (c; Annie) 1 lab Willingham S&D Co h 224 4th (V) Harden Blanche tex wkr Bibb Mfg Co h 1028 2d Harden Cora Mrs r 24 (87) Mill Harden Geo (c; Georgia) 5 emp J W McCook Lbr Co h 315 Dure (U) Harden Geo (c; Kathrine) 1 lab r 105 Drews Qtrs Harden Gilbert (c; Eliza) 1 emp Cherokee Brick Co h 112 Edgewood Harden Grace (c) r 210 Turpin Harden Hennie Mrs 5 r 105 (11) Myrtle (EM) Harden Henry (c; Hattie) 5 lab h 321 Dure (U) Harden J Henry (Leona) emp Bibb Mfg Co h 234 Jackson Harden Jack student r 856 Orange Harden John (Mae) 2 h 856 Orange Harden Kathleen (c) maid Rebecca Ard Harden Lateefa r 1028 2d Harden Lena (c) cook r 102 (404) Randall la Harden Lena tex wkr r 121 Roff Home Harden Leona (Mrs J H) speeder hd Bibb Mfg Co r 234 Jackson Harden Lillie (c) (o) dom h 105 (141) Richard Harden M N ins agt r 103 3d Harden Mae (Mrs John) opr Happ Bros r 856 Orange Harden Margt (c) maid E R Hearin r 311 Dure (U) Harden Mary (c) 1 r 154 Ernest la Harden Mattie Mrs spinner Bibb Mfg Co Harden Milton (c) lab Willingham S&D Co r 149 Sycamore Harden Oscar speeder hd Bibb Mfg Co Harden Ralph (Helen) dept formn Chapman's Garage Harden Rita (wid M W) 1 h 121 Roff Home Harden Timothy (Mary E) 3 (o) dentist 511 Bibb bldg h 208 Buford pi (V) Harden W Grady (Lillie) tex wkr r 121 Roff Home Harden Wm H (Amanda) 1 (Harden Ice Sta) h 1028 2d Harden Willie L (c) r 164 5th Hardigree Beatrice (Mrs Chas) winder Bibb Mfg Co r 123 Peachtree Hardigree Chas (Beatrice) 1 slsmn Watkins Co r 123 Peachtree Hardin Aline lawyer r 1218 Ash Hardin Cecil (Ruby) lab r 125 Willingham Hardin Ella (c; George) cook C S Thurman Hardin Ernest H (Frances D) bkpr Macon Teleg Pub Co h 184 English Hardin Frances D (Mrs Ernest H) bkpr Steve M Solomon r 184 English Hardin Geo S (Gertrude) gro 504 Pio Nono h 650 do Hardin Ila (Mrs W H) 3 r 117 Virginia Hardin Marcus N agt Am Nat Ins Co r 115 3d Hardin Mattie Lee (Mrs Oscar) tex wkr Bibb Mfg Co r 113% Willingham Hardin Oscar (Mattie Lee) tex wkr Bibb Mfg Co h 113% Willingham Hardin R T emp Greyhound Lines r Central Hotel Harding Moses (c) emp r 717 3d (V) Harding Steph (c; Lola) tr dr Willingham S&D Co h 717 3d (V) Hardison Chas H (Kate) r 470 Orange Hardison Dudley H (Pauline) 1 emp Art Furn Co r 51 Arlington pi Hardison E Woodrow dr Yellow Cab Co r 251 Jeff Davis Hardison Edna slswn S H Kress Co r 207 (195) Henry (Lynmore) Hardison Ellen (wid Homer) 2 h 207 (195) Henry (Lynmore) Hardison Florida (Mrs G O) bkpr A S Hatcher Co r 732 Napier Hardison Geneva (c) cook K R Slocum r 104 Randall la Hardison Geo O (Florida S) slsmn A S Hatcher Co h 732 Napier Hardison Henry C (Evelyn) atndt Power Oil Co h 317 Beech Hardison Jesse (c) lab C of Ga Ry r 110 Harris la Hardison Nell r 207 (195) Henry (Lynmore) Hardison R Cliff (Minnie) 2 h 251 Jeff Davis (SM) Hardison Robt (c) porter G Bernd Co r 104 Randall la Hardman Horace E pharm r 654 Vineville (V) Hardman Margt Mrs nurse City Bd of Health r RD 2 Columbus rd Hardman S Thos ins agt Liberty Nat Life Ins Co r 755 Cherry Hardick Oscar (c) pastor Jones County r 152 Lincoln (V) Hardwell Thos (c; Lillie) plstr h 102 (648) Rockhill la Hardwell Wm (c) tailor r 102 (648) Rockhill la Hardwick Callie Mrs 3 h 663 Walnut Hardwick D Frank (Edith G) 1 slsmn Burden Smith & Co h 318 Orange Hardwick Frank (c) tr dr Yates & Tabor Co r 328 Madison (V) Hardwick Iola (c) 1 emp Central Hotel r 220 Lee (EM) Hardwick James (c) r 716 Hawthorne Hardwick Kelly B hlpr r 663 Walnut Hardwick Robbie (c) h 328 Madison (V) Hardwick Sophie (c) r 716 Hawthorne 1935 Macon City Directory 261 Hardy Aleen (Mrs C G) tel opr FERA r 817 Poplar apt 1 Hardy Alva elk C of Ga Ry r 129 (105) Charles Hardy Augustus B lab r 2218 2d Hardy Bobby student r 852 Orange Hardy Curtis G (Aleen) h 817 Poplar apt Hardy Delree (c) h 123 (9) Fulton la Hardy Dora B instr Kaigler's Business College r 852 Orange Hardy Dorothy r 110 Reese Hardy Dorothy (Mrs H W) dept mgr Burden Smith & Co r 2480 Broadway Hardy Eug G sec Citizens & So Nat Bk r 322 Buford pi (V) Hardy Frances (c) r 363 Hazel Hardy Fredk C (o) serv dept Burden Smith & Co h 322 Buford pi (V) Hardy Geo W (Velma) 1 dr T&T Pkg Co r 1674 3d Hardy Gilbert (c) lab Cherokee Brick Co Hardy James C (Agnes) 1 hlpr City Scavenger Dept h 1801 3d Hardy Jane (c) r 608 (595) Cowan Hardy John B (Tera) elk C of Ga Ry h 137 Piedmont (SM) Hardy Lucile r 129 (105) Charles Hardy Mona (c) r 341 Madison (V) Hardy Nathl (e) r 341 Madison (V) Hardy Pauline slswn H L Green & Co r 754 Cherry Hardy Robt C (Annie M) trav slsmn h 852 Orange Hardy Rufus E (Rosalee) 2 lab h 512 Ogle- thorpe Hardy Sarah A (wid J T) h 129 (105) Charles Hardy Wm (c) emp Gills Bakery r 101 Forest (V) Hardy Wm (c) hlpr Standard Oil Co Hardy Wm C h 110 Reese Hardy Wm H (Sallie) buyer T&T Pkg Co res Skipperton Ga Hargan Lonnie asst mgr Federal Transient Bur r 504 Plum Hargrove A Douglas mech City r 817 Poplar apt 2 Hargrove Anne L Mrs 1 cash Mitchell & Wil- liams Co r 855 2d Hargrove Clara N tchr Lanier High Sch for Girls r 180 English Hargrove Ebb W auto mech Roy Chambliss r 357 1st Hargrove Elwyn r 180 English Hargrove Herman solr Hill Dry Cleaning Co r 180 English Hargrove Josephine (c) 2 r 152 Madison (V) Hargrove Lois student r 180 English Hargrove Madge C (wid C M) 3 slswn J C Penny Co r 118 Lamar (V) Hargrove Melvina (c) maid J A Knott r 254 Madison (V) Hargrove Sennie (c) r 254 Madison (V) Hargrove Wm (c; Leola) jan Georgian Terrace Apts h 254 Madison (V) Hargrove Wm (c) lab So Ry r 162 Elm Hargrove Wm M (Clara G) slsmn Met Life Ins Co h 180 English Harkins Esther H (wid J D) r 615 Duncan Harkless Alma (c) student r 801 (814) Cowan Harkless Bessie (c) carder Bibb Mfg Co r 801 (814) Cowan Harkless Chas (c; Corinne) 6 emp City h 414 Short (EM) Harkless Geo (c) lab C of Ga Ry r 611 Fort Hill Harkless Hattie (c) carder Bibb Mfg Co Harkless Ida (c) h 801 (814) Cowan Harkless R L (c) r 303 Womack Harmon Fred hlpr Willingham S&D Co 538 Telfair Harmon Geo F r 219 High Harmon James A (Mamie) (o) pastor Centen- ary ME Ch h 219 High Harmony Baptist Ch (c) J T Davis pastor 330 2d (V) Harmount Edwin H (Ida Mae) pntr So RR h 281 Rutherford (SM) Harold Ossie (c) 1 r 917 Edgewood Harp Christy M student r 777 Courtland Harp General M serv sta mgr Gulf Refining Co r 118 Rogers (V) Harp Gladys (c) cook W R Melton Harp Mary E (c) maid G W Alexander r 937 Montpelier Harp Melvin (Erma) 2 (o) supt Maxwell Bros Inc h 777 Courtland Harp Wm (c) r 202 3d (U) Harpe Janie M (c) student r 102 May (U) Harpe Lewis (c; Hattie) 6 jan Huckabee Auto Co h 102 May (U) Harpe Wm (c; Doris) lab h 206 (2) Tatnall la Harper Aaron D (Mary) 3 (o) car repr So Ry h .300 Mikado Harper Abr (c; Carrie) 1 dr Colored Taxi Co h 528 Forsyth Harper Amanda (c) maid J J Faircloth r 653 Oglethorpe Harper Arth (c; Clevelee) lab r 528 Forsyth Harper Bernice emp Atlantic Mills r 30 Atlantic Village Harper Bertha (c) emp Independent Ldry Co Harper Blanche r 168 Spring Harper Clarence B r 902 Orange Harper Claude emp Willingham S&D Co r 600 (356) Woolfoik Harper Claudia B (c) clnr Bibb Mfg Co Harper Cornelius B (Lena R) h 902 Orange Harper Daisy (c) cook A B Donnan r 138 Tharpe Harper Elijah (c) lab r 13 (3) Paradise al Harper Emma (c) cook J S Schofield Jr r 208 (122) Virgin la Harper Eunice elocution tchr 140 Georgia r do Harper Eva (c) maid r 30 Macon (EM) Harper Florence elk Wesleyan Conservatory Harper Frank r 109 Stratton Harper Frank (c) h 4 Franklin St la Harper Frank R (Ezelle) 5 blrmkr So Ry h 252 (253) School Harper H Grady (Flossie M) 3 (Harper's Ga- rage) h 3500 Houston Harper Hansel L (Rachel) 2 (o) mach Taylor Iron Wks h 249 Oakland Harper Homer emp Middle Ga Tourist Camp r 3917 Houston Harper Janie (c) clnr Bibb Mfg Co r 138 Tharpe Harper John H (Mary L) 2 stm shovel opr r 3033 Houston Harper John T (Hattie) 1 h 109 Stratton Harper Joseph (c) r 528 Forsyth Harper Jos B (Annie) (o) ins rep So Bell Tel Co h 437 American blvd Harper Joseph L r 4007 (4099) Houston Harper Joseph S tr dr Economy Dry Cleaning Co r 168 Spring Harper Lee (c; Mattie M) lab So Crate & Ve- neer Co h 484 Chestnut Harper Leila Mrs smstrs New York Clnrs r 130 (126) Grady Harper Leon (Edna) 1 emp Art Furn Mfg Co r 109 Richmond Harper Leonard emp Art Furn Mfg Co r 130 (126) Grady Harper Lewis H (Plessye W) supt C of Ga Ry Creosote Plant h 1906 Vineville (V) Baldwin's and Telegraph's Harper Lois r 4007 (4099) Houston Harrell Odessa opr Happ Bros Co r 202 Cole Harper Louise cash Burden Smith & Co r 902 Harrell Ruby (wid J W) r 415 Vineville (V) Orange Harper Lucille (wid E C) 2 r'7l5 Pine Harper Lucy (c) cook; T H Hall r 155 2d (V) Harrell Sandy B (Zella M) (o) phys 605% Cherry h 702 Mikado Harrell Susie M (c) cook r 301 Norris Harper Mamie M (wid J B) h 108 2d Harrell Thos B (Francina) teller Citizens & Harper Margt (c) r 439 (443) Chestnut So Nat Bk r 304 Bond Harper Martha (c) dom J D Corr r 714 Hazel Harrell W Lamar (Caroline) 1 credit mgr R A Harper Mary (c) cook J B Hill r 217 (524) McCord Mtr Co r 527 Georgia 3d (B) Harper Mattie (c) r 528 Forsyth Harrell Wesley (c; Mattie) 1 lab h 301 Norris Harrell Wm L (c; Julia) pastor h 113 (167) Harper Max W r 437 American blvd DeBorde (SM) Harper Mollie (Mrs L L) h 30 Atlantic Village Harrelson O Homer (Bessie) 2 barber East Harper Mollie (c) clnr Bibb Mfg Co Harper Myrtice tex wkr Atlantic Mill r 236 Rolf Home Harper Nathan (c) emp Jeffreys-McElrath Mfg Co Harper Nora B (wid J S) nurse 300 Mikado Side Barber Shop h 308 Peachtree Harrington Ernest (c; Rosa) 5 lab Freeman- Dent-Sullivan Co h 224 Tindall (SM) Harrington Evelyn cash Rialto Theatre r 316 Spring Harrington Fredk elk Mrs Beulah Poppell r r do Harper Raburn r 30 Atlantic 128 Steel Harrington John D (Nadine) creeler Bibb Mfg Harper Ralph (Ruth) 2 (o) mech Yellow Cab Co h 11 Bellevue rd Co h 401 American blvd Harrington John T firemn Truck Co No 2 h Harper Raymond J (Cecil M) 1 emp Art Furn 432 Carling Mfg Co r 115 Grady Harrington John W (c; Eula) 3 tr dr Burney Harper Robt (c; Bessie M) 1 emp Jeffreys-Mc- Bros Co h 230 Jefferson Elrath Mfg Co r 515 Forsyth Harrington Lora Mrs 3 h 128 Steele Harper Ruth (Mrs Ralph) emp Happ Bros Co Harrington Mae opr Happ Bros Co r 1537 3d r 401 American blvd Harrington Robt F (Lillie C) 1 wtchmn W S Harper Stella (c) 4 r 13 (3) Paradise al Dickey Clay Mfg Co h 326 Hanson (SM) Harper Thelma (wid W E) 2 tex wkr Atlantic Harrington Roy elk The Great A&P Tea Co r Mill h 236 Roff Home Harper Theo D (c; Hattie) h 243 Chestnut 326 Hanson Harrington W T emp C of Ga Ry Harper Tobias (c; Janie) 5 h 138 Tharpe Harrington Wm r 432 Carling Harper Valley L (c) dishwasher Cozy Corner Harrington Wm M hlpr So Ry r 316 Spring Cafe r 5 Franklin St la Harrington Wm T (Cora M) 3 shoe repr Harper Walter (Josephine) r 109 Stratton Gray's Shoe Shop h 1537 3d Harper Whiggam L (c) r 243 Chestnut Harris Ada M (wid J W) elk Burden-Smith Co Harper Wm (c) emp Jeffreys-McElrath Mfg Co h 809 y2 Pine r 209 Green HARRIS ALBERT G (Eugenia Pou) 3 Pastor Harper Wm C elk r 715 Pine First Presbyterian Ch, h 112 Buford pi-- Harper Wm T r 4007 (4099) Houston tel 2025 Harper Wm W (Mary F) 3 engr C of Ga Ry h 4007 (4099) Houston Harper Woodrow r 4007 (4099) Houston Harper's Garage (H G Harper) auto reprs 3110 Houston Harrell Agnes (c) dom P W Jones Harrell Ceila Mrs 2 h 548 Ocmulgee Harrell Daisy K r 115 Habersham Harrell Eason H (Mamie) 1 tr dr h 122 Log Cabin dr Harrell Emory S (o) br mgr Rogers Inc h 115 Habersham Harrell Eunice (c) (o) h 236 Powell Harrell Everett L (Sallie M) 3 cond MD&SRR h 2346 (r) Forsyth rd Harrell Frankie slswn S H Kress Co r 115 Habersham Harrell Glover F (Carolyn) 1 teller First Nat Bk & Trust Co r 415 Vineville Harrell Hattie (wid J C) slswn Singer Sewing Mach Co r 821 Cherry Harrell Helen V r 115 Habersham Harrell Henry (c; Annie P) emp Atlantic Mills h 65 (305) Forest (V) Harrell Henry G dairymn J T Smith r 1231 College Harrell J Henry (Ellie) 1 pntr h 1231 College Harrell Jack E (Marjorie) 2 opr Happ Bros Co r 615 Oglethorpe Harrell James (c; Phyllis) 4 lab C of Ga Ry h 146 (206) e Ell Harrell Lewis F atndt Tank Car Serv Sta r 122 Log Cabin dr Harrell Mamie (c) r 771 Ash Harrell Marjorie (Mrs J E) emp Happ Bros Co r 615 Oglethorpe Harris Albert J (Myrtice H) 1 slsmn Macon Paper Co r 405 Duncan Harris Alberta (c) r 1331 Broadway Harris Alberta (c) cook F W Farmer r 254 4th (V) Harris Alice (c) 1 cook J E Yates h 436 Lawton Harris Alice (c) cook L C Rader r 314 Pat- terson Harris Alonzo (Mary) 3 slsmn r 2908 For- syth rd Harris Amanda (c) dom H D Cutter r 508 Broad Harris Amanda (c) 3 dom h 219 Hawkins Harris Andrew L (Eliza) (o) meats 167 5th h 322 New Harris Anna (c) 2 ldry wkr r 454 Hawthorne Harris Annie (wid G L) smstrs r 605 Forsyth Harris Annie B (c) 3 emp Bibb Mfg Co r 298 (651) Womack Harris Argo (c) maid Hotel Lanier h 502 O'Hara la Harris Arth W slsmn Ga Power Co Harris Atlee M (Callie) 6 h 815 Broad Harris Beatrice (c) hlpr Bibb Mfg Co Harris Benj (c) 5 lab Miller & Martin Wood Yd h 1129 Napier Harris Benj F (Mary) 2 emp Bibb Mfg Co h 859 Elm Harris Beretha (c) maid r 528 Cotton Harris Bertha (c) h 206 Elliott Harris Bessie (c) Indrs Crescent Ldry r 813 Elbert Harris Bessie (c) maid W C Kilpatrick Harris C M emp Jeffreys-McElrath Mfg Co Harris Carrie L (c) dom h 96 Harris la 1935 Macon City Directory 263 Harris Celia (c) maid Harold Berliner Harris Chas (c) emp So Ry r 143 Evergreen la Harris Chas (c; Belle) emp J W Shine h 4 Violet Harris Chas (c) lab C of Ga Ry r 298 (651) Womack Harris Chas (c) porter Ry Exp Agcy r 330 Jackson Harris Chas A (Ella) (o) h end Mill Harris Chas A (Mattie) h 811 Poplar apt 18 Harris Chas A Jr sta atndt D C Harris Jr r 811 Poplar apt 18 Harris Chas O (Lucile) 3 emp Central S&D Co h 1807 Broadway Harris Chester doffer Bib Mfg Co r 859 Elm Harris Clara (c) cook Mrs Jean C West r 108 Ruby Harris Clarence (c) carp Zack Williams r 668 Douglas (V) Harris Clarence (c) pntr r 407 Chestnut Harris Clem (c; Lucy M) r 103 2d (B) Harris Clinton (c; Georgia) 5 lbr h 339 Maple Harris Danl (c; Ola M) lab h 1131 Broad Harris Danl (c; Mamie) 1 (o) lab C of Ga Ry h 308 4th (V) Harris Danl D (Romalda M) 1 (o) teller Citi- zens & So Nat Bk h 425 (417) Forest (V) Harris David C Jr serv sta 519 Poplar h 706 Napier Harris Dorothy sten Macon Sav Bk r 422 Spring Harris E Ernest emp C of Ga Ry Harris Eddie M (c) r 506 Martha Harris Edison (c) porter W M H Weaver Harris Elbert tex wkr r 1024 2d Harris Elijah (c; Patience) h 102 Walls al Harris Eliz r 117 Buena Vista Harris Eliz I mus tchr Pearl Stephens Sch r 651 Forsyth Harris Emily student r 202 Georgia ter Harris Emmett B (Lillie) mgr Cherry St Serv Sta h 452 College apt 1 Harris Ernest L (Evelyn) 3 h 313 Giles Harris Eug (c) emp Dessau Realty & Ins Co r 1331 Broadway Harris Eugenia (c) r 254 4th (V) Harris Eva (wid Jacob) (o) h 720 2d Harris Evelyn (c) cook P J Doster Harris Evelyn spooler Bibb Mfg Co r 7 Bibb Harris Evelyn sten Southland Coffee Co r 809% Pine Harris Fannie (c) lndrs h 227 (334) Farga- son (V) Harris Felton (c) lab r 202 (423) Plummers a? Harris Francis (c) r 439 Madison (V) Harris Frank (c; Lois) 1 lab r 800 (115) Colquitt Harris Frank H (Ethel) 3 tex wkr h 234 (r) Roff Home Harris Fredk (c; Viola) h 519 Gilmer Harris Gabe (c) lab C of Ga Ry Harris Geo (c; Ella) 1 h 102 (501) Campbell (SM) Harris Geo (c; Frances) 5 h 201 Neel (U) Harris Geo (c) emp Chas Harris r 121 Douglas (SM) Harris Geo M r end Mill Harris Gladys (c) 3 r 726 Hazel Harris Gladys Mrs emp Bibb Mfg Co Harris Greely (c; Loudella) (o) emp Chero- kee Brick Yd h 301 Edgewood Harris H Earl (Eula) 2 (o) (Lyon, Harris & Brooks) h 105 Carlisle Harris Harvey V (Janie) 1 emp C of Ga Ry h 331 Winship Harris Henry (c) lab Atlantic Ice & Coal Co h 34 Cheatham al Harris Henry (Rosalind) 1 (o) mgr Morris Harris Ins Agcy h 248 (119) Stanislaus cir Harris Hester (wid G L) r 853 Hemlock Harris Hollis S sta agt C of Ga Ry Wesleyan Sta r 393 Orange Harris Homer (c; Alberta) carp h 406 (465) Alabama (SM) Harris Houston (c) lab C of Ga Ry r 424 Lawton Harris Ida (wid Danl) r 858 Elm Harris Ida (Mrs W A) opr Happ Bros Co r 437 Ross Harris Ida P (c) maid Maxwell Bros Furn Co r 122 e Ell Harris J B (c; Vada) orderly Macon Hosp r 120 Green Harris J Paul carder Bibb Mfg Co r 7 Bibb Harris James J emp C of Ga Ry Harris James T (Corine) 1 (o) emp C of Ga Ry h 206 Kemper Harris Janie L (wid H K) emp Bibb Mfg Co h 419 Edgewood Harris John (c; Lucy) 2 emp Atlantic Ice & Coal Co h 206 (705) Henderson (SM) Harris John (c; Minnie) lab City Scavenger Dept h 24 7th Harris John A (Ora) 2 trav slsmn h 7 Rose pi HARRIS JOHN B (Louise E) (Harris, Rus- sell, Popper & Weaver) h 611 Vineville-- tel 1235 Harris John J (Helen) 3 mech C of Ga Ry h 200 College pi Harris John L (Gladys), 2 (o) knitter Bibb Mfg Co h 202 Georgia ter Harris Joseph (c; Mary) 4 h 231 Turpin Harris Joseph J (Lillie) 2 mach h 1024 2d Harris Judge B (c) porter Am Optical Co r 718 3d Harris Julia (c) h 424 Lawton Harris Julia (c) r 201 Lynwood (V) Harris Kenneth R student r 811 Poplar apt 18 Harris L B tex wkr Bibb Mfg Co r 6 Schell (EM) Harris L Olin emp C of Ga Ry Harris Laura (c) (o) h 210 3d (V) Harris Leola (c) maid Mrs Fannilu Scott r 254 Madison Harris Leroy elk C A Couch r 234 (r) Roff Home Harris Leroy metal wkr W A Hammond & Son r 1335 3d Harris Lewis A (c; Julia) 2 atndt Bob Stevens Serv Sta r 205 Orange Harris Lillian r 415 Oak Harris Lillie r 204 Georgia ter Harris Lillie (c) 2 h 17 7th Harris Lillie (Mrs E B) sec U S Nat Reemployment Ofc r 452 College apt 1 Harris Lillie M (c) dom R T Mahone h 314 Patterson Harris Loan Co T I Harris Jr Mgr 352 2d Harris Lola (wid Morris) r 248 (119) Stanislaus cir Harris Lonnie O (Irene) 1 emp C of Ga Ry h 437 Ross Harris Louis (c) r 201 Neel (U) Harris Louis (c; Henrietta) elk Crescent Ldry h 820 Ocmulgee Harris Louise (c) r 318 (316) Monroe (V) Harris Lucile (c) r 718 3d (V) Harris Lucius (c; Katie) h 709 Cowan Harris Lucy (c) r 331 Turpin Harris Lula L (wid S E) (o) h 62 Arlington pi Harris Mabel r 234 (r) Roff Home Harris Mabel beauty opr Darling Shops r 247 High Harris Mabel H prin Alex Sch No 2 r 706 Napier m Baldwin's and Telegraph's Harris Mabel S (c) h 298 (651) Womack Harris Mae Mrs winder Bibb Mfg Co Harris Maggie (c) r 254 Madison (V) Harris Maggie (c) r 107 Rose Crest Harris Maria (c) maid 1401 Ridge (I) Harris Marie (c) 1 r 711 Daisy (SM) Harris Marie (c) cook W E Hill r RD 1 Harris Marvin P (Carrie) engr So Ry h 853 Hemlock Harris Mary (c) cook W R Martin Harris Mary (Mrs Benj) spinner Bibb Mfg Co r 859 Elm Harris Mary A Mrs (o) h 811 Napier Harris Matron (c) blpr Roberts Cafeteria' r 528 Cotton Harris Mattie (c) h 220 (27) Hilliard al Harris Mattie (c) cook Mrs Kate M Roberson r 113 (354) Spring la Harris Mattie (c) ldry r 455 Arch Harris Mattie (Mrs P T) pharm Macon Hosp Harris Mattie (Mrs C A) restr 201 Poplar r 811 Poplar apt 18 Harris Monroe slsmn Freeman-Dent-Sullivan Co r 720 2d Harris Morris Insurance Agency Henry Harris mgr genl ins 210 Bibb bldg Harris N Inez r 853 Hemlock Harris Nancy (c) cook Sallie Rabun h 962 Ocmulgee Harris Neal (c; Mary) (o) farmer h 1016 Port Hill Harris Nehemiah (c; Bessie) 2 lab h 611 4th (WH) Harris Norman (c) tr dr Kent & Herin r 316 Walnut Harris Oscar (c; Mabel) 5 lab h 228 Plant (SM) Harris Oscar L (Juanita M) 4 (o) dep sheriff Bibb County h 605 Montpelier Harris Ora H Mrs instr Ethel B Davis Sch of Beauty Culture 7 Rose pi Harris Otis (c) delmn Caseros Gro Store r 528 Cotton Harris P Tilton (Martha) trav slsmn r 108 Cleveland (V) Harris P Tracy elk C P Sheridan r end Mill Harris Parthenia (c) r 217 Chestnut Harris Paul (c; Georgia) 7 tr dr Ry Exp Agcy h 226 Woodliff Harris Percy M Mrs sten Ga Power Co Harris Peter (c; Lizzie) cook Mrs Margt P Hatcher h 204 (100) Virgin la (V) Harris Robt L r 104 Marshall (CP) Harris Romalda M (Mrs D D) elk Murphy Taylor & Ellis r 425 (417) Forest (V) HARRIS, RUSSELL, POPPER & WEAVER (John B and Walter A Harris, Joseph W Pop- per, Henry D Russell and A H S Weaver) Lawyers, 914-18 Ga Casualty bldg--tels 48614862 (See Page 102) Harris Ruth (c) cook r 528 Cotton Harris Ruth (c) maid C P Lucas Harris Sadie (c) tchr County Schs h 439 Madison (V) Harris Sami (c) lab r 439 Madison (V) Harris Sarah c) dom Shirley Hill r 298 (651) Womack Harris Seaborn (e; Mary) lab r 124 1st (U) Harris Selma (c) lab Proctor & Gamble Mfg Co r 615 Ross Harris Seymour (c; Mary) (o) emp Dempsey Hotel h 208 (220) Roye Harris Sidney (c) h 5 (2) Cheatham al Harris T J (c; Argie) 1 h 154 Linden Harris Theo I Jr (Georgia) 1 mgr Harris Loan Co h 360 College apt 4 Harris Thos (c; Nancy) r 215 Telfair Harris Thos (c; Ruth) emp Jeffreys-McElrath Mfg Co r 231 Riley (CP) Harris Thos (c; Nancy) lab r 1021 3d Harris Thos J (Gladys) 1 emp C of Ga Ry h 101 Capitol Harris Ulysses G (c; Ethel) 1 (o) h 529 Flanders Harris Vada (c) cook Chas Damour r 120 Green Harris Vina (c) r 4 Violet Harris Vinie (c) lndrs h 528 Cotton Harris W Floyd (Anna J) 1 printer Macon Teleg Pub Co h 108 Park pi Harris Walter (c) whsemn Macon Paper Co Harris Walter (c; Amanda) farmer h 901 Ballard (EM) Harris Walter (c; Bessie) 1 h 813 Elbert Harris Walter r 234 (r) Roff Home HARRIS WALTER A (Emily W) (o) (Harris, Russell, Popper & Weaver), h 560 College-*tel 1034 Harris Wesley opr Bibb Mfg Co r 204 Georgia ter Harris Wm (e; Annie) 1 h 441 Elbert Harris Wm (c; Carrie) 2 emp C of Ga Ry Creosote Plant h 114 Roff Home Harris Wm (c; Lillie) 4 lab C of Ga Ry h 109 Bay Harris Wm (c; Josie) lab h 110 Henderson (SM) Harris Wm (c; Ethel) 6 lab h 206 Tindall (SM) Harris Wm C (Viola) 5 (o) emp Bibb Mfg Co h 204 Georgia ter Harris Wm H formn Taylor Iron Wks h 1674 3d Harris Willie (c; Mary) 2 lab h 135 e Ell Harris Willie M (c) cook May Lester r 8 Witkowski al Harris Wilmer A (Ida) emp C of Ga Ry h 437 Ross Harrison Addie (c) (o) dom h 103 Empire (V) HARRISON ALF M Sec Yates Motor Co Inc, h 101 Katherine Court Apts, 855 Mulberry-- tel 4120-J Harrison Annie (wid J G) r 1064 Walnut Harrison Annie R opr So Bell Tel Co r 308 American blvd Harrison B Franklin Jr emp Sunshine Creamery r 664 College Harrison B W slsmn Sawyer Coal & Ice Co res Bolingbroke Ga Harrison Benj F (Mary) 2 r 664 College Harrison Bernard J (Lillian) slsmn S G Surgical Sup Co r 131 (224) W Grenada ter Harrison Bill (Lucile) r 711 Orange Harrison D Jewel (Isabelle) h 124 Habersham Harrison Eliz emp Met Life Ins Co r 795 Pio Nono Harrison Emily cash Cherry St Serv Sta Harrison Ethel slswn Union Dry Gds Co r 656 New Harrison Eug T (Minnie P) receiving elk A S Hatcher Co h 207 Washington Harrison Eunice r 813 (819) Pio Nono Harrison Flossie M (Mrs H K) opr So Bell Tel Co r 764 Plum Harrison Frances (wid Julian) x-ray tech The Clinic r 232 Georgia Harrison Geneva Mrs opr Happ Bros r 302 Jones (EM) Harrison Georgiana (c) dom J W Davis Harrison Goodwin student r 308 American blvd Harrison H T slsmn Standard Oil Co res Cross Keys Harrison Horace K (Flossie M) 1 baker Am Bakeries Co h 764 Plum 1935 Macon City Directory 265 Harrison Isabelle (Mrs D J) bkpr Sherwood Lbr Co r 124 Habersham Harrison J Binyon (Dovie) 2 (o) coir Macon Teleg Pub Co h 308 American blvd Harrison J Ralph 2 agt h 871 Orange Harrison J Z farmer F S Royster Guano Co Harrison James C (Susan) mach h 118 Grady Harrison James E soda elk Shelverton-Bayne Drug Co r 656 New Harrison James T hlpr h 1064 Walnut Harrison John B Jr mgr City Finance Co r 308 American blvd Harrison John E (Crisie) asst formn C of Ga Ry h 147 Park pi Harrison John G (Alice) 2 flgmn C of Ga Ry h 813 (819) Pio Nono Harrison John W 2 elk Dunlap-Peeler Hdwe Co h 795 (803) Pio Nono Harrison Joseph K (Annie) h 656 New Harrison Judson J radio opr r 118 Grady Harrison June asst bkpr C D Kinney Co r 106 Del Park Harrison Kath (Mrs W R) opr So Bell Tel Co r 657 Pine Harrison L Holmes tr dr Swift & Co r 224 Georg.a Harrison Leila student r Y W C A 2d Harrison Lewis (Beulah) 1 sheet metal wkr r 1017 2d Harrison Mattie (wid W T) r 130 Willingham Harrison Myrtice opr So Bell Tel Co r 308 American blvd Harrison Pearl H r 731 Ridge (I) Harrison Richd C slsmn A G Rhodes & Son res Bolingbroke Ga Harrison Robt (Ruth) lab' r 758 Cherry Harrison Robt B r 813 (819) Pio Nono Harrison Ruby sec-treas Cornell-Young Co r 401 College apt 4 H Harrison Ruth B (wid J G) (o) 1 matron Mer- cer College Dormitory h 421 Adams Harrison Sarah E (Mrs E T) emp McKesson- Riley r 965 Cherry Harrison Tim student r 147 Park pi Harrison W H chem F S Royster Guano Co Harrison Walter L (c) porter r 103 Empire (V) Harrison Wm waiter Smitty's Barbecue Lunch Harrison Wm R (Kath) slsmn Maxwell Bros Furn Co r 618 Pine Harrison Winifred elk FERA r 813 (819) Pio Nono HARROLD CHAS C (Helen) (o), Phys 210 Doctors Bldg h 550 Orange--Tel 1306 Harrold Chas C Jr student r 550 Orange Harrold Crugar r 214 (290) Hill Crest HARROLD EDW B (Louise C) (o) (Edw B Harrold Co) V P Vineville Improvement Co, h 214 (290) Hill Crest--Tel 3019 HARROLD EDWARD B CO , Pres A 323 Broadway h 143 1st (V) Hatfield Sami E (Vera) 2 agt Am Nat Ins Co S Hatcher Co, h 422 Forsyth--Tel S423-J HATCHER ALBERT S JR (Edyth C) 1, Vp A S Hatcher Co, h 2450 Forsyth rd--Tel 3446-W Hatcher Arth E (Clara) (o) tr dr Sincliar Re- fining Co h 115 (123) Colquitt Hatcher Arth M emp C of Ga Ry r 115 (123) Colquitt Hatcher E Cornelius (Inez) 1 tr dr h 982 (977) Montpelier Hatcher Elmo (Nora) emp McAfee Candy Co h 619 Walnut apt 6 Hatcher Emmett A r 115 (123) Colquitt Hatcher Evelyn student r 315 Carling Hatcher Florence E (Annette) pntr supv C of Ga Ry h 148 Cole Hatcher Fredk E r 148 Cole HATCHER GEO E (Kathleen A) (Mut Ins r 926 Cherry Hathaway Annie (Mrs Orr) opr Happ Bros Co r 750 Walnut Hathaway Danl J (Blanche) slsmn h 401 Col- lege apt 7A Hathaway Lula Mrs r 860 Orange Hathaway Orr (Annie) emp Macon Boat Club h 750 Walnut Hattaway Geo (Eula Mae) 4 tr dr Ga Hwy Exp Inc r 306 Peachtree Hattaway Sarah student r 151 Cole Hattaway Wm C (Myrtle) 1 slsmn Lee Baking Co h 151 Cole Hatterway Charles (Leola) r 553 Elm Hatton Huldah (Mrs W W) opr Happ Bros Co r 315 Shamrock Hatton John student r 315 Shamrock Agcy) Pres Hatcher, Turpin & Hogan Inc., res Rivoli Ga--Tel 4648-W Hatcher Grace R (wid WE) 1 elk County Superior Court h 315 Carling Hatcher Hazel nurse Middle Ga Hosp r do Hatcher John (c; Mary) h 203 3d (U) Hatcher L Louise sch tchr Milledgeville Ga r 620 Log Cabin blvd Hatcher Margt cataloguer Washington Memeroial Library r 319 Hardeman Hatcher Margt P (wid M F) (o) h 319 Hardeman Hatcher Martha L (o) tchr A L Miller High Sch h 252 Appleton Hatcher Myrtle r 303 Cutters Green (EM) Hatton Lorena student r 315 Shamrock Hatton Wm W (Huldah) 2 slsmn h 315 Sham- rock Hattrich Fred H (Nellie) 2 (o) aud Lanier Hotel h 117 Buckingham pi Haugabook Danl (c; Eliz) 3 lab h 606 (109) Colquitt Haugabook Squire (c) h 108 (127) Orchard Haven Ethel (c) emp Bibb Mfg Co h 549 Har- ris Haverfield Margt sten Miller & Lowrey r 415 Georgia Haverfield Margt Mrs h 415 Georgia Haverfield Paul emp Transient Bureau r 415 Georgia Havis Chas emp So Crate & Veneer Co r 554 Hatcher Robt lab Ivey-Turner Ice Cream Co 1st Hatcher Robt (c; Cleo) 2 lab r 98 Key (XT) 111 Havis Ros' e (c) tchr r 210 3d (V) ' ' Baldwin's and Telegraph's Hawes Edw H (c; Susie M) (o) gro 113 (121) Sycamore (V) r do Hawes James (c; Cornelia) 4 porter Idle Hour Nurseries h 1020 Ocmulgee Hawes Julia (c) (Pythian Lunch Hoorn) 503 Pebhle Hawkins Adrienne sten Bankers H & L Ins Co r 231 North Hawkins Allene r 553 Walnut Hawkins Anna M student r 351 Hines ter (V) Hawkins Annie (c) 2 dom r 300 Hawkins Hawkins Annie K (c) 3 Indrs h 402 Crisp Hawkins Belton L (Dessie) 1 hlpr h 553 Wal- nut Hawkins Bessie (c) waitress Union News Co r 455 Chestnut Hawkins Blanche (wid W R) emp Happ Bros Co r 718 Main (EM) Hawkins Buster (c; Ceola) 2 emp Bibb Mfg Co r 328 McClain la Hawkins Carrie (Mrs W A) emp FERA r 476 College apt 2 Hawkins Charlie (c) carp r 335 Hawkins Hawkins Clay student r 710 Broad Hawkins Edw (c) (o) brklyr h 300a Hawkins Hawkins Emma (c) Indrs h 525 Forsyth Hawkins Ernest (c; Mary) h 72 Oliver (SM) Hawkins Ernest (c; Kate) 3 barber 206 (104) Charles h do Hawkins Florence waitress Betsey Ross Cof- fee Shop r 821 Mulberry Hawkins Frances B student r 231 North (NH) Hawkins Frank C r 111 Rogers (V) Hawkins Frank N reporter Macon Telegraph r 351 Hines ter (V) Hawkins Frank T (Nannie) 4 pntr h 289 Rutherford .(SM) Hawkins Nannie (Mrs F T) opr Happ Bros Co r 289 Rutherford Hawkins Geo (c) cook Joe's Crescent Cafe r 121 (21) Williams la Hawkins Geo (c) porter The Reliable Outfit- ters r 455 Chestnut Hawkins Harris elk G' A Couch r 217 2d Hawkins Henrietta (c) h 100 May (U) Hawkins J Walter (Hazel) br mgr Rogers Store Inc h 210 Brentwood Hawkins James (c; Christina) (o) carp h 455 Chestnut Hawkins James M student r 710 Broad Hawkins James W (Alean) 2 slsmn h 117 2d Hawkins Jeanette (c) r 275 3d (V) Hawkins Jessie (c) Indrs h 108 Antioch rd Hawkins John W (Isabelle N) 2 agt Bankers H & L Ins Co h 231 North (NH) Hawkins L Ray elk r 1538 2d Hawkins Laura (c) r 108 Antioch rd Hawkins Lucius R gro 559 Edgewater r 1538 2d Hawkins Mabel (Mrs W W) opr Happ Bros Co r 2004 2d Hawkins Maggie r 1538 2d Hawkins Maggie (c) maid J W Windom r 525 Forsyth Hawkins Mary (c) maid r 72 Oliver (SM) Hawkins Mary V cash Life Ins Co of Va r 351 Hines ter Hawkins Miles W (c; Carrie) (o) h 300 Haw- kins Hawkins Mose (c; Irene) hlpr Kash & Kary Mkt h 311 (313) Jefferson Hawkins Norris r 553 Walnut Hawkins Ola A (wid C R) h 105 Appleton Hawkins Pruden (c) slsmn r 555 Monroe (V) Hawkins Ralph (Mollie) 1 USN h 855 Mulberry apt 205 Hawkins Ralph W (Mary E) (o) dist mgr Life Ins Co of Va h 351 Hines ter (V) Hawkins Rebecca (c) maid Thelma Bowman r 960 Hazel Hawkins Robt D (Pauline) carrier P O h 244 Edna pi (LCHts) Hawkins Robt D asst stock mgr Adams Buchanan Mtr Co r 244 Edna pi Hawkins Sallie (wid E C) r 710 Broad Hawkins Walter M (Eunice) payroll work FERA r 111 Rogers Hawkins Wesley N bkpr Juliette Milling Co r 231 North (NH) Hawkins Wiley (c; Jane) lab h 960 Hazel Hawkins Wilhelmina (c) maid r 541 3d (V) Hawkins Wm (c) r 213 Green Hawkins Wm (c) porter Union News Co r 455 Chestnut Hawkins Wm J (c) r 72 Oliver (SM) Hawkins Wm M (Minnie E) patrolmn CPD h 1116 Oglethorpe Hawkins Wm W (Mabel) 4 barber 2004 2d h do Hawkins Willis A (Carrie) 1 slsmn Goodyear Tire Co h 476 College apt 2 Hawshaw Bertie Lee (c) 2 r 213% Elliott Hawthorne Carrie (wid J B) r 100 Fountain (EM) Hawthorne Hubert H (Fannie R) (o) shop engr C of Ga Ry h 116 Clisby Hawthorne J Lawrence (Ruby) 2 blksmth C of G Ry h 425 Winship Hawthorne James R (Ismay) 8 hlpr h 200 (101) Myrtle (EM) Hawthorne Kath student r 116 Clisby pi Hawthorne Nettie (Mrs W H) emp Bibb Mfg Co r 100 Fountain (EM) Hawthorne Wm H (Nettie) creeler Bibb Mfg Co h 100 Fountain (EM) Hay Eliz r 124 Georgia Hay Park L (Maude S) (o) pres Bankers H & L Ins Co h 124 Georgia Hay Park L Jr (Polly W) 1 vp Bankers H & L Ins Co h 401 College apt 5 C Hay Robt L (Nan L) 2 (o) elk Bankers H & L Ins Co h 325 Buford pi (V) Hayden Cornelia (c) r 302 Green Hayes (see also Hays) Hayes Barber Shop (Y E Hayes) 553 Cherry Hayes Chas G (Dora) supv Farm Credit Adm h 793 Courtland Hayes Clothing Store (Y E Hayes) 553 Cherry Hayes Edw (c; Vera) 1 lab Cherokee Brick Co h 100 1st (WH) Hayes Ernest c; Estella) shpr Bibb Mfg Co h 51 (48) Green's al Hayes Evelyn opr Happ Bros r 530 Washing- ton Hayes Flora L (c) maid Cherry S Lindsey r 905 Elbert (SM) Hayes Harold B (Berta K) (o) mstr mech MD&SRR h Jackson Spring rd (SH) Hayes James (c) delmn Mulberry Mkt h 14 Fordville la Hayes James (c) emp Dempsey Hotel r 417 (450) 3d (V) Hayes Joseph S (Jewel) 3 pastor h 1335 Col- lege Hayes Kath M student r 793 Courtland Hayes Lois (Mrs Dennis) tel opr So Bell Tel Co r 619 Forsyth Hayes Louise (c) r 111 (541) Tinsley la Hayes M Opal elk City of Macon r 793 Court- land Hayes Margt C file elk County Relief Admn r 515 College Hayes R Burton (Hope L) 1 chf elk MDS&SRR r Jackson Spring dr (SH) Hayes Roberta slswn Union Dry Gds Co r 619 Forsyth 1935 Macon City Directory 269 Hayes Royce H student r 793 Courtland Hazelhurst Marie tchr A L Miller High Sch h Hayes Sami L (Minnie L) firemn P O h 221 Dorothy (Lynmore Estates) 559 Orange apt 8 Hazen Frances Mrs 1 dept mgr Dannenberg's Hayes T Dennis (Lois) engr Wesleyan Col r h 133 Nottingham dr 619 Forsyth Hayes Walker (c) emp Swift & Co Oil Mill r 710 Ash Hayes Yeager E (Helen) 1 (Hayes Clo Co; Hayes Barber Shop) h 401 College apt 3 G Haygood Choice S (Mattie) emp Bibb Mfg Co h 764 Oglethorpe Hazlehurst Carrie (Mrs F W) tchr Ga Acad for the Blind r 527 Georgia Hazlehurst David D student r 514 Linden Hazlehurst Frank W (Carrie) (o) (Hazlehurst Veneer Co) h 527 Georgia Hazlehurst R Roger student r 514 Linden Hazlehurst Wm (Edna) (o) asst engr City Bd Haygood Mattie (Mrs C S) spinner Bibb Mfg Co r 764 Oglethorpe Hayles Robt (c) lab O' of Ga Ry Haynes Alex (c; Annie B) 3 h 135 Mitchell of Water Comrs h 514 Linden Hazzard Bernice (c) r 717 Daisy (SM) Hazzard Leon (c) student r 717 Daisy (SM) Hazzard Lessie (c) emp Snow's Ldry r 717 Haynes Annie (c) h 168 (124) Plummer's al Haynes Annie (wid J D) r 135 Roff Home la Daisy (SM) Hazzard Norma (c) student r 717 Daisy (SM) Haynes Arnold H (Clara) 3 pntr h 1116 Ash Hazzard Wm (c; Mamie) 8 h 717 Daisy (SM) Haynes Athel (Annie) 1 pntr r 2091 3d Haynes Carrie (c) student r 438 Chestnut Head Archie J asst cash So Cotton Oil Co r 7 Rose pi Haynes Fannie (wid G W) r 2909 Houston Haynes Henry H (Lennie) pntr h 2091 3d Head Emily student r 106 Ransome (V) Head Geo (c; Katie L) lab h 203 1st (U) Haynes Isabell (c) maid B D Knight r 164 Head Geo W (Nettie M) 1 agt N Y Life Ins Coles al Co h 106 Ransome (V) Haynes Lennie opr Happ Bros Co r 1537 3d Haynes Norris (c) r 410 Peachtree Head Gilbert (Dixie) 1 r 7 Rose pi Head J Francis (Pauline L) 1 pres Macon Haynes Obie (c; Rosa) h 438 Chestnut Banana & Prod Co Inc r 1414 Edgewood Haynes Paul (Clifford) r 719 College Head J Kiel (Maude) (o) h 125 (314) W Gren- Haynes Rosaline tchr Clisby Sch r 533 Orange Haynes S R emp Willingham Mills Haynes Sarah (c) 1 emp Independent Ldry Co ada ter Head James (c; Viola) 3 h 113 (148) Hudson Head James (c) emp r 319 Dure (U) r 805 Fort Hill Haynes W R (Florrie) trav rep Macon Teleg Head Juliet W (wid J S) (o) elk Jones Johnston Russell & Sparks h 7 Rose pi Pub Co r RD 2 Bloomfield rd Haynes Wm (c) lab So Crate & Veneer Co r Head Pauline L (Mrs J F) sec-treas Macon Banana & Prod Co Inc r 1414 Edgewood 162 Bay Haynie Clyde M (Ethel) military sgt Lanier High Sch for Boys h 205 Brentwood Head Wm (c; Fannie) 1 (o) tr dr J W McCook Lbr Co h 319 Dure (U) Headden Hardy H (Nellie) 3 emp Willingham Hays (see also Hayes) Hays Carl H (Annie M) elk C of Ga Ry h 871 Mills h 213 (26) Holt Healey Paul (c; Jessie M) 2 lab So Crate & Cherry Hays Carl H Jr slsmn Kernaghan-Goodman Inc r 871 Cherry Hays Clara M emp Bibb Mfg Co r 69 Davis (PM) Veneer Co r 805 Fort Hill Heals Idella (c) 2 r 559 Monroe (V) Healy Herman (c; Mattie M) emp F S Royster Guano Co h 259 Cowan Heard Bros J M Heard genl mgr cotton fac- Hays Florrie L (c) r 905 Elbert Hays Geo B (Inez) 5 h 216 6th (SM) Hays Geo W (Rosa) 2 formn C of Ga Ry h 120 Richmond Hays Guy (Marion) druggist Mitchell & Wil- liams Co r 165 Magnolia Hays Hazel Eliz student r 256 Appleton Hays John A (Edith) elk Ga Power Co r 473 Orange Hays Lois S opr So Bell Tel Co r 619 Forsyth Hays Lula student r 216 6th (SM) Hays Mae (Mrs Willie) waitress Dannenberg's r RD 2 Columbus rd Hays Mildred nurse Macon Hosp r do Hays Oscar W (Minnie) (o) sect-treas The Ross Co h 256 Appleton Hays Pauline (wid Geo) opr Hotel Dempsey r 193 Magnolia Hays Roberta cash Union Dry Gds Co r 619 Forsyth Hays Rose opr So Bell Tel Co r 816 New tors 350 Poplar plant 8th nr Cherry Heard Gussie (c) h 12 Buckner al Heard Hardeman student r 198 Henry (Lyn- more) Heard Hattie opr Happ Bros Co r 121 Knott (SM) Heard J Milton (Susie) (o) genl mgr Heard Bros h 168 Laurel Heard J Milton Jr student r 168 Laurel Heard Jacob F (Eliz B) 1 (o) used auto parts 610-12 Broadway h 198 Henry (Lynmore) Heard Jacob F Jr student r 198 Henry (Lyn- more) Heard Ola (c) h 6 Graham's lot Heard Pearl D (wid V E) typist r 3809 Hous- ton Heard Sami (c; Bessie) lab h 102 Peacock Heard Susie sch tchr r 168 Laurel Heard Theo R (c) r 102 Peacock Heard Wm (c; Olla M) 1 h 505 (506) Elbert Hearin Ada (wid T E) r 205 Corbin (V) Hearin D Leon student r 205 Corbin (V) Hays Wm C (Miriam) formn Standard Tool & Hearin Ellis R (Bessie B) dist traffic mgr .So Handle Co h 816 New Bell Tel Co h 205 Corbin (V) Haywood Ethel (c) carder Bibb Mfg Co Haywood James (c; Victoria) lab Atlantic Ice & Coal Co h 1406 Broadway Haywood Johnnie (c) 1 maid r 701 (608) Crisp Hazel Street Pentecostal Church I O Allen pas- tor 858 Hazel Hazel Street School (c) P H Williams prin 652 Hazel Hearn Paul (o) h 205 Ingleside (I) Hearn Richd L student r 409 Ridge (I) Hearn Robt W (Madeline) 4 emp Bibb Mfg Co r 205 Ingleside (I) Hearn Sallie T (o) h 409 Ridge (I) Hearn Wilfred E slsmn Economy Auto Stores Inc r 409 Ridge (I) Hearn Wm S r 205 Ingleside (I) 370 Baldwin's and Telegraph's Hearne Ada (Mrs J M) ofc mgr Doctors' Businessss Bur & Colin Serv r 115 Madden Hemingway Ludie (wid C F) r 225 Adams Hemingway Lyn (Mae) mech Snow's Ldry r HEARNE JOHN M (Ada) 1 (o>, Mgr Doctors' Business Bureau & Collection Service, h 115 Madden--Tel 6007-W 850 Walnut Hemingway Sami M (Helen) 2 (o) condr GS&FRR h 155 Hendley Heath Agnes student r 178 Palace (B) Heath Burena (c) r 707 (605) Prince (SM) Heath C J rep Macon Better Housing Program Hencely Leila (wid B L) h 311 (321) Shamrock Hencely Leila J emp Southland Knitting Mills r 308 Cutters Green Heath Clarence B carp r 310 Randolph r 311 (321) Shamrock Hencely Royce F r 311 (321) Shamrock Heath Clifford J ins agt r 308 Cutters Green (EM) Hencely Wiley B r 311 (321) Shamrock Henderson Andrew R (c; Lavonia K) 3 lab C Heath Clyde emp Willingham Mills r 25 (63) of Ga Ry h 86 (134) Forest (V) Mill Heath Danl D (Mattie L) 3 lab h 330 Hanson Henderson Arth (c; Eleanor) h 89 (126) Forest (V) (SM) Henderson Arth C (c; Katie) tailor Union Dry Heath Dollie Mrs 1 spinner Bibb Mfg Co h 825 Gds Co h 1022 Power House al Henderson B Kendrick (Eliz) 2 h 263 Georgia Heath Ella O Mrs h 574 DeBorde (SM) Heath Evabell nurse Macon Hosp r do apt 5 Henderson Beatrice (c) maid J W McKay Heath Fredk (Mattie) r 178 Palace (B) Henderson Bessie (c) cook R R Evans Heath Geo W (Ida) h 848 Hazel Henderson Buford A (Annie M) yd elk C of Heath H Persons (Cornelia) (o) h 1304 Vine- Ga Ry h 212 Ormond ter ville Henderson Claybon (c; Ella) lab h 637 Elm St Heath Hubert W 2 tr dr Buster Btlg Co r la 574 DeBorde (SM) Henderson Cran E (Grace) 4 slsmn h 124 In- Heath Ira C (Ruby) 6 hlpr h 1917 3d verness Heath John H (Bedie) 1 doffer Bibb Mfg Co Henderson Eleanor (c) cook Mrs Molly S Jelks h 178 Palace (B) r 89 (126) Forest (V) Heath Julia (Mrs W E) spinner Bibb Mfg Co Henderson Ella (c) cook F M McKenney r 574 DeBorde (SM) Henderson Ella (c) (o) cook C B Holleman r Heath Linda E (wid E J) h 308 Cutters Green 137 4th (V) (EM) Henderson Emma (c) dom r 7 Cheatham al Heath Louise Mrs spooler Bibb Mfg Co Henderson Eva (c) cook r 1238 1st Heath Mattie (Mrs Fredk) sten Ga Industrial Henderson Fate (c; Pinkie B) 2 butler R J Home r 178 Palace (B) Taylor r 410 Ward (V) Heath Ralph T (Helen) hse phys Macon Hosp Henderson Frank (c) r 105 Amos (V) h 257 High Henderson Geo elk Kennington's Mkt Heath Sara opr Happ Bros Co r 574 DeBorde Henderson Gertrude (c) 3 maid Charles Nash r Heath Wm (c; Eddie M) r 132 (22) Williams la 326 Monroe (V) Heath Wm E (Julia) 2 r 574 (DeBorde (SM) Henderson Gladys opr So Bell Tel Co r 556 Heaton Arth N (Leila) (o) slsmn r Bloomfield Boulevard (NH) rd RD 2 Henderson Henry P emp C of Ga Ry Heaton Leila (Mrs AN) bkpr The Reliable Out- Henderson Herschel C elk Ry MS res Lorraine fitters r Bloomfield rd RD 2 Ga Heavenly Geo mech Colbert Mfg Co Henderson Hollie B (Jewel) 3 mech Steve M Heck Myrtle (Artistic Beauty Shop) h 474 Solomon h 324 Forsyth Orange apt 3 Henderson Howell H (Maggie) 1 emp P O h Heckle Viola (wid J C) cafe mgr High Sch r 300 College apt 2 525 Vineville Henderson J B (c; Gertrude) delmn Chiches- Hedemann Lennie Mrs 3 h 105 North (NH) ters Tatnall Sq Drug Store r 326 Monroe (V) Hedgepath Jeanette (Mrs A L) 2 h 121 Rogers Henderson J Grant (Lillie) 5 pntr h 320 Ran- (V) dolph Hedgepath Mary F opr So Bell Tel Co r 121 Henderson Jessie (c) maid H W Watson r 818 Rogers (V) Elm Hedgepath Sami P slsmn Leaptrot's Dry Henderson Jesse L r 3145 Houston Cleaning Co r 121 Rogers (V) Hegmann Fred E r 101 Ormond ter Henderson John (c) picker Bibb Mfg Co Henderson John P formn C of Ga Ry Height Edgar P (Lillie) 4 firemn GS&FRR h 1713 2d Henderson Joshua emp H A Kennington Gro r 320 Randolph Height Fred (c) lab C of Ga Ry Creosote Henderson Kath r 324 Forsyth Plant Henderson Lavera (c) maid T A Jacobs r 421 Height Henry H (Lucile) slsmn Atlantic Refining Co r 1713 2d North Henderson Lena student r 224 Georgia Height John H (c) r 415 Ward (V) Henderson Leo (c; Mary) 6 (o) lab C of Ga Height Lucius (c; Lillie M) lab C of Ga Ry Ry h 202 Antioch rd Creosote Plant h 415 Ward (V) Henderson Levi (c) 1 r 826 (830) 3d (V) Height Oscar (c) lab C of Ga Ry Creosote Henderson Lola (c) r 326 Monroe (V) Plant Henderson Louise (c) cafe 212 (307) Elizabeth Heiss Ane M instr Macon Vocational Sch r 533 Orange apt 1 Helmly Bea R (Maude) h 429 Duncan Helmly Eva slswn H L Green & Co r 429 Dun- can Helmly Vernon W agt Conn Mut Life Ins Co (SM) r 204 (167) do Henderson Lucinda (c) 1 emp Snow's Ldry r 731 Edgewood Henderson Manoah F (Willie R) (o) trav slsmn h 213 Belmont r 1410 Vineville Henderson Mary (c) h 258 4th (V) Helton Eloise Mrs gro 826 Montpelier r 821 do Henderson Mary (c) 3 maid Greater Wesleyan Helton Wm L (Lillian) 4 hlpr h 100 Enterprise r 258 4th (V) 1935 Macon City Directory 3U Henderson Mattie (c) cook J T Redding h 826 Henry Horace (Grace R) (o) dept mgr Burden (830) 3d (V) Smith Co h 111 Hill Crest Henderson Mildred (c) maid B E Willingham Henry Isaac J (c; Rosa) 2 (o) tailor 805 Broad- r 826 (830) 3d (V) way h 615 Monroe (V) Henderson Olin H (Josephine) slsmn r 329 Henry James F (Annie L) h 417 Winship College Henry Jasper (c; Queen) emp Birdsey Flour Henderson Raymond (c) delmn College Hill Mills h 232 5th (V) Pharm r 326 Monroe (V) Henry Julia (c) h 326 Calhoun Henderson Roy (Idell E) 1 meter reader City Henry Katherine Mrs sten Karsten & Denson Bd of Water G'ornrs r 103 Callaway (V) Co r RD 4 Henderson Ruth J (wid D T) r 99 Vineville Henry Louis C S (c) r 216 Middle (V) apt F 4 Henry Louisa L (o) h 1017 Walnut Henderson Sami Y (Rosa B) traffic rep So Ry Henry Lucille (c) maid Mrs Bessie Pritchett h 2336 Forsyth rd Henry Lucy B (c) cook J M Chance r 326 Henderson Sara (c) cook Chichesters Tatnall Wade's la Drug Store h 326 Monroe (V) Henry Mable r 417 Winship Henderson-Tumer Co (Russell Turner) gros Henry Mack (c; Birdie) hlpr Maxwell Bros r 1000 Napier 421 Damour la Henderson Vera (c) maid r 421 North Henry Maggie M Mrs elk Liggett's Drug Store Henderson Wilburn (c; Essie) 1 lab Carling Henry Mamie (c) (o) h 217 Duval Tile Co r 1331 1st Henry Marguerite r 205 (185) Henry (Lyn- Hendley Joseph C (Kate) 3 (o) (W T Hendley more) Gro) h 307 Melrose (B) . Henry Marjorie E (wid W N) opr Adams Mfg Hendley Wm H gro 454 Clinton r do Co r 111 Violet Hendley Wm T (Gertrude) 1 (o) (W T Hendley Henry Mary (c) maid Lanier High Sch for Boys Gro) h 300 Atlantic (B) r 619 Pio Nono Hendley Wm T Jr (Nellie) 1 slubber hd Bibb Henry Montrey (c) elk County Relief Admn Mfg Co r 103 Forest (B) r 615 Monroe (V) Hendley Wm T Grocery (W T and J C Hend Henry N C r 417 Winship ley) 33 Bellevue rd Henry Queen E (c) maid H L Chichester r 232 Hendricks Alice sten Bibb Mfg Co r 317 5th (V) Orange Henry Susie K r 1017 Walnut Hendricks Annie (wid E L) h 317 Orange Henry Susie (c) hlpr Bibb Mfg Co Hendricks Annie R r 412 Ridge (I) Henry Thos B (Georgia) 1 (o) farmer h 205 Hendricks Geo (c; Ella) hlpr C of Ga Ry h 218 (185) Henry (Lynmore) Jones Henry Wm (c) butcher T & T Pkg Co r 606 Hendricks Hollis T elk Piggly Wiggly r 317 (1281) Elbert Orange Henry Wm (c) porter Arcade Billiard Parlor Hendricks John (c; Annie) plmbr P M Hat* h 102 (150) Magnolia la field h 133 (81) Long la Hensley Frank shpg elk Am Bakeries Co r 740 Hendricks Lillian F (wid T R) r 1701 Vineville Montpelier Hendricks Luther W mech r 264 Winship Hensley John H (Cornelia L) rep Macon Better Hendricks Nannie E (wid G W) r 134 Summit Hsg Program h 740 Montpelier Hendricks Sam T (Grace W) 1 msngr Ry Exp Henson James A shoe repr Alex Kell 903 Plum Agcy Inc r 865 Orange Hephzib'ah Orphanage D L Jones supt 3201 Hendrix Chas C h 258 Niagara Forsyth rd Hendrix Irene (o) h 101 1st Herb Alberta student r 1315 2d Hendrix Josephine nurse Middle Ga Hosp r do Herb Chas B r 507 Clinton Hendrix Jonnie r 457 Oak Herb Henry farmer r 507 Clinton Hendrix Lillian r 101 1st Herb James C (Ella) 8 meat ctr J B White r Hendrix Matthews r 258 Niagara 1315 2d Hendrix Perry L (c; Ella) lab Southeastern Herb Sarah Mrs h 507 Clinton Compress h 6 (124) Paradise al Herbert Lawrence C emp State Hwy Dept r Hendry Lee utility matron Masonic Home of 244 Washington Ga r do Herin Eliz slswn Dannenberg's r 952 Elm Hendry W Turner (Louise) 1 emp McKesson- Herin H H (Mazie) mgr Dunlap-Peeler Hdwe Riley h 253 Boulevard (NH) Co r RD Bloomfield rd Henley Mary F (wid W H) r 100 Daisy Park Herin Kingman student r 129 Winship Henry Alonza (c) h 121 (25) Magnolia la HERIN PEARL, Office Mgr Macon Transfer Henry Ann student r 111 Hill Crest Co, r 952 Elm--Tel 3238 Henry Barnard (c; Elnora) 1 (o) lab F S Roy- Herin Walter G student r 952 Elm ster Guano Co h 901 Taylor (EM) HERIN WALTER S (Mary L) 1 (o) (Macon Henry Bertha M (c) tex wkr Bibb Mfg Co r Transfer Co) h 952 Elm--Tel 3238 235 Riley (CP) Heriot Evelyn r 120 Park pi Henry C Elfe r 1017 Walnut Heriot Helen elk City Board of Health r 120 Henry Carrie C r 1017 Walnut Park pi Henry David (c) delmn T M Raines Gro Co r Heriot May r 120 Park pi 126 1st (U) Heriot Steph Ch 120 Park pi Henry Edwin (c) 4 (o) lab C of Ga Ry h 126 Herman Emma M (wid Ike) h 810 Mulberry 1st (U) apt 3 Henry Edwin Jr (c) lab So Crate & Veneer Co Herman Jerome (Madeline) h 810 Mulberry r 126 1st (U) apt 4 Henry Etta M (c) r 126 1st (U) Henry Eva (c) dom J W Hanson Henry Geo L (c; Lucy) 2 h 526 Wade's la Herman Wm M emp Happ Bros Co h 810 Mulberry apt 3 Herndon Bradley H (Mabel) 4 firemn Pump Co No 4 h 252 Maple Henry Grace R (Mrs Horace) tchr Winship Herndon Chas A (Mary E) plmbr h 757 New Sch r 111 Hill Crest Herndon Ella (c) (o) lndrs h 139 1st (V) m Baldwin's and Telegraph's Herndon Holly (Mrs S J) r 725 Hawthorne Herndon James A (Nancy) 2 hlpr h 132 Will- ingham Herndon James R student r 132 Willingham Herndon John A blksmth supv C of Ga Ry Herndon Lillian student r 909 Cherry Herndon Lois opr Happ Bros Co Herndon Mary nurse in charge Bibb Mfg Co Payne City Clinic r 69 Davis (PM) Herndon Nancy (Mrs J A) opr Adams Mfg Co r 132 Willingham HERNDON OLLIE C (Agnes) 2 (o), Mgr Broadway Trading Co, r RD 4--Tel 5351-W Herndon Thos J (Josephine) 1 elk Ry MS h 909 Cherry Herndon Wilbur L (Agnes) 5 hlpr h 130 Will- ingham Herring Alphaeus C student r 461 Spring Herring Alvin A student r 461 Spring Herring Fletcher L (Hilda E) personnel supv FERA r RD 6 Cross Keys Herring Francis (Annie) slsmn h 461 Spring Herring Hannah Mrs spinner Bibb Mfg Co r 1427 2d Herring Henry (Myrtle) 2 speeder hd Bibb Mfg Co h 102 Green (PM) Herring Horace L mus r 535 Telfair (SM) Herring John L (Alice) 2 (o) pntr h 535 Tel- fair (SM) Pierring Loraine r 1427 2d Herring Mabel (Mrs Wm) warper Bibb Mfg Co r 51 Davis (PM) Herring Martha tchr Alexander Sch No 2 r 139 Rose pk Herring Mary E r 107 Harrold Herring Myrtle r 1427 2d Hertwig Edw J elk Bibb Mfg Co r 846 College Hertwig Herman (Emma S) (o) chf elk MD&SRR h 519 Linden Hertwig Maria P (wid EJ) 2 tchr Chas H Bruce Sch h 846 College Hertwig Mary L emp C Huhn & Son r 1020 Elm Hertz Frank C capitalist r Hotel Southland Hertz Hermia h 401 College apt 4 E Hester Ada M (c) 1 emp Snow's Ldry r 1005 (224) Dempsey Hester Albert emp r 231 Reid Hester Albert (c) lab Willingham S&D Co r 961 Hazel Hester Chas r 318 Chappell (SM) Hester Cherrie (c) h 110 (109) Rockhill la Hester Clara Mrs h 315 Water (EM) Hester Earl hlpr City Scavenger Dept r 900 Main (EM) Hester Hillyer (c; Dollie) lab C of Ga Ry h 321 Cedar (U) Hester Ira (c; Leola) pntr r 314 Jefferson Hester James r 900 Main (EM) Hester James H emp r 231 Reid Hester James O 4 h 231 Reid Hester James T (Alleen) 4 h 128 Stratton Hester Lizzie (c) dom h 201 3d (U) Hester Loren G (Bessie) 2 tr dr City St Dept h 1907 3d Hester Mary (c) 1 (o) lndrs F N Burch h 430 Cedar (U) Hester Mary E spinner Bibb Mfg Co r 2010 Vineville Hester Paul W (c) confr 17 5th r 321 Cedar Hester Pauline (wid S A) r 354 Spring Hester Perry emp Willingham Mills Herring Myrtle (Mrs Henry) emp Bibb Mfg Co r 102 Green (PM) Herring Pearl (wid J F) 1 h 139 Rose pk Herring Prentice A (Eliz) elk Mtr Parts Corp r 535 Telfair (SM) / Hester Rachel Mrs 1 r 318 Chappell (SM) Hester Robt L (Nannie) h 900 Main (EM) Hester Robt L (Lucille) 3 gro 557 Telfair (SM) h do Hester Robt L Jr tr dr City Scavenger Dept r Herring Robt A (Eliz) 2 tex wkr Willingham 900 Main (EM) Cotton Mills h 1005 Hazel Herring Wesley (Mary) h 311 Giles Hester Sophia (c) cook Margt S Ferrill h 218 Shamrock Herring Wm (Mabel) 1 speeder hd Bibb Mfg Hester Wm M emp Ga Power Co Co h 51 Davis (PM) Hewatt Claude A (Blanche) 2 formn Macon Herrington Alice (o) h 412 Calhoun Mattress Co h 138 Log Cabin dr Herrington Clarence (c; Annie) emp C of Ga Hewatt Lucile G r 138 Log Cabin dr Ry h 807 Ash Hewell Arth M (Maude M) 2 (o) mach C of Ga Herrington Herbert C (Rose) 1 sta opr Scott Ry h 231 Capital (Mikado pi) Serv Sta h 103 McGee (CP) Hewell Mabel opr Tomlinsor) Paper Box Co r Herrington Horace O (Mary L) (o) condr C of 115 Washington Ga Ry h 726 Pine Hewell Maude opr Tomlinson Paper Box Co r Herrington Jesse J (Mary) 1 (o) mach So Ry 115 Washington h 2023 Broadway Hewes Caroline K emp Macon Hosp r do Herrington John (c) r 815 Edgewood Hewitt Eva M (wid R P) r 163 Spring apt 1 Herrington Louise student r 309 Jenkins Hewitt Valeria r 425 College Herrington R E frt agt Nashville C & St L Ry Heyser Dorothy r 306 Fort Hill r 322 Cherry Heyser John F (Ada) 4 (o) engr MD&SRR h Herritage Elmo r 102 Ponce de Leon (SM) 306 Fort Hill Herritage M Edna emp Met Life Ins Co r 102 Heyser John F Jr formn F S Royster Guano Ponce de Leon (SM) Co r 306 Fort Hill Herritage Wm M h 102 Ponce de Leon (SM) Heyser Kathleen r 306 Fort Hill Herron Frances tex wkr Southland Knitting Heyser Nell student r 306 Fort Hill Mills r 124 Roff Home la Heyward Andrew H (Marion S (o) h 1021 Herron Gertrude Mrs 4 tex wkr h 124 Roff Vineville (V) Home la Heyward Emory S (Louise) elk Whitman's Herron Hugh J (Mary P) 2 (o) agt So Ry Pharm h 476 College apt 7 h 132 Curry dr (NH) Heyward Eustace W elk Rogers Stores r 1021 Herron Joseph student r 130 Curry dr (NH) Vineville Herron K E r Y M C A Heyward Marion S student r 1021 Vineville Herron Lucille tex wkr r 124 Roff Home la Hi Lo Grocery (Lillie D Thornton) 516 Mont- Herschel Merchant Tailor (c) (Herschel W pelier Johnson) 264 Broadway Hi-View Service Station (C G Moore) 5000 Hersey Warren C (Helena) 4 ins agt h 501 Houston Duncan HICKEY'S COFFEE SHOP, (Jas M Yates), Hertwig Chas C (Louise B) 2 (o) asst sec-treas "Home Cooked Foods", 312 Broadway--Tel Bibb Mfg Co h 772 Hillyer 1172 1935 Macon City Directory 273 Hicklin Eddie (c) hlpr r 121 Davis (NH) Hicklin Geo W (c; Julia) chauf R C Dunlap h 702 Clinton Hicklin Julia (c) maid R C Dunlap r 702 Clin- ton Hicklin Marshall (c) emp Bibb Mfg Co r 121 Davis (NH) Hickman A Louise opr W U Teleg Co r 868 2d Hickman Alice (wid W H) r 2166 2d Hickman Broadus S (Ruby) 1 opr Happ Bros Co r 207 Reid Hickman Edw (Mary) 1 emp Atlantic Ice & Coal Co h 125 Stratton Hickman Irene opr Adams Mfg Co r 2166 2d Hickman Rosa (wid G R) h 207 Reid Hickman Ruby (Mrs B S) opr Happ Bros Co r 207 Reid Hickman Theresa opr Adams Mfg Co r 2166 2d Hickman Wm C (Eunice) 2 auto repr 304 Reid h do Hicks Alice (c) hsekpr h 453 (r) Walnut Hicks Anna E (wid J C) 3 h 205 Central (SM) Hicks Carrie Lou (c) cook J A Zeigler r 201 Patterson Hicks Cecil (c) delmn R S Purser r 504 (710) Campbell (SM) Hicks Chas (c; Dollie M) r 312 Cedar (U) Hicks Chas r 205 Central (SM) Hicks Chas M slsmn Swift & Co r 158 High Hicks Charlotte (c) 4 r 342 Long (SM) Hicks Clarence (c) lab r 342 Long (SM) Hicks Claude M (Ruth) 1 pntr C of Ga Ry h 620 Plum apt 2 Hicks Cleveland C (Sallie) h 313 (113) Dan- nenberg Hicks D H (c) r 551 4th (V) Hicks Duncan (c) r 234 Jefferson Hicks Eliz (c) r 1220 Reynolds al Hicks Emma business mgr Oglethorpe Private Infirmary r 99 Vineville apt B 4 Hicks Epsie elk So Ry r 99 Vineville apt B4 Hicks Georgia r 414 Napier Hicks Harvey (c; Jane) r 615 Hazel Hicks Helen Mrs r 273 Ell (SM) Hicks Henry elk Alf Mack's Pharm Inc Hicks Henry elk Dixie Cafe & Commissary r do Hicks Henry (c; Kate) lab James & Kingman Lbr Co h 214 Division Hicks Herbert A (Ruby) 1 meat ctr Rogers Inc h 735 Blackburn Hicks Isaiah (c) lab Carling Tile Co h 1220 Reynolds al Hicks James (c; Mary) h 104 (503) Campbell (SM) Hicks James (c; Doris) tr dr Birdsey Flour Mills h 12 (307) Hanson (SM) Hicks James A (Helen) 1 city firemn Pump Co No 4 r 718 Hemlock Hicks James R Jr (Willie Mae) (o) sheriff Bibb County h 105 Courtland Hicks Jane (c) maid A C Waits r 615 Hazel Hicks John H (c; Ruth) (o) lab C of Ga Ry h 227 Grant (V) Hicks John H tr dr Burney Bros Co 453 5th Hicks Josephine (c) r 659 Hazel Hicks Lillie (c) h 359 (2) 7th Hicks Louella (c) 1 maid Mrs G D Wheeler h 205 (123) Mutual (V) Hicks Louise (c) h 418 Hazel Hicks Louise N (wid A G) h 710 Forsyth Hicks Louise N r 710 Forsyth Hicks Mary (c) 1 r 366 Flanders Hicks Mary (c) 1 h 239 (131) Moore la Hicks Mazie (c) emp Snow's Ldry r 408 (541) Elizabeth (SM) Hicks Minnie (c) r 643 4th (WH) Hicks Nancy D (wid O W) r 710 Forsyth Hicks Nancy G sten Ga Mtr Finance Co r 710 Forsyth Hicks Nellie r 205 Central Hicks Ola (c) clnr Bibb Mfg Co r 110 Ernest Hicks Ranny ofc boy Jones, Johnston, Russell & Sparks r 906 Napier Hicks Raymond R (Nellie) 1 elec Adams Buch- anan Mtr Co h 213 Henry (Lynmore) Hicks Revena (c) emp Hub Fish & Oyster Co r 361 (3) 7th Hicks Richd (c; Mozelle) 7 lab h 501 (710) Campbell (SM) Hicks Richd B (Edwina) (Trading Post) r 319 Forest Hill Hicks Robt (c; Mattie) 1 porter Flynt's Bar- ber Shop h 403 Monroe (V) Hicks Romas hlpr Sterchi's r 205 Central (SM) Hicks Sami W (c) porter Edw Bashuk r 803 Ocmulgee Hicks Thos W (c; Lucille) (o) lab' h 852 Ocmulgee Hicks Virginia Mrs 1 r 960 1st Hicks W G shpg elk Chambers Lbr Co res Lizella Ga Hicks W Roughten tr dr Swift & Co r 205 Cen- tral Hicks W T wtchmn Chambers Lbr Co res Lizella Ga Hicks Warren (c; Marie) lab S E Compress & Whse Co h 329 Gilmer Hicks Wm (c; Ola) 5 hlpr Adams Mfg Co h 110 Ernest Hicks Wm (c; Annie) 1 emp Bibb Mfg Co h 201 Patterson Hickson Chas B (c) (o) carp h 501 1st (U) Hickson Marion (c) delmn H A Spivey r 435 Chestnut Hickson Wesley (c; Florrine) 3 brklyr h 107 1st (U) Hiett Hartley W (Hester J) 3 formn So Crate & Veneer Co r 926 Cherry Higgens Maudie M (c) h 7 Barnhart's Bottom Higgins Augustus (c; Anna) (o) lab City Bd of Water Comrs h 939 (743) Pio Nono Higgins Clarence (c; Dolly) 1 h 204 (108) 2d HOGAN PAUL G (Jennie B) (Macon Auto Ex- HoQbbAstlaUnntiief1 tVexillswp1?kr Atlantic Cotton Mills r change) h 430 Washington--tel 3134-M Hogan Pulaski (c; Annie) lab C of Ga Ry h Hobby Dovie (wid J P) 1 r 113 Schell (EM) 537 Flanders Hobby John P r 113 Schell (EM) Hogan R Wesley asst funeral dir Burghard- Hobby LeGrande (Dorothy) 1 slsmn Gill's Bak- Connally r 718 Cherry ery r 840 Courtland Hogan Roberta (c) emp Snow's Ldry r 1019 Hodge Fannie (c) 1 h 1272 Cheatham al Oglethorpe Hodge Hodge IWsamacB(1 c()Mrau4d0e5) Chestnut emp GS&FRR h 161 3d Hogan Sarah (c) lndrs h 649 Oglethorpe Hogan Steve (c) emp Central Cotton Oil Co r Hodges Cephus (c) r 104 Smith (EM) 161 College Hodges Chas T (Lucille) 2 slsmn Willingham Hogan Virginia r 120 Log Cabin dr S&D Co h 704 Napier Hogan Wm (c; Alma) lab h 104 (2) Cedar (U) Hodges Chas T Jr student r 704 Napier Hogan Wm O (Pimal) 2 mach Maxwell Bros Hodges David (c; Bessie) 5 lab h 104 Smith h 120 Log Cabin dr (EM) Hoge Addie r 126 High Hodges E C (Marie) 1 h 405 Cedar Hoge Gertrude (wid J T) 1 r 660 Hemlock Hodges Eliz P Mrs h 456 Oak Hoge Joseph S slsmn Carstarphen Inc r 660 Hodges Ernest (c) r 127 Wyche Hemlock Hodges Gladys emp Macon Cafeteria r 659 Hoge Julia (c) h 126 High Hemlock Hoge Kath r 660 Hemlock Hodges H Raiford (Ellanor) 1 printer Macon Hoge Lizzie r 170 Virginia Teleg Pub Co h 532 Log Cabin blvd Hoges James (c) r 507 Coleman al Hodges Hettie (wid J O) r 112 Summit Hoges John (c) lab h 114 (812) Railroad Hodges James O (Lula H) 1 (o) emp South- Hogg Hazel (c) 5 lndrs r 139 Culver (V) land Knitting Mills h 127 Summit Hogg Mary B (Mrs R H) bkpr Volunteer Hodges Loulie r 426 Forsyth Pharm r 759 1st Hodges Lula H student r 127 Summit Hogg Robt H (Mary B) (Volunteer Pharm) r Hodges M B (c; Susie) 2 lab h 112 Long St la 759 1st (SM) Hogue Freeman (Juliette) elk Sami Hogue r Hodges Miller (c) r 34 (498) White (SM) 320 Dannenb'erg Hodges Odessa (c) r 112 Long St la (SM) Hogue Sami (Annie B) 3 gro 320 Dannen- Hodges Ralph T (Lilly) formn So Ry h 666 berg h do Napier Hoke Edith (Mrs W A) opr Happ Bros Co r Hodges Ralph T Jr student r 666 Napier 215 Williams (SM) Hodges Robt (c; Ella) 5 h 4 Plant al Hoke Wm A (Edith) (o) car inspr So Ry h Hodges Sallie Mrs r 659 2d 215 Williams (SM) Hodges T L emp C of Ga Ry r Central Hotel Holbrook Bertie (c) sten County Relief Admin HODGES WALTER E, Pres-GenI Mgr Empire r 222 Chestnut Dixie Coal Co Inc, r 2601 Forsyth rd--tel 1468 Holbrook Carrie (c) h 226 Chestnut Hodgkins Mary E sch tch r 714 Napier Holbrook Georgia B (c) r 226 Chestnut Hodnett Melinda J (wid W H) h 618 New Holbrook Marion J (c; Bertie) carrier P O h Hodo A C (c) porter Jake's Shoe Store 222 Chestnut Hodrick Oscar (c; Victoria) h 112 Sapp (U) Holcomb Bryant M (Florence) carp h 113 Hoffman Ella (Mrs F R) opr Happ Bros Co r Schell (EM) 815 Main Holcomb Christopher C (Rosie) pntr h 866 1st Hoffman Frank R (Ella) mach C of Ga Ry h Holcomb Maude nurse Macon Hosp r do 815 Main (EM) Holcombe Agnes (wid J F) h 208 Washington Hoffman Kath cash Wisteria Cafe r 716 Pine Holcrow Robt emp Federal Transient Bur r Hoffman Paul H (Maude W) 1 h 2344 For- 504 Plum syth rd Holden James (c; Hilder) 3 lab C of Ga Ry Hogan Anna (c) r 104 (2) Cedar (U) h 1634 1st Hogan Anna (c) r 161 College Holden John H (c) lab h 20 Short St la Hogan Arth (c; Ella) lab r 330 2d (U) Holder Annie B emp Willingham Mills r 94 Hogan Austin (c; Alberta) electrn Dessau (328) Dannenberg al Realty & Ins Co r 212 (227) Roye Holder Annie P (c) 1 r 133 McKay's al Hogan David (c; Annie B) 1 lab Macon Gas Co Holder Fletcher L (Florine) 2 emp Willingham h 107 Mulberry Mill h 177 Roff Home la Hogan Dolores C Mrs slswn Darling Dress Holder Gladys M student r 912 College Shop r 354 Hardeman Hogan Doris (c) cook Mrs Kath Toole r 112 May Hogan Ella M (c! cook C H Gordon Hogan Glover (c; Roberta) 1 delmn Ivey Turner Holder Henry N (Mendie) 3 h 224 (2) Forest (B) Holder Horace (Mary) tex wkr Atlantic Cotton Mill r 107 Roff Home Ice Cream Co h 1019 Oglethorpe Holder Isabel (wid F J) 1 (o) h 912 College 278 Baldwin's and Telegraph'* Holder John (Lois) tex wkr Atlantic Cotton HOLLEY JOHN C (c; Willie M) (o) Dentist, Mill h 28 Atlantic Village 300-02 Knights of Pythias bldg--tel 3071, h Holder John (Annie B) 1 emp Willingham Mills 236 2d (V)--tel 844-J (See Page 205) r 94 (328) Dannenberg al Holley John J eng So Ry r 620 Pine Holder Lois tchr Lanier High Sch for Girls r Holley Milton H (Edna) meat ctr Rogers Inc 912 College h 104 Nelson (SM) Holder M E Mrs r Hotel Macon Holley Wm S (Mamie) r 2803 Houston Holder Rosa L student r 107 Roff Home Holley Willie M (c) case aide County Relief Holder Thos (c; Minnie) r 125 (204) Admn r 236 2d (V) Magnolia la Holliday Elah elk Wesleyan Conservatory Holding Commission Co J B Hart sec-treas Holliday Peter O (Martha R) 2 (o) judge 354 1st County Juvenile Court h 216 Hines ter (V) Holimon Alonza (Fannie) emp So Crate & Holliman Alonzo (c) lab So Crate & Veneer Co Veneer Co r 503 Center (EM) Holliman Annie L mus tchr r 153 Summit Holingshed Cora (c) maid M J Callaghan r 51 Holliman Arthur (c; Rosa) carp h 105 1st (U) Fordville Holliman Ethel sten r 131 Culver (V) Holland Annie F (e) r 364. Flanders Holliman James (c; Rosa L) 3 h 214 Grant (V) Holland Belle opr Happ Bros Co r 410 Belmont Holliman Julian C (c; Nancy) 1 lab h 216 Holland Benj W (Mettie) 1 emp G G Harde- Shamrock man Co h 915 Walnut apt 3 Holliman Louise (c) maid D D Harris r 214 Holland Bessie (wid O J) 1 h 414 Duncan Grant (V) Holland Edna opr Happ Bros Co r 725 Holliman Lucius (c; Pinkie) 3 emp Payne Mill Anderson (SM) r 414 Ward (V) Holland Edna opr Happ Bros Co r 220 Cal- Holliman Myrtle (Mrs R B) elk Crescent Ldry houn r 131 Culver (V) Holland Ernest C (Mozelle) pntr r 1724 2d Holliman Pearl emp Metro Studio r 105 Pio Holland Frazier (c; Sadie) shoe shiner Budrow Nono Thompson r 364 Flanders Holliman Pinkie (c) maid Minnie G Thomas r Holland Xduma (Mrs Wilton) opr Happ Bros 414 Ward (V) Co r 725 Anderson (SM) Holliman Richd (c) hlpr r 1100 (920) Broad Holland James (c; Georgia) porter Goodrich Holliman Rosa L (c) cook T N Paris r 214 Silvertown Stores h 230 Orange Grant (V) Holland James F (Belle) emp Willingham Holliman Roy B (Myrtle) (o) shpg elk Crane Mills h 410 Belmont Co h 131 Culver (V) Holland James W (Florence W) (o) bkpr El- Holliman Virginia tchr Alex Sch No 3 r 153 kan Stone-Tile Mfg Co Inc h 121 Summit Summit Holland James W chemist Bibb Mfg Co r 121 Hollinger Friendly (c; Alberta) pntr h 128 Summit Williams Holland Joseph (c; Clara) 4 delmn Johnson Hollingsworth Allen L (Eleanor S) 1 pntr r 94 Bros h 963 Oglethorpe Lawton Holland Jas C (c) r 610 (105) Elliott Hollingsworth Berry G (Emma B) 1 slsmn Holland Lilian (c) 2 dom r 488 Hill Crest Atlantic Ice & Coal Co r 211 Heard (SM) Holland Lillie opr So Bell Tel Co r 906 Hollingsworth C Fredk r 401 Burton Cherry Hollingsworth C Jefferson (Dorothy) 2 slsmn Holland Lucinda (c) r 348 (445) Forest (V) h 18 Drury (I) Holland Mattie (c) cook C H Cooley r 764 Hollingsworth Dollie Mrs r 222 Knott (SM) (152) Whitehead al Hollingsworth Emma B (Mrs B G) marker Holland Mattie B (c) r 364 Flanders Independent Ldry Co r 211 Heard Holland Mary S Mrs 1 tchr Chas H Bruce Sch Hollingsworth Emma C (wid J E) (o) fum r 218 Georgia' rms 767 Walnut h do Holland Maud r 121 Summit Hollingsworth Ernest tr dr City St Dept Holland Mildred (Mrs M E) emp Willingham Hollingsworth Francis M (Eliz L) opr Proctor Mills r 191 (195) Belmont & Gamble Mfg Co r 94 Lawton Holland Minter E (Mildred) 1 policemn CPD Hollingsworth Francis M (Allie) (o) trk gdnr h 191 (195) Belmont h 401 Burton Holland Ora (Mrs Walker) opr Happ Bros Co Hollingsworth Frank waiter Smitty's Barbecue r 220 Calhoun Lunch r 401 Burton Holland Sadie M (c) cook r 419 Douglas (V) Hollingsworth Frank D (Minnie Lee) tr dr Holland Thos (c; Amy) 4 h 364 Flanders City Scavenger Dept h 120 Knott (SM) Holland Vernedia r 220 Calhoun Hollingsworth Henry G (Louise) 1 (o) sec Holland Walker (Ora) 1 emp Nehi Btlg Co Scottish Rites h 107 Buckingham pi h 220 Calhoun Hollingsworth Joseph r 301 Chappell (SM) Holland Warren hlpr Whitman's Pharm r 915 Hollingsworth Lillian C matron Methodist Or- Walnut apt 3 phans Home r do Holland Wilton (Iduma) 2 h 725 Anderson (SM) Holleman Cornelius B (Lilia A) (o) trav slsmn h 653 Forsyth Hollingsworth Marshall H (Lillie) 3 (o) plmbr Miller Bros h 409 Burton Hollingsworth Maxine student r 767 Walnut Hollingsworth Paul E 1 tr dr h 222 Knott (SM) Hollingsworth Sami R (Eva D) lab r 222 Holleman Ellis L emp C of Ga Ry Knott (SM) Holleman Fannie M (c) dom A C Crow r 503 Hollingsworth Thos F Effie) 1 o) mgr mkt Center Lester Grady h 108 (134) Colquitt Holleman Lena L r 325 Vineville Hollingsworth Wiley L Harvey) 1 slsmn Wag- Holleman Linton V slsmn Corbin Sup Co r 103 Rogers (V) Holley Harry L (Eliz) 2 agt Shell Petroleum Corp h 126 (142) Pierce (V) ner Brewing Co r 410 416) Montpelier Hollins David (c; Mary) emp Goodyear Serv Inc h 971 Hazel Hollins Hamp (c; Bessie) 1 emp C of Ga Ry h 153 e Academy EM) 1935 Macon City Directory 279 Hollinshed Calodonia c) cook C A Thompson h Holloway Albert (Hildreth L) asst cred mgr 101 Hicks al Sterchi's r 821 New Hollinshed Henry (c) r 101 Hicks al Holloway Arnold (c) lab C of Ga Ry Hollinshed Sylvester (c) lab Bibb' Mfg Co r 211 Holloway Benj T (Lillie) 3 h 116 Stratton (431) Alabama (SM) Holloway Birl H (Ollie) 3 h 612 Elm Hollis Alice (c) cook R E Lowrance Holloway Bose (c) h 297 1st (V) Hollis Chas B Jr mach C of Ga R./ Holloway Callie M Mrs winder Bibb Mfg Co Hollis Chas F (c; Ada L) 1 (o) emp So Ry h Holloway Chas R (Belle) 2 (o) yd condr So Ry 277 Dempsey h 253 Ell (SM) Hollis Claude H (Helen) 3 agt Carolina Life Holloway Clark L (c; Lena) h 319 3d (V) Ins Co r 863 2d Holloway E Howard drftsmn C of Ga Ry r Hollis Estella (c) maid Starling Gilmore r 230 771 Walnut Plant Holloway E Hughes (Bessie) 3 emp PO h 703 Hollis Ethel (c) 1 cook E G Clark r 913 (833) Woolfolk Pio Nono Holloway Ethel (c) r 505 (472) Alabama (SM) Hollis Inez waitress Betsey Ross Coffee Shop r Holloway Forrest S swtchmn So Ry r 2615 Smith rd RD 2 Broadway Hollis James E (Mary) 1 r 151 2d Holloway Frank (c; Lucinda) 3 (o) emp C of Hollis James H (c) (o) lab Buckeye Cotton Oil Ga Ry h 505 (472) Alabama (SM) Co h 913 Pio Nono Holloway Gus (Callie Mae) peach pkr r 612 Hollis Johnnie (c) (o) tchr Unionville Sch h 255 Elm 4th (V) Holloway James (c) cook Plaza Cafe r 234 Hollis Louise sten Southland Coffee Co r 163 2d Tdfflir Hollis Mayburn J (Edna) doffer Bibb Mfg Co Holloway Jas (c; Leila) lab Taylor Iron Wks h 818 Main (EM) h 1313 1st Hollis Moses (Callie) 2 r 163 2d Holloway Jas Jr (c) r 1313 1st Hollis Nell elk Kash & Karry Mkt r RD 2 Holloway James C (Myrtle V) (o) bus opr Ga Bloomfield rd Power Co h 108 Montpelier Hollis Primrose (c) dom W P Jones h 522 (509) Holloway James C (c) hlpr A W Wright r 408 Middle (EM) Crisp Hollis Thos Jr (c) r 107 (152) Richard (U) Holloway Jas J student r 301 Hendley Hollis Thos (c; Mabel) 5 tr dr Central Cotton Holloway James M elk Rogers Stores r 108 Oil Co h 107 (152) Richard (U) Montpelier ,, . Hollis Victoria (c) Idry r 234 Calhoun Holloway James M (Rosa) (o) eng So Ry h Hollis Virginia (c) r 230 Plant (SM) 771 Walnut Holloman Elvenia (c) 3 h 178 Park Hotel al Holloway James M elk Rogers Stores r 108 Holloman Felix (c; Emma) emp Atlantic Ice & Montpelier Coal Co h 706 (446) Charles Holloway Janie M (c) maid O R Thompson h Holloman Ira (c) lab Maxwell Bros r 142 Bay 144 Pecan, Holloman James (c; Rose) gro 98 (113) Forest Holloway Jeff (Ethel) 3 firemn Standard Tool (V) h 214 Brent & Handle Co h 121 Rutherford (SM) Holloman James F Jr elk O R Sowell r 563 Holloway Jessie (c) 3 (o) h 168 2d (V) Woolfolk Holloway John C (c) lab r 408 Crisp Holloman James F (Clyde) 1 emp Spillers Res- Holloway Lewis M (Pearl) h 108 (107) Bell taurant h 563 Woolfolk Holloway Lillie M (c) cook L D Porch r 505 Holloman Jewel elk Ivey-Turner Ice Cream Co (472) Alabama (SM) r 563 Woolfolk Holloway Lucius G asst mgr Macon Cred Bur Holloman John (c; Lucile) lab Buckeye Cotton r YMCA Oil Co h 311 (11) Henderson (SM) Holloway Maggie r 2615 Broadway Holloman Mabel (c) 1 h 116 (230) Stewarts al Holloway Martin (c; Lillie) farmer h 62 Holloman Pinkie (c) r 334 Hammond Water (EM) Holloman Reid (c; Nettie) 3 swtchmn C of Ga Holloway Mary T (wid J B) (o) h 477 Duncan Ry h 710 Charles Holloway Maurice (Aline) (o) h 302 Fort Hill Holloman Susie r 413 Ross Holloway Oscar (c; Mattie) h 304 Crisp Holloman Tracy elk Chichester's Tatnall Sq Holloway Patk G h 2615 Broadway Drug Store r 413 Ross Holloway Paul mach opr So Ry r 2615 Broad- Holloman Tracy Jr elk A&P Tea Co r 413 Ross way Holloman Annie (c) 1 maid Geo Nottingham h Holloway Porter (c; Lena J) (o) lunch rm 87 333 Monroe (V) (128) Forest (V) h do Hollomon Clinton (Viola) 2 mach Bibb Mfg Co Holloway Roland M (Mattie L) 1 (o) (Macon h 515 Linden Butter Co) h 301 Hendley Holloman Collie V bkpr Mitchell & Williams Holloway Ruby (c) h 408 Crisp Co h 413 Ross Holloway Ruby slswn S H Kress Co r 253 Hollomon Ellis L (Martha) 1 (o) carp C of Ga Ell (SM) Ry h River rd (NH) Holloway Ruth Mrs 1 r 100 Anthony rd Hollomon Emmett (c) r 333 Monroe (V) Holloway Sam (c) farmer r 62 Water (EM) Hollomon Howell (Lillian) hlpr r 208 Wash- Holloway Wilbert (c) cook r 211 Madison (V) ington Holloway Wm M (c: Mary) 1 (o) lab C of Ga Hollomon Jack C emp Bibb Mfg Co r 515 Ry h 100 (110) Blount Linden Holloway Wilma (c) cook Ira Kaplan r 211 Hollomon Jesse (c) r 212 Woodliff Madison Holloman John (c) delmn College Hill Pharm Holman Bessie nurse Macon Hosp r do r 333 Monroe (V) Holmes Alfonso (c; Hattie J) 1 jan Macon Hollomon Kate (c) r 333 Monroe (V) Chamber of Commerce r 307 Womack Hollomon Kate Mrs slswn Mangels of Ga r 151 Holmes Alicia (c) smstrs r 93 (122) Forest (V) Park PI Holmes Amy L (c) dom Leonard Berg r 108 Hollomon Ollie (c) maid r 212 Woodliff (158) Thomas Hollomon Wilburn A carp r 1530 2d Holmes Anne student r 106 Vista cir (I) 280 Baldwin's and Telegraph's Holmes Annie (c) 3 lndrs r 111 Short la Holmes Mary J tchr A L Miller High Sch r 475 Holmes Annie G Mrs r 475 Monroe (V) Monroe (V) Holmes Arlie O (Estelle) 2 elk W E Hamlin h Holmes Minnie R (Mrs F S) (o) (Mansfield 361 Church (EM) Dray Line Co) h 463 Orange Holmes Arcelius (c; Nancy) 3 lab Cherokee Holmes Myra (c) hlpr Sunlite Electrik Bake Brick Co h 436 Hammond Shop Inc r 105 (5) Alabama Holmes Bernice smstrs Burden-Smith & Co r Holmes O Wendell (Bunnie) 1 mach Taylor 626 1st Iron Wks h 319 Johnson Holmes Bertha (c) maid r 908 Clayton Holmes Ola M (c) r 409 Peachtree Holmes Cath (c) maid r 1315 Broadway Holmes Oliver C (Mamie L) 2 slsmn Willing- Holmes Chas (c) r 321 Jefferson ham S&D Co h 117 Lamar (V) Holmes Christopher (Ella) lab h 512 Telfair Holmes Parlee (c) 1 h 314 Harris la (SM) Holmes Pearl (c) smstrs h 93 (122) Forest (V) Holmes Clara (c) smstrs r 93 (122) Forest (V) Holmes Pearl L (wid J C) r Nottingham dr Holmes Clayton (c; Rosa) 3 h 208 Northwest Holmes Pete (c) tr dr Kinnett-Odom Co r 453 Boundary Arch Holmes Cornelius (c) lab MD&SRR r 102 (554) Holmes Polly (c) maid J A Murray r 153 Mill Tinsley la Holmes Robt (c) r 409 Peachtree Holmes Curley R (c; Maidie) emp C of Ga Ry Holmes Robt (c) porter Nutting Floral Co r r 203 (704) Henderson (SM) 751 Edgewood Holmes Dollie (c) cook G M Rickards r 117 Holmes Rosa (c) baker Macon Cafeteria r 208 Spring Northwest Boundary Holmes Edw (c; Dolly) lab h 4 Short (EM) Holmes Ruth T (c) tchr Ballard High Sch r Holmes Eliz (c) r 726 (8) Reynolds al 121 Chestnut Holmes Emma (c) cook r 204 Green Holmes Sami (c; Amanda) 2 (o) mus h 412 Holmes Estelle Mrs spooler Bibb Mfg Co (125) Bartlett Holmes Ethel cook G G Nutting r 211 Hawkins Holmes Sarah E (wid W H) r 14 Lake Holmes Evalene (c) maid Flanagan's Camp r City (EM) 123 (157) DeBorde (SM) Holmes Shye student r 98 Osborne pi (I) Holmes Evaline (c) r 312 Telfair Holmes Taylor (c) r 245 (649) Womack Holmes Fannie (c) (o) h 203 (704) Hender- Holmes Taylor (c; Henrietta) curtain stretcher son (SM) h 375 Madison (V) Holmes Flora (c) 1 waitress The Tavern h 263 Holmes Viola (c) h 137 (r) 2d (V) North Holmes Viola (c) 1 r 138 e Ell Holmes Fredk emp Willingham Mill h 122 Holmes Walter r 203 (704) Henderson (SM) Stratton Holmes Wilder C emp Central Ry r YMCA Holmes Garrett (c; Sallie) (o) plstr R L Clarke Holmes Wm (c) h 117 (13) Frank al h 473 Douglas (V) Holmes Wm (c) h 211 Hawkins Holmes Geo (c; Fannie) lab h 15 (4) Para- Holmes Wm B (Ethel) 1 (o) (Macon Dental dise al Depot) and dentist 556 Mulberry h 106 Holmes Grant (c) dom 205 (r) Hartley (CP) Vista cir (I) r do Holmes Wm D (c; Ida M) 1 r 122 New Holmes Hattie J (c; Alphonso) maid Burden Holoman Zelner (Kate) r 151 Park pi Smith & Co r 307 Womack Holsenbeck F Dorsey (May S) mgr shoe dept Holmes Inez (c) 1 r 120 Jones McCommon Bros h 197 Laurel Holmes James emp Crescent Ldry r 162 Jeff Holsenbeck Helen E (wid W H) (o) h 771 Davis Spring Holmes Jas (c; Mary) lab Willingham S&D Holsenbeck Howard student r 197 Laurel Co r RD 5 Holsenbeck R Ross r 771 Spring Holmes John (c; Eula) emp Macon Hosp h 914 Holsenbeck Thos R (Maggie) 1 trav slsmn r Hazel 136 Winship Holmes John (c; Doshia) porter MD&SRR h Holsey Lillian (c) 1 emp So Crate & Veneer 229 Orange Co r 511 Hazel Holmes John H (c; Evalene) 3 delmn Ga Pow- Holsey Temple CME Ch (c) Elisha McNair er Co h 123 (157) DeBorde (SM) pastor 261 Washington Holmes John P (Kath) 2 (o) phys 101 Doctors' Holster Carrie (e) h 12 Murray al bldg h 206 Overlook (I) Holston Alice A (wid T E) emp Bibb Mfg Co Holmes Jos A (Marie E) 1 (o) elk So Ry h 128 h 553 Main (EM) Ponce de Leon (SM) Holston Chas dormitorymn Federal Transient Holmes Julian O student r 117 Lamar (V) Bur r 504 Plum Holmes Leon M (Maysie L) 1 mach Taylor Iron Holston E Julian emp Bibb Mfg Co r 553 Wks h 201 Newberg (SM) Main (EM) Holmes Lewis (c; Mabel) elevatormn Macon Holston F A engr Jeffreys-McElrath Mfg Co Saving Bk h 1600 1st Holston Fannie (c) (o) lndrs h 22 Berthadale Holmes Lewis (e; Laurene) 3 emp Ga Power Co h 23 Parker (V) Holmes Lilian (c) cook r 105 (5) Alabama Holmes Lillian (c) emp Independent Ldry Co r 1600 1st Holmes Lizzie (c) (o) smstrs 405 (508) Prince dr (V) Holston Mildred r 553 Main (EM) Holston Thos sta atndt J A Gordon Holt A Flewellyn h 540 Washington HOLT A FLEWELLYN JR (Aurelia) (Holt & Hanberry) Vp A T Holt & Co, r 540 Wash- (SM) h do ington--tel 4230-J Holmes Lucinda (c) (o) h 127 Bartletts la HOLT A T CO, Oscait L Martin Pres, A Flewel- Holmes M Anne Mrs tchr Alex Sch No 4 r 702 lyn Holt Jr Vp, James W C Mathews Sec- Napier Holmes Maggie (c) maid r 263 North Holmes Mamie (Mrs C B) h 475 Monroe (V) Holmes Mariah (c) maid L H Johnson h 208 Middle (V) Treas, Real Estate, Rentals and Loans 569 Mulberry--tels 946-947 Holt Adam (c; Alice) 2 coal roller City Bd of Water Comrs h 101 Mutual (V) Holt Adam Jr (c) r 101 Mutual (V) 1935 Macon City Directory 281 Holt Alma, (wid I C) 1 (o) h 321 New apt 2 Holt Annie (c) Indrs r 114 Sapp (U) Holt Apartments 321 New Holt Beatrice (c) 2 maid H B Adams h 411 Ward (V) Holt Carrie r 687 College Holt Carter (c) bellmn Hotel Southland r 520 New Holt Chas (c; Minnie) emp Macon Milling Co h 505 Edison Holt Edw (c; Ella) 4 h 155 Bright al Holt Fannie (c) r 339 Monroe (V) Holt Fannie (c) probation officer County Ju- venile Court h 147 (210) Nussbaum Holt Frances M tchr Joseph Clisby Sch h 109 Culver (V) Holt Frank (c) lab Cherokee Brick Co Holt Frank Jr (c) lab Cherokee Brick Co HOLT HAMILTON T (Melva) 2 Pres Clark Me- morials Inc, r 2502 Forsyth rd--tel 68 .. Holt Harriett (c) r 101 Mutual (V) Holt Harris (c) r 222 Patterson Holt Ida (c) (o) cook C J Clark h 142 (5) Brooklyn (S) Holt Ida M (c) 3 maid C H Farmer r 101 Mutual (V) Holt Ira C student r 321 New apt 2 Holt J C (c; Clara) 2 h 108 Ruby (V) Holt Jack W student r 2502 Forsyth rd Holt James (c) emp Macon Hosp r 1157 Oglethorpe Holt Jeff (c; Cora) 1 lab r 11 Ross St pi Holt Jerry (c; Ruth) swtchmn C of Ga Ry h 124 Elm Holt Jesse R (Olga S) emp Bateman Co Inc h 631 Vineville (V) Holt Jesse R Jr (Eliz S) (Central Sign Co) r 631 Vineville Holt Joseph (c) gro 310 Green h do Holt Katie (wid I F) r 140 Bacon Holt Lillian sten J P Snelling r 2720 Forsyth rd Holt Mamie L (o) prin Chas H Bruce Sch h 728 Napier Holt Miles F (Esther) 1 (o) emp So Ry h 140 Bacon Holt Miles F Jr (Bertha Lee) 1 pntr h 120 Bacon Holt Olga elk FERA r 631 Vineville Holt Olga L r 216 Bright (SM) Holt Ora (wid J H) r 622 Main (EM) Holt Sami (c; Annie M) 3 farmer h 100 Sapp (U) Holt Silas (c) emp Snow's Ldry h 339 Monroe Holtzclaw Essie Mrs 3 h 310 Reid Holtzclaw Vertis (Pansy) 1 doffer Bibb Mfg Co h 723 Hawthorne Home Owners Loan Corp G G Toole dist mgr 206 First Nat Bk bldg Honea Dock (c) lunch rm 115 Telfair h do Hood Cleveland (c; Susie) 6 lab h 359 Hazel Hood Exie (c) cook B E Willingham Jr r 712 3d (V) Hood Frank (c; Exie) h 712 3d (V) Hood Isaac M (c; Eva) 3 trkr C of Ga Ry h T10 Hazel Hood Jack mech S E Greyhound Lines Hood Jesse (c; Mamie) 1 emp Dempsey Hotel r 359 Hazel Hood Laura (Mrs R A) tex wkr Bibb Mfg Co r 21 Lake City (EM) Hood Marshall H (Miriam) 2 engr C of Ga Ry h 123 Clisby pi TT . Hood Maude R (wid T W) smstrs Union Dry Gds Co h 233 Bond apt 1 ^ Hood Muriel opr Ethel B Davis Beauty Shop r 233 Bond apt 1 Hood Robt A (Laura) 4 emp Bibb Mfg Co h 21 Lake City (EM) Hood Robt E (c; Emma), h 176 Hazel Hooker Bell (wid J M) r 306 Washington Hooker Ernest O (Sadie) 3 (o) slsmn Goldgar Furn Co h 167 Ell (SM) Hooker Henry C (Genie M) 2 swteh tndr C of Ga Ry h 110 Paul Hooker John P r 258 Irving (Lynmore Es- tales) Hooker Mary opr Adams Mfg Co r 123 Yates Hooker Mildred W r 258 Irving (Lynmore Estates) Hooker Ramon F (Eunice) 2 emp C of Ga Ry r 278 Ell (SM) Hooker Wm E tr dr Middle Ga Lbr Co r 258 Irving (Lynmore Estates) Hooker Wm E P (Lucy) (o) iron mldr Paul Williams Co h 258 Irving (Lynmore Estates) Hooks Chas (c) picker Bibb Mfg Co r 228 (721) Pear Hooks Clara B student r 315 Bond Hooks Dessie M (c) 1 hlpr Maxwell Bros r 526 e 2d (EM) Hooks Fannie (c) h 509 (r) Monroe (V) Hooks H Julian (Mattie L) opr Bibb Mfg Co h 843 Hazel Hooks Isaac (c; Mollie) h 228 (721) Pear Hooks Isadore (c; Bertha) 2 emp Maxwell Bros h 103 (203) Elliott (V) Holt Terrell H tchr Winship Sch r 728 Napier Holt W A (Vera) dr Southeastern Greyhound Lines r 321% 1st Holt Walter (c) lab r 753 3d Holt Wardine F r 728 Napier Holt Willie (c) maid J B Hill r Glen Coe Spring rd HOLT & HANBERRY (A Flewellyn Holt Jr, Richd L Hanberry) Printers, 367 Broadway-- tel 3106 (See Page 95) Holton H Beach (Mattie) slsmn r 750 2d Hooks James B (Jane) 2 carder Bibb Mfg Co h 725 Hawthorne Hooks James D (Kate W) underwriter Murphey-Taylor & Ellis h 140 Jefferson Hooks James F emp Bibb Mfg Co r 48 Hydrolia Hooks Lucile (wid F F) h 48 Hydrolia Hooks Margt sten Dennis & Dennis r 140 J efferson Hooks Mollie (c) clnr Bibb Mfg Co r 228 (721) Pear Hooks Onree student r 48 Hydrolia Hooks Rosa M (c) 2 r 406 e 2d (EM) Holton H Fredk dr Yellow Cab Co r 150 2d Holton John H (c) presser Crow's Toggery HoIoQks(*7}RuPfnurnsfli<(c!P; nAllice) lab Maxwell Bros n Tailors HOOKS THOS W (Hotel Lanier) r Hotel Holton Jonnie (wid W F) r 109 Florida Lanier--tel 2771 Holton Marie r 109 Lamar (V) Hooks W Glenn (Clara B) dist mgr Mut Bene- Holton May student r 750 2d fit Life Ins Co r 315 Bond Holtzclaw Benj W (Mary M) engr Taylor Iron Hooks Wm (c; Anna) (o) h 158 Lynwood (V) Wks r 206 Clayton Holtzclaw Earl J (Edith) doffer Bibb Mfg Co h 1037 1st Holtzclaw Edith (Mrs E J) winder Bibb Mfg Co r 1037 1st Hooper Bertron (c) agt N C Mut Life Ins Co r 301 Hawkins Hooten H Clifford (Odelle) 1 prsmn Macon Evening: News h 102 Grace Hooten Gordon (Tommie) 1 mgr So Bell Tel Co r 104 Pio Nono Hooten J T (Evelyn) 1 ins Progressive Life Ins Co h 203 Central (SM) Hoover Clyde H baker Am Bakeries Co r 868 2d Hoover Ella Mrs r 218 Chappell (SM) Hoover Jack mech r 6 Moore (SM) Hoover Louis r 310 Heid Hope Della (c) r 145 Middle (V) Hope Edw (c) 1 (o) swtchtndr Terminal Co h 145 Middle (V) Hope Fannie (c) r 145 Middle (V) Hopkins Alma (c) cook r 106 Ruby (V) Hopkins Angie (c) lndrs r 752 Center (EM) Hopkins Annie M (c) r 605 4th (WH) Hopkins Chas (c; Fannie) hlpr Coca-Cola Btlg Co h 124 (120) Tatnall Hopkins Clarence (c; Nettie) tr dr Kinnett- Odom Co h 462 Chestnut Hopkins Daisy (c) dom r 387 Melrose Hopkins Eliz (c) h 111 (6) Braswell la Hopkins Ellie M (c) maid J C McCullough r 104 Rock Hopkins Emma (c) r 812 Edgewood Hopkins Ernest (c; Mary) 1 h 7 White al Hopkins Geo (c; Eliza) 1 h 107 Sapp (U) Hopkins Geo (c; Lucile) porter Rogers Inc r 945 Montpelier Hopkins Gussie (c) 1 dom r 302 (202) 2d (U) Hopkins Katie (c) h 111 Mulberry Hopkins Leila (c) maid C H Gregorie h 222 Lynwood (V) Hopkins Marie L (wid E M) r 205 Albemarle pi (I) Hopkins Mary (c) maid Middle Ga Hosp r 7 White al Hopkins Milton (c) r 812 Edgewood Hopkins Moody (c) h 5 Bears al Hopkins Nettie (c) lndrs h 462 Chestnut Hopkins Obie (c; Annie) 1 lab Central Cotton Oil Co r 152 Moore al Hopkins Rhoda (c) r 387 Melrose Hopper B Eliz r 110 Kemper Hopper Chas F (Bertha M) 4 (o) shop formn Yellow Cab Co h 110 Kemper Hopper Lizzie r 467 Monroe (V) Horgan Danl C (Edith) (o) (Idle Hour Nurs- eries) r RD 1 Forsyth rd Horn Earl B (Lona) 2 line formn So Bell Tel Co h 507 Flamingo dr Horn Emla F (wid R J) opr Happ Bros Co r 334 Clinton Horn Frank (c) trkr C of Ga Ry r 2 Bertha- dale dr (V) Horn Lillie (c) (o) h 2 Berthadale dr (V) Horn Luther (c) h 211 Elm Horn Myrtle (c) 1 r 130 Moughon (V) Horn Susie cook r 111 Tatnall la Hornbuckle Aymer P (Bertha) 1 power hse engr C of Ga Ry h 101 Hill (LCHts) Hornbuckle Ruth K sten Bankers H&L Ins Co r 101 Hill (LCHts) Horne Alex J emp So Ry h 2531 2d Horne Annie M (c) maid Capitol Hotel r 1335 1st Horne Bertha Mrs spinner Bibb Mfg Co Home Byrd (c; Susie) 2 hlpr So Ry h 152 5th Horne Carrie (c) r 354 Pine Horne Chas L (Rosa) 3 tex wkr Atlantic Cot- ton Mills h 34 Atlantic Village Horne Danl W (Harriet) 1 (o) slsmn Macon Coca-Cola Btlg Co h 106 Grenada ter Horne Edgar B (Irene) h 2924 Houston Horne Effie May Mrs h 461 New HORNE EUG (Velda) 3, Lawyer 3-4 Washing- ton Bldg--tel 2681, h 773 Winton--tel 2614-M Home Frank elk Sterchi's r 425 Forsyth Horne Frank elk Chapman's Groceteria r 108 Newberg Horne Frank H (Pearl) 1 (o) rate elk So Ry h 101 (108) Newburg (SM) Horne Gladys marker Snow's Ldry r 815 Cherry Horne Gus E (Vinie Mae) 2 tex wkr Atlantic Cotton Mills h 27 Atlantic Horne Hubert W (Eliz A) 3 pntr h 106 Newberg (SM) Horne Ida (wid C R) 3 r 321 Randolph Home J Benj (Margt) (o) 1 eng C of Ga Ry h 646 Forsyth Home J Gilbert (Mattie) 4 mach Willingham S&D Co h 815 2d Horne J Gilbert Jr student r 815 2d Horne James (Mary) tex wkr Atlantic Cotton Mills h 36 Atlantic village Horne James student r 131 (101) Charles Horne James (Marie) trav slsmn r 646 Forsyth Horne Joseph E (Mae) 6 h 1161 (r) Milledge- ville rd Horne Julia student r 106 Grenada ter Horne Kath r 111 Violet Horne Leila Mrs beautician Dannenberg's r 111 Violet Horne Leila (c) 2 maid R T Cline r 327 2d (V) Horne Leola (c) cook Mrs Flora Backer Horne Lillie Mae r 34 Atlantic Horne Lizzie (c) ldry wkr r 358 Ash Horne Lonnie H (Bertha) emp Ga Caro Oil Co h 307 Chappell (SM) Horne Louise r 131 (101) Charles Horne Mamie (c) cook H E Turner r 432 Coles la Home Martha sten Stecher-Traung Lithograph- ing Corp r 209 1st Horne Mary tchr Whittle Sch r 533 Orange Horne Pearl (c) cook r 112 (850) Singleton's la Horne Phillip (c; Louise) emp Swift & Co Oil Mill h 256 Bright (SM) Horne Phillip Jr (c) jan J E McCormick r 256 Bright (SM) Horne Stewart (c) 4 lab C of Ga Ry r 167 (319) Nussbaum Horne Thos (c) student r 167 (319) Nussbaum Home Virginia student r 106 Grenada ter Horne Virginia Mrs r 307 Chappell (SM) Horne W Fredk (Irene) (o) carp h 106 Ell (SM) Horne Wm H (c) jan First Christian Ch h 358 Madison (V) Horne Wm H Jr (c) r 358 Madison (V) Horne Wm N (Lucy) mach Taylor Iron Wks h 111 Violet Hornsby Annie M (Mrs Paul) emp Bibb Mfg Co r 116 Yates Hornsby Paul (Annie M) 1 emp Bibb Mfg Co h 116 Yates Horton Annie (c) r 127 (1) Rockhill la Horton Annie (wid J M) h 316 Spring Horton Archie W (Maggie) 1 emp Bibb Mfg Co h 9 Bellevue rd Horton Barney (Mary) 4 h 322 Reid Horton Bessie slswn S H Kress Co r 858 Cherry Horton Carrie (wid N J) r 554 Hawthorne Horton David (Florine) 1 picker Bibb Mfg Co h 22 Brigham (PM) Horton Dolly (c) lndrs r 1164 Ocmulgee Horton Eddie (c; Mary) 2 hlpr Maxwell Bros h 576 Siam Horton Eliz r 135 Gordon Horton Ellis (Leola) 1 emp Bibb Mfg Co h 7-8 Bellevue rd 1935 Macon City Directory 283 Horton Emmett emp Bibb Mfg Co r 99-100 HOTEL CENTRAL (See Central Hotel) Green (PM) HOTEL DEMPSEY, N M Block Pres, H M Horton Ester (c; Minnie) lab C of Ga Ry h Block V-P and Genl Mgr, E H Block 2nd 923 Pio Nono Vp, E V Barnes Sec-Treas, 363 3d--Tel 4750 Horton Florine ( Mre David) winder Bibb Mfg Hotel Dempsey Barber Shop Hotel Dempsey Co r 22 Brigham (PM) oprs 663 3d Horton G Roswall (Alice) 5 firemn C of Ga Hotel Dempsey Cigar Stand Hotel Dempsey Ry h 211 Log Cabin dr oprs 363 3d Horton Geo E (Myrtle) inspr C of Ga Ry h 135 Hotel Gordon Jake Gordon mgr 313 Cherry Gordon HOTEL LANIER (Thos W Hooks) 525 Mul- Horton Geo E Jr r 135 Gordon berry--Tel 2771 (See Page 89) Horton Harry N case wkr Macon Transient Bur Hotel Lanier Cafe (Hotel Lanier) 525 Mul- r 931 Orange berry Horton Jack B ( Sara) 3 slsmn Dunlap Roof- Hotel Lanier News Stand (G W Burr) 525 ing Co r 316 Spring Mulberry Horton James emp Bbb Mfg Co r 99-100 Green Hotel Macon C G Sloan mgr 315 Mulberry (PM) Hotel Macon Co L S Dure pres W V Davis Horton Jesse L bkpr r 555 Pine sec treas oprs Hotel Macon 321 Mulberry Horton Laura (c) cook h 458 (456) Clinton Hotel Southland O M Tarver mgr 569-71 Horton Leola ( Mrs Ellis) spinner Bibb Mfg Co Broadway r 7-8 Bellevue rd Houge Freeman (Juliette) h 315 (2) (V) Horton Leonard D ( Reba) 3 lab r 512 Ogle- Hough Chas C (Ruth) 5 h 356 (300) Central thorpe av (SM) Horton Lucius J (o) (W O Kinney & Co) h 511 Hough Ruth (Mrs C C) opr Happ Bros Co Ridge (I) r 356 (300) Central av (SM Horton Maggie (Mrs Archie) spinner Bibb Mfg House Annie L (Mrs E J) reeler Bibb Mfg Co Co r 9 Bellevue rd r 80 Short (PM) Horton Mamie 1 r 914 Ash House Dempsey R (Ruth E) 1 signalmn C of Horton Marie S (wid H N) 1 (o)o elk Brown's Ga Ry h 2603 Broadway Book Store h 110 Rogers (V) House Earl J (Annie L) 2 emp Bibb Mfg Co Horton Marion (c; Mary L) tr dr r 633 4th h 8 Short (PM) (WH) House Eileen student r 80 Short (PM) Horton Mattie (wid H) 4 r 250 (308) Pio Nono House Essie (Mrs M P) opr Bibb Mfg Co r Horton Nellie (Mrs W H) winder Bibb Mfg Co 220 (121) Cutters la (EM) r 16 (6) Bellevue rd House Mitchell (Louise) 1 tex wkr Bibb Mfg Horton Pearl spinner Bibb Mfg Co r 99-100 Co r 262 Niagara av Green (PM) House Mitchell P (Essie) 1 (o) h 220 (121) Horton Reba (Mrs L D) tex wkr Southland Cutters la (EM) Knitting Mills r 512 Oglethorpe Houser Beulah Mrs h 4 Moore (SM) Horton Richd (c) 1 h 236 Plant al Houser Danl (c) r 121 (21) Williams la Horton Rubye V opr So Bell Tel Co r 858 Houser Frances student r 236 Hardeman av Cherry Houser Ida (c) 2 r 121 (21) Williams la Horton Thos H (Louise) elk Dixie Cafe & Houser Lonnie (c) h 645 Elm St la Commissary r 1710 2d Houser Mae (Mrs W E) sten Ga Power Co Horton Virgil hlpr City St Sweeping Dept r r 514 Orange 612 Hawthorne Houser Mary A (wid W H) h 514 Orange Horton Wm D (Ada) 2 h 99-100 Green (PM) Houser Nathan (c; Stella) lab So Crate & Horton Wm H (Nellie) 2 speeder hd Bibb Mfg Veneer Co h 110 (201) Elliott Co h 16 (6) Bellevue rd Houser Peter (c) dr S Jones Co Horton Wm, I (Irma) 1 inspr C of Ga Ry h 218 Houser Sami (c; Corine) hlpr Levine Tire & Ormond ter Parts Serv h 122 (260) Singleton la Horwitz Joseph (Ida M) 2 slsmn Dannenberg Houser W Erwin (Mrs) dist aud Ga Power Co & Waxelbaum Co h 753 Poplar r 514 Orange Hose Felton H (Clara) 4 lab' h 556 Woolfolk HOUSER WALTER F (Nora) (o) v-p Jos N Hose Hattie (c) cook Frank Huff r 112 Ell Neel Co h 236 Hardeman av--Tel 2198 Hose Lelia B (wid S J) (o) h 189 Magnolia Houseworth David (c; Fannie) (o) pntr h 363 Hosey Ethel R (c) 1 r 111 Mulberry 3d (U) Hosey Lillian (c) lab S Crate & Veneer Co Houston Avenue Vulcanizing Shop (WB Shep- Hoskin Anna Mrs r 324 Chappell (SM) pard 3000 Houston (SM) Hoskin Emma L (c) cook C A Odom r 113 (13) Houston David (c; Ida) 1 glazier Central S & Alabama D Co h 115 Johnson (SM) Hoskins Charlie delmn Clinton Cash Mkt Houston Katie (c) presser Crescent Ldry r Hoskins Danl H (c; Rosa) 2 lab C of Ga Ry 394 Telfair h 701 Clinton Houston Thos (c) lab So Crate & Veneer Co Hoskins Florine (c) hlpr Independent Ldry r Houston W Bernard (Ruth) 1 (o) bkpr Sawyer 315 (145) e 2d (EM) Coal & Ice Co h 109 St John Hoskins Gabriel (c) emp Bibb Mfg Co Houston Wm (c; Lucile) porter Dunlap-Feeler Hoskins John (c) hlpr Bibb Mfg Co r 701 Clin- Hdwe Co h 237 Chestnut ton Hovey Edwin R (Nina T) agt Equitable Life Hoskins Lillie M (c) student r 701 Clinton Assurance Soc of U S h 119 De Soto pi Hoskins Maggie M (c) r 701 Clinton Howard Ada (c) dom 3 154 Ernest la Hoskins Rebecca (c) nurse r 701 Clinton Hoskins Rosa (c) lndrs r 701 Clinton Hoskins Roy B (Hortie Mae) 1 slsmn Sin- clair Refining Co h 461 Napier Hotchkiss Leonard B Mrs 3 h 849 Hillyer Hotel Arcadia W P Mahone mgr 663 Mulberry Howard Ada (c) cook Jones Collins Howard Adam (c; Leola) 2 lab h 330 Bar- field al Howard Adam (c) lab So Crate & Veneer Co r 102 (302) Plummer's al HOTEL ARLINGTON (See Arlington Hotel) Howard Adell (c) cook Mary N Frierson 284 Baldwin's and Telegraph's Howard Albert (c; Carrie) 1 case aide County Howard Fred hlpr Macon Auto Exch r Y M Relief Admn r 106 Wise av (V) C A Howard Albert R (c; Bessie) h 116 Green (V) Howard Geo (c; Florence) 2 caddie Idle Hour Howard Alberta (c) 2 r 663 Hurley la Golf Club h 1 Barnhart's Bottom Howard Alex (c; Ruby) 2 h 111 Sapp av (U) Howard Geo (c; Corrine) lab Carling Tile Co Howard Allie M (c) 1 maid Mrs Fannie M Taylor h 379 Boardman's al Howard Alvesta (c) student r 119 Neal av (V) Howard Ananias (c; Laura); 5 (o) h 103 (156) Carter (B) Howard Annie (c) h 125 Holmes av Howard Annie (c) h 102 (302) Plummer's al Howard Artis (c; Claudie) lab Power Oil Co h 312 Curd (SM) Howard Banister (c) r 101 (105) Amos (V) Howard Benj (c) r 110 (4) Cedar (U) Howard Benj (c; Lillie M) (1) (o) brklyr h 204 3d (U) Howard Benj (c; Mahala) farmer h 105 Ar- mond av (U) Howard Berry (c; Ola) h 312 (445) Alabama (SM) Howard Bertha (c) cook G A Willis h 112 Neal av (V) Howard Bessie (c) maid G T Cason Howard Carlton m 221 Knott (SM) Howard Carrie (c) r 216 Pond (V) Howard Carrie (c) maid A E Odom r 203 Patterson , Howard Celia (c) r 135 Brooklyn av (S) Howard Chas (c; Beulah) porter Williams Mus Co h 12 Cheatham al Howard Chas (c; Cath) trav slsmn r 150 Lin- coln av (V) Howard Chas (c) tr dr Dixie Dairies r 110 (297) Craft (V) Howard Chas W (c; Esther) pastor h 405 Ward (V) Howard Cherrie L (c) 2 cook T B Martin r 218 Collins pi Howard Clara (c) 1 lndrs h 134 Roosevelt (V) Howard Claudia (c) carder Bibb Mfg Co Howard Cleo J (Mrs Richd) case wkr F E R A r 1353 Edgewood Howard Clifford r 154 Ernest la Howard Clifford (c; Annie) lab C of Ga Ry h 323 Long (SM) Howard Collins (c; Nancy) lab Idle Hour Club h 104 Ernest Howard Danl (c) r 406 (381) Plummer's al Howard David (c) lab' r 126 Cemetery la Howard Dollie (c) hr 154 Ernest la Howard E N uphlstr Muecke & Sons Co Inc r RD 2 Howard Edw (c; Mary) h 105 (128) Kahn's al Howard Edw (c; Marie) 2 emp Bibb Mfg Co h 139 Auburn av (S) Howard Edw (c; Mary) 1 tr dr Atlantic Ice & Coal Co h 206 (407) Campbell av (SM) Howard Edw (c; Inez) 4 tr dr Builders Lbr Co h 119 Johnson (SM) Howard Edw Jr (c; Lila) lab Atlantic Ice & Coal Co r 206 (407) Campbell av (SM) Howard Ella (c) r 204 Woodliff Howard Emma (c) cook r 111 Hardeman av Howard Emma (c) r 200 Church al (SM) Howard Eva (c) h 359 Flanders Howard Felton (c) jan Capitol Theatre r 227 J eff erson Howard Fisher (c; Ruth) 4 carrier P O r 254 Middle (V) Howard Floyd (c) lab r 112 (101) Plummer's al Howard Frank (c; Elnora) h 117 (14) Tinsley la Howard Frank J (c; Sarah L) (o) postmn h 119 Neal av (V) Howard Frankie (c) tchr Pleasant Hill Sch r 119 Neal av (V) h 132 Bright al Howard Geo (c; Mary) pntr r 78 (135) Forest av (V) Howard Georgia (c) cook E B Saye Howard Gus (c; Bessie) 2 h 302 Gordon (CH) Howard Haines M (c) r 473 Chestnut Howard Harry L (Jessie J) msngr City Bd of Water Comrs h 1427 3d Howard Harvey (Margt) 4 lab h 532 Telfair (SM) Howard Hattie (c) r 645 Elm St la Howard Hattie (c) r 126 (494) Virgin (V) Howard Hattie (c) cook J E Sammons Howard Hayes (c; Louvinia) 5 jan W D Grif- fith & Son h 209 (125) Virgin la (V) Howard Haynes (c; Mattie) 2 tr dr Wood- Peavy Furn Co h 121 Linwood av (V) Howard Henry (c; Mattie) emp Kinnett Odom Ice Co h 103 Price (V) Howard Homer (c; Eddie M) 1 hlpr Maxwell Bros h 111 (102) Long la Howard Horace J (Nora L) 3 h 2906 Houston av (SM) Howard Ida L Mrs 2 r 120 Mill av Howard Idell (c) dom r 52 Parker av (V) Howard Ira (Sadie) 1 tr dr Orange Crush Btlg Co r 734 Anderson (SM) Howard James (c; Anna) 1 del mn O R Sowell h 709 3d (V) Howard James A (Ora) dr Yellow Cab Co r 233 Chappell (SM) Howard John (c; Bertha) h 144 Carling av Howard John (c; Senetta) 1 h 433 Pio Nono av Howard John (c; Lula) h 101 Texas Howard John (c; Mattie) 1 lab h 110 (o) Cedar (U) Howard John (c) student r 405 Ward (V) Howard John B (Cornelia) 1 emp C of Ga Ry r 116 (130) Charles Howard John H (Wiladel) 2 (o) h 126 Pearl Howard John J (e) hlpr Bibb Body & Fender Wks r 405 Ward Howard John R (Sarah E) (o) elk J S Waldorf & Son h 690 College Howard Jordan (c; Jennie) h 19 Short St la (EM) Howard Joseph (c) h 214 Gilmer Howard Joseph elk Great A & P Tea Co r R D 1 Howard Joseph (c) tr dr Yates & Tabor Gro r 124 Rockhill la Howard Joseph O slsmn Johnson Bros r R D Forsyth rd Howard Julian (c) lab Dixie Dairies r 114 (646) Hicks al Howard Julian (c) r 101 (25) Tinsley la Howard Laura (c) h 216 Pond (V) Howard Laura (c) maid J T Matthews h 101 105) Amos (V) Howard Lavercia (c) maid Taylor Furn Co h 261 Madison (V) Howard Leah (c) r 412 Ward (V) Howard Leola (c) r 708 Clinton Howard Lillian (c) r 215 (434) Thompson's al Howard Lillian Mrs r 2036 2d Howard Lillie G (c) 1 (o) h 304 Telfair Howard Lizzie (wid John) r 114 Highland av (LCHts) Howard Lizzie (c) 1 cook h 448 Douglas electrn City of Macon h 681 College--Tel 610 Humphreys Floyd H (Martha) (o) frt traffic rep So Ry h 101 Ridge (I) Humphreys Floyd H Jr elk Economy Auto Shop r 101 Ridge av (I) Humphreys Thos H (Lois) 2 (o) (Macon Sup Co) h 247 Belvedere dr (I) Humphries Adolphus (c; Hattie) lab r 101 2d av (U) Humphries Adolphus (c; Pearl) lab h 450 City Hall la Humphries Albert A store mgr The Great A & P Tea Co r 236 (136) Capitol (Mikado pi) Humphries Anna (c) cook Wm Faulk r 220 Gilmer Humphries Annie (wid J C) (o) h 236 (136) Capitol (Mikado pi) Humphries Chas L (Ida R) (o) h 1014 Clinton rd (EM) Humphries Doris student r 145 Piedmont (SM) Humphries Estee (c) emp Bibb Mfg Co Humphries Eug T (Gladys) 1 coir Kaybee Clo Co r 432 Beech Humphries Homer W ( J Ruth) 5 sgt CPD h 129 Currly pi Humphries J C (c) dr Colored Taxi Co r 779 Reynolds al Humphries John (c; Mamie) lab h 450 City Hall la Humphries Lass r 272 College Humphries Leila (c) r 117 Tindall (SM) Humphries Louis (c; Gladys) 3 lab h 772 Rey- nolds al Humphries Mamie smstrs Snyder's Ready-to- Wear r 1015 Clinton (EM) Humphries Mattie (wid C C) (o) h 272 College Humphries Medie (c; Marie) 3 (o) lab Stand- ard Tool & Handle Co h 318 (319) Williams (EM) Humphries Paul (c; Annie) 1 lab The Standard Tool & Handle Co h 349 Hammond Humphries R E r 115 (227) Elliott Humphries R Sami (Minnie L) 8 (o) genl contr h 145 Piedmont (SM) Humphries R Sami Jr student r 145 Piedmont (SM) Humphries Sami (c; Lily) 1 lab Bibb Mfg Co h 115 (227) Elliott Humphries Sarah J (c) h 503 Gilmer Humphries Silas (c; Ollie) 2 lab Standard Tool & Handle Co h 501 (471) Crisp Humphries Spencer (c; Bessie) swtchmn C of Ga Ry h 254 Broad Humphries W Lawrence (Myrtle) carp r 765 Mulberry Humphries Wm (c; Pearline) 1 lab r 117 Tin- dall (SM) Hundley Roy (c; Mildred) lab Kinnett Odom Co h 11 Gas House al Hunley J Henry (Donnie) carp r 229 Reid Hunnicut Bertha (c) 1 r 801 (814) Cowan Hunnicut Jewel emp Atlantic Cotton Mills r 102 English Hunnicut Mary emp Atlantic Cotton Mills r 102 English Hunnicut Susie emp Atlantic Cotton Mills r 102 English Hunnicutt A Doris slswn H L Green & Co r 423 New Hunnicutt Annie (wid T F) r 210 Davis (SM) Hunnicutt Annie (wid J W) r 210 Henry (Lyn- more) Hunnicutt Berney L (Sallie) 1 coir Bibb Chev- rolet Co h 123 Charles Hunnicutt Bernice elk H L Green & Co r 861 Hemlock Hunnicutt Cath r 1068 Ash Hunnicutt Chas H (Irma) (o) h 535 Vineville Hunnicutt Clarence H (Mamie) 2 tr dr City Scavenger Dept r 754 Cherry Hunnicutt Edw R supt Dixie Roll & Cot Co h 107 1st Hunnicutt Eliz ( wid R W) r 861 Hemlock Hunnicutt Eliz sten Met Life Ins Co r 727 Orange Hunnicutt Eloise Mrs 3 r 512 Hemlock Hunnicutt Emma (wid J P) furn rms 954-58 Cherry h 754 do Hunnicutt Ethel I r 107 3d (SM) Hunnicutt Eug student r 7 Bellevue rd Hunnicutt Gladys (Mrs J I) slswn McCommon Bros 456 3rd Hunnicutt Harry elk Leaptrot's Mkt r 614 Ocmulgee Hunnicutt Isaac M (Lucy E) 2 mach h 1716 2d Hunnicutt J Frank (Lennah) 5 emp C of Ga Ry h 501 Mikado Hunnicutt Jack H r 105 Womack Hunnicutt Jas C (Mildred) 1 (o) engr GS&FRR h 107 3d (SM) Hunnicutt James T (Estelle) 2 cbntmkr Ma- con Cbnt Wks h 1105 Oglethorpe Hunnicutt Jasper N (Margt E) pntr Stroberg Body & Fender Wks r 2457 (2455) 2d Hunnicutt Lucy E (Mrs I M) opr Happ Bros Co r 1716 2d Hunnicutt Luther H (Annie B) emp C of Ga Ry h 105 Womack Hunnicutt Mary J (wid C C) 1 h 322 Georgia Hunnicutt Mollie (wid H C) h 1068 Ash Hunnicutt Ola elk Central of Ga Bkg Co r 1068 Ash Hunnicutt Ruby pkr Swift & Co r 210 Henry (Lynmore) Hunnicutt Sarah (c) Indrs h 426 Lawton Hunnicutt Thos (Estelle) 1 r 1716 2d Hunnicutt Thos J r 501 Mikado Hunnicutt Wm O (Florence) 2 h 2322 2d Hunnicutt Wm O Jr (Mary O) r 2322 2d Hunt Abe (c) r 242 Garden Hunt Addie (c) (o) Indrs h 172 Astor Hunt Albert (c; Lillie) 1 h 278 4th (V) Hunt Andrew (c) emp Bibb Mfg Co Hunt Annie B mus tchr 709 Adams r do Hunt Annie M r 715 American blvd Hunt Barney J slsmn Cannon Shoe Store r 866 Mulberry Hunt Benj (c; Lottie) 1 lab h 301 Short (EM) Hunt Chas B ( Nora) asst supt Macon Peanut & Storage Co r 615 Duncan Hunt Clara (c) emp Snow's Ldry r 1315 1st Hunt Earl W (Mildred) emp Collins Baking Co h 1059 Elm Hunt Edw D r 1059 Elm Hunt Edw D Jr emp Sunlite Electrik Bake Shop r 1059 Elm Hunt Eliz sten Yates & Tabor Co Inc r 198 Crescent (CH) Hunt Elmer (c; Willie M) porter Mayson's h 124 Cowan Hunt Estella (c) 4 r 108 Gustin 290 Baldwin's and Telegraph's Hunt Eula C (c; Jewel) dom C C Tidwell r 608 Hunt Willie M (c) dom R J Graham r 124 4th (WH) Cowan Hunt Eunice (wid E J) blcpr Yates & Tabor Co Hunt's Tourist Camp (L B Hunt) 3300 Hous- Inc h 198 Crescent (CH) ton (SM) Hunt Fanny (wid J O) r 715 American blvd Hunter Aaron J (c; Lois) 1 lab Cherokee Brick Hunt Fannie (c) dom Isadore Hirsch h 236 Co h 811 (129) Charles (140) Cowan Hunter Annie (c) 1 h 248 Division St la Hunt Frances (c) r 429 Douglas (V) Hunter Bertha (c) h 268 Division St la Hunt Helen (c) tchr B S Ingram Sch r 400 Hunter Edw (c) lab r 268 Division St la Davis Hunter Georgia (c) r 771 Edgewood Hunt Henry (c) shpr Bibb Mfg Co Hunter Hattie (c) (o) cook N A Dempsey h 3 Hunt J Carver atndt Shell Petroleum Corp r Center (EM) 251 (352) Blackburn Hunter Hattie M (c) r 100 (205) Amos (V) Hunt J Robt (Ruth) mgr Liggett's Drug Store Hunter Isaac lab' So Crate & Veneer Co h 356 New apt 5 Hunter James (c) lab h 332 Dempsey Hunt Jacob (c; Laura) 1 peddler h 119 (126) Hunter John (c; Virginia) 2 chauf Julia Lamar Phillips la r 237 Chestnut Hunt James R ( Mattie D) (o) evangelist h Hunter Josie B (c) r 811 (129) Charles 159 Jeff Davis (SM) Hunter Lessie (c) 2 lndrs r 104 Peacock Hunt Jefferson B (Lucia R) 2 (o) engr So Ry Hunter Lonnie (c) maid G W Head h 211 Ridge (I) Hunter Maria (c) r 95 Bay Hunt John (c; Lucius) (o) h 401 (342) May- Hunter Mary (c) dom r 421 Hazel nard Hunter Mary (dklndrs r 332 Dempsey Hunt John (c) hlpr Power Oil Co Inc r 417 Hunter Mattie (c) r 318 (616) Plummers al Hazel Hunter Osceola (c) h 320 Monroe (V) Hunt John (c; Rochelle) presser Hill Dry Clean- Hunter Reuben (c) 2 h 315 Coles al ing Co h 223 (130) Grant (V) Hunter Sami B lawyer 316% 2d r RD 5 Hunt John A (Lona B) 1 (o) elk So Ry h 182 Hunter Susie (c) 2 h 226 Calhoun Macon Hunter Sylvester (c; Easterlee) lab C of Ga Ry Hunt John W (c; Willie M) opener Bibb Mfg h 5 (522) Waterville rd Co h 608 4th (WH) Hunter Wm (c; Mary) 2 h 413 (325) Elizabeth Hunt Johnson (c; Louise) hlpr Central of Ga (SM) Bkg Co h 6 Murray al Hunter Wm (c; Robt) 5 pkr Bibb Mfg Co h Hunt Joseph A coir Empire Furn Co Inc r 801 202 Mitchell Pio Nono Hurd Wm B (Beulah) 2 barber Federal Tran- Hunt Katie (c) r 119 (126) Phillips la sient Bur r 763 Cherry Hunt Laura (c) cook r 119 (126) Phillips la Hurlbert Harry M (Bertha) 2 h 222 Ayers rd Hunt Letcher B (Hunt's Tourist Camp) h 101 (B) Villa Esta Hurley Electric Co (R W Hurley) 452 Cotton Hunt Letcher B Jr atndt Hunt's Tourist Camp Hurley Elenor G student r Jackson Spring dr r 101 Villa Esta (SH) Hunt Lillie (c) cook r 278 4th (V) Hurley Eliz B sten Am Bakeries Co r Japkson Hunt Lizzie (c) 2 h 408 e 2d (EM) Spring rd (SH) Hunt Lizzie D (c) 1 r 418 Elliott Hurley Leila M (c) (o) maid J E Hall h 149 Hunt Lorena (c) r 119 (126) Phillips la 2d (V) Hunt Lucy G (wid R H) (o) h 114% Rogers Hurley Madge r 127 High (V) Hurley Robt W (Ruth) 2 (Hurley Elec Co) h Hunt Mary (c) maid) r 700 (702) 3d (V) 255 Bond Hunt Mollie r 111 Pio Nono Hurley Ruth W (Mrs R W) bkpr Hurley Elec Hunt Nan E elk Murphy Taylor & Ellis r 114% Co r 255 Bond Rogers Hurley Thos A (Mary) 1 (o) phys 567 Walnut Hunt Nicie (c) (o) h 359 (355) North h Jackson Spring rd (SH) Hunt Nora (Mrs C B) bkpr Macon Storage & Hurst Eliz (Mrs E T) nurse 1322 2d r do Peanut Co r 615 Duncan Hurst Ellis T (Eliz) elk Mack Pur Co r 1322 Hunt O Sidney (Johnnie G) slsmn Burden 2d Smith & Co r 440 New Hurst Frank C baker Am Bakeries Co r 868 2d Hunt Obie (c) (Lizzie) h 14 Spring Hurst John P (Clyde) 1 (o) elk P O h 14 Mar- Hunt Raymond (c; Maggie) 1 h 417 Hazel ion pi Hunt Robt (c) 2 h 611 (240) Hall (EM) Hurst Lois serv rep So Bell Tel Co r 209 1st Hunt Sylvester (c; Mary) porter Bibb Chevro- Hurst Louise (Mrs W E) emp Bibb Mfg Co r let Co h 700 (702) 3d (V) 224 (115) Ayers rd (B) Hunt Thos B (Emily) 1 tex wkr Atlantic Cot- Hurst Morgan (c) lab C of Ga Ry r 212 ton Mills h 234 Oak Haven Roosevelt (V) Hunt Thos C (Dossie) slsmn So Cotton Oil Co Hurst Needham W (Ethel K) (o) h 204 Ridge h 251 (352) Balckburn Hunt Thos J (c; Elnora) (o), barber 413 Cotton (I) Hurst Olin L (Kate) physio-therapist The Clin- h 705 3d (V) ic h 855 Walnut apt 3 Hunt Ulysses (c) emp Bibb Mfg Co Hurst Robt F elk Ga Power Co Hunt Virginia L r 101 Villa Esta Hurst Ruth slswn Union Dry Gds Co r 763 2d Hunt Wm G (Annie B) (o) eng So Ry h 709 Hurst Stanford B bkpr C D Kenny Co r 204 Adams Ridge (I) Hunt Wm H (c; Mary) (o) emp Bibb Mfg Co Hurst Walter E (Louise) 2 h 224 (115) Ayers h 407 Maynard Hunt Wm J atndt Hunt's Tourist Camp r 101 Villa Esta Hunt Wm J (c; Nettie M) porter Bob Stephens Barber Shop h 140 Washington | rd (B) Hurt Andrew (c; Mabel) lab h 113 (354) Spring la Hurt Paul emp Snow's Ldry r 715 2d Hurtt Jewell (Mrs K E) mgr Milady Clnrs r 727 Orange 1935 Macon City Directory 391 Hurtt Kolin E (Jewell) tr dr Milady Clnrs r ' Hutchins Minter (c) lab C of Ga Ry 727 Orange Hutchins Ophelia (c) dom J A Mitchell Huston M Alf Jr student r 713 2d Hutchins Wm (c; Emma) 2 lab r 703 (207) Huston Myron A (Frances) emp Macon Auto Colquitt Co h 713 2d Hutchinson Ernest elk C-M-P Drug Co r 811 Hutchens Oliver (c) r 131 (209) Elliott Poplar Hutcherson Ethel J Mrs spooler Bibb Mfg Co Hutchinson Ethel Mrs emp Bibb Mfg Co r 821 Hutcheson Henry E creeler Bibb Mfg Co r 267 2d Maple Hutchinson Otis R emp Ga Power Co Hutcheson Jesse L emp Bibb Mfg Co r 267 Hutchinson Paul (Agnes) 2 emp Fairyland Maple Dairy h 100 Grace Hutcheson John H (Carrie) 1 speeder hd Bibb Hutchinson Sallie (c) 1 r 923 Clinton rd (EM) Mfg Co h 267 Maple Hutchison Alton L (Elise) 1 serv mgr Power Hutcheson Pearl (wid Lingo) 3 opr Happ Bros Oil Co h 852 2d Co h 869 2d Huthnance Alice M (wid E D) (o) h 747 Col- Hutchings Beatrice (Mrs H H) emp Southland lege Knitting Mills r 127 Oakland Huthnance Annie D (wid F A) 1 (o) h 122 Log Hutchings Bertha (c) 1 r 134 Woodliff Cabin blvd HUTCHINGS CHAS H (c) (o) Pres Hutch- Huthnance Edw D opr Proctor & Gamble Mfg ings Funeral Home, h 239 2d (V)--Tel 1528 Co r 122 Log Cabin blvd Hutchings Clarence P 1 elk C of Ga Ry h 811 Huthnance Jodie r 800 Orange Poplar apt 5 Huthnance Lena sis Union Dry Gds Co r 800 Hutchings Danl (c; Mittie) lab' h 867 Ocmulgee Orange Hutchings Emma K (c) 1 cook White House Huthnance Martha C cash Mary Ann Beauty Weiner Stand h 134 Woodliff Shop r 122 Log Cabin blvd HUTCHINGS FRANK J --Tel 6438 Jones C Baxter Jr student r 101 Osborne pi (I) Jones C Columbus (c; Mattie) 3 emp Webb Coal Co h 126 (228) Green (V) Jones C Earl farmer r 203 2d (WH) Jones C J (c; Helen) 2 r 306 Strayers al Jones C (Virgil (Frances) 5 (The Green Front) h 101 Helen Jones Calvin (c) r 407 Mason Jones Carl (c) student r 9 Spring Jones Carl C (Christine) 5 tex wkr h 105 De- witt Jones Carlton (c; Mattie) 4 (o) lab h 387 Mon- roe (V) Jones Carlton C slsmn Sawyer Coal & Ice Co res Cross Key3 Ga Jones Carrie (c) h 247 (255) 5th Jones Carter Jr (c; Ada M) delmn Willingham Gro Co r 513 Forsyth Jones Cecil emp So Bell Tel & Teleg Co r 521 College Jones Cecil hlpr r 523 Jackson Jones Chapel Cemetery Cedar (SM) Jones Chas (c; Elnora) 1 emp T & T Packing Co r 702 (320) Colquitt Jones Chas (c) porter Ry Exp Agcy Jones Chas (c; Mary) tailor h 9 Spring Jones Chas F tex wkr r 443 (506) Log Cabin dr JONES CHAS S (Alleen R) (o) (Jones & Con- ey), h 761 Winton--Tel 4810-J Jones Chas W (Georgia) (o) capt Pump Co No 5 h 133 Oakland Jones Chas W (Minnie) B) 1 emp So Ry h 2017 3d Jones Chas W (c; Ruby) mech Bibb Mfg Co b 857 Ash Jones Charnie H (Margt) 2 (o) mgr Citizens Loan Co h 697 Ingleside (I) Jones Chester P (Pauline) 2 mach Bibb Mfg Co h 109 (10) Balkcom Jones Clara (wid L M) h 769 Hemlock Jones Clara r 271 Winship Jones Clara (c) 3 lndrs h 562 Plant al Jones Clara (c) (o) sch tchr h 273 1st (V) Jones Clarence (c) mech Fredk Jones r 162 5th Jones Clarence B (Alice) 1 r 508 Carling Jones Clarence G (Essie) 3 elk Palm Pur Co h 704 Woolfolk Jones Claude E (Ivy) 4 (o) firemn Pump Co No 2 h 123 Tenny (SM) Jones Claude F student r 123 Tenney (SM) Jones Claudia R (wid S D) prin Gresham Sch r 320 Orange Jones Clifford (c) h 320 (720) Lexington Jones Clifford (c) cook E F Yearty r 809 Daisy Jones Clifton (c; Ora B) 1 emp Maxwell Bros h 117 Ritchey Jones Colonial (c; Lottie) chauf B C Jones r 118 (137) Kahn's al Jones Connie r 271 Winship Jones Constance (c) sch tchr r 857 Ash Jones Cooper (c; Julia) 1 lab h 216 Fretwell al Jones Cora (c) h 51 Chestnut la Jones Daisy (c) student r 108 Amos (V) Jones Dallas (s) lab serv sta r 224 Forest (V) Jones Dalton J (c; Martha) (o) restr 613% Broadway h 130 Adams Jones Danl (c) delmn Mrs M Otis Dean r 165 Hazel Jones Danl (c) lab Payne Mill r 393 Robinson Jones David (c; Dolly) 3 h 421 Douglas (V) Jones David (c; Daisy) 2 h 921 Hazel Jones David (Louise) 2 barber r 115 (6) Myrtle (EM) Jones David (c) dr Colored Taxi Co r Wall Jones David J (Lena) 4 (o) eng C of Ga Ry h 240 Ell (SM) Jones David L (Edna E) 1 supt Hiphzibah Or- phanage h 3201 Forsyth rd JONES DAVID S (Erma C>, Sec to Mayor and City Purchasing Agent, City Hall--Tel 1880, h 325 Forsyth--Tel 1372-J Jones David S Jr r 325 Forsyth Jones Dollie (wid Henry) h 13 Bibb Jones Dolly (c) cook Mrs Addie C Stone r 421 Douglas Jones Dolly (c) 2 (o) maid Postal Teleg h 301 Gordon (CH) Jones Dolly M (c) cook O P Beall r 301 Gordon (CH) Jones Donie (c) (o) h 417 Ward (V) Jones Doris r 3 Dessau pi Jones Dorothy (c) maid F E Chambers r 216 Collins pi Jones E Lucile sten Ga Power Co r 166 Magnolia Jones Earlie C (Gussie) slsmn Rogers Inc h 245 Winship Jones Edith (c) r 967 Pio Nono Jones Edw (c; Gladys) r 115 (531) Campbell (SM) Jones Edw (c; Sallie) 7 h 3 (103) Mitchell la (EM) Jones Edw (c; Olivia) 3 emp Art Furn Mfg Co r 301 Blount Jones Edw (c; Beatrice) 1 (o) peddler h 103 Simmons Jones Edw student r 655 1st Jones Eleanor emp McKesson-Riley r 512 Washington Jones Elijah (c; Roberta) 1 emp C of Ga Ry h 625 4th (WH) Jones Elijah (c; Eva Mae) 3 lab h 104 e Ell Jones Eloise (c) r 726 (8) Reynolds al Jones Eliza (c) r 229 Orange Jones Eliza (c) h 217 (524) 3d (B) Jones Eliza (c) cook Louise Tharpe Jones Eliz (c) h 110 (113) Magnolia la Jones Eliz (c) cook C E Kanagham r 314 Patterson Jones Eliz tchr Clisby Sch r 117 Corbin (V) Jones Eliz T (wid F R) 2 r 110 Ingleside (I) Jones Ella (wid R C) r 153 Boulevard (NH) Jones Ella (c) r 107 (226) Johnson la Jones Ella (c) r 162 (166) Plummer's al Jones Ella (c) 1 h 6 White al Jones Ella (c) cook Laura A Suber Jones Ella (c) lndrs h 330 2d (U) Jones Ellena (c) r 240 5th (V) 308 Baldwin's and Telegraph's Jones Emma (c) (o) h 1051 Pio Nono Jones Emma (c) 4 h 82 (168) Schofield Jones Emma (c) cook r 1025 3d Jones Emma tchr Ga Acad for the Blind r do Jones Emmett emp Willingham Mills Jones Emory (c) r 333 2d (U) Jones Ernest P (Ada) 1 r 302 Fairmont (B) Jones Escal L r 5 Astor pi Jones Essie (c; Annie) carp r 1226 Broad Jones Estella (c) dom r 513 Forsyth Jones Ethel sten FERA res Lizella Ga Jones Ethel L (c) 1 lndrs r 2 (3553) Duffey's al Jones Eugenia student r 1517 3d Jones Eugenia C tchr Bellevue Sch r 325 For- syth Jones Eula (c) hlpr Wm Jones r 202 (310) Elizabeth (SM) Jones Eunice (c) cook J T McGehee r Pio Nono Jones Eva (c) 1 lndrs h 513 Forsyth Jones Evelyn r 240 Ell (SM) Jones Everett E (Mary) 3 gro 868 Hazel h 866 do Jones Ewell C (Laura) pharm r 824 Curd (SM) Jones Ezell (c) tchr r 387 Monroe (V) Jones Fannie r 1023 Ash Jones Fannie (wid Chester) r 201 Coleman Jones Fannie (c) 1 h 402 (9) Crisp Jones Fannie (c) 1 h 102 (2) Fulton la Jones Fannie (c) 1 r 303 Short (EM) Jones Fannie (wid B D) r 616 1st Jones Fannie (c) cook C L McWaters Jr r 153 Moore's la Jones Fannie (c) student r 920 Montpelier Jones Fannie (c) 1 lndrs Crescent Ldry h 6 (755) Sparks la Jones Fannie (c) maid Terminal Hotel h 466 Vt Cotton Jones Florence (c) 3 h 117 (201) Orchard Jones Florence (c) cook Lula W Patillo h 212 (6) Virgin la (V) Jones Florence (c) tchr Green St Sch h 256 e Elliott Jones Florrie r 829 Burton Jones Frances (c) h 124 Tindall (SM) Jones Frances r 866 3d Jones Frances (c) cook C R Ward r 105 (107) 2d (V) Jones Frances (c) dom Masonic Home of Ga Jones Frances (c) 2 lndrs h 17 (130) Witkow- ski's I3, Jones Frances C sten R C Goolsby r 512 Wash- ington Jones Frank (Bessie) 6 h 1532 Broadway Jones Frank (c; Pearl) 1 farmer h 137 Davis , (Jones, Johnston, Russell & Sparks), h 339 Hardeman --Tel 872 Jones Geo T emp So Ry shops r 508 Carling Jones Geo T Jr sta atndt Standard Oil Co r 512 Washington Jones Georgia E r 255 Montpelier Jones Georgia M (c) cook H G Williams Jones Gladys r 240 Ell (SM) Jones Gladys (c) lndrs Crescent Ldry r 215 Elliott Jones Glenn E (wid J W) h 261 High Jones Grace pkr Stansell Potato Chip & Sandwich Co Inc r 202 Ridge (I) Jones Grover C (Florence) 1 (o) osteopath 609 Bibb Bldg h 212 Corbin (V) Jones Grover J (Mary G) (o) gro 3481 Houston h 204 Ormond ter Jones Gussie Mrs junior boys matron Masonic Home of Ga r do Jones Gwendolyn tchr Alex Sch No 4 r 824 Curd (SM) Jones H Ardelle (Mary) mech Steve M Solomon res Lizella Ga Jones Hannah (c) h 610 (105) Elliott Jones Harold B (Essie) 2 (o) farmer h 411 Capital (Mikado pi) Jones Harold B Jr carp r 411 Capital (Mikado pi) Jones Helen elk Ivey-Turner lee Cream Co r 706 1st Jones Helen (c) cook H F Kraft r 109 Third Jones Henry (c; Henrietta) 7 h 116 Johnson (SM) Jones Henry (c; Mary) 2 h 436 Monroe (V) Jones Henry (c; Susie) 1 h 274 (262) White al Jones Henry (c; Willie M) blrmkr Taylor Iron Wks h 116 Opera Hse al Jones Henry (c) lab Cherokee Brick Co Jones Henry (c) lab F S Royster Guano Co Jones Henry A r 412 Fort Hill Jones Henry Y emp Jefferson Standard Life Ins Co r Y M C A Jones Herbert (Avera) 2 r 725 Anderson (SM) Jones Herman emp Sunlite Electric Bake Shop r 706 1st Jones Hilda Mae (Mrs J F) emp Willingham Mills r 226 Duncan Jones Homer (Hattie) 1 (o) mach MD&SRR h 99 Jeff Davis (SM) Jones Homer student r 806 Courtland Jones Horace (Mary) hlpr City Scavenger Dept h 523 Jackson Jones I Hardeman (Rosemary L) 3 slsmn Huckabee Auto Co h 302 Pierce (V) Clinton Ga Jones Ida (c) (o) h 324 (297) Hawkins Jones Fredk (c) auto repr 307 Graham's lot r do Jones Fredk (c; Fannie) lbr h 452 Coles al Jones Fredk L (Lucile) 1 prof Mercer Univ h Jones Ida A (wid J J) emp Southland Knitting Mill h 120 Grady Jones Ida L (c) maid J H Jones Jones Ida M elk F W Woolworth Co r 555 Ogle- 1401 Oglethorpe thorpe , _ Jones Fredk N (Frances) 3 firemn Ga So Ry h 2619 2d Jones G Paul (Louise) 2 (o) vp Carnell-Young Co h 98 Osborne pi (I) Jones Ira H bkpr Macon Transient Bur r 271 Winship Jones Irene (c) student r 256 Elliott Jones Irvin J (Virginia) 2 emp Bibb Mfg Co Jones Garfield (c; Bertha) (o) lab Proctor & Gamble Mfg Co h 606 Clinton Jones Geo (c; Bertie M) h 234 Calhoun Jones Geo (c; Otelia h 562 Chappell (SM) Jones Geo (c; Alice) r 803 Elbert Jones Geo emp Willingham Mills r 21 (65) h 156 Comer ter (PM) Jones Isaac (c; Hattie) h 333 2d (U) Jones Isaac E (Arvie) (o) h 101 Freeman Jones Isabella (c) r 106 (6) Orchard Jones J Blount (Adel V) 1 (o) bkpr Taylor Iron Mill Wks h 1407 Oglethorpe 1935 Macon City Directory 309 Jones J Calvin (Harriet T) (o) ydmstr C of Jones John H (c; Vina) emp Adams Buchanan Ga Ry h 127 Rogers (V) Jones J Clifton (Lucille) agt Bankers; H & L Mtr Co h 913 Edgewood Jones John H (Tracy) formn Ga Roofing & Ins Co h 202 Ridge (I) Sup Co r 663 Plum Jones J Henry elk Vineville Drug Co r 669 1st Jones J Henry (Mildred) sta atndt The Texas Jones John H (c; Minnie B) lab h 306 Cedar (V) Co r 701 Anderson Jones J Paul firemn MD&SRR r 99 Jeff Davis (SM) Jones John L (Maggie) emp USPO h 337 Adams Jones John P sash mkr Willingham S&D Co Jones J Paul sta opr Power Oil Co r 236 r 952 Oglethorpe Stanesclaus cir Jones John P student r 236 Stanislaus cir Jones J W (c) r 407 Mason JONES, JOHNSTON, RUSSELL & SPARKS Jones J Wm (Pearl) welder Procter & Gamble Mfg Co h 1668 2d Jones Jack emp Procter & Gamble Mfg Co r (Geo S Jones, Edw P Johnston, Bruce C Jones, Scott Russell, C Baxter Jones, A O B Sparks), Carl S Oliver, R Bruce Jones and 125 Cole Jones Jadie M (wid C F) r 523 Jackson Jones James (c; Annie) r 215 Collins pi Jones James (c; Bertha) r 520 (426) Pio Nono Jones James (c; Jennie) 1 lab h 7 (317) Sterns al Jones James (c; Lenette) emp So Ry h 402 (565) Elizabeth Jones James A (B Pearl) 3 h 5 Astor pi Edw L Benton associates, Lawyers 1007-20 Ga Casualty Bldg--Tels 96-97-98 (See page 103) Jones Joseph (c) barber Jack Sheftall Jones Joseph (c) farmer r 613 Maynard Jones Joseph H (Mildred) r 701 Anderson (SM) Jones Joseph H (Florence) mach S Ry h 555 Arch Jones Joseph J (Odessa) 1 h 2606 Broadway Jones James A r 111 Mill Jones James A (Margt G) mach Mtr Parts Corp r 337 Adams Jones Joseph N (Belle) h 221 Chappell (SM) Jones Josephine (wid B L) h 140 Georgia Jones Josephine (c) cook A J Ward r 109 Har- Jones James A J (Anna) 2 mech Bibb Mfg Co h 555 Oglethorpe Jones James A J Jr student r 555 Oglethorpe Jones James C (c) hlpr Maxwell Bros Box Fcty r 247 (255) 5th Jones James D (Claude) wtchmn h 669 1st Jones James E (Eliz) (o) barber Lindsey Bar- ber Shop h 701 Anderson (SM) Jones Jas H (c; Jennie) (o) h 967 Pio Nono Jones James H Jr (c) cook Smitty's Barbecue Lunch r 967 Pio Nono Jones James R emp C of Ga Ry r 240 Ell (SM) Jones Jane B r 325 Forsyth Jones Janet (c) r 114 Bostic la Jones Janie (c) maid J W Nisbet r 289 1st (V) Jones Janie M (c) lab So Crate & Veneer Co r 712 Elbert Jones Jeffie (c) tchr J A Brooks Sch r 557 Ward (V) Jones Jennie (c) nurse Sarah V Minter r 967 Pio Nono Jones Jerry L elk So Ry r 323 Georgia Jones Jessie (c) lndrs h 301 Blount Jones Jettie (c; Mattie) 1 firemn Proctor & Gamble Mfg Co h 219 Hazel Jones Jettie (c) lab r 613 Maynard Jones Jetty (c; Lula) pntr h 11 Lennox la Jones Jobbie (c) lab C of Ga Ry Jones John (c; Mamie) h 108 Amos (V) Jones John (c; Dorothy) h 216 Collins pi Jones John (c) r 307 (604) Colquitt Jones John (c; Eurilee) 1 h 121 Rock Hill la Jones John (c; Minnie) 2 h 969 Pio Nono Jones John (c; Annie) h 124 (137) Wings Hill Jones John elk Chapman's Pharm r 2606 Broadway Jones John (c; Love) lab r 432 Davis al Jones John A (Nettie) 1 dispr C of Ga Ry h 806 Courtland JONES JOHN A (Nellie S), Mgr Packer Adv Corp, h 140 Hines ter--Tel 5384-W Jones John B (c; Queener) 1 lab r 2 (3553) Duffey's al Jones John C (Sallie) (o) h 304 Fort Hill Jones John E (Estelle) 2 firemn Pump Co No 4 h 336 Ross Jones John F (Hilda M) 1 emp Willingham ris la Jones Josephine (c) lndrs h 110 Smith (EM) Jones Julia (c) h 563 Monroe (V) Jones Julia (wid C E) smstrs Union Dry Gds Co r 109 3d Jones Julia Parksham Benevolent Home Eliz Whitmore matron 512 Walnut Jones Kate (c) h 238 1st (V) Jones Kath S sch tchr r 320 Orange Jones Katie (c) r 974 Pio Nono Jones Kenneth r 658 Carman pi (Lynmore Estates) Jones Kenneth E (Ellen) 2 brklyr h 954 Ogle- thorpe Jones L Alf (c) tailor 385 Monroe (V) r 9 Spring Jones L Franklin student r 815 Courtland Jones Lacey (c) cook B S Fitzpatrick r 123 Bartlett's la Jones Lamar (Bessie) 2 h 306 Flanders Jones Lamar (Bessie) 3 gro 600 Clinton h do Jones Laverne (c) cook Annie L Woodruff r 114 Unionville Jones Lee (c) emp Hart's Mortuary r 908 Montpelier Jones Leila (c) 2 presser Crescent Ldry h 107 (226) Stewart's al Jones Lendon (c) h 154 Clara Jones Leola (c) 3 h 809 Daisy (SM) Jones Leon farmer r 203 2d (WH) Jones Leona Mrs 1 emp Southland Knitting Mills r 553 Main (EM) Jones Leone r 302 Winship Jones Lillian r 626 Forsyth Jones Lillie (c) r 972 Pio Nono Jones Lilly (c) 1 carder Bibb Mfg Co h 166 Coles al Jones Lily M dept mgr Union Dry Gds Co h 401 College apt 5 I Jones Lizzie (wid H N) h 603 Plum Jones Lois slswn Sears-Roebuck & Co r 508 Carling Jones Lonnie (c) delmn Willingham Gro r 118 (137) Kahn's al Jones Louis A farmer r 203 2d (WH) Jones Louis P (Elma) (o) sta engr Ga Power Co h 815 Courtland Mills r 226 Duncan Jones Louis V r 5 Astor pi Jones John H emp Bibb Mfg Co Jones John H-- (c; Alice J) h 711 Broadway Jones Louise E (wid L H) 2 tchr Lanier High Sch for Girls r 201 Hines ter (V) 310 Baldwin's and Telegraph's Jones Lucile (c) maid Monroe Dismukes Jones Lucille (c) maid r 123 Paradise la Jones Lucille (Mrs F L) mus tchr 554% Mul- berry r 1401 Oglethorpe Jones Mossie (c) emp Vineville Branch Pressing Club r 226 (125) Grant (V) Jones Myrtle student r 954 Oglethorpe Jones Nancy (wid W H) r 719 Anderson (SM) Jones Lucius (c; Margt L) 2 h 231 Roosevelt (V) Jones Lucius (c) porter Sterchi's Jones Lucius C (c) r 402 (9) Crisp Jones Lucy (c) r 955 Hazel Jones Nellie (Mrs V A) elk V A Jones r 50 (45) White (SM) Jones Nellie opr Happ Bros Co r 1318 3d Jones Nora E (c) cook R D Handley Jones Norman r 516 Hemlock Jones Lula (c) dom h 103 Richard (U) Jones Mack (c; Leona) lab h 650 4th (WH) Jones Malcolm D (Rosa) (o) judge County Su- Jones Norman S (Miriam W) 2 mgr L C Smith Typewriter Agcy h 208 Pierce (V) Jones Odessa (Mrs J J) opr Happ Bros Co r perior Court h 58 Arlington pi Jones Malcolm D Jr (Marion E) 1 radios 613 2606 Broadway Jones Ola M (c) cook R A McCord r 370 Mon- Mulberry h 119 Buford pi (V) roe (V) Jones Mamie (c) maid J L Davis Jr r 108 Amos Jones Mamie W tchr Clisby Sch h 117 Corbin Jones Margt C Mrs r 203 Plant (SM) Jones Marian E (Mrs M D) tchr Wesleyan Conservatory r 119 Buford pi Jones Ollie (c) orderly Macon Hosp r 2 Dunlap al _ . Jones Ophelia (c) maid B E Willingham Jr n 713 3d (V) Jones Ora M (c) maid r 1230 1st Jones Marie (c) cook R H Malone r 302 (442) Jones Oscar (c) porter Hart's Mortuary r RD Industrial Home rd 2 Jones Marietta (c) peddler r 328 McClain la Jones Marion M mus tchr-494 Orange r do Jones Martha (c) r 218 Garden Jones Oscar tr dr City r 523 Jackson Jones Patk (Eliz) ticket ofc Terminal Sta h 112 Ninadell dr Jones Martha (c) cook J T Avent h 152 Linden Jones Martha E (wid F S) r 110 Ingleside (I) Jones Paul carp Willingham S&D Co r 952 Oglethorpe Jones Martin L (Nan) 1 asst serv mgr Bibb Chevrolet Co h 250 College apt 1 Jones Marvin J tchr Lanier High School for Boys r 508 Carling Jones Mary (c) h 332 Gilmer Jones Paul A (John H) 3 emp The Texas Co h 3001 Forsyth rd Jones Paul D (Evelyn W) 1 mech So Ry h 161 Daisy Park Jones Pauline (Mrs C P) opr Happ Bros Co r Jones Mary (c) 3 h 407 Mason Jones Mary (c) h 613 Maynard Jones Mary (c) maid r 543 Calhoun Jones Mary A (c) 1 r 805 Ocmulgee Jones Mary B slswn H L Green & Co r 302 Winship Jones Mary E (wid J E) h 1318 3d Jones Mary L (c) maid W A Skinner r 196 109 (10) Balkcom Jones Pauline Mrs spinner Bibb Mfg Co r 309 Rutherford (SM) Jones Pearl (Mrs J W) tel opr So Bell Tel Co r 1668 2d Jones Peter (c) r 416 (220) Elizabeth (SM) Jones Peyton W (Gertrude H) 1 (o) sec-treas Bankers H & L Ins Co h Sunset dr (SH) Tindall (SM) Jones Mary L Mrs opr Happ Bros Co r 111 Capitol Jones Mary M (wid W W) sec B P O'Neal Jr & Co r 192 English Jones Mary N r 806 Courtland Jones Mattie (c) 2 h 206 Cedar (U) Jones Mattie (c) h 118 (137) Kahn's al Jones Mattie (c) r 387 Monroe (V) Jones Mattie (c) cook B P Smith r 9 DeBorde (SM) Jones Mattie (c) cook r 2 (3553) Duffey's al Jones Mattie (c) cook h 110 (452) Johnson's al Jones Mattie (c) 2 dom r 118 (137) Kahn's al Jones Mattie (o) tel opr City Hall h 302 Car- ling Jones Mattie B (c) h 857 3d Jones Mattie H (c) dir City Play Grounds h 264 5th (U) Jones Mattie M (c) 2 maid J J Gill r 231 Roosevelt (V) Jones Mazie (c) Indrs h 403 (708) Henderson (SM) Jones Milas (c) pntr h 231 Jefferson Jones Mildred (c) h 116 (10) Fulton la Jones Mildred Mrs r 891 Waterville rd Jones Miller (c; Ida) emp Cherokee Brick Co h 301 Crisp Jones Minnie (c) cook R W Goins r 539 Rail- road \ Jones Minnie Mrs emp Darling Shops r 802 Mulberry Jones Miriam W (Mrs N S) sten L C Smith Typewriter Agcy r 208 Pierce Jones Moses (c; Lillie M) pntr r 106 (71) 3d Jones Phillip (c; Bessie) jan County Relief Admn h 149 Lincoln (V) Jones Preston (c; Corinne) lab So Crate & Veneer Co h 1113 Broad Jones Priscilla (c) h 770 Moore al Jones Priscilla L (c) student r 210 Ward (V) JONES R BRUCE (Elsie H), lawyer 1007-20 9G8a2-CJ asualty Bldg, h 103 Beverly pi--Tel Jones R Clement (Annie M) 1 (o) cred mgr Union Dry Gds Co h 112 (104) Heard Jones R Frank (Annie) (o) div aud Ga Power Co h 1510 Vineville Jones R L (c) r 407 Mason Jones Rayfus (c) lab r 402 (9) Crisp Jones Raymond (c; Emma) 1 lab Moyer Lbr Co h 244 (242) Church la (SM) Jones Rebecca L (wid W O) (o) h 706 Broad Jones Richd (c; Minnie) 2 r 338 2d (U) Jones Richd (c) lab r 110 Smith (EM) Jones Robt (c; Georgia) 1 lab Copland Junk Co h 223 Elliott Jones Robt (c) msngr L & N Drug Co r 1315 1st Jones Robt E (Muriel) tr dr Riverside Ice & Coal Co r 516 Hemlock Jones Robt J student r 320 Coleman Jones Robt L (Mary) 3 emp Proctor & Gamble Mfg Co h 1710 3d Jones Rob't T (Lucy R) (o) gro 406 Main (EM) h 412 Fort Hill Jones Robt T Jr elk Robt T Jones r 412 Fort Hill Jones Roger (c; Mary) 6 (o) h 1005 (224) Dempsey (U) Jones Rosa (c) (o) cook Paul Hogan h 316 2d Jones Moses (c) student r 974 Pio Nono (V) 1935 Macon City Directory 311 Jones Rosa (c) emp Independent Ldry Co r 145 Forsyth la Jones Rosa L (c) r 409 Maynard Jones Rosa L (wid W H) h 255 Montpelier Jones Rosa L (c) dom H P Sanchez Jones Rosa L (c) student r 247 (255) 5th Jones Roy (c) r 307 (604) Colquitt Jones Ruby cook E P Johnston Jones Rudolph W (Gladys) 1 (o) pres Ga Caro Oil Co h 236 Stanislaus cir Jones Rufus (c; Mary L) 2 tr dr Burney Bros Co h 196 Tindall (SM) Jones Russell N r 255 Montpelier .Tones Ruth slswn H L Green & Co r 423 New Jones Ruth (c) student r 1005 (224) Dempsey Jones S Co A M Williams pres-genl mgr gros 310 3d Jones S Fielder (Willie M) slsmn Industrial Life & Health Ins Co h 109 Rogers Jones S Gustavius lawyer 403 Macon Sav Bk Bldg r 261 High Jones Sallie (wid W J) r 116 Lee (EM) Jones Sallie (c) h 114 (106) Rock Jones Sallie (c) cook West Jones r 163 Roye (CH) Jones Sallie W (wid H M) h 302 Carling Jones Sami (c; Laura H) (o) h 133 (300) Neal (V) Jones Sami (c; Jimmie L) lab Taylor Iron Wks h 162 Phillips la (SM) Jones Sami (c; Viola) 1 farmer h 1226 Broad .Tones Sarah (c) cook C W Jones Jones Sarah O r 401 Montpelier Jones Savannah (c) lndrs r 539 Plant al Jones Simon (c; Fannie) 1 lab h 153 Moore al Jones Smith (c; Lacey) lab C of Ga Ry Creo- sote Plant h 123 Bartlett's la .Tones Sol (c) lab C of Ga Ry r 809 Daisy (SM) Jones Sol (c; Bertha) lab h 432 Davis al Jones Sol (c; Hazel) peddler r 397 Neel (U) Jones Sol (c; Susie S) presser Tat nail Sq Dry Cleaning Co h 131 Roosevelt (V) Jones Stanley A (Myrtle) 1 (o) It in chge USN Recruiting Sta h 211 Forrest Hill Jones Stella (c) cook Edw Bashuk r 513 For- syth Jones Sula V (wid W C) (o) emp Happ Bros Co h 1018 Elm Jones Susie (c) 3 h 204 (335) Gibson Jones Susie (c) r 317 Hammond Jones Susie (c) emp Snow's Ldry r 131 Roose- velt Jones Susie dom W T Davis Jones Susie (c) 1 lndrs h 220 (12) Virgin la Jones Sylvia R r 560 Hemlock Jones T Frank (Dorothy)i 2 r 2129 Broadway Jones T J (c; Addie M) 2 lab h 133 e Ell Jones T Milton br mgr Standard Oil Co r RD 2 Jones Tabernacle A M E Ch (c) 612 (698) Cow- an Jones Taylor M (Pauline) emp Ga Koalin Mines h 115 (6) Myrtle (EM) Jones Thos (c; Rhoda) h 702 Ocmulgee Jones Thos (c; Minnie) lab Riverside Lbr Co h 123 (539) Railroad Jones Thos A hlpr Geo F Yetter Inc r 157 Mag- nolia Jones Thos G (Ada S) mach C of Ga Ry h 146 Magnolia JONES THOS J (Nora) 1 Genl Mgr Nehi Bot- tling Co., h 320 Coleman--Tel 4018-J Jones Timothy (c) lab Buckeye Cotton Oil Co JONES TOM M (Helene H) 2 (o), VP Murphy Taylor & Ellis Inc, h 115 Culver (V)--Tel 2979-R Jones Tommie L (c) maid r 1235 Dempsey Jones Troy E (Minnie) 1 hlpr r 108 (109) Pineview Jones Ulysses (c; Louise) 1 porter Empire Serv Sta h 134 Sycamore (V) Jones Vernon A (Nellie) 3 gro 45 White (SM) h do Jones Victoria (c) lndrs h 2 3d St la Jones Vina (c) 2 h 215 Elliott Jones Viola (c) maid M S Putzell r Tendall field Jones Virginia Mrs r 651 Plum Jones Virginia M (Mrs I J) winder Bibb Mfg Co r 156 Comer ter (PM) Jones W Harvey (Lillian) 1 tex wkr Bibb Mfg Co h 1013 Hazel Jones W Ralph (Corinne) dispr C of Ga Ry h 121 Brentwood Jones W Russell baker Am Bakeries Co res Lizella Ga Jones Walker P (Edna) msngr City Bd of Water Comrs r 655 Forsyth Jones Walter (c; Estelle) lab r 321 McClain la Jones Walter (c; Daisy) lab C of Ga Ry h 170 (126) Plummer's al Jones Walter P (Berta S) 1 (o) supt Bd of Public Education h 231 Boulevard Jones Warren (c; Lillian) 4 emp C of Ga Ry h 155 (408) Nussbaum Jones Watson (c; Idella) lab h 106 (105) Randall la Jones West (c) r 625 4th (WH) Jones Will (c; Cora) washer Crescent Ldry r 1231 3d Jones Wm (c; Josephine) h 109 Harris la Jones Wm (c) r 118 (137) Kahn's al Jones Wm (c) r 407 Mason Jones Wm (c; Essie) 1 h-202 (412) Thompson's al Jones Wm (c; Neapolis) 5 bellmn Dempsey Hotel h 300 (200) 2d (U) Jones Wm (c; Eula) cafe 202 (310) Elizabeth (SM) h do Jones Wm (c; Irene) 1 emp So Crate & Veneer Co h 327 Hammond Jones Wm (c) 1 emp C L Bowden h 10 (43) White al Jones Wm (c) peddler h 203 Holmes Jones Wm (c; Gertrude) porter J S Waldorf & Son h 552 Monroe Jones Wm (c) student r 103 Richard (U) Jones Wm B (Dellie) 3 emp Bibb' Mfg Co h 30 Taylor Jones Wm C r 124 Log Cabin dr Jones Wm C (Maude E) (o) coir City Bd of Water Comrs h 125 Cole Jones Wm E (Lizzie) gro 267 Oakland r 302 Winship Jones Wm G (o) engr C of Ga Ry h 271 Winship Jones Wm H blrmkr C of Ga Ry r 255 Montpelier Jones Wm J (Clara) 1 (o) car repr So Ry h 224 Buena Vista Jones Wm J (Edna) engr C of Ga Ry h 166 Magnolia Jones Wm M (c; Ellie) h 1235 Dempsey Jones Thos J (Mary L) slubber hd Bibb Mfg Jones Wm M (Lillian) sta atndt So Oil Stores Co h 111 Capital Inc r 302 Carling Jones Thos L r 111 Mill Jones Wm N (Beulah) wtchmn Happ Bros Co Jones Thos R (Ida M) 1 mgr Am Bakeries Co h 508 Carling h Jackson Spring rd (SH) Jones Wm O elk Bibb Mfg Co r 706 Broad Jones Timothy (c) r 387 Monroe (V) Jones Wm S (Annie) 1 farmer h 203 2d (WH) 313 Baldwin's and Telegraph's Jones Wm T (Elline) pntr r 1018 Elm Jordan Geraldine (c) lndrs r 185 (562) North Jones Willie B tchr Wesleyan Conservatory r (NH) 300 College Jordan Gillis L (Edna M) tr dr Ga Hwy Exp JONES & CONEY (Chas S Jones, C Lee Coney) Commercial Printers*--"We Deliver Your Job When Promised", 411 Broadway-- Tel 3087 (Seee Page 96 and cards BD) Jordon Ada Mrs warper Bibb Mfg Co h 658 Hawthorne Jordan Ada M (c) lndrs h 889 Main (EM) Jordan Apartments 613 Orange Jordan Asberry (c) r 203 (310) Railroad Jordan Beatrice (c) cook Walgreen Co r 1431 Broadway Jordan Blanche (Mrs John) spooler Payne Mill r 177 Gardner (PM) Inc h 100 Capitol Jordan Hattie (c) r 319 2d (V) Jordan Hazel emp Met Life Ins Co r 628 Orange Jordan Helen r 812 3d Jordan Inez K Mrs emp Bibb Mfg Co Jordan J Mack dist farm supv FERA r RD 2 Jordan James (c; Ella) r 538 e 2d (EM) Jordan James (c) 1 (o) emp Macon Iron & Paper Co h 107 Bowman Jordan James (c) lab r 209 Division Jordan James C (Eva) 2 (o) lieut Truck Co No 1 h 104 (142) Charles Jordan Bridges G br mgr Sawyer Ice & Coal Ca r Hotel Lanier Jordan C Edw ship elk Dunlap Roofing Co r RD 3 Jordan Callie (c) cook B M Goldgar r 483 Industrial Home rd Jordan Carlena (c) case aide County Relief Admn r 552 Broad Jordan Carrie L (c) cook J W Ramsey r 6 (555) Withowski'e la Jordan James H student r 245 Bond apt 4 Jordon James M (c) barber 908 Montpelier r do Jordan Jamie nurse Macon Hosp r 803 Pine Jordan Jesse J (Maude) h 61-62 Davis (PM) Jordan John (c; Susie) (o) shoe repr 161 5th h 519 Fort Hill Jordan John (Blanche) speeder hd Payne Mill h 177 Gardner (PM) Jordan John H (c; Mary) 1 cook Wisteria Cafe Jordan Chas (c; Cassie) 4 h 18 Gustin Jordan Chas (c) lab F E Stillwell h 355 (r) Edna pi (LCHts) Jordan Chas C agt Conn Mut Life Ins Co r 267 Boulevard (NH) h 132 (128) Moughon (V) Jordan John R (Eva B) dentist 803 Ga Casual- ty Bldg h 810 Mulberry apt 2 Jordan John R Jr student r 810 Mulberry apt 2 Jordan Korea (c) cook Ollie C Stubbs Jordan Chas J (Louise) (o) firemn So Ry h 2503 Broadway Jordan Clarence (c; Minnie L) 1 lab F E Stillwell r 355 (r) Edna pi (LCHts) Jordan Claude (c; Willie C) 4 h 503 (715) Jordan Lenora (c) 3 h 125 (16) Bay Jordan Lillian (c) h 237 Jones Jordeti Lillie P (c) r 326 Calhoun Jordan Louise (c) h 108 (115) Davis la Jordan Lucille (Mrs V/ H) elk Woman's Exch Campbell (SM) r 717 2d Jordan Claude (c; Mary) 2 porter Dempsey Jordan Lula (c) cook r 146 2d (V) Hotel h 241 Church la (SM) Jordan Lula (c) 3 h 121 (120) Franklin Jordan Clifford W (c) elk County Relief Admn h 607 Broad Jordan Dollie (wid G W) r 301 Simmons (SM) Jordan Dontnamer (c) dom r 209 Division Jordan Dora (c) 2 r 1023 Edgewood Jordon Dorothy student r 1782 3d Jordan E Rosa smstrsi Union Dry Gds Co r 112 Jordan Luther (c; Mary L) hlpr Willingham S&D Co h 520 Middle (EM) Jordan Luther (c; Willie) atndt Am Oil Co h 59 Spring Jordan M Gussie r 112 Lawton Jordan Magnolia (c) h 114 Moccasin Slide Jordan Mamie G (c) tchr Cressville Sch r 483 Lawton Industrial Home rd Jordan E Ross (Carolyn M) (o) mgr Ga State Jordan Mamie cook E A White r 209 Division Exposition h 114 Rogers (V) Jordan Margt (c) cook W M Whitehurst r 4 Jordan E Ross Jr agt Nat L & A Ins Co r 114 South Boundary Rogers Jordan Mary Mrs r 628 Orange Jordon E Washington (Annie B) tr dr h 1782 Jordan Mary (c) lab' So Crate & Veneer Co 3d Jordan Mary (c) maid r 707 3d (V) Jordon E Washington Jr r 1782 3d Jordan May C (wid Richd) r 235 High Jordan Edgar (c; Mamie) tr dr S Jones Co h Jordan Mildred winder Payne Mill r 61-62 483 Industrial Home rd Davis (PM) Jordon Edna (c) (o) cook N G Gewinner h 110 Jordan Milly (c) r 404 Richard (U) (815) Amos (V) Jordan Nancy (c) (o) h 552 Broad Jordan Edw (c) r 204 Toombs (SM) Jordan Nellie P (Mrs Woodrow) spinner Payne Jordan Eliz r 267 Boulevard (NH) Mill r 114 Comer ter (PM) Jordan Ella (c) cook C L Ridley r 538 e 2d Jordan Odessa (wid J F) r 803 Pine (EM) Jordan Olin (c; Ida) 3 h 920 (r) 1st Jordan Essie (c) cook C B Cartwright r 412 Jordan Ollie (c) maid E B DeMerritt r 212 Mitchell al Woodliff Jordan Essie (c) cook A F Arnold r 204 Toombs Jordan Ollie M (c) r 318 Edgewood Jordan Essie (c) 1 emp So Crate & Veneer Co Jordan Pauline (c) maid M F Bullard r 107 (7) r 4 Mitchell la (EM) Alabama (SM) Jordan Eug H (Kitty E) 1 elk Bibb Mfg Co h 1 Rose pi Jordan F Edith student r 908 Ridge (I) Jordan Fleming P (Alpha) h 207 (1) Dannen- berg JORDAN G MAC, Mgr Dunlop Tire & Rubber Co, r 114 Rogers (V)--Tel 2770-J Jordan R Sylvester yd formn Middle Ga Lbr Co r RD Jordan Rachel (c) (o) h 127 Telfair Jordan Robt (c; Josephine) lab h 722 Edge- wood Jordan Robt E (Mattie E) 2 crane opr So Ry h 301 Simmons (SM) Jordan Robt G (Corinne) real est h 245 Bond Jordan G T mech R A McCord Mtr Co r RD 3 apt 4 Jordan Geo W (o) h 112 Lawton Jordan Rosa (c) r 326 Calhoun 1935 Macon City Directory 313 Jordan Sam (c; Beatrice) porter Walgreen Co h 1431 Broadway Jordan Sarah A student r 267 Boulevard (NH) Jordan S Lee (c) trkr C of Ga Ry r 552 Broad Jordan Sidney J (Daisy) 1 asst roaster South- land Coffee Co h 1634 3d Jordan Steph (c; Henrietta) 1 lab h 101 Drew's Qtrs Jordan Street Baptist Church 234 (236) Jor- dan's al Jordan Susie (c) cook C B Jones r 211 Pond (V) Jordan Susie (c) maid r 268 2d (V) Jordan Thos (c; Alice) r 113 Edgewood Jordan Thos (c; Essie) 1 lab Buckeye Cotton Oil Co h 204 Toombs (SM) Jordan Thos (c) restr 301 Edgewood r 318 do Jordan Tommie (c) maid M E Everett r 154 Middle (V) Jordan Vacie (c; Pauline) hlpr Monk's Gar- age r 107 (7) Alabama (SM) Jordan W Allen (Josephine) route mn Crescent Ldry h 628 Orange Jordan Wade H (Lucile) 1 plmbr J O Hamlin h 717 2d Jordan Wiley M (Martha J) (o) field rep At- lanta Joint Stock Land Bk h 267 Boulevard (NH) Jordan Wiley M Jr mgr Stecher-Troung Lithograph Corp r 267 Boulevard (NH) Jordan Wm (c) h 100 (114) Short (EM) Jordan Wm (c; Lula) r 9 (115) White al Jordan Wm (c) hlpr Trading Post r 185 (562) North (NH) Jordan Wm (c; Lottie) lab Schwartz & Phaul Inc Jordan Wm (c; Beulah) 6 lab So Ry h 209 Division Jordan Wm Jr (c; Mary) h 9 (115) White al Jordan Wm H (Fannie M) 3 supt meat ctr Rogers Inc h 195 Boulevard (NH) Jordan Wm K phys r 267 Boulevard (NH) Jordan Woodrow (Nellie P) 1 slubber hd Payne Mill h 114 Comer ter (PM) Jorgensen Axel J chem Bibb Mfg Co r 201 Vista cir (I) Joseph Vester (c; Marzelia) 1 lab h 138 e Ell Josephson Raymond lab h 100 (r) Walker (LCHts) Josey Albert D (Nellie) r 251 Jeff Davis (SM) Josey Alex A (Mary L) (o) emp So Ry h 119 (131) Charles Josey Andrew D (Bertie L) (o) h 103 (114) Heard (SM) Josey Clifford M (Nannie) 2 h 661 Elm Josey Doris L r 119 (131) Charles Josey E Clifford carp r 469% 2d Josey Eli (c; Minnie) hlpr h 302 (258) Roye Josey Eva M (c) maid G M Camp r 103 (245) Booker's al Josey Frankie (c) r 608 Cheatham al Josey Fred H (Mary) tchr Lanier High Sch for Boys h 744 Patterson Josey Georgia (c) cook Ernest Corn r 433 Pio Nono Josey Gertrude (Mrs W T) emp Southland Knitting Mills r 868 1st Josey Jack (c; Ruth) h 103 (245) Booker's al Josey Lake E (c; Mattie) lab Macon Cooperage Co r 531 Calhoun Josey Lorie C (Thelma) (O K Shoe Repair Shop) r 203 (103) 3d (SM) Josey Mack (c) h 608 Cheatham al Josey Minnie (c) cook W V Williams r 302 (258) Roye Josey Richd (c; Fannie) lab Central S&D Co h 93 (116) Hazel Josey Thelma (Mrs L O') slswn Snyder's Readyto-Wear r 203 (103) 3d (SM) Josey Will (c; Georgia) peddler r 433 Pio Nono Josey Wm T (Gertrude) 1 emp Bibb Mfg Co r 868 1st Josey Willie B r 103 (114) Heard (SM) Jossey Paul H (Ruby G) 1 slsmn h 305 Clayton (V) Jossey Wm J slsmn r 852 1st Journeymen Barbers of Am E P Scott sec meets 3d Tuesdays 7:30 p m 502% 2d Joyce Anne (wid J A) 1 nurse 286 Winship r Joyner Chas S 1 (o) agt Met Life Ins Co h 101 Summit Joyner Charlotte J r 101 Summit Joyner Grady C (Pearl) emp Art Mfg Co h 863 Orange Joyner Howard emp Art Mfg Co r 663 Plum Joyner J Albert (Ella M) 3 emp Willingham Mills h 23 Randolph pi Joyner J C emp Dempsey Hotel r 360 New Joyner J Henry (Jennie) lab r 673 Edgewood Joyner J Henry (Annette) tex wkr Willing- ham Mills r 24 (81) Randolph pi Joyner James O (Ida M) 3 mech Monk's Gar- age h 1811 2d Joyner John T (Beulah) tex wkr Willingham Mills h 24 (81) Randolph pi Joyner Lawrence r 11 Bellevue rd Joyner Mable Mrs h 252 Washington Joyner Margt sten Macon Paper Co r 863 Orange ,_ . Joyner Sidney C (Claude) 3 dr Yellow Cab Co h 360 New . ,,,,,, Joyner Wm M (Pearl) (Bill's Cash Gro) h 102 Jozef's Beauty Shoppe (E C Lockerman) 312% 2d Juhan Bernice nurse Macon Hosp r do Juhan Lillie (c) cook Kitchen's Kitchen h 5 Park Hotel al , JUHAN WM Dry Goods J JR Co, h (Leah) 2 (o), 235 Riverdale dVr P(I)U--n1iToenl 5605 Juhlin Esther r 135 (133A) Oakland Julti,,ette MTi\Tlloiini gPCporrvS RsecJ-atqreuaess vpraersn JmNfrsBi4rc1h3 Broadway Jung Alphonso F slsmn C W Farmer res Lo- raine Ga Jung Anna M r 108 Holt (V) Jung Frank (Grace) ldry 363 Cotton h do Junior Order United American Mechanics meets Friday 8:00 p m 515 2d Jurdon Troy (c) chauf J S Birdsey r 402 1st Justice Grace Mrs spinner Bibb Mfg Co Justice John r 605 Main (EM) Justice Minnie (c) maid W W Odom 109 Cedar Kacsik Frank mech Broadway Top & Body Shop res RD 4 Kadmiel Chapter Knights Templar of Rose Croix H G Hollingsworth sec meets Friday 8:00 p m 710 Mulberry Kah Geo T (o) lab h 103 Thomas (Mikado pi) Kah Louis L (Alice E) prod r 549 Hillyer Kahdy Assif G (Edna E) 4 confr 467 Broad- way h 557 New Kahdy Edna E (Mrs A G) elk A G Kahdy r 557 New Kaigler Alfonza (c) lab r 102 Division St la Kaigler Hattie J (wid E L) pres Kaigler's Business Col r 533 Orange apt 2 Kaigler John (c) lab h 102 Division St la Kaigler Mattie (c) 1 r 248 Division St la Kaigler's Business College Mrs Hattie J Kaig- ler pres 3d fl Washington Bldg 314 Baldwin's and Telegraph's Kaler- Corinne (wid W C) (o) h 251 New Kalish David M (Kalish Optical Co) h 855 Mul- berry apt 102 Kalish Optical Co (DM Kalish) 563 Cherry Kane (see also Cain) Kane Agnes r 605 1st Kane Lawrence slsmn Yates Mtr Co r 605 1st Kane Mary (wid J H) h 605 1st Kansas City Life Insurance Co J C Edwards mgr 204 Ga Casualty Bldg Kaplan Esther (Mrs M M) slswn Darling Shops r 334 Hill Crest Kaplan Henry (Julia) 1 (o) (So Sports Co) pawnbroker 516 Broadway h 1408 Vineville KAPLAN HYMAN D (o), Pres Empire Furn Co Inc, h 818 Cherry apt 4--Tel 1093 Kaplan Ira (Jenny) slsmn So Sports Co h 864 Mulberry apt 4 G Kaplan Michl M (Esther) 2 Co) sec-treas Art Furn Mfg Co h 334 Hill Crest KAPLAN PEARL, VP Empire Furn Co Inc, r 818 Cherry apt 4--Tel 1093 Kaplan Philip slsmn So Sports Co r 1408 Vine- ville Kappa Sigma Fraternity 629 Adams Karas Jimmie (Harry's Cafe) r Gordon Hotel Karesh David student r 400 Washington Karesh Department Store (Sami Karesh) 115 Hardeman Karesh Irvin student r 400 Washington Karesh Sami (Annie) (o) (Karesh Dept Store) h 400 Washington Karsten & Denson Co Inc J W Denson pres E J Denson sec-treas poultry sups 517 3d Kash & Karry Market (C A Rushin) meats 412 2d Kassner Irving E (Rose) 2 (o) slsmn h 712 Forsyth Kassner Sara Mrs r 712 Forsyth Katherine Court Apartments 855 Mulberry Ktz Chas r Hotel Macon Kaufman Augustus student r 205 Clisby pi Kaufman Elberta Mrs mgr Beverly Dress Shop r 205 Clisby pi Kaufman Jane slsmn Lerner Shops r 205 Cha- tty pi Kavanaugh Fannie M Mrs slswn Dannenberg's h 131 High Kavanaugh Frances C sten Dannenberg's r 131 High Kaybee Clothing Store R L Levison mgr 416 3d Kaylor Anna Mrs r 320 Coleman Kea (see also Key) Kea A Pierce r 361 1st Kea Elsie asst cash Wisteria Cafe r 361 1st Kea Emma (wid B C) furn rooms 361 1st h do Kea Eviedel sch tchr r 361 1st Kea Ezra W barber Palace Barber Shop r 361 1st Keating Eliz h 441 Madison (V) Keaton Arke (c) r 1119 (112) Woolfolk Keaton Fannie (c) cook r 1119 (112) Woolfolk Keaton Morris (c; Virginia) emp Bibb Mfg Co r 204 (255) Bowman Keaton Oscar (c; Fannie) emp Bibb Mfg Co h 1119 (112) Woolfolk Keefer Bessie Mrs h 100 2d Keefer Dorothy waitress Roberts Cafeteria r 100 2d Keefer Missouri (wid Max) (o) h 207 Fort Hill Keefer Hill Robt L 1 emp Bibb Mf6g Co r 207 Fort Keel Wm A (Birdie V) 2 prof Mercer Univ h 1409 Oglethorpe Keen James W (Inez) 4 (o) pntr h 56 Wor- sham (Lynmore Estates) KEEN OSEE F (Margaret) 3, Sec-Treas Oglethorpe Private Infirmary ( Phys 1309 Oglethorpe, h 506 Napier--Tel 1932 Keene Carrie S (Mrs T E) opr So Bell Tel Co r 436 Washington Keene Elmer emp Rogers Inc r 756 Mulberry Keene Emory r 756 Mulberry Keene Mollie (wid C D) h 114 Cole apt 1 Keene Theo E (Carrie S) 2 slsmn Bibb Mat- tress Co h 436 Washington Keenum J Benj (Lizzie M) 1 slsmn Yates Mtr Co h 209 Hines ter (V) Keepler Lonnie (c; Sara) (o) h 2, Alabama (SM) Kessler Esther Mrs matron Hephzibah Or- phanage r 3201 Forsyth rd Keesley Louise opr So Bell Tel Co r 476 Col- lege apt 9 Keily Willie B optician 505 Cherry r Y M C A Keiser Hilary H emp S H Kress Co r 194 Laurel Keiser John M (Marguerite K) (o) phys 18 Jaques Bldg h 194 Laurel Keiser Martha E r 598 Boulevard (NH) Keith Arth N paperhngr John Hainline r 460 Mulberry Keith Leland hlpr r 106 Ross Keith Margt (wid John) r 353 Walnut Keith Martha (c) maid Terminal Co Kell Alex (Mollie) (o) shoe repr 517 Mulberry h 961 Cherry Kell I Louis mgr Marilyn Slipper Shop r 961 Cherry Kell Jessie L (Mrs R T) smstrs Bibb Mfg Co r 918 New Kell Julia student r 961 Cherry Kell Roy T (Jessie L) 2 doffer Bibb Mfg Co h 918 New Kellam Reedy (c; Bessie) 1 emp C of Ga Ry h 607 Pebble Kellam Wiley (c) jan J H Burns h 424 Peach- tree Keller James emp Willingham Mills Kelley Aaron (c; Estella) 2 lab' h 130 (228) Norris Kelley Ada (c) h 4 Park Hotel al Kelley Alberta (c) cook C D Roberston Kelley Bertha Mrs 2 r 116 Comer ter (P M) Kelley Beulah (c) r 613 Shoals al Kelley Bryant L (Louise) 1 firemn Truck Co No 2 r 457 Duncan Kelley Clara B (c) 2 r 130 (228) Norris Kelley Danl B (Lillie W) capt Truck Co No 1 h 120 3d Kelley Evie emp Bibb Mfg Co Kelley Geo W (Eunice) emp R A McCord Mtr Co h 711 Walnut Kelley Gertrude (c) 1 (o) maid Winship Sch h 17314 Lincoln (V) Kelley Grace (c) Indrs h 240 (213) Plant row Kelley Henry (c; Sarah) 2 r 613 Shoals al Kelley Jack (Ora L) 1 speeder hd Bibb Mfg Co r 717 Plum Kelley Joseph B (Ruth) 2 slsmn Nu-Icy Btlg Co r 711 Walnut Kelley Joseph K (c; Eliz) 2 lab h 14 (156) Paradise al Kelley Julia (wid L C) r 105 Carlisle Kelley Lillie W (Mrs D B) florist 120 3d r do Kelley Lonnie r 108 Whitehead Kelley Louise r 120 Forest Hill Kelley Margt (c) maid Nevarro apts Kelley Minnie (c) h 203 (2) 3d (B) Kelley Nell G (c) cook J A Hill Kelley Ora L (Mrs Jack) opr Happ Bros Co r 717 Plum Kelley Thos E (Nellie M) 1 agt Met Life Ins Co h 618 Broad 1935 Macon City Directory 315 Kelley Thos O printer r 105 Carlisle Kelley Willie M (c) cook B S Gostin r 901 Edgewood , Kellum Troy L (c; Evelyn) 1 emp GS&FRR h 808 Dempsey Kelly Annette elk Bibb Mfg Co r 110 Corbin (V) Kelly Arth (c; Matilda) lab Central Cotton Oil Co h 1021 3d Kelley Arth (Annie M) 1 (o) mgr Cotton ofc Bibb Mfg Co h 203 Albemarle pi (1) Kelly Arth R (Rowena) 3 archt Indian Mounds h 855 Mulberry apt 203 Kelly Beulah (Mrs R N) emp Carling Tile Co r 1809 2d Kelly Cecil R student r 157 Laureal Kelly Clemmie bkpr Macon Gas Co r 810 Mul- berry apt 5 Kelly Clifton E (Estella) wtchmn Proctor & Gamble Mfg Co h 260 Ell (SM) Kelly Eliz (c) student r 325 (315) Plant (SM) Kelly F Burns slsmn Penney's r 157 Laurel Kelly Gertrude dancing tchr 232 Georgia r do Kelly J Edw pntr r 521 College Kelly J Otis (Lucy Mae) 2 pntr h 209 Ninadell dr Kelly James (c; Margt) (o) h 314 Jackson Kelly James H h 864 Mulberry apt 2 B Kelly John B asst mgr Woolworth's r 860 Mul- berry Kelly Joseph (c) orderly Oglethorpe Private Infirmary Kelly Lena (c) 1 r 320 Cheatham al Kelly Leroy (c) emp Bibb Mfg Co r 923 Hazel Kelly Lillian emp Bibb Mfg Co r 1817 3d Kemp Clarence E r 114 Brentwood Kemp Clyde D (Grace) 3 h 114 Brentwood Kemp Eula M (c) maid r 318 Walnut Kemp Gene H (Myrtie M) 1 h 102 Cleveland (V) Kemp Gussie (c) maid W B Willingham r 1075 Pio Nono Kemp Luticia (c) 1 r 435 Cedar (U) Kemp Mary (c) lndrs h 107 (355) Spring la Kemp Mortimer (c; Letitia) lab The Standard Tool & Handle Co h 1060 Pio Nono Kemp Paul E elk Rogers Inc r 355 New Kemp Pauline (c) lndrs h 225 Roosevelt (V) Kemp Tinsley D (Lurline) 3 formn C of Ga Ry h 2349 2d Kemp Wilbur (c; Pauline) emp Kmnett-Odom Co h 35 Gas House al Kemper Hattie E (wid W G) h 123 Magnolia Kemper Lamar C atndt Flanagan's Camp r 403 Cleveland (SM) Kemper Margt E r 403 Cleveland (SM) Kemper Marvin E (Gertrude) solr frt agt Ga RR h 201 Lynmore Kemper Mary R (wid DP) (o) h 403 Cleve- land (SM) Kemper Maude G (wid Graham) 6 h 1337 Edge- wood Kemper Taylor D agt Penn Mut Life Ins Co r 403 Cleveland (SM) Kendall Adolphus (c; Berta M) hlpr Buckeye Cotton Oil Co r 206 O'Harra la Kendall Anna B (c) maid h 919 Ash Kendall Anthony T (Grace M) pres Sunlite Elec Bake Shop Inc h 555 College Kendall Berta M (c) cook J L Boland r 206 Kelly Lois student r 209 Ninadell dr Kelly Louise opr So Bell Tel Co r 209 Ninadell dr Kelly Mabel A r 157 Laurel Kelly Madie student r 209 Ninadell dr Kelly Marie (c) cook W M Weaver r 140 Pecan Kelly Marion Mrs r 864 Mulberry apt 2 B Kelly Ralph N (Beulah) tr dr Swift & Co r 1809 2d Kelly Rose (c) 1 lndrs h 131 McKay's al Kelly S Virginia elk Met Life Ins Co r 521 Col- lege Kelly Silas A (Corinne) 2 elk Nat Re-employ- ment Serv h 1003 Walnut Kelly-Springfield Tire Co W O Land mgr 687 3d Kelly Timothy (c; Lucy) lab r 317 (72) Plummer's al Kelly W Frank (Lillian M) (o) formn S E Com- press Co h 157 Laurel Kelly Wm (c) student r 325 (315) Plant (SM) Kelly Wm A (c; Amelia) 6 (o) h 325 (315) Plant (SM) Kelly Wm L (Charlie) 1 asst ticket agt Term- inal Ticket Ofc h 212 North (NH) Kelpen Rosa Mrs r 520 (552) Oglethorpe Kelpen Walter hlpr r 520 (552) Oglethorpe Kelsey Bertha (c) cook r 335 Ernest Kelsey Bertha (c) dom h 339 Hawkins Kelsey Lena r 526 Edgewood Kelsey Mattie (c) (o) h 335 Ernest Kelsey Nora L Mrs h 110 Pearce Kelsey Wm (c; Lottie M) 3 waiter Hotel Demp- sey h 157 Bennett's la Kemme Eugenia (wid J C) h 525 College apt 3 KEMP A P (Mary M) 1, Phys, 511 Walnut, h Kendall Etta L (Mrs J L) tchr Gresham Sch r RD 5 Kendall Evie L (c) cook J C Murphey r 473 Chestnut Kendall Grace M (Mrs A T) v-pres Sunlite Elec Bake Shop Inc r 555 College Kendall Harry C (c) slsmn Power Oil Co h 311 Bond Kendall Henry (c; Nora) 1 mus h 134 City Hall la Kendall Henry A treas Sunlite Elec Bake Shop Inc r 555 College Kendall Howard D sec Sunlite Elec Bake Shop Inc r 555 College Kendall James D (o) h 102 Madden Kendall John B (Mattie Ava) 1 bldg contr 102 Madden r do Kendall Leonard J (Etta) (o) planter h River rd (NH) Kendall Pearl (c) cook G W Hubbel Kendall R Palmer (Nova C) 2 police capt So Ry h 503 Beech Kendall Randall P Jr elk Exch Pharm r 503 Beech Kendall Sidney (c; Sallie) 1 h 102 Roye Kendrick Ada (c) dom Frank Roberts r 922 Montpelier Kendrick Andrew (c; Sally) 2 box mkr h 421 Ash Kendrick Andrew (c; Leola) (o) brklyr h 112 Ernest Kendrick Anthony A (c) gro 271 4th (V) h do Kendrick Chas (c) r 315 Middle (V) Kendrick Chas (c; Annie) hlpr h 601 (575) Chappell (SM) do--Tel 776 (See Page 106) Kendrick Chas L (c; Louise) (o) tr dr Macon Kemp Albert (c; Mattie)l lab h 117 (9) Bras- Cigar & Tob Co h 315 Middle (V) well la Kendrick Dollie A (c) (o) dom h 226 Ernest Kemp Alice (c) h 424 Long St la (SM) Kemp Chas (c; Gussie) 3 farmer h 1075 Pio Nono Kendrick Ella A (c) 3 h 109 5th (B) Kendrick Ethel (c) student r 226 Ernest Kemp Chas (c; Zephyr M) mech h 201 2d (U) Kendrick Fannie (c) r 112 Ernest . 316 Baldwins and Telegraph's Kendrick Gladys L tchr Eurke Sch r 108 La- Kent John F (Mattie) 1 wtchmn Willingham mar (V) Lb'r Co h 240 Jeff Davis Kendrick Justyne (c) cook W V Davis r 226 Kent John F Jr student r 240 Jeff Davis Ernest Kent Louis M (Annie M) emp S E Battery Co Kendrick Leola S (c) dom r 112 Ernest r 1337 Edgewood Kendrick Louise (c) maid Ga Power Co r 315 Kent Mattie opr Happ Bros Co r 240 Jeff Davis Middle (V) Kent Reuben r 500 Oglethorpe Kendrick Lucinda (c) r 303 (583) Hall (EM) Kent Sami (c; Gussie) 1 lab Standard Tool & Kendrick Mamie (c) cook E B Harrold h 224 Handle Co h 627 Division Ernest Kent Sami E (Eliz) (o) engr C of Ga Ry h 1134 Kendrick Mary W (wid A N) (o) h 108 Lamar College dr (V) Kent & Herin (E C Kent) whol gros 9 Termi- Kendrick Oscar (c; Lucy) 1 h 123 Harris nal Kendrick Richmond (c; Lettie) (o) h 228 Kenyon Eunice C student r 342 American blvd Ernest Keppler Lola (Mrs Louis Jr) tex wkr Bibb Mfg Kendrick Valeria (c) dom r 301 Hawkins Co r 434 Lob Cabin dr Kennedy Adele (wid C E) 2 h 1412 Edgewood Keppler Louis (Mary B) (Service Shoe Repair (SM) Shop) h 434 Log Cabin dr Kennedy Beulah Mrs 1 slswn r 127 James Keppler Louis Jr (Lola) 2 tex wkr Bibb Mfg (LCHts) Co r 434 Log Cabin dr Kennedy C Alton elk Alf Mack's Pharm Inc r Kerlin Harvey J (Dovie) 7 elk Karsten & Den- 1412 Edgewood son Co h` 207 (143) Flamingo dr Kennedy E Lewis (Jane) (o) h 111 Forest (B) Kern Martha asst prof Wesleyan Col r do Kennedy Elgie W (Lillian) formn Maxwell KEKNAGHAN C EUG (Marie) 1 (o), Pres Bros r 2604 2d Kernaghan-Goodman Inc, h 305 Cherokee-- Kennedy Ella Mrs h 216 (56) Clinton Tel 3397-W Kennedy Elmer pntr r 316 Belmont Kernaghan Chas E Jr student r 305 Cherokee Kennedy Emmett E (Annie) (o) firemn Tr Co KERNAGHAN-GOODMAN INC, C Eug Kerna- No 2 h 316 Belmont ghan Pres, Alex M Goodman Sec-Treas, Kennedy Eunice r 1412 Edgewood (SM) Jewelry, Watches, Clocks, Silverware and Kennedy Georgia (wid J F) r 473 Orange China, 411 Cherry--Tel 836 Kennedy J Robt (c) r 205 (100 Peacock Kernaghan Robt H student r 305 Cherokee Kennedy J Vernon elk Ry Exp Agcy h 473 Kernstein Paul A (Carl H) slsmn r 118 Stone- Orange wall pi (V) Kennedy Jesse (Lois) 1 emp Willingham Mills Kerr James F (Florence A) with McKesson- r 330 Dannenberg Riley h 401 College apt 8 D Kennedy Lillian (Mrs E W) opr So Bell Tel Co Kerry May nurse 761 Courtland r do r 2604 2d Kersey Tura (Mrs W D) emp So Bell Tel Co Kennedy Lois (Mrs Jesse) emp Willingham r 213 Bond apt D 3 Mills r 330 Dannenberg Kersey Wyatt D (Tura) 1 h 213 Bond apt D 3 Kennedy R J emp State Hwy Dept r 855 Mul- Kesler Louise opr So Bell Tel Co r Nevarro berry apt 300 Apts Kennedy Robt A (Vannie) 1 chauf CFD h 2436 Kessler Celeste student r 855 Mulberry apt 301 2d Kessler Max H (Lena) 2 prod comm mer h 855 Kennedy Roy L (Gladys) 2 mus Sam Pair's Mulberry apt 301 Orchestra h 896 Hillyer Kessler Moses slsmn r Hotel Southland Kennemer Rupert D (Lera) elk L D Brown r Ketch Henry L (c) r 502 Fulton (EM) 112 Cleveland (V) Ketch James (c; Louise) b'ellmn Dempsey Ho- Kennesaw The (Peter Modena) confrs 557 tel r 311 Ward (V) Broadway Ketch Louise (c) tchr Antioch Sch h 311 Ward Kenney Henry C (Emmie F) (o) ptrn mkr (V) Taylor Iron Wks h 418 Jackson Ketchie Everett E appr Taylor Iron Wks r 121 Kennington Claude D nurse 201 Villa Esta r do w Grenada ter Kennington Godfrey A (Parmie) mgr meat Ketchie Lura M opr Happ Bros Co r 121 w dept Kennington's Mkt r 747 College GrsnOid^ ter Kennington Henry A (Josephine) mgr Ken- Ketchie Robt L (Jessie) 1 inspr So Ry h 2341 nington's Mkt h 111 Appleton 2d Kennington Henry F (Pauline) 1 r 201 Villa Ketchie Robt L Jr emp Crescent Ldry r 2341 Esta 2d Kennington Jerome P (o) sta mgr Gulf Refin- Ketchie W Louis (o) carp So Ry h 121 w ing Co h 201 Villa Esta Grenada ter Kennington Marie elk Kennington's Mkt r 111 Ketchie W Louis Jr r 121 w Grenada ter Appleton Keth Carl A (Mary L) (o) printer Macon Kennington Viola (wid Britt) h 619 Spring Teleg Pub Co h 803 Mikado Kennington's Market H A Kennington mgr Ketterbaugh Geo H (Juanita) slsmn Macon gros 338 Main (EM) Linen Sup Co r 2110 2d KENNY C D CO, A B Brumback Mgr, Whol Key (see also Kea) Coffee 320 Oglethorpe--Tels 1936-1937 (See Key Chas (c; Martha) brklyr r 150 Washing- page 84) ton Kent Augusta (Lena) r 196 Edna pi (LCHts) Key Hattie (c) dom h 187 Gordon (CH) Kent E Carl (Lynette) (o) (Kent & Herin) h Key Homer A (Marjorie G) 2 printer Macon 111 Inverness Teleg Pub Co h 122 Stonewall pi (V) Kent Ellen E (wid R G) 1 h 617 Plum Key John (c) lab Co of Ga Ry Creosote Plant Kent Eric A (Crystal) 2 (o) h 196 Edna pi r 411 Ward (V) (LCHts) Kent Geo L r 465 Duncan Kent Ida B (wid W R) (o) h 465 Duncan Key Martha (c) maid Terminal Sta r 150 Washington Key Mary (c) h 212 Church al (SM) Key Mattie (wid J W) h 463 y2 Cotton 1935 Macon City Directory 31? Key Milton (Mary) shoe repr r 253 Broadway Kimble John C (Nellie L) h 100 Richmond Key Sina (c) cook L F Russell r 187 Gordon Kimble Nellie (Mrs J C) opr Happ Bros Co r (CH) Key Wm (c; Alene) 1 lab h 10 West Boundary Keys Eliz tex wkr Adams Mfg Co r 104 (105) Pineview 100 Richmond Kimble Wm W (Anna B) (o) slsmn Taylor Furn Co h 823 Curd Kimbrew Ada E (wid J W) (o) h 135 Ross Keys John L (Myrtle) 1 carp h 104 (105) Pineview Kidd James H (Nannie E) (o) h 756 Montpelier Kimbrew Annie (wid T M) r 331 American blvd _ Kimbrew Emmett V (Thelma L) 1 slsmn Bur- Kight L Joseph (Myrtle C) 1 elk h 162 High Kiltaurn Ida (wid Walter) opr Tomlinson Paper Box Co r 161 3d Kilcrese J Cornelius speeder hd Bibb Mfg Co ney Bros Co h 765 Montpelier Kimbro Annie (c) maid L A Fetner r 142 Pecan Kimbro Clarence (c; Annie) 1 delmn Wilson's r 117 Comer ter (PM) Kilgore Alice (c) r 110 Middle (V) h 142 Pecan Kimbrough Evans (c) emp Hardeman Bldg h Kilgore James hlpr City Water Wks r 1427 3d Kilgore Thos emp So Crate & Veneer Co r 1427 3d Kilgore Walter (c; Ella) (o) emp C of Ga Ry h 437 Tindall 917 Clinton rd (EM) Kimbrow Alice (c) 1 lndrs h 431 Chestnut Kimbrow Helen (c) 1 maid V J Adams r 431 Chestnut Kimbrow Obie (c) student r 431 Chestnut Kilgore Walter B (c; Annie M) porter Burden Kimes Albert R (Maude) 1 emp Birdsey Flour Smith & Co r 361 (460) Alabama Mill h 548 Log Cabin blvd Killebrew Edgar L (Lucile) (o) carp h 300 Capital (Mikado pi) Killebrew Faybelle (c) r 711 Ash Killebrew James (c; Minnie) 1 emp Merritt Coal Co h 711 Ash Killebrew Lucile (Mrs E L) slswn Beverly Dress Shop r 300 Capital (Mikado pi) Killebrew Mattie (c) cook Sallie Parrish r 967 Ocmulgee Killebrew Minnie (c) maid R E Lee r 711 Ash Killen Eug H flrmn Union Dry Gds Co r 146 Georgia Killen Herbert F (Pauline) 1 sten Armour & Co h 772 Hemlock Killen Janie (c) (o) h 554 Chappell (SM) KILLEN JOHN T (Georgia) , Supt Riverside Cemetery, h 290 College--Tel 2071 Broadway Kimble Edw L (o) rd mach opr City h 215 Heard (SM) King Carrie (c) elk County Relief Admn r 109 May King Christine (c) maid r 122 Ross 318 Baldwin's and Telegraph's King Clarence (c; Sylvia) h 1234 1st King Cleveland (c; Emma) carder Bibb Mfg Co r 367 Flanders King D Lee (Ruth) 4 farmer h 254 Church (EM) King Daisy L (c) cook W E Floyd r 123 (116) Wood al King Della (c) 5 h 229 Woodliff King Earnestine student r 333 Carling King Edw (c; Mary) emp Cherokee Brick Co h 405 Colquitt King Edw (c; Emma) 4 lab Taylor Iron Wks h 296 1st (V) King Edwin K tex wkr Willingham Mills r 6 (78) Mill King Eliz emp Southland Knitting Mills r 325 (323) Dannenberg King Ella (c) cook W M De Vaughn r 127 Bostic la King Elmo E (Margt) 1 mech R A McCord Mtr Co h 318 Hydrolia King Elvie opr Sou Bell Tel Co r 333 Carling King Essie (c) h 127 Bostic la King Esther opr Happ Bros Co r RD 5 King Frank (c; Lucile) 2 h 587 (20) Siam King G Shell meat ctr J C Land r 407 Walnut King Geo (c; Josephine) h 41 Harris King Geo H (Nellie P) 2 plmbr A B Lee Plmbg & Htg Co h 309 Mikado King Georgia B (wid J C) r Y W C A King H Clayton (Pearl) 2 firemn Tr Co No 2 h 333 Carling King H L (Jessie C) 4 patrolmn CPD h 301 Montpelier King Hattie L (wid James) r 408 Church (EM) King Henry G (Lessie) r 1429 3d King Homer J (Lucile) emp T & T Pkg Co h 247 Oakland King Ina (c) (o) h 453 e Academy (EM) King lone student r 6 (78) Mill King J Franklin (Mary) pharm h 101 Lamar (V) King J McDuffie (Dora) formn Liberty Candy Co h 768 Mulberry King J McDuffie Jr (Blanche) asst supt Swift & Co r 475 Spring King J Otis (Laura) 5 dr Yellow Cab Co h 100 Grand (B) King James (c) delmn Macon Fish & Oyster Co r 748 Edgewood King James hlpr h 308 Applewood King James (c; Henrietta) lab Idle Hour Club r RD 1 King James (c; Callie) porter Arcadia Hotel h 270 Madison King James E (Kath) slsmn Gulf Refining Co h 696 Hillyer King James L (Grace) 2 (o) phys 418 Ga Casualty Bldg h 223 Buford pi King James M (Elma) 2 tex wkr Willingham Mills h 22 (86) Mill King James R 1 r 279 College King James R meats 1913 Vineville (V) r 596 Boulevard (NH) KING JAMES R (Ezra) 2, slsmgr Schall Paint Co, h 326 Linden King James R (Pearl) 2 tex wkr Willingham Mills h 6 (78) Mill King James T (Gladys V) tr dr Kinnett-Odom Co r RD 4 King Jessie (c) maid C I Motte r 256 Madison King Jesse C (Annie M) 4 emp Maxwell Bros Box Fcty h 221 (261) Willingham King Jesse L slsmn Bibb Sup Co r 306 Hines ter King Jesse T r 100 Grand (B) King John (Mary) emp City h 125 Williams (SM) King John H (c; Mamie) 1 tr dr Sunshine Creamery h 129 (205) Magnolia la King Joseph (c) h 106 Grant (S) King Joseph emp Bibb Mfg Co r 122 Ross King Joseph (c; Louise) stablemn r 153 Bright al King Joseph F (Mary M) carp formn C of Ga Ry h 452 Spring King Joseph R (Ruby) 2 asst engr Pump Co No 3 h 2330 2d King Josie elk r 121 1st King Julia (c) cook Sarah Willingham r 520 Broad King Julia M (c) maid W G Cobb r 124 Roose- velt King Launa (Mrs J O) spooler Payne Mill r 100 Grand (B) King Lavina (c) 3 h 487 Short al (V) King Leila (c) 1 lndrs r 124 Roosevelt (V) King Lillian (c) cook h 125 (204) Magnolia la King Lizzie (c) r 413 (433) Forest (V) King Lizzie (c) h 127 (1) Rockhill la King Lonnie mkr Liberty Candy Co King Louise (c) waitress D J Jones King Lubelia (wid L E) r 570 Oglethorpe King Lula (c) cook J S Tablor h 122 Ross King Mamie (c) mkr Central City Bag Co h 108 (4) Davis al (EM) King Marie (wid A A) (o) h 2839 Houston (SM) King Martha (c) cook Mrs Fannie Taylor r 103 (308) Spring la King Mary (c) maid C C Hertwig r 296 1st (V) King Mattie Mrs r 866 Mulberry King McDuffie (c; Daisy) bellmn Hotel South- land r 108 Spring King Mildred (c) r 103 Spring King Minnie T r 33 Arlington pi King Myles V (Ida) emp City Scavenger Dept h 1429 3d King Nettie (c) cook C C Bennett r 227 Sum- mit Hill (S) King Olden B (c; Mattie) 1 (o) emp C of Ga Ry h 104 Roye King Oscar H (Esther C) plmbr A B Lee Plmbg & Htg Co r RD 5 King Owen r 325 (323) Dannenberg King Pattie (c) maid r 613 (120) Charles King Ponder W (Florence) 2 mech Dixie Dairies h 444 Vine King R Earl student r 301 Montpelier King Reed (c; Ophelia) 1 lab h 7 Short (EM) King Rennie (c) r 308 Madison (V) King Rilla (c) lndrs h 206 (350) 3d (U) King Robt (c; Louise) 2 h 1055 Pio Nono King Roosevelt (c) emp Bibb Mfg Co r 360 Edison King Ruth (Mrs D L) opr Happ Bros Co r 254 Church (EM) King Sallie Mrs 1 r 101 (1) Balkcom King Sara E (c) maid Woman's Exch r 427 North King Shannon (c; Annie M) 3 emp James & Kingman Lbr Co h 102% Roberts (U) King Taylor (c; Mary) h 124 Roosevelt (V) King Veturia (wid J R) (o) h 596 Boulevard (NH) King Virgil E (Lillie M) 1 It Pump Co No 3 r 258 Columbus King Wade H (Louise) 2 (o) pipeftr Macon Gas Co h 212 American blvd King Walter r 325 (323) Dannenberg King Wilbur S (c; Julia) (o) h 520 Broad King Wm (c; Lady) 2 h 128 Bostic la King Wm (c; Maud) 1 r 442 O'Hara la King Wm (c; Corinne) 2 (o) jan S M Solo- mon h 199 Patterson 1935 Macon City Directory 319 King Wm (c; Mary) 3 peddler h 338 (77) Kirby Henry J (Adelle) emp Willingham Mills Dempsey h 217 (24) Holt King Wm (c; Jessie) porter The Red Front h Kirby Louise student r 217 (24) Holt 256 Madison Kirk Bertie W r 117 Garden King Wm H (Leila) 5 city firemn h 130 Wil- Kirk Lillie M opr Happ Bros Co r 117 Garden liams (SM) King Wm L (Linnie) (o) h 115 American blvd Kirk Mary E Mrs winder Bibb Mfg Co h 168 Gardner (PM) King Wm L (Blonnie) 3 sausage mkr T&T Kirk Mary S r 117 Garden Pkg Co h 103 Jeff Davis Kirk Mattie L tex wkr Bibb Mfg Co r 117 King Wm O tr dr Am Oil Co r RD 3 Garden King Woodrow r 768 Mulberry Kirk Wm W (Mina E) 1 h 117 Garden Kingery Cecil student r 218 Georgia Kirk Wilson W student r 117 Garden Kingery Lucille slswn Globe Dress Shop r 218 Kirkland Ernest T (Florrie) dist mgr Pan-Am Georgia Life Ins Co h 810 College apt 3 Kingery Pearl (wid H L) r 142 Magnolia Kirkland Perry (c) r 610 3d (V) Kingman Alf L (c) r 554 Chappell (SM) Kirkpatrick Frank M (Mary) ins agt h 615 Kingman Andrew L (Birdie H) sta atndt Ingleside Oil Co r 202 Ridge Johnson Kirkpatrick J D emp Greyhound Lines r Cen- Kingman-Burnett Stables J A Burnett mgr live tral Hotel stock 460 Plum Kirkwood Herman L (Thelma) 3 (o) plstr h Kingman Robt D (Rose O elk Kingman & 435 Marion (Lynmore Estates) Everett Inc h 401 College apt 5A Kingman Robt H Jr (May D) (o) pres Ga Seed Kirtland Lillian student r 1335 Edgewood Kirtland Lois dist sec FERA r 1335 Edgewood Store, Kingman & Everett Inc and Piggly Wiggly Macon Inc, vp City Bk & Trust Co h 218 High Kirtland Lucy Mrs 3 h 1335 Edgewood KIRVEN CEIL L (Miriam G) 1 Dist Mgr So Bell Tel & Teleg Co, h 109 Boulevard--tel Kingman Virginia S (wid P S) tchr Burke Sch 9070 r 340 Vineville Kingman & Everett Inc R H Kingman Jr pres, M E Everett vp J H Turner sec-treas who! gros 570 Broadway Kinley Chas T (Virginia) 1 slubber hd Bibb Mfg Co h 756 Oglethorpe Kirven Liston C (Beatrice) 1 (o) emp C of Ga Ry h 237 College Kitchen Betty waitress Hickey's Coffee Shop r Macon Hotel Kitchen Chas A (c; Janie) lab Carling Tile Co r 120 (310) Brooklyn (S) Kinley Paul (Paul's Place) r 405 Montpelier Kinley Virginia (Mrs C T) speeder hd Bibb Mfg Co r 756 Oglethorpe Kitchen James (c) (o) gdnr Ga Acad for the Blind h 120 (310) Brooklyn (S) Kitchen Nell reporter Macon Cred Bur r 378 Kinley Wm C (Audie M) 1 (o) repr So Bell Tel Co h 405 Montpelier Kinman Russell B (Ruth) 2 (o) assignment ofer Orange Kitchens Abbie Mrs h 130 Concord Kitchens Albert H (Florrie) emp Dessau Real- FERA h 222 Coleman Kinnett Donald D (Isabel) 2 sec Cotton States Fertilizer Co h 260 Belvedere dr (I) Kinnett Isabelle tchr Wesleyan Conservatory r Rivoli Ga Kinnett Jas T (Grace M) asst supt Willingham Mills h 118 De Soto pi Kinnett Katie B (wid J D) (o) h 515 Vine- ville (V) Kinnett Lizzie r 118 Rogers (V) KINNETT-ODOM CO, D I Lee Vp-Genl Mgr, Coal Yd 154 Railroad (V>---tels 771-772, Ice Plant 6th nr Cherry--tels 363-364 Kinney Fred emp Firestone Serv Sta r 600 Napier Kinney G R & Co Inc H E Shoenfelt dist mgr Fred Oliphant store mgr shoes 570 Cherry Kinney Roderic B (Sarah E) slsmn Mtr Parts Corp h 213 Bond apt C2 Kinney W O & Co (W O Kinney, L J Horton) cotton brokers 460 Pine Kinney W Oscar (Clara G) (W O Kinney & Co) h 600 Napier Kinney Wilbur (c) jan Lanier High Sch for Boys r 2 Bears al ty Co h 357 Fairview Kitchens Alice Y (Mrs C M) (Kitchen's Kitch- en) r 220 New Kitchens Alton r 130 Concord Kitchens Andrew C (Ileen L) (o) ins agt h 308 Log Cabin dr Kitchens Ami Mrs opr Ethel B Davis Beauty Shop r 756 Pine Kitchens Arnold E (Evelyn) 3 emp Bibb Mfg Co h 132 Comer ter (PM) Kitchens Aurelia opr Happ Bros Co r 815 Poplar Kitchens Bettie (c) h 315 Green Kitchens Blanch (c) h 121 (514) Fulton la Kitchens C Estes (Hildred) 2 elk r 172 Ell (SM) Kitchens Carl (Marie) 3 h 314 Chappell (SM) Kitchens Carolyn student r 330 Winship Kitchens Chas M (Alice Y) gro 500 (603) Smith (EM) h 220 New Kitchens Cohen B (Mae) emp C of Ga Ry h 117 Park pi Kitchens Drew dr Yellow Cab Co r 815 Poplar Kitchens E Mack (Gladys) (o) slsmn Marshall Furn Co h 204 Williams (SM) Kinsey Alf (c; Essie) emp Kingman & Everett Kitchens Ella (wid L C) h 815 Poplar r 416 (426) North (V) Kinsey Bee (c; Rosa) (o) jan Wesleyan Col h 109 (108) 4th (B) Kinsey Chas (Rosa L) 1 carder Bibb' Mfg Co r 3 Bibb Kinsey Fletcher (c; Annie) chauf Albert Adams h 428 y2 Ward (V) Kinsey Jos (c; Elnora) 2 cook Hotel Dempsey h 253 Garden Kitchens Elton baker Am Bakeries Co r 1535 2d Kitchens Ethel G (Mrs W L) emp Piggly Wiggly r 105 Rocky Creek rd Kitchens Floyd (c; Celia) 1 farm hd Masonic Home of Ga h 612 Broad Kitchens Francis (Virginia) carrier Macon Telegraph r 514 Jackson Kinslow Georgia (c) (o) h 233 (124) Elliott Kinslow Silas (c) farm hd h 923 Clinton rd (EM) Kitchens Fred A (Mary) 1 farm hd h 159 Roff Home la Kitchens Genie student r 330 Winship 320 Baldwin's and Telegraph's Kitchens H Coleman (Dorothy) cook Spillers Restr h 717 Plum Kitchens Harold L r 135 Ell (SM) Kitchens Harry timber buyer r 620 2d Kitchens Hattie L r 301 (104) Newberg Kitchens Henry elk Wilson's r 663 Plum Kitchens Homer E barber r 108 Pearce Kitchens Hugh D msrtgr Postal Teleg r RD 4 Kitchens Ida (Mrs W W) opr Adams Mfg Co r 1431 3d Kitchens J Hansel (Annie Bell) coir Macon Teleg Pub Co r Cross Keys RD 6 Kitchens James r 132 Comer ter (PM) Kitchens James hlpr Vineville Dog & Cat Hosp r 117 Park pi Kitchens Jas (c) lab Ga Acad for the Blind Kitchens James E (Addie M) 1 emp C of Ga Ry h 307 Church (EM) Kitchens James E (Annie) (o) gro 104 Center (EM) h do Kitchens James E student r 135 Ell (SM) Kitchens James T (Beulah) 2 emp Washburn Storage Co h 711 Main (EM) Kitchens James W (Willie M) (o) gro 1190 Mil- ledgeville rd h do Kitchens John C (Sallie) 2 serv sta 1156 Mil- ledgeville rd h do Kitchens John H h 330 Winship Kitchens John W (Ethel) 2 hlpr h 301 (104) Newberg Kitchens Joseph T (Mattie) swtchmn So Ry h 109 Grenada ter Kitchens Kath Mrs checker Snow's Ldry r 865 1st apt 1 Kitchens Kitchen (Mrs Alice Y Kitchens) restr 574 Mulberry Kitchens Lawrence H (Decima) 4 blrmkr C of Ga Ry h 2239 (2231) 2d Kitchens Lee D (Emmie) 5 city firemn h 135 Ell (SM) Kitchens Lee E r 135 Ell (SM) Kitchens Leila (c) r 315 Green Kitchens Lois Mrs r 664 Plum Kitchens Lucy Mrs 1 h 206 Main (EM) Kitchens Lula (Mrs P A) r 1528 3d Kitchens Mae W (Mrs C A) waiter Kitchen's Kitchen r 220 New Kitchens Margt waiter Joe's Crescent Cafe r 330 Winship Kitchens Marie (Mrs Carl) opr Happ Bros Co r 314 Chappell (SM) Kitchens Martha r 218 Georgia Kitchens Marvin O (Mary) 1 emp Bibb Chev- rolet Co h 117 (121) Colquitt Kitchens Mattie (c) maid r 718 Hawthorne Kitchens Myrtle emp Carling Tile Co r 1431 3d Kitchens O L baker Am Bakeries Co res Jef- fersonville rd Kitchens Odessa Mrs marker Independent Ldry Co r 556 Pine Kitchens Ollie (c) dom r 612 Broad Kitchens Oscar (Elva) 1 lab h 300 Antioch rd (Lynmore Estates) Kitchens Pearl opr Happ Bros Co r 613 1st Kitchens Philip (c) r 227 Collins pi Kitchens Rena r 115 Washington Kitchens Richd (c) hlpr Tank Car Serv Sta r 121 (514) Fulton la Kitchens Robt J mech Capitol Cycle Co r 1528 3d Kitchens Sallie opr Happ Bros Co r RD 4 Kitchens Sarah r 1141 Milledgeville rd Kitchens Sellers (c) porter Gulf Refining Co r 121 (514) Fulton la Kitchens Thelma (Mrs Wm) opr Happ Bros Co r 138 Concord Kitchens W Burke elk McNair Lbr & Sup Co r RD 6 Cross Keys Kitchens W Lee (Ethel G) r 105 Rocky Creek rd Kitchens W Lester baker Am Bakeries Co r 1535 2d Kitchens Wm (Thelma) h 138 Concord Kitchens Wm T (May) trav slsmn h 127 Washington Kitchens Wm W (Ida) 2 h 1431 3d Kitchens Willie (c) maid r 612 Broad Kitching Walter A (Laura) (o) emp C of Ga Ry h 458 Spring Kite Hattie M winder Bibb Mfg Co r 301 Main (EM) Kite Jackson student r 224 Georgia Kite Jesse (Lucile) 4 tex wkr Bibb Mfg Co h 301 Main (EM) Kite Jesse Jr emp Bibb Mfg Co r 301 Main (EM) Kite Louise student r 301 Main (EM) Kiwanis Club S L Orr sec meets Wed 1:15 p m Hotel Dempsey Kizzie Anderson (c; Mary) 3 (o) lab MD&SRR Co h 505 Fulton (EM) Kizzie Andrew (c) lab Proctor & Gamble Mfg Co h 454 Bay Kizzie Carlton (c; Mary) jan Huckabee Auto Co r 1204 3d Kizzie DeWitt (c; Alma) lab Proctor & Gam- ble Mfg Co h 321 Hammond Kizzie Hattie (c) (o) maid Mrs Eugenia Kemme h 216 Fulton (EM) Kizzie Nellie (c) dom W G Robarts Kizzie Nellie (c) maid 756 Ridge Kizzie Rufus (c; Louise) 3 fnshr Art Furn Mfg Co h 386 Melrose (EM) Kizzie Sylvia (c) r 454 Bay Kizzie Thos (c; Marie) emp Proctor & Gamble Mfg Co h 518 Plant al Kizzie Wm (c) barber J A Braswell r 321 Hammond Klarpp Frank H tr dr Ga Power Co r 813 Poplar apt 2 Klarpp Frank S (Minnie) supt Bibb Bag Co h 813 Poplar apt 2 Klarpp Joseph M r 813 Poplar apt 2 Kleckley Moody D rodmn State Hwy Bd r 125 Rose pk Klein Louise (wid S A) (o) h 974 Montpelier Klein Mynette H Mrs slswn Beverly Dress Shop r 205 Clisby pi Klemko Joseph tech Dixie Dental Lab r 401 College Kline Constance r 202 Albemarle pi (I) Kline Frank W (Rose B) 1 (Brown-Kline Sign Co) h 121 Log Cabin dr Kline Wm R (L Jean) (o) dept mgr J N Neel Co h 202 Albemarle pi (I) Kline Wm R Jr student r 202 Albermarle pi (I) Klinefelter Louise (wid B R) 1 slswn Dannen- berg's h 672 Hemlock Knight Alice (Mrs J H) opr Adams Mfg Co r 106 Church (EM) Knight B Dallas (Gladys) 4 (o) condr C of Ga Ry h 204 College pi Knight Chas (c; Estella) mech City Garage h 159 Lincoln (V) Knight Clarence E (Minnie) (o) elk Ry MS h 445 Boulevard Knight Clarence E Jr (Esther M) 1 slsmn r 445 Boulevard Knight Daisy (c) h 122 (782) Nussbaum Knight Daisy (c; Beatrice) lab h 10 Buckner al Knight David (Lizzie) h 304 Flanders Knight Earle (wid T P) (o) h 356 Masonic Home rd (NH) Knight Effie M (c) cook C W Robinson r 416 Bay 1935 Macon City Directory 331 Knight Estelle (c) maid C H Smith Knight Ethel Mrs 1 h 512 Hemlock Knight Ezekiel (c; Emma) 1 hlpr Central S&D Co h 302 Charles Knight Ezekiel Jr (c; Rosa) 2 lab Standard Tool & Handle Co h 125 (155) DeBorde Knight Francina Mrs ofc sec The Clinic r 209 1st Knight Frank (c; Esther) 1 h 451 Broad Knight Geo student r 201 Pierce (V) Knight Harold student r 428 Carling Knight Isaac C formn So Ry res Walden Ga Knight Jack (c; Edith) 5 porter Am Bakeries Co h 2116 Wyches al Knight Jas H gro & lunch rm 991 Montpelier h do Knight Jean marker Snow's Ldry r YWCA Knight Jesse J (Mattie) h 104 3d Knight John H (Alice) h 106 Church (EM) Knight John H (Evelyn) 1 city firemn h 305 Church (EM) Knight Julia (wid C H) r 106 Church (EM) Knight Lena B tex wkr r 304 Flanders Knight Louise E mgr Coml Casualty Ins Co r 422 Spring Knight Mattie L (Mrs J J) opr Happ Bros Co r 104 3d Knight Mattie M (c) maid r 303 (302) Charles Knight Prentice L (Eunice) 2 elk J H Knight h 983 (1793) Montpelier Knight Robt L vp Macon Production Cred Assn res Waldon Ga Knight Rosa (c) maid M E Bassett r 125 (155) DeBorde (SM) Knight Wm emp Bibb Mfg Co r 304 Flanders Knight Wm C (Laura) 1 mech Dixie Dairies h 156 Williams (SM) Knight Wm C (Gussie) 2 (o) slsmn Barden & Taylor h 428 Carling Knighton Susie (c) r 108 Wise (V) Knighton Thos (c; Matilda) 7 emp Riverside Cem h 108 Wise (V) Knights of Columbus Lodge No 925 M J Cal- lagan sec meets 1st & 3d Tues at 8 p m 814 Poplar Knights of Pythias S T Ray sec meets 1st Wednesday 8pm 515 2d Knights of Pythias Building (c) 556 New Knights of Pythias Hall (c) 217 Garden Knott James A (Emily) vp-sec GAB Sch of Com h 261 Georgia apt D1 Knowles Fannie Mrs h 409 Virginia Knowles Mattie (wid W M) opr Happ Bros Co h 117 Dixie Knowles P Wesley dr Yellow Cab Co r 117 Dixie Knowles Pamelia (wid J W) r 847 Patterson Knowles Steph (Martha) emp State Fish Hatchery r 112 Enterprise Knowlton Ruby (c) r 240 Middle (V) Knox Rose A (wid J A) r 300 Pierce (V) Koch Edw A (Lenora) 2 mgr Riverside Arena r 615 Ocmulgee Kochis Jack L student r 627 Adams Kohler Mabel B sten r 2400 Forsyth rd Kolodner Morris (Belle) 1 (Morris Gro Store) h 869 Elm Kontos Geo cafe mgr r Hotel Southland Koplin Alvin bkpr Macon Iron & Paper Stock Co r 312 Cherokee Koplin Henry (Sarah) 2 (o) (Central City Auto Krenson Fredk (Lenora) U S Probation Ofcr h 107 Buford pi Kress S H & Co J D Brown mgr dept store 610-12 Cherry Krewson Luther H (Bessie) emp Buckeye Cot- ton Oil Co r 726 Walnut Krewson Wm H elk Burden Smith & Co r Ub Walnut Kuhn Fredk V (Lucrecia) lbrmn Moyar Lbr Co h 384 Suwanee KUHN FREDK W (Dorothy), Mgr Kuhn Mfg Co, r 384 Suwanee--tel 2357 KUHN MANUFACTURING CO, Fredk W Kuhn Mgr, Janitors Supplies 314 Broadway-- tel 3628 (See Page 92 and Cards BD) Kuhr Dorothy elocution tchr 855 Mulberry apt 400 r do , jnn Kuhr Edith (wid Julius) h 855 Mulberry apt 400 Kurtz Jewel (Mrs L R) spinner Bibb Mfg Co r 1020 Hazel Kurtz John H (c; Mamie) 2 (o) barber Jack Sheftall h 599 Center (EM) Kurtz Leroy R (Jewel) reprmn Empire Furn Co r 1020 Hazel Kyles Octavine (c) r 357 North Kyles Vernetta (c) r 357 North Kyles DeVerne (.c) r 357 North KYLES DRUG STORE (James G Kyles) 527 Cotton--tel 9304 Kyles Euphrasia (c) elk Kyles Drug Store r 417 Monroe Kyles Frank (c; Kath) 4 (o) h 357 North Kyles Frank (c; Eliz) 1 brklyr r 358 Madison Kyles Hattie (c) elk Kyles Drug Store r 417 Monroe ,,, . KYLES JAMES G (c; Euphrasia) (o) (Kyles Drug Store) h 417 Monroe L&N Drug Co (E D & E D Leonard Jr) 610 3d Laborn James (c; Rosetta) lab City St Dept h 8 Franklin St la Lacey Ada (c) lndrs r 165 Coles al Lacey Edw H del supvr Buck Ice & Coal Co r 393 Orange Lackay Edw D (Leola) genl repr 501 Giles apt 3 h 76 Cedar (SM) Lackey Edw P elk Lackay & Lackay r 3033 Houston Lackay Hall 1502% Broadway Lackay James (Ada) (o) (Lackay & Lackay) h 110 Cedar (SM) Lackay John F (Eva M) (o) (Lackay & Lack- ay) h 3033 Houston Lackay & Lackay (J F & James) gros 1502 Broadway Lackey Joseph (c; Tennia) 1 emp C of Ga Ry h 627 4th (WH) Lackey Joseph Jr (c) student r 627 4th (WH) Lackie James C (Dolly) 2 (Southland Barber Sup) h 566 Poplar Lacy Ellen (c) cook F H Humphreys r 210 Summit Hill (S) Lacy Thos (c) delmn R K McAfee r 210 Sum- mit Hill (S) Lacy Wm (c; Willie M) porter Mercer Umv r 317 Jefferson Lacy Willie-D (c) 12 lndrs h 210 Summit Hill (S) Ladd John (c) jan Mulberry St ME Ch Ladies Auxiliary Brotherhood of Locomotive Engrs Mrs Avaleen McDaniel sec meets 2d & 4th Tues 3:30 p m 408 Poplar Pts Co; Macon Iron & Paper Stock Co) h Lafayette Terrace apt 305 College 312 Qh prokee La Grone C Jack (Leila May) 4 tex wkr Wil- Kraay Eloie (Mrs A L) opr Happ Bros Co r lingham Mills h 143 Carling 208 Peachtree Kraay Leonard r Arcadia Hotel Kraft Herbert F (Rena C) 3 tchr Wesleyan Conservatory h 304 Hill Crest La Grone Mary E Mrs 1 tex wkr Willingham Mill r 224 Duncan La Grone Minnie L r 224 Duncan 3 n Baldwin's and Telegraph's Lain Parks L (c; Sara) 3 (o) carrier PO h 562 Monroe Laing Fredk C (Ethel M) sta atndt Tank Car Serv Sta h 544 Forsyth Lakes Julia (c) emp Independent Ldry r 953 Ocmulgee Lakes Sylvester (c; Viola) emp C of Ga Ry r 916 Ocmulgee Lakes Viola (c) emp Snow's Ldry r 916 Ocmulgee Lakin Clifford emp John Hainline r Phoenix Hotel Lamar Aaron (c; Mattie) 6 h 250 5th (U) Lamar Aaron Jr (c) r 250 5th (U) Lamar Annie (c) dom C S Joyner r 145 Col- lege Lamar Annie (c) lndrs h 562 Dunlap al Lamar Annie P (c) presser Economy Shoe Reprs r 310 (346) Tindall Tamar Arth (c; Edna) emp Maxwell Bros r 206 Elliott Lamar Arth (c; Salome) trkr C of Ga Ry h 230 (235) Roosevelt Lamar Champ (c) hlpr C of Ga Ry h 205 (406) Thompson's al Lamar Clara (c) 1 maid T T Carstarphen h 104 (148) Elizabeth (SM) Lamar Clifford (c; Bertha) h 624 Chapman al Lamar Eli (c) lab r 132 Bright al Lamar Eliz (c) h 209 (711) Plummers al Lamar Eliz (c) 6 h 441 (440) 4th (V) Lamar Emmett (c) emp C of Ga Ry r 909 (993) Cowan Lamar Ethel (c) lab So Crate & Veneer Co r 803 (789) Crisp Lamar Eula (c) cook r 521 Ross Lamar Fannie (c) lab Proctor & Gamble Mfg Co Lamar Foustine (c) 2 lndrs h 521 Ross Lamar Geo (c; Ethel) emp So Crate & Veneer Co r 803 (789) Crisp Lamar Hattie (c) r 265 Walnut Lamar Henry (c) h 604 4th (WH) Lamar Henry J (Kath) 1 slsmn R A McCord Mtr Co h 108 Alabama (V) Lamar James (c) 2 h 259 Woodliff Lamar James student r 553 Walnut Lamar Jerry (c) butler 110 Montpelier Lamar Jerry (c) hlpr Pig 'n Whistle Sandwich Shop r 250 5th (U) Lamar John H (c) delmn Moore's Gro r 521 Ross Lamar Jos (c) hlpr C of Ga Ry r 205 (406) Thompson's al Lamar Julia (Mrs J T) h 401 College apt 7G Lamar Larious emp C of Ga Ry r 553 Walnut Lamar Laurina (c) r 71 Schofield Lamar Lucia bkpr Masonic Home of Ga r do Lamar M L (c) porter So Stages Inc r 111 (10) Orchard Lamar Maria case wkr Masonic Home of Ga r do Lamar Mary (c) cook L R Baird r 521 Ross Lamar Mattie (c) r 421 (r) Oak Lamar Mattie (c) 1 dom r 300 Hawkins Lamar Millie (c) 1 h 803 (789) Crisp Lamar Minnie (c) r 250 5th (U) Lamar Mollie (c) cook J L Davis r 116 (366) Craft (V) Lamar Neal (c; Anna) 2 lab So Crate & Ve- neer Co h 46 Harris Lamar Pierce L (c) barber Palmetto Barber Shop r 441 (440) 4th (V) Lamar Robt (c; Mattie) bellmn Dempsey Hotel h 374 3d (U) Lamar Robt F (c; Mollie) delmn Lyons Cash Mkt r 116 (366) Craft (V) Lamar Rosa (c) cook Mrs Louise Cater r 89 (126) Forest (V) Lamar Salome (c) cook J M Sigman r 230 (235) Roosevelt Lamar Sami (c; Nellie) 5 h 217 Mutual (V) Lamar Shorter (c) porter Mary Elizabeth Shop r 310 (346) Tindall Lamar Vinie (c) cook Horace Newman h 310 (346) Tindall Lamar Walter D (Dorothy) (o) ofc 206 Grand Bldg h 238 Georgia Lamar Willie (c) r 310 (346) Tindall Lamb Annie B (c) lndrs r 818 Elm Lamb Chas F (Jennie A) supt Standard Tool & Handle Co h 614 Montpelier Lamb Doris L (Mrs H D) elk Newberry's r 1304 2d Lamb Durelle F (Margt O) trav slsmn h 661 New Lamb Harvey B (Lillie) 1 emp Bibb Mfg Co h 744 Oglethorpe Lamb Henry D (Doris L) 1 emp Swift & Co r 1304 2d Lamb Henry K (Lizzie) 3 checker Jeffreys- McElrath Mfg Co h 204 American blvd Lamb Henry S (L Gertrude) (o) formn Chero- kee Brick Co h. 126 Napier Lamb James C (Orie) 5 wtchmn Paul Wil- liams Co h 220 Buena Vista Lamb John G (Ollieree) pdlr r 1106 Oglethorpe Lamb John R (Daisy) (o) formn Cherokee Brick Co h 145 Laurel Lamb Julian dispensor Hotel Dempsey r 204 American blvd Lamb L Gertrude (Mrs H S) ofc sec Barfield Feed Mills r 126 Napier Lamb Lillie (Mrs H B) spooler Bibb Mfg Co r 744 Oglethorpe Lamb Margt r 126 Napier Lamb Margt O (Mrs D F) tchr Fort Hawkins Sch r 661 New Lamb Mollie (c) lndrs r 901 (917) Cowan Lamb Paul R (Louise B) 2 elk PO h 11 Des- sau pi Lamb Perry H (Iona) (o) asst county solr genl and bailiff City Court h 104 Pierce Lamberth Barney C elk Shelverton-Bayne Drug Co r YMCA Lamis Andrew emp New York Clnrs r 261 Columbus Lamis Cecile r 261 Columbus Lamis Chas student r 261 Columbus Lamis James A (Lula) 1 (o) (New York Clnrs) h 261 Columbus Lamis Pepina r 261 Columbus Lamis Wm hat clnr New York Clnrs r 3d fir Hardeman bldg Lamon Allie M r 139 Tenney Lamon Harry V (Helen B) 1 elk Willingham Mills h 104 Summit Lamon Homer N student r 309 North (NH) Lamon John D (Lucy I) (o) engr GS&FRR h 309 North (NH) Lamon Martha A tchr Bellevue Sch r North (NH) Lamon Sara L librarian Miller High Sch r 309 North (NH) Lamon Sarah C (wid H N) 1 (o) h 139 Tenney Lampertine Ada Mrs r 320 Cherry Lancaster Ada (wid J E) 4 r 1432 2d Lancaster Clinton elk FERA r 105 Willingham Lancaster Fannie M (wid C C) h 105 Willing- ham Lancaster Omar J Jr elk Rogers Inc r 156 Magnolia Lancaster Wm G (Bell) 1 engr C of Ga Ry h 123 Washington 1935 Macon City Directory 333 Lancaster ffm G Jr r 123 Washington Land Ancie P (wid J W) 3 spooler Bibb Mfg Co r 1421 3d Land Edw r 1421 3d Land Ernest M (Pearl) 2 mach Maxwell Bros h 103 Log Cabin wy Land Fred R (Elzie) 1 doffer Bibb Mfg Co h 122 Comer ter (PM) Land Geo T (Emma) 2 h 423 American blvd Land Green B (Cleo) 1 tex wkr Willingham Mills h 18 (84) Mill Land Helen sten State Hwy Bd r 422 Spring Land J C meats 165 5th r do Land J Hillyer (Blanie C) 1 pntr r 142 Laurel Land J Robt r 103 Log Cabin wy l and James (Minnie B) 2 lab Adams Mfg Co Lane L Otis (c) emp Dr Pepper Btlg Co h 319 Norris Lane Lillian (c) r 332 Gilmer Lane Lovey (c) maid h 218 5th (V) Lane Lucile (wid M L) 1 r 615 2d Lane Lucille (c) opr Bibb Mfg Co r 412 Peachtree Lane Lula (c) r 635 Elm St la Lane Marjorie student r 409 Adams Lane Mattie M (c) 1 lndrs r 866 (65) Ballard (EM) Lane Mildred instr Middle Ga Hosp r do Lane Milton O B (c) agt N C Mut Life Ins Co r 380 Monroe Lane Moses (c) r 144 Sycamore (V) Lane Nicholas (c; Essie) 4 lab C of Ga Ry h r 425 American blvd Land Jas L (Josephine) (o) flgmn So Ry h 324 Cleveland (SM) Land James R r 103 Log Cabin wy Land John F (Evie L) 3 h 215 (111) Balkcom Land Louell opr Vanity Beauty Shop r 142 Laurel _ _ Land Marguerite (Mrs W O) bkpr Union Dry Gds Co r 115 De Soto pi Land Oscar (Mamie) 3 tex wkr h 112 (260) Bell Land Sami r 822 1st Land Thos A (Velma) 1 emp Art Furn Mfg Co h 133 Williams (SM) Land Viola (wid E J) 2 (o) winder Bibb Mfg Co h 223 (122) Cutters la (EM) Land Wm tex wkr Willingham Mills r 18 (84) Mill Land Wm L (c) student r 501 e 1st (EM) Land Wm O (Marguerite) (o) br mgr Power Oil Co and mgr Kelly-Springfield Tire Co h 115 De Soto pi Land Willie L pugilist r 507 Hawthorne Landcaster A K emp Greyhound Lines r Cen- tral Hotel Landd Corine (c) smstrs Mathew Fleming res Dry Branch Ga Landrum C Logan (Marguerite) 2 pastor Tat- nall Sq Presbyterian Ch h 426 Carling Lane A Eldridge (Berta) prod buyer h 109 (145) Charles Lane Adeline (Mrs R H) opr Happ Bros Co r 1315 2d Lane Andrew W (Adeline) 1 emp Adams Mfg Co h 520 Washington Lane Anna B (wid L B) (o) h 144 High Lane Annie (c) 4 h 249 Woodliff Lane Carrie (c) h 216 Plant (SM) Lane. Clayburn B (c) barber 613 Broadway r 218 5th (V) Lane Curtis (c; Lucile) 2 emp C of Ga Ry h 412 Peachtree Lane Del r 112 Holt (V) Lane Ellen (Mrs Chas) 1 (o) h 112 Holt (V) Lane Fillmore B (The Apex; Lanes Hotel) r Lanes Hotel Lane Harvey T (Norma) 1' (o) yd condr C of Ga Ry h 130 Magnolia Lane Harvey T Jr elk Ga Power Co r 130 Magnolia Lane Hattie McK (wid A W) (o) h 316 Harde- man Lane Inez Mrs slswn Maysons r 209 1st 305 Plant (SM) ,, Lane Obie (wid C E) opr Happ Bros Co h 457 New _ t ,anp Richd L (Mary) 4 bus opr Ga Power Co h 130 Ponce de Leon Lane Ruben M (Viola) 5 (Ohio Garage) h 3490 Houston (SM) Lane Ruth opr So Bell Tel Co r 457 New Lane Sherman (c) emp Maxwell Bros r 122 Thomas (EM) Lane Sylvester (c) emp Nu Icy Btlg Co r 319 Norris Lane Thos R (Eva G) h 860 Pine LANE V McKIBBEN (Linda A) 3 (o) (Turpin & Lane) h 109 Hines ter (V)--tel 4328 Lane Virginia H sten Bibb Mfg Co r 316 Hardeman Lane Walter tex wkr r 7 Roff Home pi Lane Walter B (Rose) electrn Bibb Mfg Co h 754 Oglethorpe Lane Wm (c) lab Macon Cooperage Co r 112 Elm Lane Wm F (c; Susie) emp Macon Milling Co r 241 Tindall Lane Wm F (c; Rosa) 1 lab h 305 Norris Lanes Hotel (F B Lane) 555 Broadway Laney Chas H (Agnes L) 2 (o) coir Macon Teleg Pub Co h 133 Edna pi (LG'Hts) Laney Howard F student r 505 Carling Laney John F (Annie D) 1 printer Macon Teleg Pub Co h 505 Carling Laney Lydia F r 505 Carling Laney Maude (c) tchr Green St Sch r 217 1st (V) Lang Sami (c; Viola) emp So Ry h 755 Elm Langford Danl F (Lillie M) printer J W Burke Co r 554 1st Langford Geo H (Alice) yd mn B F Merritt Coal & Wood Co h 670 Ash Langford Hattie B Mrs opr Happ Bros Co h 1505 2d Langford John (c; Sallie) (o) emp Mercer Univ h 123 Bell Langford Leroy (Mary H) 2 emp Bibb Mfg Co h 752 Oglethorpe Langford Lois r 310 Reid Langford Lucile (Mrs R D) winder Bibb Mfg Co r 303 Chappell (SM) Langford Mary H (Mrs Leroy) emp Bibb Mfg Co r 752 Oglethorpe Langford Odelle winder Bibb Mfg Co r 303 Chappell (SM) Langford Robt D (Lucille) winder Bibb Mfg Co h 303 Chappell (SM) Lane J Warren student r 112 Corbin (V) Langford Sarah E (wid J R) (o) h 1723 3d Lane Jesse L (c) lab r 305 Norris Langford Thelma opr Happ Bros Co r 1505 2d Lane John (c; Jessie M) 5 lab So Crate & Veneer Co h 426 (513) Henrietta (SM) Lane John T (Lois L) elk Acme Fish Co r 651 Plum Langford Thos I (Emma) hlpr h 915 Walnut apt 6 Langford Thos I Jr r 915 Walnut apt 6 Langley Edna r 144 Williams (SM) Lane Kate (c) 4 maid G S Jones h 289 2d (V) Langley H Veston (Odell) 1 h 1525 Broadway 331 Baldwin's and Telegraph's Langley Oscar E h 144 Williams (SM) Lassetter Nannie E Mrs Oo h 555 Pine Langley Timothy R emp Ga Power Co Lassetter Robt L (L Inez) 2 (o) gro 907 Clin- Langston A Raymond (Pauline) 1 asst supt ton h 128 North Bibb Mfg Co r 310 Duncan Lassiter Bonnie winder Bibb Mfg Co r 267 Langston Alex T (Edith) 3 (o) elk C of Ga Ry Maple h 402 Beech Lassiter Louella winder Bibb Mfg Co r 267 Langston Chas r 103 Academy Maple Langston Chas E (Daisy) (o) engr So Ry h Lassiter Lula (c) maid r 456 Chestnut 1408 2d Laster Kathleen N student r 137 Magnolia Langston Comer (c) emp Maxwell Bros r 410 Laster Reuben J (Annie L) 1 (o) slsmn Ga Oil Peachtree Co h 137 Magnolia Langston Emmaline (wid J W) r 1408 2d Laster Reuben J Jr student r 137 Magnolia Langston Henry (Lula L) 2 (o) slsmn Central Lastinger Martha nurse Middle Ga Hosp r do Ga Bkg Co h 104 1st (CP) LaTaste John J (Ella) h 115 Plant (SM) Langston Inez (wid Walter) slsmn Union Dry Latham Alberta (c) r 453 Shoals al Gds Co r 103 Academy Latham Elias M (Eliz K) trav slsmn r 140 High Langston Mabel (wid J C) (o) h 503 Napier Latham Eliz (Mrs R O) asst G C Jones r 123 Langston Marion elk C-M-P Drug Co r 503 Inverness Napier Latham James (c; Ella) 2 cook h 501 e 1st Langston Martha 1159 Elm (EM) Langston Maud (wid D G) r 346 6th (SM) t,atham Robt O (Eliz) slsmn Shell Petroleum Langston Wm G (Nell) elk C of Ga Ry r 503 Corp r 123 Inverness Napier Latham Robt S (Helen T) formn C of Ga Ry Langston Wm W (Carrie E) patrolmn CPD h h 611 Forsyth 350 Columbus Latham Wm T hlpr E H Meadows r 4103 Lanham Clifford (wid W A) opr Adams Mfg Houston Co h 114 Chappell (SM) Latimer A Thos (c) porter Dunlay-Peeler Lanham John r 114 Chappell (SM) Hdwe Co h 506 Wanders Lanham Virginia r 114 Chappell (SM) Latimer Adolphus (c; Mary J) h 156 Sycamore Lanier Albert (c) r 301 Hanson (SM) (V) Lanier Chas P (Sarah C) 1 asst mgr Liggetts Latimer E L (c) r 506 Flanders Drug Store h 114% Pierce (V) Latimer Eula F (wid E C) (o) h 103 Hartley Lanier D Ashley student r 102 Cleveland (V) (CP) Lanier D Walter (Edith) 2 trav rep U S Nat Latimer Exie (c) 3 maid L B Thompson h 247 Reemployment Ofc r 102 Cleveland (V) 5th (V) Lanier Eilleen (wid D B) r 318 Spring Latimer Florine mus tchr 111 Cleveland (V) Lanier Emma (Mrs S C) opr Adams Mfg Co r do r 760 Cherry Lanier Henry L pntr Freeman Hart r 600 Hill Crest rd Latimer Ida E Mrs (o) h 111 Cleveland (V) Latimer Isaac (c) r 247 5th (V) Latimer Mary (c) maid S W Wallenstein h 1 Lanier High School for Boys P R Anderson Hawkins prin Holt cor Napier Latimer Nellie tchr Joseph Clisby Sch r 111 Lanier High School for Girls Anna Weaver Cleveland (V) prin 126 Forsyth LANIER HOTEL (See Hotel Lanier) Latson Chas (c; Mollie) h 105 2d (B) Latson Linnon L (Hattie) emp C of Ga Ry Lanier Louise Mrs h 718 3d h 1809 2d Lanier Louis D (Evelyn M) 1 printer Macon Latter Day Saints Church 408 Poplar Teleg Pub Co h 125 Laurel Lattimore Dooley (c; Mary) 1 lab h 1164 Lanier Marjorie sten Met Life Ins Co r 722 Ocmulgee Mulberry Lattimore Effie (c) maid The Clinic r 12 Spring Lanier Mary sten FERA r 722 Mulberry Lanier Minnie (wid J D) r Y W C A Lattimore Gabriel (c; Effie) hlpr C of Ga Ry h 12 Spring Lanier Noel J elk P O r 111 Jefferson Lanier Otis (c; Eliz) lab r 855 Smith row Lanier Robt C (Ollie) electrn Ga Power Co h 106 (144) Charles Lanier Robt D r 759 Poplar Lanier Sidney slsmn r Hotel Dempsey Lanier Sidney C (Emma) tr dr r 760 Cherry Lanier Sidney Chapter U D C Mrs C C Corbin pres meets 1st Wed 4pm 113 Rogers Lansing Maude (wid O S) 1 h 505 Telfair (SM) Lansing Oscar r 505 Telfair (SM) Lapsley Geo A (Daisy) 1 slsmn Sears-Roebuck r 102 Cleveland (V) Large Clara (wid W F) smstrs r 416 Calhoun Larry Carrie (c) h 408 (541) Elizabeth (SM) Lary James R (Louise) 1 asst bkpr So Crate & Veneer Co r 106 Lamar (V) Lary Nancy B Mrs h 459 Carling Lary Robt (c) r 230 Jones Lasear Hannah (c) r 1 Moore al Lash Hattie (c) 2 maid h 311 Monroe Lasseter Helen C student r 263 College Lasseter Horace S (Marion) 3 (o) plan A L Miller High Sch h 885 Winton Lasseter Rob't V (Winona) coir E Tris Napier Co r 263 College Lattimore Hattie (c) r 77 Wilder (SM) Lattimore Mary L (c) maid h 77 Wilder (SM) Lattimore Matilda (c) 3 h 213 Tharpe Lattimore Perrie (c) cook W W Bennett r 126 (219) Orchard Lattimore Rosa (c) 3 r 49 (54) Greens al Laurine Apartments 559 Orange LaVar Emma Mrs r 308 Applewood Lavender A Clinton (Earl) dr Yellow Cab Co r 219 Tatnall Lavender Alma G opr Bibb Mfg Co r 40 Hydrolia Lavender Ardelia (wid C F) r 151 Milledge- ville rd Lavender Beulah Mrs (New Deal Gro) h 511 Forsyth Lavender Clinton D (Harriet) (o) car inspr So Ry h 219 Tatnall Lavender Ernest (c; Eula) emp Willingham Mills h 208 Douglas (V) Lavender Ethel (Mrs R B) opr Bibb Mfg Co r 40 Hydrolia Lavender Eula (c) maid B A Schmidt r 208 Douglas (V) Lavender Herbert slsmn Hayes Clo Store r 210 1st 1935 Macon City Directory 325 Lavender Hubert (c; Maud R) 3 draymn h 229 Lawrence Floyd (c) lab r 114 Sapp (U) Grant (V) Lawrence Geo (c; Priscilla) (o) brklyr r 506 Lavender Ida emp Bibb Mfg Co r 1151 e 2d (EM) Milledgeville rd Lawrence Henry (c; Viola) 4 chauf W D Lamar Lavender James (Mary) emp Indian Mounds h 170 Lynwood (V) r 85 Cedar (SM) Lawrence Hency (c; Jennie) 1 jan YWCA Lavender James A (Bertha M) h 212 Calhoun r 504 Edison Lavender Jessie (e) maid r 208 Douglas (V) Lawrence Henry G slsmn Dixie Dairies res Lavender Joseph (c; Tommie) 1 h 215 Jeffer- Lakeside pk son Lawrence Henry I (c) delmn Moore & Boone r Lavender Leonard L (c; Genevieve T) (o) picker 170 Lynwood (V) Bibb Mfg Co h 200 Lincoln (V) Lawrence Homer (Bessie) blrmkr C of Ga Ry Lavender Lonnie (Mary G) emp W G Elder r h 809 Mikado 308 Church (EM) Lawrence James (c) emp Jeffreys-McElrath Lavender Lydel B (Mildred) emp Bibb Mfg Mfg Co h 5 Barnharts Bottom Co h 38 Taylor Lawrence Jas (c; Nellie T) (o) lab h 220 Roose- Lavender Mackey r 1151 Milledgeville rd velt (V) Lavender Mannie r 918 New Lawrence James B (Clara) 1 emp C of Ga Ry Lavender Marcus L (c) student r 200 Lincoln h 1331 3d (V) Lawrence James D (Mary) 1 slsmn r 703 Holt Lavender Mary G (Mrs Lonnie) spooler Bibb Lawrence Jas W (c) r 220 Roosevelt (V) Mfg Co r 308 Church (EM) Lawrence Jennie r 2810 Houston (SM) Lavender Mathie C (Louray) 1 h 625 Main Lawrence Julia h 161 3d (EM) Laurence Julia (c) emp Independent Ldry r Lavender Minnie L (wid W H) (o) h 813 Wool- 405 (346) Maynard folk Lawrence Katie (c) r 121 (25) Magnolia la Lavender Oscar T (Myrtle) (o) engr C of Ga Lawrence Lewis (c; Lillian) lab So Crate & Ry h 141 Park pi Veneer Co r 17 (9) Sparks al Lavender Richd B (Ethel) 3 opr Bibb Mfg Co Lawrence Lillian (c) cook R T Birdsey r 17 (9) h 40 Hydrolia Sparks al Lavender Tommie (c) cook T W Ellis r 215 Lawrence Lucy (c) r 5 Barnharts Bottom J cffcrson Lawrence Mamie (c) emp C of Ga Ry r 104 Lavender Walter J (Mattie) 1 h 41 White (SM) Empire (V) Lavender Wm H (Alice) 2 (o) emp So Ry h Lawrence Mamie L (c) 1 maid Purlonia 136 Ell (SM) Meaders h 114 (646) Hicks al Lavender Wm H Jr r 136 Ell (SM) Lawrence Matilda (c) dom Ruby J Grace r 124 Lavine Lillian recording elk County Superior (490) Virgin (V) Ct r 310 Cherokee Lawrence Millie (c) lndrs h 132 Coleman al Lavine Louis S (Union Furn Co) r 310 Cherokee Lawrence Roy (Bessie M) emp Bibb Mfg Co Law Albert W (Doris) 1 (o) emp C of Ga Ry r 410 Jackson h 120 Paul Lawrence Sallie (c) 1 lndrs h 114 Sapp (U) Law Anne sten r Y W C A Lawrence Sami (c; Matilda). 2 lab C of Ga Ry Law Annie (wid Jarrett) h 246 Hydrolia h 124 (490) Virgin (V) Law Edgar (c; Hattie) porter Ry Exp Agcy r Lawrence Wm (c; Velma) 1 h 14 Short St la 114 (14) Wise (V) Lawrence Wm L (c; Frances) 2 lab r 1211 Law Edw (c) elk C M Kitchens h 349 Haw- (110) Woolfolk thorne Lawrence Willie M (c) r 1211 (110) Woolfolk Law Hattie (c) cook D F Stansbury h 114 (14) Laws Robt (c) (o) pkr Willingham S&D Co Wise (V) h 236 4th (V) Law John F sta atndt Gulf Refining Co r 218 Lawson A Lowell agt Life Ins Co of Va r 506 Georgia Carling Law Joseph W emp Bibb Mfg Co r 246 Hydrolia Lawson Addie (c) r 113 Edgewood Law Wm (c; Viola) 3 lab h 110 e Ell Lawson Andrew S (Rosa) 1 (o) sheriff Bibb Lawhorne Eunice student r 201 Pierce (V) County h 196 (120) Crescent Lawhorne John student r 201 Pierce (V) Lawson Annie (c) 2 h 111 Tatnall Lawless Henry H mech Colored Taxi Co r 143 Lawson Belle (c) maid N F Coleman h 112 Cole (164) Virgin Lawless John I (Luvenia) 1 hlpr h 108 (5) Lawson Bessie (c) cook P L Hay r 211 Chest- Myrtle (EM) nut Lawless Lilia r 108 (5) Myrtle (EM) Lawson Chas (c) r 101 (1) Braswell la Lawless Roy (Ethel) hlpr r 559 Main (EM) Lawson D Mai (c) 1 r 756 Edgewood Lawless Wm hlpr r 108 (5) Myrtle (EM) Lawson Ernest (c) student r 111 Tatnall Lawless Wm H (Bessie) mgr Pleasant Hill Lawson Esther (wid W L) r 129 Edna pi Beer Parlor h 143 Cole (LCHts) Laurence Alice (c) h 17 (9) Sparks al Lawson Frank (c; Bessie) chauf P L Hay Lawrence Beatrice (c) maid Thos Harrold Jr h 211 Chestnut r 347 4th (V) Lawson Geo (c; Mary) 1 h 78 (176) Oliver Lawrence Bessie (Mrs Homer) emp Carling Tile (SM) Co r 809 Mikado Lawson Gertrude (c) 2 h 102 Brooklyn (S) Lawrence Bessie M (Mrs Roy) winder Bibb Lawson Hattiei (c) r 319 2d (V) Mfg Co r 410 Jackson Lawson Henry B (Frankie) (o) elk P O h 510 Lawrence Edgar (c) r 104 Empire (V) Log Cabin blvd Lawrence Elise (c) emp L H Jacks r 220 Roose- Lawson Herman (c; Ethel L) 2 h 451 Coles al velt (V) Lawson Hollis E (E Earle) printer Macon Lawrence Ella (c) 1 dom r 258 Broad Teleg Pug Co h 415 New apt 2 Lawrence Ella (c) lndrs h 115 (275) Brief (V) Lawson James (c) r 212 (3) Tatnall la Lawrence F Eug (Charlie B) 2 mech Bibb Lawson Jessie (c) 3 h 101 (1) Braswell la ChevJrolet Co1 h--114 Ston' ew..a.ll 1 p i (V) Lawson John (c) r 101 (1) Braswell la 8*6 Baldwin's and Telegraph's Lawson Joseph (c; Rosa L) doormn Douglass League Ellamae A Mrs 1 archt 607 Grand Bldg Theater h 112 (955) Ocmulgee la h 305 College apt 2 Lawson Josephine (c) ldry wkr r 728 Ash League Jean student r 305 College apt 2 Lawson Lee (c; Florence) emp Mansfield Dray Leak Daisy (c) h 561 Cotton Line h 248 (178) Plant row Leaptrot Bennett r 510 Giles Lawson Leroy elk Proctor & Gamble Mfg Co Leaptrot Clarence r 510 Giles r 196 (120) Crescent (CH) Leaptrot Clarence A (Minnie) (o) (Leaptrots Lawson Nellie (c) Indrs r 103 (220) Blount Dry Clng Co) h 515 Log Cabin blvd Lawson Noel H (Mary S) 1 formn C of Ga Ry Leaptrot Emmett delmn J C Moore r 510 Giles r 302 Mercer (B) Leaptrot Ernest r 510 Giles Lawson O Thos (Sarah) carp contr h 630 Leaptrot H Green (Bessie) 4 h 510 Giles Forsyth Leaptrot Hollis (Florence) slsmn r 1510 Broad- Lawson Robt (c) emp Southland Knitting way Mills r 111 Tatnall Leaptrot Hubert M (Sara) 4 elk Leaptrots Lawson Rosa L (c) maid Union Bus Terminal Mkt h 131 Violet r 112 (955) Ocmulgee la Leaptrot James T (Anna R) (Leaptrots Mkt) Lawson Rufus (c; Clara) 2 chauf B P O'Neal h 627 Arch Jr h 210 Northwest Boundary Leaptrot Mary (Mrs E W) opr Happ Bros Co Lawson Sara r 630 Forsyth r 1305 2d Lawson Sarah L student r 510 Log Cabin blvd Leaptrot Mary L (wid M B) f 627 Arch Lawson Viola (c) 1 h 104 (4) Wise (V) Lawson W Patk student r 196 (120) Crescent (CH) Lawson Warren P (May) (o) elk P O h 506 Carling Lawson Wm (c; Annie) emp Southland Knit- ting Mills h 110 (102) 5th (V) Lawton Elliott N student r 415 Vineville Lawton Emily E mus tchr Ga Acad for the Blind r 415 Vineville Lawton Furman D (May N) (o) slsmn h 415 Vineville Lawton Osgood P (Gladys) (o) slsmn h 705 Ridge (I) Lawton Wm (c) delmn Rogers Inc r Stinson- ville Lawton Wm (c; Eula L) 1 emp C of Ga Ry h 333 Elbert Lay Vera (e) h 610 3d (V) Layfield Allen B (Minnie) 1 overseer Bibb Mfg Co h 217 Clinton Layfield Alva creeler Bibb Mfg Co r 217 Clinton Layfield Ammie C (wid J M) fa, 124 Rogers (V) Layfield Ammie M student r 124 Rogers (V) Layfield Annie B (c) maid C A Joiner r 145 College Layfield Edw R (Sara P) (o) h 874 1st Layfield Ella (c) h 145 College Layfield Floyd (Tempie) emp Bibb Mfg Co h 138 Comer ter (PM) Layfield James M route formn Independent Ldry Co r 124 Rogers (V) Layfield Lena (wid J D) r 8 Rolf Home pi Layfield Lillian student r 217 Clinton Layfield Minnie (Mrs A B) emp Bibb Mfg Co r 217 Clinton Layfield Oliver D (Margt) (o) bondsmn h 131 Ross Layfield Tempie (Mrs Floyd) emp Bibb Mfg Co r 138 Comer ter (PM) Layton Homer E (Pearl) 2 slsmn h 258 Jeff Davis Layton Lolie opr So Bell Tel Co r 258 Jeff Davis Layton Rebecca (c) h 1D5 (126) Curds al Lazarus Jacob (Madeline) elk Dannenbergs h 818 Cherry apt 6 Lazarus Mabel cash Dannenbergs r 818 Cherry apt 6 Lazarus Marjorie recording elk County Supe- rior Ct r 818 Cherry apt 6 Lazenby Herbert msngr Western Union r 321 Ross Lazenby J Frank (Willie) (o) mgr Industrial Life & Health Ins Co h 310 Carling Lazenby James F Jr student r 310 Carling Lazenby Lillie (wid J D) 1 opr Happ Bros Co r 321 Ross Leaptrot Minnie (Mrs C A) emp Leaptrots Dry Clng Co r 515 Log Cabin blvd LEAPTROTS DRY CLEANING CO (C A Leaptrot) 108 Hardeman--tel 78-79 Leaptrots Market (J T Leaptrot) 1003 Broadway Leaptrott Angeline (c) (o) h 110 4th (U) LEARY BLANCHE sec-treas Johnson Bros r 143 Magnolia--tel 4965-J Leary Oscar (c; Pear!) 1 jan Ga Power Co h 441 (469) Tindall (SM) Leary Robt (c; Lucy) restr 101 Franklin h do Leath Lavinia C Mrs sec Macon-Bibb County Chapter Red Cross r 300 College Leaveritt Joseph elk Silver Dollar r 553 Hem- lock Leavester Perry (c) emp Empire-Dixie Furn Co r 716 3d (V) Leavitt Bessie (wid MF) (o) h 612 Montpelier Le Baron Fred E (May R) slsmn h 811 Poplar apt 2 Lebovitz Jack (Virginia) mgr shoe dept H L Green & Co r 239 Bond Ledbetter Hubert (Nina M) (o) bkpr Washburn Whse.h 465 Woolfolk Ledbetter W Hersten atndt Hunts Tourist Camp r 101 Villa Esta Ledsinger Eliz dep marshall City of Macon h 515 Vineville Ledsinger Hattie r 515 Vineville Lee A B Plumbing & Heating Co (A B & A B Lee Jr, H F Roller) 258 2d Lee Addie (c) h 109 (7) Fulton la Lee Alex B (Cath) (o) (A B Lee Plmbg & Htg Co) h 104 2d Lee Alex B Jr (Edna) (A B Lee Plmbg & Htg Co) h 533 Orange apt 16 Lee Annie Mrs r 716 2d Lee ^.rth (c) delmn Kyles Drug Store r 354 Maple Lee Arth H (Maude) slsmn Crane Co h 4 Drury (I) Lee Beatrice I r R D 1 Forsyth rd Lee Booker T (c; Clara) 3 (o) lab C of Ga Ry h 928 Pio Nono Lee Building 512% 3d Lee Chas r 521 College Lee Christine C student r Nothingham dr Lee Cinderella (c) 3 emp Crescent Ldry h 103 (33) Dixie row Lee Claude M (Mary) (o) h 107 Freeman Lee DanI (Myrtice) mech Parrish Garage r 516 Orange LEE DANL I (Susan R) 1 (o) v-p genl mgr Kinnett-Odom Co h 372 Orange--tel 6454-J Lee Dorothy (Mrs J R) opr Happ Bros Co r 716 2d Lee Eliz (c) r 1232 Broadway 1935 Macon City Directory 337 Lee Ernest S (Mary H) 1 aud First Nat Bk & ' Leggett Chas A (Tisha E) 1 bldg contr 538 Trust Co r 150 Georgia Cotton h 615 Forsyth Lee Ethell L (Nadine) 2 emp Bibb Mfg Co Leggett Chas A Jr hlpr C A Leggett r 615 h 34 Brigham (PM) Forsyth Lee Fitzhugh (Lois) elk h 622 Forsyth Leggett Dorothy (Mrs M L) ofc sec Y M C A Lee Genora Mrs r 127 Comer ter (PM) r 869 Orange Lee Henry (c; Louise) hlpr C of Ga Ry h 95 Leggett Herman H hlpr Ga Roofing & Sup Co Bay r 663 Plum Lee Henry R (Ada S) (o) emp C of Ga Ry h Leggett J Delbert student r 615 Forsyth 1541 2d Leggett Mamie Mrs 1 h 663 Plum Lee Ida B (Mrs R E) spinner Bibb Mfg Co Leggett Mendese L (Dorothy) asst sec Y M r 865 Elm C A r 869 Orange Lee Jack student r 114 Rembert Leggett Mildred L cash Jacobs Pharm r 615 Lee James (c) lab r 854 Hazel Forsyth Lee James (c) porter Bearings Sup Co r 411 Leggett Willis H emp Happ Bros Co r 615 Madison Forsyth Lee James (Dorothy) sausage mkr Armour & LeGuin Alf A (Ella P) 2 elk C of Ga Ry h Co r 716 2d 3810 Houston Lee Jereleen (c) case aide County Relief Admn Leidy Cora S (wid F L) (o) h 111 Garden r 275 3d (V) Leigh Jack H (Dorothy E) 1 (o) cash So Ry Lee Jesse (c; Annie) 4 lab C of Ga Ry Creosote h 195 Hendley Plant h 404 Robinson rd Leming Vassar F (Florence) 5 emp So Ry h Lee John carp h 149 Williams (SM) 107 1st Lee John D (Jewel) 1 dep elk County Tax Coir Lemmond Claudia (wid G E) elk Swannee h 114 Rembert Sweet. Shop r 623 Ingleside Lee John W (c) emp Standard Oil Co r 2 Lemon Otha (c) lab C of Ga Ry Violet Lemons Eliz (c) maid John Garvin r 226 Lee John W (Jessie) 1 (o) pntr h 204 1st (SM) Gilmore Lee Joseph (c; Reather) 2 lab h 7 Cheatham Lenderman Ambrose r 867 2d al Lenderman Artis W hlpr City Scavenger Dept Lee Julius (c; Alma) 4 lab h 633 4th (WH) r 867 2d Lee Lawrence L elk C M Rankin r Fickling Lenderman Dora tex wkr Atlantic Mills r 8 Hotel Atlantic Village Lee Lewis A (c; Lula) 1 (o) case aide County Lenderman Ella (wid J N) 2 h 867 2d Relief Admn r 212 Plant (SM) Lenderman J C r 867 2d Lee Lewis A Jr (c) lab r 212 Plant (SM) Lendon Maggie (c) 1 r 148 Middle (V) Lee Lillie (c) ldry wkr h 354 Maple Lentz Maude (wid J W) 7 h 559 Hemlock Lee Louise (c) h 354 Monroe (V) Leonard Annie M student r 222 Lawton Lee Lula B (c) tchr Pleasant Hill Sch r 212 Leonard Arth E r 1331 2d Plant (V) Leonard Beatrice (wid A L) r 877 Mulberry Lee Marie (c) maid E H Dunn r 230 Madison Leonard Carrie L (c) (o) h 106 Wise (V) Lee Mary (c) 1 (o) beauty shop 332 Jackson Leonard Carrie M Mrs 1 r 401 Carling h do Leonard Chas (c) porter Central Hotel r 602 Lee Mary C (wid B G) res R D 1 Forsyth rd 3d apt 1 (V) Lee Mary E r R D 1 Forsyth rd Leonard Chas L projectionist Ritz Theatre Lee Maude (Mrs A H) pianist Wesleyan Col- Leonard Clifford (c; Lunie) porter McCord Mtr lege r 4 Drury (I) Co h 130 Ross Lee Nadine (Mrs E L) spooler Bibb Mfg Co Leonard Dorothy student r 51 Arlington pi r 34 Brigham (PM) Leonard Edw D (Margt) (o) (L & N Drug Lee Nellie (c) h 1232 Broadway Co) h 128 Flamingo dr Lee Pinkey (c) dom h 88 Murray al Leonard Edw D Jr (L & N Drug Co) r 128 Lee Ray D emp State Hwy Dept r 870 1st Flamingo dr Lee Rebecca (c) 1 h 586 Monroe Leonard Edwin C elk Central Hotel r 10 Marion Lee Robt (c) porter Mtr Parts Corp r 230 (Lynmore Estates) Madison Leonard Evelyn sten Macon Hosp r 722 Mul- Lee Robt E (Ida B) 2 hlpr h 865 Elm berry Lee Rosa (c) cook h 101 (118) New St al Leonard Fletcher (c) r 602 3d apt 1 (V) Lee Rose G slswn Union Dry Gds Co h 760 Leonard Floy E (wid I H) h 51 Arlington pi Hemlock Leonard Fredk (c; Pauline) lab h 22 (26) Lee Sam ldry 519 Mulberry r 363 Cotton Malloys al Lee Sanford H (c; Jereleen) (o) emp U S Gov Leonard Geo (c; Margt) h 514 Coleman al h 275 3d (V) Lee Walter C (c; Evelyn) 1 (o) mgr Atlanta Leonard Hattie (c) 1 dom J C Smith h 554 Smith row Life Ins Co h 212 College Leonard Henry (c; Wilhelmina) stewart r 375 LEE WM G (Christine C) 1 (o) chairman of Middle (V) the Board First National Bank & Trust Co Leonard Herman (c) (o) porter Elks Club h h Nottingham dr (Shirley Hills)--tel 10 248 2d (V) Lee Wm G Jr student r Nottingham dr Leonard Howard N (L May) 1 (o) printer Lee & Smith Mule Co (W G Lee, D H Smith) 557 Plum Macon Teleg Pub Co h 222 Lawton Leonard I Harris elk Robertson-Walker Inc r Leech Chas (Alice) frty hd r 204 Maple 51 Arlington pi Leech Idella (c) 5 r 402 (565) Henrietta Leonard John (c; Veila May) lab Taylor Iron Le Fevre Ann Mrs cash Dannenbergs r Georgia Wks r 10 (104) Stines al Apts LeFevre Dorothy R student r 809 Napier LeFevre Mamie (wid L M) r 809 Napier Leonard Mae (c) maid G M Nottingham r 248 2d (V) Leonard Maggie (C) 2 r 274 (262) White al Lefstead P M asst mgr H L Green & Co r 258 College Leonard Marguerite tchr Nursery Sch r 51 Arlington pi 328 Baldwin's and Telegraph's Leonard Roy (c) hlpr Cassidys Garage Bookers Lester Lula (wid R W) h 563 Boulevard al Lester Margt C (Mrs Homer) mach Southland Leonard Ruby (c) h 22 Hall (SM) Knitting Mill r 1017 Napier Leonard Virginia J (wid C E) cash Dempsey Lester Mary r 616 1st Hotel r 3001 Houston (SM) Lester Mary (c) cook Joseph Clisby r 425 Leonard Wilhelmina S (c) tchr Hazel St Sch Ward (V) r 375 Middle (V) Lester Maurice A (Mary L) 2 slsmn Karsten Leonard Woodrow student r 51 Arlington pi & Denson Co h 720 Anderson (SM) Lerner Shops Inc Mrs Ossie Norwood mgr Lester May Mrs h 817 Broadway womens clo 520 Cherry Lester R Glenn (Evelyn L) formn Collins Lerter Frances (c) h 112 (7) Fulton la Baking Co r 135 Academy Leseur Mary (c) dom J W Clisby r 554 Ward Lester Rosa L (c) (o) dom h 121 Lexington Lesley S T asst mgr Singer Sewing Mach Co Lester Rose (c) dom E W Smith h 265 Cowan r 112 Rogers Lester Robt B (c; Mary F) 1 (o) h 981 Fort Leslie Bertha (Mrs Walter) spinner Bibb Mfg Hill Co r 242 Hydrolia Lester Rob't M (Annabel) 2 (o) chf dispr So Leslie Edw D (c) 1 (o) h 233 Cedar (U) Ry h 707 Birch Leslie Eug B emp Art Furn Mfg Co r 150 Lester Robt W emp Maxwell Bros r 149 Mill Roye (Lynmore Estates) Lester Rufus E (Sarah) 1 sta opr Gulf Refin- Leslie Eva (c) 4 h 246 Dempsey ing Co h 507 Duncan Leslie Geo F (Mattie) carp h 150 Roye (Lyn- Lester Walter E elk H G Ashley h 819% Broad- more Estates) way Leslie Geo H (Mozelle B) 1 emp City Bd of Lester Wm (c) emp Sinclair Refining Co h 786 Water Comrs h 125 Fort Hill Reynolds al Leslie Homer L (Glennie) 1 (o) emp Bibb' Mfg Lester Wm (c) hlpr McKinney & Adams r 145 Co h 229 (52) Maynard Leslie Howard (c) r 244 1st (V) Leslie Irene tex wkr Bibb Mfg Co r 55 Hydrolia Leslie. James (c; Anna) 2 trkr C of Ga Ry h 244 1st (V) Leslie James J (Olga A) 3 (o) supt City Bd of Water Comrs h 170 Cherokee Leslie Joe (Mary) 1 speeder hd Bibb Mfg Co r 361 Church (EM) Leslie Lena R (wid J O) 1 h 96 (95) Yates Leslie Ola (c) cook W E Dixon r 232 Cedar (U) Leslie Oscar student r 96 (95) Yates Leslie Walter L (Bertha) 3 emp Bibb Mfg Co h 242 Hydrolia Lester Alva C (Berta) 1 r 266 Columbus Lester Benj (c; Eula) 2 mech h 8 Chestney Lester Berta (Mrs A C) waitress Walgreen Co r 266 Columbus Lester Chanie (c) (o) h 248 Broad Lester Clementine (c) maid r 216 -Green Lester Effie (wid M L) (o) h 717 Courtland Lester Ernest formn Ga Roofing & Sup Co r 663 Plum Lester Essie (c) dom 130 Summit Forsyth la Lester Wm J (c; Mattie C) porter C W Farmer h 2 Woodliff Lester Willie D (c) elev opr Terminal Hotel r 141 Washington LeSure Maude Mrs r 202 Center (EM) Letson Allie B (c) Indrs Ga Acad for the Blind r do Letson Joseph (c) delmn Ingleside Pharm Letson Will (c) firmn Ga Acad for the Blind r do Letter Carriers Assn W J Johnson sec meets on call Federal Bldg LETTER SHOP INC THE C A McKay pres J J McKay v-p S W Peabody sec-treas direct mail advertising 563 */2 Mulberry--tel 4521 (See top lines page 44 and card B D) Lettice Edwin (Evelyn) (o) elk Happ Bros Co h 130 Summit Leverett C Truman r 208 Grenada ter Leverett Clarence M student r 1114 Oglethorpe Leverett Cullen C (Minnie L) capt engine Co No 6 h 1114 Oglethorpe Leverett Cullen P bkpr r 1114 Oglethorpe Lester Estella (c) 2 h 196 Elliott Leverett David R (Violet) 2 emp Standard Oil Lester Etta M (c) maid D F Stansbury r 227 Co r 281 Orange Orange Lester Eug (c) emp Riverside Ice & Coal Co r 112 (282) Amos (V) Lester Eug H slsmn Sears-Roebuck r 140 Georgia Lester Frank (Farris L) civ engr r 308 Clay- ton (V) Leverett Edw D (Annie) 2 emp Ga Power Co r 118 Holt Leverett J W (Virginia) waiter r 553 Hemlock Leverett James L tr dr Sterchis r 208 Grenada ter Lester Geo (c) hlpr Moffett Transit Lines r 812 Leverett Metta (wid C L) r 208 Grenada ter Ocmulgee Lester Henry (c; Susie) hlpr Moffett Transit Lines h 206 (543) Moore la Lester Homer (Margt C) r 1017 Napier Lester Ida (c) r 2 Woodliff Lester Ida (c) 2 cook Magnolia Inn h 8 Buck- Leverett Walter B (Pearly M) bus opr Ga Power Co h 165 Spring apt 6 Leverette Alex A 2 h 340 White (SM) Leverette John A (Sarah E) slsmn Industrial Life & Health Ins Co h 101 Lamar (V) ner al Leverette Lucius (Rose) 1 (o) elk Dixie Dairies Lester Ida (c) cook Mrs Florence Wilson r 450 h 3900 Houston City Hall la Lester James L (c; Willie D) porter Idle Hour Nurseries h 141 Washington Lester James W (Mattie L) (o) emp So Ry h 149 Mill Lester Jennie E (c) 1 maid Mrs Gertrude Leverette Mary student r 696 Courtland Leverette Oscar C barmn Hotel Dempsey r 696 Courtland Leverette Oscar E (Mary) bkpr Dunlap-Peeler PIdwe Co h 696 Courtland Pritchett h 144 (246) Forsyth la Lester John (c) butler Mamie Williams r 196 Elliott Lester John T r 720 Anderson (SM) Levie tis H stock broker 104 Ga Casualty Bldg h 401 College apt 7 (I) Levine David P (Lena) 2 (o) (Levine Tire & Parts Serv) h 119 Boulevard 1935 Macon City Directory 329 Levine Tire & Parts Service (D P Levine) 100 5th Levins Lance (Delaine) r 219 New Levison Robt L (Julia) mgr Kaybee Clo S.ore h 263 Georgia apt 1 Lewis A Belle (Mrs Aaron) opr Adams Mfg Co r 170 Virginia Lewis Anna (Mrs R L) r 311 Main (EM) Lewis Anna (c) dom r 152 Clara Lewis Annie B (c) cook A A Mueller r 468 Chestnut Lewis Arnold (c) r 506 Fort Hill LEWIS ARTH (Martha H) lawyer 3-4 Wash- ington Bldg--tel 2681 h 930 College apt 4-- tel 3850-J Lewis Arth (c; Mary) tr dr Bldrs Lbr Co h 104 (248) Johnsons al Lewis Bernard M (o) slsmn Johnson Bros h 209 Oak Haven Lewis Bertha (c) h 142 Tharpe Lewis Bessie V (c) (o) h 150 New Lewis Carrie (c) cook M G Ross r 429% Cotton Lewis Carrie (c) maid K T Alfriend r 610 3d (V) Lewis Carrie D (Mrs W M) opr So Bell Tel Co r 109 3d Lewis Chas (c) r 852 Norris Lewis Clarence H (Ida) 1 pntr h 115 5th (SM> Lewis Claude M (Ruby) 2 elk The Red Front h 1444 College Lewis Clyde student r 115 5th (SM) Lewis Dolly (c; Lucinda) farmer h 529 Middle (EM) Lewis Easter (c) maid R T Mann h 398 Telfair Lewis Edna (c) maid R N Etheridge Lewis Edw C (A Clyde) elev mech Otis Elev Co h 121 Appleton Lewis Elijah (c) r 852 Norris Lewis Eliz r 501 Center (EM) Lewis Eliz (c) 2 r 748 Edgewood Lewis Elliott (c;Lula) lab h 411 (317) Charles Lewis Emma (c) (o) h 406 Robinson rd Lewis Estella rep Macon Better Hsg Program r 271 Orange Lewis Esther B (Mrs W H) sten Chandler & Strickland Co r 222 Magnolia apt 3 Lewis Ethel (c) maid O A Morrison r 110 Wings Hill Lewis Eula B (c) cook C W Watson Lewis Eulis (c; Viola) 2 emp C of Ga Ry h 604 (222) Cowan Lewis Fannie (c) h 331 Gilmer Lewis Fannie (c) r 354 Maple Lewis Fannie (c) cook L S Dure r 151 Walker la Lewis Frances (c) lndrs r 852 Norris Lewis Garfield (c) 2 lab' r 124 Coleman al Lewis Geo (c; Eliz) 1 lab h 852 Norris Lewis Geo W (Dallas) 1 plmbr T L Wood r 273 Ell (SM) Lewis Harvey (c; Laura) h 501 Center (EM) Lewis Hazel tchr Pearl Stephens Sch r 209 Oak Haven Lewis Henry (c; Annie) 1 lab h 653 Dunlap al Lewis Hilda slswn S H Kress Co r 271 Orange Lewis Inez L (c) (o) slswn h 123 Glen Lewis Isaac N (Lilia) emp Art Furn Mfg Co h 296 Belmont Lewis James (c) r 501 Center (EM) Lewis James (c; Naomi L) lab Macon CocaCola Btlg Co h 415 e Academy (EM) Lewis James D plmbr r 115 5th (SM) Lewis James L (c; Bertha) 1 (o) carp h 620 Pebble Lewis Jennie (c) (o) maid Albert Adams h 319 2d (V) Lewis Jessie Mrs slswn Union Dry Gds Co r 271 Orange Lewis Joel student r 115 5th (SM) Lewis John (c; Julia S) 3 h 303 Ward (V) Lewis John (c; Katie M) 1 carp h 955 Pio Nono Lewis John (c; Josephine) emp Bibb Mfg Co r 215 Gantt pi Lewis John (c; Lillian) lab h 124 (2) Spring la Lewis John E 2 pntr h 915 Elm Lewis John W (Ruby) 5 emp C of Ga Ry h 173 Virginia Lewis John W Jr mus tchr Ga Acad for the Blind r 173 Virginia Lewis Joseph (c; Janie) h 1057 Pio Nono Lewis Joseph (c) student r 146 Astor Lewis Julian S (Johnnie L) ins 210 Ga Casualty Bldg h 717 Vineville Lewis Lee A (c) r 604 (222) Cowan Lewis Lee A (c) carp J B Hart h 953 Ocmulgee ewis Leonard (c; Maggie) lab h 405 (305) Waterville rd Lewis Lessie (c) 2 h 545 Plant al Lewis Lilia (Mrs I N) opr Adams Mfg Co r 296 Belmont Lewis Lillie (c) maid W M Murphey r 312 Jefferson Lewis Lillie (c) 1 r 440 Dunlap Lewis Lilly B (c) r 501 Center (EM) Lewis Lizzie (c) 1 cook h 315 (145) e 2d (EM) Lewis Logan mgr Trust Co of Ga r 717 Vine- ville Lewis Lorenzo (c; Mary) 1 gdnr J A Etheridge r 396 Telfair Lewis Lorien W (Ella M) 2 (o) tchr Lanier High Sch for Boys h 131 Beech Lewis Lula E (c) maid J L Bradbury Lewis Maggie (c) 1 h 422 Liberty (SM) Lewis Martha (c) (o) h 114 Tatnall Lewis Martha H (Mrs Arth) sec Arth Lewis r 930 College apt 4 Lewis Mary (c) cook R C Mahone h 207 Holmes Lewis Mary (c) maid r 852 Norris Lewis Mattie R (wid E L) r 647 Forsyth Lewis Mattie W (c) maid Roy Gable r 212 Jones Lewis Maybelle (c) cook J E Borum r 212 Jone3 Lewis Minnie (c) 3 h 475 Chestnut Lewis Nancy (c) lndrs h 19 Buckner al Lewis Nannie (c) cook L P Chapman r 232 Powell Lewis Naomi L (c) emp Snows Ldry r 415 e Academy (EM) Lewis Ophelia (c) waitress Len Berg Chili Par- lor r 604 (222) Cowan Lewis Ottis B (Eliz P) mgr Burroughs Adding Mach Co h 817 Beech Lewis Paul emp Hamlin Sheet Metal Wks r 109 3d Lewis Perry (c; Maggie) lab h 246 3d (V) Lewis Preston (c; Clara) 4 227 Turkin Lewis Rabe (c; Alma) lab F S Royster Guano Co r 450 Dunlap Lewis Robt (c; Ellen) r 115 (113) Thomas (EM) Lewis Robt L slsmn Strong Shoe Store r 3914 Houston Lewis Robt W (Myrtle) tele opr So Ry h 123 Inverness Lewis Rosa (c) 1 emp Hub Fish & Oyster Co r 355 (12) 7th Lewis Roy L (Annie) 4 h 1014 Hazel Lewis S L (c; Annie L) h 445 (505) Middle Lewis Jeff (c) r 406 Robinson rd (EM) Lewis Jelks r 104 Callaway (V) Lewis Sally (c) 4 r 108 (102) Randall la 330 Baldwin's and Telegraph's Lewis Sannie maid N D Mallory r 207 Holmes Liles Danl L Jr delmn J C Moore r 103 New- Lewis Seaborn (c) emp Independent Ldry Co berg (SM) Lewis Smith elk Malcolm Jones Jr r 3914 Houston Liles Frank (Annie B) 1 emp Bradys Place r 854 Hemlock Lewis Susie (c) h 218 Woodliff Liles Jas D (Julia D) (o) farmn Willingham Lewis W Chapman (Florida) 4 (o) ofc 524 Bibb S&D Co h 124 Fort Hill Bldg h 204 Belvedere dr Liles James W lab r 812 Woolfolk Lewis W Hillman (Esther B) 2 slsmn h 222 Magnolia apt 3 Lewis Walker M (Carrie D) 2 tr dr City h 109 3d Lewis Walter (c; Pauline) 2 tr dr Webb Coal Co h 400 Industrial Home rd Lewis Walter L (Emma) h 3914 Houston Lewis Wesley J (Louise) r 771 1st Lewis Wm (c; Anna) h 152 Clara Lewis Wm (c) r 538 Grant Chapel al Lewis Wm (c; Maybelle) 4 h 212 Jones Lewis Wm (c) lab r 216 Division Lewis Wm (c) lab Macon Cooperage Co h 635 Division Lewis Wm (c) lab r 852 Norris Lewis Willie (c) 1 dom r 207 Holmes Lewis Willie (c; Nannie) shoe shiner New York Clnrs h 232 Powell Lewis Willie B (c) lndrs r 940 (502) Mont- pelier Liberty Candy Co Inc H F Fargason pres Mrs Mattie K Smith sec-treas 461 5th LIBERTY NATIONAL LIFE INSURANCE CO Ernest Redd Jr mgr 515-22 First Nat Bk Bldg--tel 462 Liberty Service Station (E J Johnson) 2226 Forsyth rd Lichter Harry coir L T Gillen r 627 Adams Life Andrew T (c) delmn O K Shoe Repr Shop r 425 e 2d (EM) Life Belle (c) r 425 e 2d (EM) Life Insurance Co of Virginia R W Hawkins dist mgr 508 Grand Bldg Life James (c) r 501 Martha LIFE AND CASUALTY INSURANCE CO E L Moore dist mgr 315-16-17 Bibb Bldg-- tel 4821 Lifsey Chas L (Alice) h 279 College Lifsey Emma A (wid J A) r 312 Johnson Lifsey Hewlitte nurse 215 Clisby pi r do Lifsey Irene T (wid ML) (o) h 108 1st (CP) Lifsey J Clinton (Willie) 2 (o) emp Ga Power Co h 117 (133) Charles Lifsey M Eliz sten Swift & Co r 279 College Lifsey Oliver H r 215 Clisby pi Lifsey Virginia M tel opr So Bell Tel Co r 108 1st (CP) Liggens Annie (c) r 217 Roosevelt (V) Liggetts Drug Store J R Hunt mgr 512 Cherry Light Eliz r 415 Oak Lightfoot David (c; Capers) lab Proctor & Gamble Mfg Co h 771 Edgewood Lightfoot Henry (c) r 354 Pine Lightfoot James (c; Leola) emp C of Ga Ry Liles John A (Mary) 1 lab h 128 Fort Hill Liles John A Jr elk r 128 Fort Hill Liles Julian student r 812 Woolfolk LILES MARION H (Mary) 2 (o) pres The First Nat Bk & Trust Co in Macon h 312 Overlook (I)--tel 3976 Liles Mary (Mrs J A) opr Happ Bros Co r 128 Fort Hill Liles Wm C (Lucile) 1 gro 803 Main (EM) h 604 do Liles Wiley W (Lilia) 1 lab h 812 Woolfolk Liles Wright elk Great A & P Tea Co r 562 Arch Lilly J Pat home economist Ga Power Co h 864 Mulberry apt 5C Lilly Joshua (c) lab So Ry h 314 (66) Plummers al Lin Louise tchr Wesleyan Conservatory r do Linberger E J (Rose) emp Sou Bell Tel Co h 533 Orange apt 19 Linch (see also Lynch) Linch E Irdell (o) sec Bibb Bag Co h 612 Oglethorpe Linch Esther N (Mrs H L) sten Bankers H & L Ins Co r 319 Cherry Linch Howard L (Esther N) emp Ga Power Co h 319 Cherry Linch Tallulah r 612 Oglethorpe Linden Apartments 316 Linden Linder Ager (c) elev opr Hotel Dempsey r 131 (209) Elliott Linder F Hilton Jr slsmn Sears-Roebuck r 916 Oglethorpe Linder Ferrell H (Ethel) flgmn C of Ga Ry h 916 Oglethorpe Linder Thos G carrier Macon Evening News r 916 Oglethorpe Lindler W Parks (Alma) 2 flgmn C of G Ry h 131 Knott (SM) Lindsay Harry L (c) r 101 (102) Clinton Lindsay Howard (c; Mattie) 2 shoe shiner New York Clnrs r- 232 Powell Lindsay Ina M (c) student r 101 (102) Clinton Lindsay James (c; Mildred) 5 carp h 101 (102) Clinton Lindsay James Jr (c) porter Cannon Shoe Co r 101 (102) Clinton Lindsay Mildred (c) lndrs r 101 (102) Clinton Lindsey Albert P r 3004 Houston (SM) Lindsey Andrew H (c; Alice) 3 jan Bibb Mfg Co h 201 Lee (EM) Lindsey Andrew H Jr (c) r 201 Lee (EM) Lindsey Barber Shop (E D Lindsey) 1012 2d Lindsey Benj (Ola) 8 (o) engr So Ry h 256 Jeff tLi.rl6S Litmon Chas (c; Josephine) lab r 309 Charles Little Arth (c; Addie) 2 emp Bibb Mfg Co li 233 Tfilfftir Little Beeman (c; Carrie L) h 410 Ash Little Benj (c) lab r 3 (3566) Duffey's al Little Carrie (c) 2 h 309 Henderson la Little Chas (c; Mattie) 1 lab r 714 Maynard Little Clarence (c) emp Maxwell Bros r 226 Madison Little Claudia student r 120 Rogers (V) Little Collins (c; Frances) lab h 311 (315) Burnett Little Cora (c) majd MrAH Susan Green r 233 Jones Little David T r 904 New Little Dora (c) cook A W Jones r 111 (11) Alabama (SM) Little E Wallace (Mary) br mgr Rogers Inc h 105 Park pi apt 1 Little Edith tchr Burke Sch r 126 Summit Little Ella M r 904 New Little Emma (c) h 254 2d (V) Little Ernest (c) porter Goodrich Silvertown Stores r 405 Madison Little Eug (c; Mary) 5 busmn Macon Cafeteria h 216 Woodliff Little Fannie (c) lndrs h 1130 Ocmulgee Little Frances (c) emp Snow's Ldry r 311 (315) Burnett Little Frank (c; Kate) 3 emp So Cotton Oil Co h 307 Blount Little Frank L r 339 Vineville Little Geo (Charlotte) emp MD&SRR r 907 Cherry Little Gertrude (c) cook r 704 Ocmulgee Little Groceteria (Florida Snell) 3203 Houston Little Harriett (c) maid B P O'Neal Jr r 64 Schofield Little Hattie (c) (o) h 423 (518) Elizabeth (SM) Little Hattie (c) maid Court House r 410 Ash Little Herbert (c) r 3 (3566) Duffey's la Little Howard A (Mina C) 1 r 126 Summit Little Irene D (c) tchr Pleasant Hill Sch r 206 Madison Little Jas (c; Ella F) lab r 920 Ocmulgee Little Jenkins D (o) h 126 Summit Little Jerry (c; Lillie) 1 h 204 Green Little Jerry (c; Mary) r 333 3d (V) Little Jesse (c) emp Maxwell Bros h 226 Madi- son Little John H (c; A Florence) lab Rose Hill Cemetery h 760 Whitehead al Little Joseph W (Viola) 2 r 101 Brookdale (B) Little Josephine (c) r 407 (330) Elizabeth (SM) Little Leslie H (Annie B) chf elk MD&SRR h 120 Rogers (V) Little Letha (c) student r 208 (203) Williams (EM) Little Lewis (c; Willie) 3 (o) carp So Ry h 128 (7) Hudson Little Lewis I (c) emp C of Ga Ry r 801 (810) Maynard Little Addie (c) hlpr Bibb Mfg Co h 233 Telfair Little Albert (c; Minnie L) emp Buckeye Cotton Oil Co r 645 Elm St la Little Albert (c; Irene) (o) porter Dannenberg Little Mary (c) maid W H Cheney r 333 3d (V) Little Mary slswn Sears Roebuck r RD 2 Little Mary C (wid W J) (o) h 339 Vineville Little Mary J student r 339 Vineville Little Mattie (c) r 1327 1st & Waxelbaum Co h 206 Madison Little Namon K (Ethel) 4 emp Ga Power Co Little Alice L tchr Fort Hawkins Sch r 308 h 1143 Milledgeville rd Buford pi (V) Littlei Nellie (c) lndrs h 11 Malloy's al Little Alzada (c) 3 h 119 (17) Wise (V) Little Anderson (c; Clara) h 252 Franklin Little Andrew r 220 Shamrock Little Annie (c) r 529 (528) 3d (V) Little Oscar (c; Ruth) 2 h 112 (550) Tinsley la Little Oscar (c; Carrie) 1 emp Birdsey Flour Mills h 372 2d (V) Little Ossie (c) maid r 226 Madison Little Ossie M (c) cook r 207 Orange Little Annie (c) lndrs r 3 (3566) Duffey's al Little Pearl (c) maid Dempsey Hotel r 155 Little Annie P (c) maid r 801 (810) Maynard I Orange St la 33* Baldwin's and Telegraph's Little R Douglas (Steina B) 2 elk MD&SRR r Lockerman Andrew J (Willie E) 1 serv sta 120 Rogers (V) 3019 Houston r RD 3 Little Respy (c; Marie) 1 lab r 920 Ocmulgee Lockerman Ernest C (Alma E) (o) (Josef's Little Richd (c) lab r 527 e 2d (EM) Beauty Shoppe) asst mgr Am Optical Co h Little Rock Baptist Church (c) E W Hoyt pas- 349 Central tor 164 (400) Nussbaum Lockerman Ethel B (Mrs A J) opr So Bell Tel Little Roy (c; Frances) 2 firemn Macon Hosp Co r Hollis rd RD 3 h 220 Shamrock Locket Clarence (c) hlpr Macon Hat Clng Co Little Ruby (c) cook r 235 Jefferson r 225 (132) Grant (V) Little S Virginia student r 139 Pierce (V) Lockett Agnes (c) 3 maid h 225 (132) Grant Little Susie (c) 1 maid Katherine Ct Apts h (V) 529 (528) 3d (V) Lockett Annie L (c) cook r 129 e Ell Little Thos (c; Gertrude) lab h 704 Ocmulgee Lockett Arth (c; Beulah) (o) carp h 215 (303) Little Walter A (Annie C) sec Order Ry Condrs Mutual (V) r 308 Buford pi (V) Lockett Arth Jr (c; Lillie M) ydmn B P O'Neal Little Wm (c; Dora) h 111 (11) Alabama (SM) r 125 Ward (V) Little Wm (c; Cora) 4 hlpr Maxwell Bros h 233 Lockett Arth H (c; Ruth) 1 agt Afro-Am Life Jones Ins Co r 437 Chestnut Little Wm C (Kath) lab r 904 New Lockett Belle (c) emp Crescent Ldry h 232 Little Wm J Jr r 339 Vineville Calhoun Little Wm L (Myrtle T) 1 mach Macon Teleg Lockett Bertha (c) carder Bibb Mfg Co r 229 Pub Co h 139 Pierce (V) Telfair Little Wm N sten Letter Shop r 120 Rogers (V) Lockett Chas (c; Eula) h 73 (80) Schofield Little Willie M tchr Miller High Sch r 120 Lockett Clifford (c) lndrs h 167 Astor Summit Lockett Dock (c; Bertha) 1 lab Bldrs Lbr Co Little Willis slsmn Freeman-Dent-Sullivan Co h 229 Telfair r Columbus rd RD 2 Lockett Edgar (c) r 405 (508) Prince (SM) Littlejohn Chas R elk Ard Cash Gro r 360 New Lockett Edgar (c; Annie L) 1 lab h 129 e Ell Littleton C Durward elk Shelverton-Bayne Lockett Edgar (c) peddler h 118 Rock Drug Co r RD 6 Lockett Emmett (c) h 3 Spring Littleton Chas H (Mattie) r 623 Duncan Lockett Eva (c) r 820 Edgewood Littleton D Glen elk Bell's Pharm r 623 Dun- Lockett Eva (c) cook J E Yates r RD 1 can Lockett Everett (c) r 405 (508) Prince (SM) Littleton Daisy C student r 623 Duncan Locket Fannie (c) (o) h 1081 Pio Nono Littleton Geo L (Virgie M) 1 depot agt Ry Exp Lockett Hanson (c) r 249 Woodliff Agcy h 539 Boulevard Lockett John (c; Mattie) 5 jan r 420 (204) Littleton Lucile slswn W T Grant Co r RD 4 Bartlett Livingston Annie M (c) maid A P Evans r 432 Lockett Leonard (c; Lucille) hlpr Union Furn Monroe Co h 123 (202) Magnolia la Livingston Derecie (c) 2 r 1023 Edgewood Lockett Levi (c) r 820 Edgewood Livingston Donald F (Mary) 1 meter supt Ga Lockett Lucy (c) maid r 120 Lynwood (V) Power Co h 207 Berkely dr Lockett Mack (c) emp C of Ga Ry r 167 Astor Livingston Eug H r 321 New apt 4 Lockett Mamie G (c) nurse 215 (303) Mutual Livingston Grady C (Cath) emp Willingham (V) r do Mills r 109 College pi Lockett Mamie L (c) 1 h 54 New Livingston Kate opr Happ Bros Co r 300 Villa Lockett Marie (c) 1 h 3 Spring (B) Lockett Martha (c) 1 (o) dom h 128 Sycamore Livingston Lula C Mrs dept mgr Burden Smith (V) & Co h 321 New apt 4 Lockett Mary (c) r 154 Sycamore (V) Livingston Martha R student r 542 Log Cabin Lockett Mary (c) 2 dom North Highland h 106 blvd (104) Mitchell Livingston Perry (c: Vera) porter Empire Furn Lockett Mary (c) (o) maid Mary S Burke r Co Inc r 716 3d (V) 268 3d (V) Livingston Sanders (c) h 7 Graham's lot Lockett Milton (c; Mary) 1 lab h 105 Hazel Livingston Wm C (Bessie W) 1 agt Hatcher Lockett Richd H (c) pntr r 215 (303) Mutual & McCrary Inc h 542 Log Cabin blvd (V) Livingston Willoughby C r 542 Log Cabin blvd Lockett Roosevelt (c) student r 106 (104) Lizaboro Baptist Church (c) 105 Davis (NH) Mitchell Lizzie's Chapel (c) Rev E J Calhoun pastor Lockett Sallie (c) (o) h 420 (204) Bartlett 126 Bartlett's la Lockett Sallie (c) maid A J Lyndon r 231 2d Llorens Emanuel B (Jessie J) mech Steve M (V) Solomon 462 Broadway Lockett Susie (c) r 202 (423) Plummer's al Lloyd Carrie Mrs opr Happ Bros Co r 110 Cal- Lockett Susie (c) student r 225 (132) Grant houn (V) Lloyd F Edw emp Proctor & Gamble r 1071 Lockett Thos (c) h 820 Edgewood Walnut Lockett Ulysses (c) pntr r 582 Monroe Lloyd Geo lab h 204 (203) Main (EM) Lockett Will (c; Mamie) tex wkr r 115 Roff Lloyd Gladys L (wid Harry) 2 br mgr McCom- Home mon Bros r 419 Montpelier Lockette Vallie (c) 3 dom r 120 (222) Green Lloyd J Frank 2 (o) sign pntr h 1071 Walnut Locke Wm F (Ruby) 1 creeler Bibb Mfg Co r 363 Clinton Lockeley Nannie M ofc sec Dr W L Bazemore r 613 Orange apt 1 (V) Lockhart Alice (wid J W) (o) h 225 Knott (SM) Lockhart Annie (c) r 284 1st (V) Lockhart Fay cash Dessau Realty & Ins Co r 920 College apt 2 Lockerman Alma E (Mrs E C) mgr Jozef's Beauty Shoppe r 349 Central (SM) Lockhart Gelston P (Claudia) asst cred mgr Huckabee Auto Co h 108 Appleton 1935 Macon City Directory 333 Lockhart Geo (c) (o) h 239 Woodliff Lockhart Isaiah (c) auto mech 405 Madison r do Lockhart Leah G (wid L T) r 920 College apt 2 Lockhart Richd B slsmn Dessau Realty & Ins Co h 920 College apt 2 Lockhart Ruby M waitress Am Restr r 225 Knott (SM) Locklin Sami H (Sarah) emp So Bell Tel Co r 379 Orange Locklin Thos E (Elvia) 7 meat ctr Rogers Inc h 813 Poplar apt 4 Loden Carl L (Daisy I) 2 electrn h 225 Dorothy (Lynmore Estates) Loden Carl L Jr student r 225 Dorothy (Lyn- Wore Estates) Loeb Dorothy H ofc sec Mercer Univ Loftin Clyde H bkpr Loftin & New r 165 Spring apt 8 Loftin James (c; Dora M) lab r 1129 Napier Loftin Leola (c) r 327 Monroe (V) Loftin Otis N slsmn Loftin & New r 165 165 Spring apt 8 Lofton Dora M (c) cook C L Fisher r 1129 Napier Lofton Lena (c) h 1435 Broadway Loftin & New (O T Loftin F W New) who! gros 250 5th Log Cabin Service Store (E H, Hermit and Vermont Pratt) gros 805 (1800) Log Cabin blvd Log Cabin Sinclair Station C M Allen mgr 1148 Milledgeville rd Logan Anna (c) student r 120 (310) Brooklyn (S) Logan Arth M (Annie M) 3 supt Interstate L & A Ins Co h 333 Winship Logan Clarence S (c; Trudie) (o) swtchmn C of Ga Ry h 708 Clinton Logan Evelyn student r 333 Winship Logan Ida L (c) cook R D Feagin r 120 (310) Brooklyn (S) Logan Leonard F (c; Esther) r 612 Ross Logan Lonnie N (Edna E) 2 mech C of Ga Ry h 124 1st Logan Martha A (c) (o) tchr Ballard Normal Sch h 257 3d (V) Logan R A cbntmkr Macon Chnt Wks r RD 4 Logue Amanda (wid C H) h 1329 3d Logue Calvin (c; Essie) 5 emp MD&SRR r 521 (501) e Academy (EM) Loh Edw solr Buck Ice & Coal Co r 253 New Loh Julius r 253 New Loh Lawrence M (Vivian) 3 (o) sis mgr Bibb Chevrolet Co h 225 Riverdale dr (I) Loh Mary W (wid F W) r 748 College Loh Verna tchr Alexander Sch No 2 r 748 College Lokey Louis (c; Lela) h 7 7th Lolas Gus (Nu-Way Weiner Stand) r Southland Hotel Lollas Berdick r 106 Church (EM) Lolliss Annie (c) maid r 500 (409) Colquitt Loman Garfield (c; Eula) h 116 (714) Hick's al Lomax Regis (wid J H) 2 bkpr C F Sheridan r 341 Vista cir (I) Lominick Bartow T (Pearl) 2 h 312 Randolph Lominick G #eo speeder hd Bibb Mfg Co r 312 Randolph Lominick O Bud speeder hd Bibb Mfg Co r 312 Randolph Long Albert C (Mintie) 6 slsmn A G Rhodes & Son h 153 Cole Long Augustine J (Hath) 1 h 838 College Long Bennett A (Mary F) h 516 Montpelier Long Bertha r 114 Cole apt 3 Long Bessie (wid H J) 4 h 114 Cole apt 3 Long Bonnie L (Marion) (o) swtchmn MD&S RR h 1350 College Long Carrol E (Mary) 4 emp Willingham Mills h 16 (83) Mill Long Chas E (Leah) 2 emp Bibb Mfg Co h 212 Jackson Long Decatur (c) brklyr r 158 Middle (V) Long Doll (Mrs Luke) emp Bibb Mfg Co r 163 Gardner (PM) Long Easter (c) r 87 (128) Forest (V) Long Edmond student r 114 Cole apt 3 Long Emmett L elk Macon Feed & Seed Store r 304 Hines ter Long Frances K (wid R L) slswn Peggy Hale Inc 849 Winton Long Georgia M r 153 Cole Long Gertrude student r 201 Pierce (V) Long J C r 114 Cole apt 3 Long J Ralph (Ethel) 1 emp R L Clarke r 205 College pi Long Jack N (Idelle) emp Atlantic Mills h 3 Atlantic Village Long John C (Ellen) 4 h 235 Washington Long John T shpg elk Cudahy Pkg Co r 838 College Long John W (Ruby) mtr cycle ofer CPD r 440 New Long Kate (wid O L) h 126 Coleman Long Laura (c) cook h 120 Tatnall la Long Leah (Mrs C E) spooler Bibb Mfg Co r 212 Jackson Long Leola Mrs 1 smstrs r 651 Plum Long Lizzie (c) cook A M Peeler r 216 Green Long Luke (Doll) 1 emp Bibb Mfg Co h 163 Gardner (PM) Long Maggie O (c) r 120 Tatnall la Long Mamie (c) maid Wesleyan College r 418 (432) North Long Margt M (wid G H) (o) h 203 Clisby pi Long Margt M (wid F E) (o) h 202 Vista cir (I) Long Marion P (Mrs B L) tchr Fort Hawkins Sch r 1350 College Long Mark (c; Mamie) 2 porter Dunlap-Peeler Hdwe Co h 418 (432) North Long Marvin L barber E E Bateman r Hotel Macon Long Mary Mr3 r 252 1st Long Mary (c) lndrs h 15 (5) Witkowskis la Long Mary A bkpr Chapman's Garage r 838 College Long Maud (c) lndrs h 131 (12) Park Hotel al Long Milton A (Gussie E) repr Union Shoe Shop r RD 2 Long Minnie L (c) lndrs r 405 Chestnut Long Oscar L lawyer 215 Ga Casualty Bldg r 126 Coleman Long Otis E (Mattie) 3 emp Bibb Mfg Co h 20 Bibb Long Rose sten r 838 College Long Roy W (Mary L) 3 barber 1005 Broadway h 620 Duncan LONG SARA M (Mrs Le Roy), (Vanity Beauty Shop) r 129 Highland--Tel 1154-M Long Sarah E sch tchr r 126 Coleman Long Wesley H (Katie) 1 elk C of Ga Ry r 126 Coleman Long Wiley C (W Belle) 2 asst engr City Bd of Water Comrs h 304 Hines ter (V) Long Wm D (c) case aide County Relief Admn r 158 Middle V Longley Mary J (Mrs Fredk) opr Happ Bros Co r 821 New 334 Baldwin's and Telegraph's Longstreet Hattie (c) cook Aristide Benedetto Lovett Jack (c) h 702 Hammond r 1056 Hazel Lowder Wm (c; Rosa) 3 lab h 102 Gustin Longstreet Wm B (c; Hattie) 1 washer Cres- Lowder Willie K (c) sch tchr r 102 Gustin cent Ldry h 1056 Hazel Lowe Ada (c) r 105 e Ell (SM) Looney Frank elk Ga Casualty Sandwich Shop Lowe Alf student r Sunset dr (SH) Looney Lillian (wid E B) r 1811 2d Lowe Allie (wid E H) (o) h 131 Piedmont (SM) Loose-Wiles Biscuit Co P L Ashurst mgr 312% Lowe Beigus C (c; Savannah) (o) carp h 143 Main (EM) Laper J Loyd asst stock elk Adams Mfg Co 7 Sycamore (V) Lowe Chas (c) delmn W W Brown r 201 Lee Express Lowe Chas L (c) delmn Mitchell & Williams Lord Clyde A (Exie L) mech R A McCord Mtr Co r 9 Plant al Co h 115 Ponce de Leon Lowe Cora Lou (c) 2 lndrs h 231 (212) Mut- Lord Earl V agt Met Life Ins Co r 521 Johnson tual (V) Lord Eliz (wid F H) 1 h 108 (726) Cabaniss Lowe Dollie B (c) h 144 Bright al (EM) Lord Evelyn r 238 American blvd Lowe Dorothy tchr Mercer Univ r 300 College Lowe Dovie (c) maid h 209 Madison Lord Frances O (Mrs H O) furn rms 260 Wash- Lowe E Herbert (Tommie) 1 slsmn Dr Pepper ington h do Lord Hugh T (Martha W) pipeftr City Bd of Btlg Co r 131 Piedmont Lowe Edw (c) hlpr T & T Pkg Co Water Comrs r 321 North (NH) Lord John E (Clara) (o) dept mgr Burden Smith & Co h 238 American blvd Lord Laura E elk Newberry's r 238 American blvd Lord Loton E (Margt S) patrolman CPD r 521 Johnson Lord Pauline S (wid H B) h 112 Laurel Lord Sibyl T cash Vanity Beauty Shop r 108 (726) Cabaniss (EM) Losey John (c; Mattie) 4 wtchmn C of Ga Ry h 109 Bonaire Losey Laveme (c) r 109 Bonaire Lott Alice tchr Fort Hawkins Sch r 808 Wal- nut Lott Clarence L (Florence P) 1 ofc mgr So Bell Tel Co h 103 De Sota pi Lott Furna E slsmn Ga Power Co r 808 Wal- nut Lott Grace r 720 Forsyth Lott Gus O (Lena B) eng GS&FRR h 720 Forsyth Lott Gus O Jr student r 720 Forsyth Lott John T (Daisy) 1 tailor 808 Walnut h do Lott Leonard L (o) formn Armour & Co h 320 Newberg Louder Lillie M (c) 5 dom r 640 4th (WH) Lougee Bessie (wid D B) (o) h 110 Brookdale (B) Louisville & Nashville Railroad Co J P Gil- man coml agt 201 Terminal Sta Love Cleo (c) (o) sch tchr h 371 Monroe (V) Love Edw (c) cook Dixie Cafe & Commissary h 903 (303) Elbert Love Geo (c) cook DeLuxe Cafe r 445 Tindall Love Hattie (c) h 85 Wilder (SM) Love Henry A (Clara) 3 (o) wtchmn C of Ga Ry Creosote Plant h 420 Ridge (I) Love Mary (c) lndrs h 220 Fargason (V) Love Maude H Mrs slswn J N Neel Co h 263 Georgia apt 3 Love Robt elk U S Dept of Labor r 263 Geor- gia apt 3 Lovein H C emp McKesson-Riley r 258 College Lovejoy Emma C beauty opr Estelle Robinson r 655 1st Lovejoy Lenora waitress Dannenberg's r 655 LOWE EDW M (Jimmie L) 1, Sec-Treas Lowe Electric Co, h B 3 Georgian Terrace, 261 Georgia--Tel 3924 LOWE ELECTRIC CO, .Henry E Lowe Jr Pres, Edw M Lowe Sec-Treas, Whol Elec Sups and Mechanical Refrigeration 131 Cotton--Tel 6300 Lowe Elijah (c; Florence) hlpr C of Ga Ry h 57 Spring Lowe Eliza (c) 2 h 113 (235) Stewart's al Lowe Emory (c) emp Cherokee Brick Co r 105 (656) Peacock Lowe Etta (c) h 215 Elm Lowe Eug Y (c) case aide County Relief Admn r 520 Monroe Lowe Fannie (c) r 711 (r) Broadway Lowe Frances C Bibb County Home Demon- stration Agt r 456 Cherry Lowe Francis J (Maggie M) 1 (o) spec agt Prudential Ins Co h 135 Hines ter Lowe Florence (c) presser Crescent Ldry r 137 Magnolia la Lowe Geo (c; Myrtle) 1 emp Spiller's Restr h 545 (445) Tindall (SM) Lowe Hattie (c) 1 r 144 Bright al Lowe Helen (c) r 242 Nona (EM) LOWE HENRY E JR (Martha P) 1 (o), Pres Lowe Electric Co, h 146 Beverly pi--Tel 438 Lowe Hubert (c) r 416 Oglethrope Lowe James (c) waiter Henry Williams r 800 (139) Maynard Lowe James E (c; Mary) (o) emp Macon Hosp h 1157 Oglethrope Lowe James T student r Sunset dr (SH) Lowe Jane (c) 1 emp T & T Packing Co h 653 Hazel Lowe Jerry G (Artie B) 2 (o) farm supvr U S Govt h 456 Cherry Lowe John (c; Dollie) r 112 (156) DeBorde Lowe John (Josie) 2 hlpr h 452 Elm Lowe John A (Essie) detective City h 569 1st Lowe John A Jr (Viola) mgr Odom Candy Mfg Co h 247 Winship Lowe John D (c) delmn Pitts Pharmacy r 314 Industrial Home rd Lowe Julius wtchmn Grand Bldg r 617 Mul- berry Lovelace Edwin P (c; Anna) (o) lab C of Ga Ry h 106 New Lovelace John W (Daisy) dentist 605% Cherry Lowe L W Mrs opr Happ Bros Co r RD 5 Lowe Leila (c) (o) dom A O B Sparks h Clin- ton rd extd (EM) h 213 Bond apt B 1 Lowe Leon (c; Ouroy) h 303 (310) Bowman Lovelace Ralph A (Alice W) (o) lbrmn h 144 Lowe Lillian Mrs 1 elk L H Shipman r Forsyth Hines ter (V) rd RD 2 Loveless Wm L (Bertha) 6 (o) lab h 228 Knott (SM) Lovett Clarence (c; Pearl) 2 emp G Bernd Co h 615 (214) Edison Lowe Louisa (c) r 800 (139) Maynard Lowe Lucille (c) emp Independent Ldry r 702 (122) Cowan Lowe Mary (c) maid 858 Elm 1935 Macon City Directory Lowe Mary M (wid HE) 1 (o) h Sunset dr Lubel Ben (Esther C) 2 mgr Macon Linen Sup (SH) Co h 99 Vineville apt A 1 Lowe Mattie (c) (o) emp Independent Ldry Co Lucas Albert (c; Sallie A) pntr h 321 Culpep- h 702 (122) Cowan per's la (V) Lowe Nannie C opr Happ Bros Co r RD 2 Lucas Annye L (Mrs R E) bkpr Willingham Lowe Nimrod (c; Minetta) 1 (o) lab E H Auto Co r 102 Lamar (V) France h Lawton rd (B) Lucas Bunyan O r 106 Highland (LCHts) Lowe Pearl (c) emp Snow's Ldry r 223 (564) Lucas Cecil Mrs candy wrapper Carstarphen Disroon la Inc r 2032 3d Lowe Randall (c) h 728 Fort Hill Lucas Celia S sten First Nat Bk & Trust Co Lowe Randall (c) (o) gro 498 (28) Mitchell h do r 26 Progress Lowe Robt A (Sarah) atndt Standard Oil Co Lucas Charlotte (c) ldry wkr h 12 Ross St pi r 110 Park pi Lucas Chas (c; Ella) (o) firemn Terminal Co Lowe Sami (c; Mabel) carp Packer Adv Corp h 125 (732) Nussbaum h 242 Nona (EM) Lucas Chas (c; Willie) (o) gro 216 (353) Eliza- Lowe Savannah (c) cook Ruth Carmichael r beth (SM) h 213 (353) Campbell (SM) 143 Sycamore (V) Lucas Chas J (c) slsmn Pilgrim Life Ins Co r Lowe T Jackson student r 135 Hines ter (V) 406 Ward (V) Lowe Willard elk Mitchell & Williams Co r 131 Lucas Chas P (Alice) (o) h 741 Ridge (I) Piedmont (SM) Lucas China M (c) student r 310 (98) Culpep- Lowe Wm (c; Eugenia) 2 chauf 2524 Forsyth per's la (V) rd Lucas Corrinne (c) cook r 118 (119) Bell Lowe Wm (c; Lauria B) (o) emp So Ry h 229 Lucas Dora (c) r 66 Turpin Roosevelt (V) Lucas Earl student r 102 Lamar (V) Lowe Wm E (c) delmn Hi Lo Gro r 115 Hicks Lucas Eug (c;Estelle) 9 farm hd Methodist Or- al phanage h 310 (98) Culpepper's la (V) Lowe Wm P lino opr J W Burke Co r RD 5 Lucas Eug Jr (c) student r 310 (98) Culpep- Lowe Wm T (Annie) r 901 Clinton per's la (V) Lowe Wm T (c; Alma) (o) h 611 Fort Hill Lucas Fred D (c) delmn Ard's Cash Gro r 152 Lowenthal Marcus M (Sadie) 3 emp C of Ga Spring Ry h 2422 2d Lucas Henry W (c; Emma S) 1 (o) carrier Lowery Gena (wid J O) r 505 Jackson P O h 115 Neal (V) Lowery LeRoy (c) r 403 Maynard Lucas Henry W Jr (c) student r 115 Neal (V) Lowery Obie L (Ursie L) 1 emp Bibb Mfg Co Lucas Ike (c; Corienne) 1 h 118 (119) Bell h 18 Bibb Lucas John (c; Dovie) h 34 (498) White (SM) Lowrance James L (Minnie) (o) pres Dixie Lucas Lucille dietician The Clinic r do Roll & Cot Co h 667 Courtland Lucas Mary (c) cook Minnie G Scott r 428 Lowrance Roy E (Lillian) 2 genl mgr Carling Lawton Tile Co h 203 Vista cir (I) Lucas Mary B (wid Jonathan) 1 r 1416 Ogle- Lowrey Carrie (c) cook Eugenia W Blount r thorpe 221 Lynwood (V) Lucas Mattie (c) r 406 Ward (V) Lowrey Edw (c; Carrie) jan Tatnall Sq Pres- Lucas Mattie D (wid C M) h 26 Progress byterian Ch h 221 Lynwood (V) Lucas Mozelle (c) r 514 e 2d (EM) LOWREY JAMES A JR (Louise S) 2, (Miller Lucas Naomi (c) student r 115 Neal (V) & Lowrey) h 275 Orange--Tel 2175-M Lucas Olivia (c) cook Mattie R Taylor r 304 Lowry Claudia r 1 Parker's la (256) Roye Lowry Hester (c) cook D G Mann r 105 (157) Lucas Oscar (c; Azie) 1 lab So Crate & Ve- Davis la neer Co r 1524 1st Lowry John T (Annie) 3 h 1 Parker's la Lucas Robt E (Annye L) supt Cotton States Lowry Jos (c; Hesther) 1 h 105 (157) Davis la Lowry Julius (c; Annie M) emp Willingham Mills h 220 Pear Lowther Althea (c) student r 132 4th (V) Loyall Jennie librarian Wesleyan Col h 401 College apt 7 F Loyd Albert A (Lola M) 3 (o) emp So Ry h Fertilizer Co h 102 Lamar (V) Lucas Sallie (c) cook Mitchell & Williams Co Lucas Sol W (c; Rachael) lab Taylor Iron Wks h 1140 Broadway Lucas Susie M (c) tchr Hudson High & Indus- trial Sch r 321 Middle (V) Lucas Viola (c) cook M R Gardner h 318 1st 862 Cherry (V) Loyd Bertha (c) 2 h 151 Clara Lucas Willie (c) elk Chas Lucas r 213 (353) Loyd Ethel S opr So Bell Tel Co r 134 Virginia Campbell (SM) Loyd Geo (Alma) 1 tr dr City r 367 Walnut Lucas & Jenkins A P Barry mgr, oprs Capitol, Loyd Horace C (Mary E) 1 h 134 Virginia Rialto and Ritz Theatres 368 2d Loyd Howard dr Yellow Cab Co r 134 Virginia Lucky Aretha (c) 2 cook L W Carter h 123 Loyd Ida M student r 134 Virginia Brooklyn (S) Loyd Larue nurse Macon Hosp r do Lucky Strike Bowling Alleys (J B Massey) Loyd Thos E (Ethel) elk Ry MS r 1302 Ridge 358 Cotton (I) Ludlow Ralph P (Celsie) 2 tr dr City Scaven- Loynd Agnes M sten Macon Transient Bur r ger Dept r 210 6th (SM) 107 Stonewall pi (V) Ludwig Rene r 817 Walnut Loynd Gertrude E r 107 Stonewall pi (V) Lueree Beauty Shop (Mrs Lula M Sapp) 572% Loynd Herbert A (Alice A) (o) elk Dannenberg & Waxelbaum Co h 107 Stonewall pi (V) Loynd Lillian B sten r 107 Stonewall pi (V) Lubach Anthony P vet 659 Broadway r 852% Cherry Lufburrow W A (Florence) state ed Macon Telegraph r 248 (119) Stanislaus cir Lugand A Emil slsmn Ga Power Co r 220 1st Lumpkin Daisy W (wid Geo) r 122 (153) Pierce Lumpkin Evelyn (wid W O) h 101 Clayton (V) Cherry Lumpkin Evelyn M elk Sunlite Electrik Bake Lubach Mamie L Mrs h 852% Cherry Shop Inc r 655 Forsyth 336 Baldwin's and Telegraph's Lumpkin G Wallace student r 655 Forsyth Lumpkin Geo (Hazel S) 2 (o) cotton buyer Bibb Mfg Co h 123 Buford pi Lumpkin Geo B (Mattie W) 1 blksmth C of Ga Ky h 655 Forsyth Lumpkin Harry E sta atndt Ingleside Oil Co r 101 Clayton (V) Lumpkin J Quinton (Louise) 1 (o) engr GS&F RR h 512 Hillyer Lumpkin Jack G (Olene) elk Terminal Hotel r do Lumpkin James Q Jr (Mary P) student r 512 Hillyer Lumpkin Joe H sta atndt Standard Oil Co r 655 Forsyth Lumpkin Kath L emp Met Life Ins Co r 512 Hillyer Lumpkin Lila V sten Bibb Mfg Co r 122 (153) Pierce Lumpkin Olene (Mrs Jack) sten Hotel Lanier r Terminal Hotel Lumpkin Z Lee (wid W O Jr) 1 slswn Mary Elizabeth Shop r 101 Clayton (V) Lundy A Malissa h 123 Yates Lundy Andrew G (c; Ossie W) 4 glazier Mc- Millan Paint & Glass Co h 120 Forest (V) Lundy Annie (c) cook C W Walters r 453 Douglas (V) Lundy Bright W (Iva) (o) elk C of Ga Ry h 348 Pierce Lundy Carl A (Eva) 5 farmer h 386 Clinton Lundy Chas (c; Mabel) porter S E Exp Co h 512 (532) Maynard Lundy Claudia (c) 1 lndrs h 1151 (811) Wool- folk Lundy Corley (c) r 228 Lexington Lundy Eva (c) tchr St Peter Claver Catholic Sch r 313 Green Lundy Harry (c; Alice) lab Carling Tile Co h 230 Gilmer Lundy Ida (c) h 408 e 1st (EM) Lundy Jno W (c) phys 533% Forsyth h do Lundy John W (c; Annie) 5 tr dr Buck Ice & Coal Co h 453 Douglas (V) Lundy Laura (c) 1 (o) h 200 (221) Bowman Lundy Laura (c) h 221 Division St la Lundy Mabel (c) maid YWCA Residence r 512 (532) Maynard Lundy Melvin (Annie M) 4 dairymn Solomon's Dairy h 308 Melrose (B) Lundy Miles L (c) (o) glazier h 230 (234) Far- gason Lundy Miles L Jr (c; Eva) 3 plstr h 313 Green Lundy Ossie W (c) maid J S Birdsey r 120 Forrest (V) Lundy Robt (c; Oveda) 1 emp Buckeye Cotton Oil Co h 304 Charles Lundy Robt opr Dixie Roll & Cot Co r 123 Yates Lundy Wm E (c) h 215 (434) Thompson's al Lundy Wm W (c; Lula) 9 (o) (Busy Corner Lunch Rm) h 353 Robinson rd Lunsford Mortie (c; Ella) 3 h 303 Green Lupo Kendall lab Ivey-Turner Ice Cream Co 635 Oglethorpe Luster Felton (c) r 114 Bright al Luster Ida (c) ldry wkr r 7 Ross St pi Luster Jeanne (c) r 7 Ross St pi Lutheran Church of the Redeemer 723 Holt Lutsky Benj slsmn Goldman's Pawn Shop r 820 2d Lutsky Meyer (Annie) (o) tailor h 820 2d Lyle H Grady (Jessie B) 2 elk C of Ga Ry h 412 Forest (V) Lyles (See also Liles) Lyles Addie (wid N H) r 250 Hydrolia Lyles Alberta (Mrs W S) opr Happ Bros Co r 709 Main (EM) Lyles Annie Lee emp Nat Pecan Mktng Assn r 210 Willingham Lyles Benj F r 210 Willingham Lyles Benj F (Julia D) 2 restr 554 Mulberry h 101 Crisp Lyles Billy J waiter Spiller's Restr r 1037 2d Lyles Duke (c; Suzanne) lab Willingham S&D Co h 1149 (349) Woolfolk (EM) Lyles Edgar L (c; Eliz) 1 r 138 Woodliff Lyles Eliz (c) cook J R L Smith r 138 Wood- liff Lyles Ella (wid W N) (o) h 1241 College dr Lyles Gladys opr Happ Bros Co r 210 Wlliing- ham Lyles Hattie (Mrs S H) emp Bibb Mfg Co r 622 Hawthorne Lyles Herman L (Eugenia) 5 taxi dr h 1674 2d Lyles J Frank (Alma) 4 wtchmkr The Watch Shop h 810 Woolfolk Lyles John L (Minnie) h 210 Willingham Lyles John N tex wkr r 250 Hydrolia Lyles Lula (c) cook h 111 Spring Lyles Nancy (wid R H) r 709 Main (EM) Lyles Nora (wid Wm) r 1027 2d Lyles Obie (Bradley) 2 emp Bibb Mfg Co r 107 Capital Lyles Robt L (Bessie) 3 emp Bibb Mfg Co h 34 Taylor Lyles Rufus (Mary B) emp City St Sweeping Dept r 524 (562) Oglethorpe Lyles Stewart H (Hattie) r 662 Hawthorne Lyles Wm S (Alberta) 1 farmer h 709 Main (EM) Lynch (See also Linch) Lynch Bernice C (o) sch tchr h 118 Piedmont (SM) Lynch Grief R (Ina) 3 supt Willingham Mills h 222 (54) Holt Lynch Julia F (wid R W) drsmkr 556 Pine h do Lynch Letitia (wid W L) 2 (o) slswn W T Grant Co h 126 Richmond Lynch Lois r 118 Piedmont (SM) Lynch Lucille sch tchr Hawkinsville Ga r 118 Piedmont (SM) Lynch R Winfrey (Am Restr) r 556 Pine Lynch Willie F r 118 Piedmont (SM) Lyndon Andrew J (Annie M) 1 (o) local rep Phoenix Mut Life Ins Co h 930 Vineville Lyndon Andrew J Jr student r 930 Vineville Lyndon T Miller student r 930 Vineville Lynn Dewey (Dessie) 2 h 104 St John (EM) Lynn Ethel emp Willingham Mills r 19 (66) Mill Lynn Margt student r 215 New Lynwood Cemetery (c) end Lynwood (V) Lyon, Harris & Brooks (W J Lyon, H E Har- ris, R F Brooks) printers 560 Mulberry Lyon Mamie M (wid C G) 1 (o) slswn Charis Corp h 205 Mikado Lyon Margt F elk S H Kress r 205 Mikado Lyon Wm J (Ruth) (o) (Lyon, Harris & Brooks) h 221 (220) Log Cabin dr Lyons Aaron (c) delmn W N Shinholser r RD 1 Lyons Annie B (c) student r 131 (123) Phillips la Lyons Eug (c; Emma) 5 h 853 3d (V) Lyons Joseph J coir Ga Power Co r 104 Mill Lyons Juanita (c) cook W J Davis r 230 Berk- ley dr (I) Lyons Katie (wid W A) r 104 Mill Lyons Napoleon (c) r 131 (123) Phillips la Lyons Walter (c; Juanita) dairy hd Solomon's Dairy h 230 Berkley dr (I) 1935 Macon City Directory 337 Lyons Walter (c; Alice) lab h 131 (123) Phillips la Lyons Wm (c) delmn Marvin'c Gro r 853 3d (V) Lyons Wm A (Leona) 2 (Lyon's Cash Mkt) h 285 Washington Lyster Annie (Bellevue Cash Gro) h 201 American blvd Lyster John T (Ida B) (o) (Woods Mkt) h 817 Broad Mabel Lodge No 255 F & A M J W Graham sec meets 2d & 4th Tuesdays 8pm 710 Mulberry Mabry Ernestine (c) r 316 3d (V) Mabry Essie (c) 1 h 117 (14) Magnolia la Mabry Geo (c) student r 206 Forest (V) Mabry Ida (c) (o) h 833 3d (V) Mabry Inez (c) r 206 Forest (V) Mabry Lemuel (c) porter D H Adams Mtr Co r 833 3d (V) Mabry Lucius (c) chauf r 833 3d (V) Mabry Paul (c) carder Bibb Mfg Co Mabry Robt H (Eula) 3 (o) dentist 510 First Natl Bank Bldg b 749 Winton Mabry Robt H Jr student r 749 Winton Mabry Roy (c; Julia L) 2 porter Sparks Mtr Co b 224 (131) Grant (V) Mabry Sallie L Mrs 1 emp Carling Tile Co r 440 New Mabry Wm (c) 1 emp Buckeye Oil Mill h 206 Forest (V) Mabry Wm Jr (c) r 206 Forest (V) Macdonald Alf (Isabel W) dist supv HOLC r 111 Jefferson MAC DONELL ALAN M (Laura T) (o), Local Adv Mgr The Macon Teleg and Macon Evening News, h 1110 Ridge (I)--Tel 6568 Mac Donell Jean student r 1110 Ridge (I) Mace Wm A (c; Ethel) 1 (o) cook b 968 Montpelier Macedonia Baptist Church (c) E J Calhoun pastor 164 Hazel Mae Ewen Harry A student r 103 Laurel Mac Ewen Harry L (Sue W) accnt h 103 Laurel Mac Ewen Wilson M elk Ga Power Co r 103 Laurel Macey Jos M (Katie) 2 h 234 Tatnall Mack Daisy (c) maid T M Willingham r 387 Melrose (EM) Mack Dorothy (c) maid Jack Shrem r 115 Tindall Mack Edw (c; Willie B) 1 h 2117 Wyche's al Mack Edw (c) student r 129 Ritchey Mack Effie (c) cook H C Godwin Mack Essie M (c) 1 h 309 Edgewood Mack Geo R (c; Rebecca) emp Cherokee Brick Co h 145 Evergreen la Mack Helen J sec-treas Alf Mack's Pharm Inc r 105 Hill Crest Mack Ida (c) lndrs h 181 (164) North (NH) Mack J M r Fickling Hotel Mack Jeannette (wid A F) (o) pres Alf Mack's Pharm Inc h 105 Hill Crest Mack Jesse (c) delmn Ed Smith Gro Mack Jesse (c; Essie) porter Huckabee Auto Co r 357 Elm Mack John (c) h 387 Melrose (EM) Mack John (c; Tessie) h 129 Ritchey Mack Lucile (c) r 307 Blount Mack Mamie (c) h 421 (472) 3d (V) Mack Mary L (c) dom r Clinton rd extd (EM) Mack Minnie L (c) r 308 Edgewood Mack Purchasing Co Inc R S McWilliams mgr loans 612% Poplar Mack Rhetta F r 105 Hill Crest Mack Ruby (c) r 620 Hammond Mack Tommie (c) 1 h 308 Edgewood Mack's Alf Pharmacy Inc Mrs Jeannette Mack pres Helen J Mack sec-treas 401 Cherry Mack's Place (Lonnie McDaniel) gro 120 En- terprise Macken Dorothy student r 804 Napier Macken J Edw (Kath H) (o) blrmkr supv C of Ga Ry h 804 Napier Macken J Edw Jr r 804 Napier Mackey Thos coir Empire Furn Co r Y M C A Mac Millan Donald M (Lillian) 4 (Mac Millan Tire Retreading) h 247 Hardeman Mac Millan Donald M Jr hlpr Mac Millan Tire Retreading r 247 Hardeman Mac Millan Tire Retreading (D M Mac Millan) 352 1st Macon Academy Music Co D G Phillips mgr 513 Grand Bldg Macon Alex (c; Lelia) 1 lab h 218 Fretwell Macon Allen B soda elk Macon's Pharm r 412 Ridge (I) Macon Art Assn Mrs Fontaine Barden pres meets on call Wesleyan Conservatory MACON AUTO EXCHANGE (Paul G Hogan), Auto Storage and Service Station 362 1st-- Tel 9185 Macon Banana & Produce Co Inc J F Head pres P L Head sec-treas 11 Terminal Macon Ban Association Court House Macon Better Housing Program W T Derry mgr 321 3d Macon Butter Co (R N Holloway) 619 Linden MACON CABINET WORKS INC, Carl Bohn Pres, Mrs Julia K Dohn VP, Philip H Dohn Sec-Treas, Poplar nr 8th--Tel 471 (See page 50 and cards B D) Macon Cafeteria M B Woodard mgr 415 Cherry Macon Carrie (wid J N) (o) h 412 Ridge (I) Macon Casket Co (C W Dooley) 1501 Broadway MACON CHAMBER OF COMMERCE, Augustus O B Sparks Pres, Peyton W Jones 1st VP, Cecil L Kirven 2d VP, Guyton G Abney Treas, John L Morris Mgr, James O Cromwell Traffic Mgr, Mrs Lucille L Marshall Information See, Municipal Auditorium--Tels 1767-1768 Macon Cigar & Tobacco Co L A Walker pres, R D Sams sec-treas 651 Broadway MACON CITY OF CITY HALL, Poplar bet 1st and Cotton-- Tel 1880 Airport (Miller Field) J M Mathews mgr 2 miles east city limits via Milledgeville rd ALDERMEN, Sam S Chandler, J Milton Heard, DeWitt McCrary, Chas L Bowden, E R Layfield, B I Waller Jr, A J Flowers, H W Pittman, Henry Harris, Calder B Clay, Harry D Chapman and G G Walden, City Hall ATTORNEY, Elijah J Maynard, 403 Madon Sav Bk Bldg--Tel 727 Board of Education (see Bibb County) Board of Health, J D Applewhite health officer, 720 New BOARD OF WATER COMMISSIONERS, Jesse Mitchell Chairman, C T Williamson Vice Chairman, John T Moore Commissioner, R E Findlay Sec- Treas--Tel 1880 City Hall CLERK, Mrs Viola R Napier, City Hall--Tel 1880 Council Chamber, City Hall ELECTRICIAN, Chas H Humphreys, City Hall--Tel 1880 ENGINEER, Watson Walker, City Hall-- Tel 1880 338 Baldwin's and Telegraph's FIRE DEPARTMENT, Volley C Shepard chf, John E Dellinger 1st asst chf, Guy L Moseley 2d asst chf, Headquarters rear of City Hall--Tel "Call Fire Dept" Pump Co No 1, 127 Garden Pump Co No 2, Georgia at Monroe Pump Co No S, rear City Hall Pump Co No 4, rear City Hall Pump Co No 5, 2233 3d Pump Co No 6, 303 Pio Nono Truck Co No 1, rear City Hall Truck Co No 2, Georgia at Monroe INSPECTOR OF BUILDINGS, F Joe Bishop, City HaU--Tel 1880 LICENSE INSPECTOR, Don C Glendenning, City Hall--Tel 1880 MARSHALL, John T Pool, City Hall--Tel 1880 MAYOR, Hon Herbert I Smart, City Hall-- Tel 1880 Municipal Auditorium, Cherry at 1st PERMANENT TAX ASSESSOR, Isaac L Dunwody, City Hall--Tel 1880 PLAY GROUNDS SUPERVISOR, Mrs Wil- mer E Beggs, City Hall PLUMBING INSPECTOR, Lawrence A Mil- ler, City Hall--Tel 1880 POLICE DEPARTMENT, Ben T Watkins Chief, City Hall--Tel 1880 PURCHASING AGENT, David S Jones, City Hall--Tel 1880 RECORDER'S COURT, G M Nottingham re- corder, City Hall--Tel 1880 Stockade, J P Reese warden, Poplar nr 8th Street Department T W Ellis Jr supt, Poplar at 9th Street Sweeping and Scavenger Department, B C Smith supt, Poplar at 9th TREASURER, Rufus W Evans, City Hall-- Tel 1880 Water Works, H R Taliaferro supt, plant Waterworks rd at river shop 265 5th Weighing Bureau, J E Cooper weigh mstr, 3d cor Arch Macon Clearing House Assn J K Hogan pres C H Usina sec meets on call First Nat Bk Bldg MACON COCA COLA BOTTLING CO, W T Williford Mgr, 416-20 Oak--Tels 3266-3267 Macon Transient Bureau C W Sherlock Executive sec 208-12 2d MACON TYPEWRITER & OFFICE SUPPLY CO, Walter T Johnstone V-P and Genl Mgr* Typewriter Repairing, Mimeographing and Direct Mailing Service, 564 Mulberry--Tel 1087 Macon Vocation School D M Ward director 29 Washington Bldg Macon Volunteers Armory 468 1st Macon Wm E (Pearl) 2 h 225 Belmont Macon Womans Club Mrs Eloise Stoball hostess 200 Beconfield Macy Bessie M Mrs tchr Bruce Sch r 53 Arlington pi Madden J L baker Am Bakeries Co Maddox A Grady emp Ga Power Co Maddox Andrew D emp Bibb Mfg Co r 338 Calhoun Maddox Andrew D Jr student r 338 Calhoun Maddox Asa (Bessie) (o) pntr h 357 Hydrolia Maddox Barney B (Floy) 2 (o) blrmkr C of Ga Ry h 239 Jeff Davis Maddox Buford Mrs tex wkr Happ Bros Co r 407 Walnut Maddox Chas tex wkr Bibb Mfg Co r 235 Washington Maddox Clara (c) r 61 Craig's la Maddox Clara (wid L A) emp Happ Bros Co r 760 1st Maddox Claude (Verna) 2 lab Tomlinson Paper Box Co h 351 Flanders Maddox Danl M (Hannah) h 1020 Hazel Maddox Dollie (c) 2 lndrs h 73 Brooklyn (S) Maddox Edgar M (Delone) formn City St Dept h 374 Clinton Maddox Edw (Emma) 1 r 357 Hydrolia Maddox Edw L (Nancy D) 1 trav slsmn h 204 Corbin (V) Maddox Eva (c) 4 h 16 (100) Elm Maddox Evelyn student nurse Oglethorpe Pri- vate Infirmary r do Maddox Heyward (c) lab Willingham S&D Co h 319 (18) Plumtree Maddox J Lamar (Myrtle M) pipeftr A B Lee Plmbg & Htg Co 2650 Houston Maddox Jesse E (c; Ella) (o) delmn h 205 Roosevelt (V) Maddox John J (Lillie) 2 h 916 New Maddox Kath (c) r 730 Hazel Maddox Katie (c) r 113 Morris (B) Maddox Kesley tex wkr Bibb Mfg Co r 235 Washington Maddox Leona r 351 Flanders Maddox Lizzie (c) h 61 Craig's la Maddox Louis (c) student r 205 Roosevelt (V) Maddox Margt nurse Macon Hosp r do Maddox Marshall (Mildred r 341 Calhoun Maddox Mary (wid I W) 1 r 351 Flanders Maddox Mary nurse 216 Adams r do Maddox Nathan (c; Sara) (o) h 113 Morris (B) Maddox Palmer (c) student r 205 Roosevelt (V) Maddox Roberta (c) maid Horace Durden h 1220 Napier Maddox Rose (c) r 118 Tindall (SM) Maddox Roy student r 338 Calhoun Maddox Sim (c; Jessie) h 204 Woodliff Maddox Spencer F (Martha) 1 slsmn h 212 (220) Hill Crest Maddox Thos C (Myrtice) 1 emp Roberson Realty Co h 659 2d Maddox Thos L slsmn Willingham S&D Co r 760 1st Maddox W Reid electrn Ga Power Co r 167 Cherokee Maddox Wm (c) emp Willingham Mills h 429 Chestnut Maddux Hugo L emp Bibb Mfg Co r 709 Courtland Maddux Josiah A (Pearl) (o) engr C of Ga Ry h 709 Courtland Maddux Julian R (Ruby) 1 (o) v-p Ga Caro Oil Co r 413 Spring Maddux Kathleen cash Artistic Beauty Shop r 709 Courtland Maddux Mamie T (wid R D) (o) h 413 Spring Maddux Marguerite sten Martin, Martin & Snow r 709 Courtland Maddux Robt D student r 413 Spring Madison Clara (c) 4 h 303 (205) Waterville rd Madison Laura (c) emp Macon Hosp r 1011 Elbert Madison Robt (c; Irene) emp Bibb Mfg Co h 955 Hazel Maerz Glenn P (Mrs Jos) tchr Wesleyan Con- servatory r 217 Nottingham dr MAERZ JOSEPH (Glenn P) director Wesleyan Conservatory of Music and Fine Arts, h 217 Nottingham dr--Tel 1973-J (NH) Maerz Lucian student r 217 Nottingham dr Maerz Paul student r 217 Nottingham dr Magee Estalena r 410 Forsyth 340 Baldwin's and Telegraph's Magee James S (Marjorie) 2 condr C of Ga Ry Mallory Georgia V (Mrs H P) slswn Penney's r 410 Forsyth r 452 Spring Maghee Torrey B (Betty) colonel USA h Sun- Mallory Howard (c) hlpr Shell Petroleum Corp set dr (SH) r 410 Crsip Magill James H emp So Ry r 217 1st Mallory L Ellen (wid L T) r 120 Lamar (V) Magnolia Baptist Church (c) Nathl Cephus Mallory Louise (c) cook J N Birch h 189 Hat- pastor 316 Jackson field al Magnolia Camp No 88 WOW G R Williams sec Mallory Maggie (c) 2 r 410 Crisp meets 1st & 3d Fridays 8:00 p m 515 2d Mallory Minnie (c) 2 r 110 (772) Nussbaum Magnolia Inn (Mrs Mattie A Smith) bdg 555 Mallory Mission Baptist Church 219 Roff Home 2d Mallory Ola (c) maid r 104 Wings Hill Magwood Robt (c) lab C of Ga Ry Mallory Robt (c) lab Buckeye Cotton Oil Co r Mahogany Jos (c; Lillian) h 114 Green 110 (772) Nussbaum Mahone Harrison (c; Julia) h 58 New Mallory Sami (c; Lou) h 110 (772) Nussbaum Mahone Norman A elk Hotel Arcadia r 663 Malone Bertha Mrs r 1903 3d Mulberry Malone Booker T (c) lab So Crate & Veneer Mahone Robt C Louise) h 105 De Sota pi Co Mahone Roland T (Ruth) 1 (o) sec-treas Will- Malone Carolyn (Mrs Louis) opr Happ Bros Co ingham Cotton Mills h 114 Courtland r 217 Chappell (SM) Mahone Ruth student r 114 Courtland Malone Carrie (wid J F) emp Union Dry Gds MAHONE W PERRY, Sec-Treas Joseph N Co h 142 Laurel Neel Co, r 247 Boulevard--Tel 443-W Malone Clerie M (c) r 1215 3d Mahone Wm P ( Rosa L) mgr Hotel Arcadia r Malone Cleveland (c; Julia) lab h 266 Broad 663 Mulberry Malone Code F (Ola) tr dr r 2130 Broadway Mailey Christie C (Ruth) 1 slsmn h 864 Mul- Malone Comer R emp C of Ga Ry berry apt 3 D Malone E Lansford hlpr Macon Butter Co r 315 Mailey John L r 15 Atlantic Village Jenkins Mailey Sami F (Daisy) mstr mech Atlantic Malone Frances r 324 Jenkins Cotton Mills h 15 Atlantic Village Malone Frances (c) dom W B O'Neal Mainor James T (Iva) 4 (o) age C of Ga Ry Malone Gordon (Lucile) tr dr Porter's Dry h 749 Hillyer Cleaning Co h 2644 Houston (SM) Mainor Mary B student r 749 Hillyer Malone Grover S (Susie) 1 (o) sgt So Ry h 117 Mainor Nell student r 749 Hillyer Buena Vista Mainor Wm B (Vera) tr dr S E Exp Co r 622 Malone Harry r 126 Stratton Orange Malone Hodge H (Claudia) 2 h 224 Chappell Malabar Annie smstrs r 4004 (3910) Houston (SM) Malcolm Guy A (M Bernice) (Bibb Auto Serv) Malone Howard E (Lillian) 2 bkpr R H Mat- r 185 Laurel thews Inc r 664 Napier Malcolm Judida (wid G) r 952 Elm Malone James C (Addie) h 126 Stratton Malcolm Sami (c; Odessa) jan The New York- Malone James C Jr r 126 Stratton er Malone Julia r 315 Jenkins Malcolm Barnett L (Emily) tr dr Gamble Mtr Malone Julia (c) maid Bessie Cheffer Exp r 510 Orange Malone Kate C (Mrs M E) prin Alex Sch No Mallard Emmie L Mrs opr Happ Bros Co r 603 3 h 436 Washington Plum Malone Lillian r 315 Jenkins Mallard John A hlpr r 124 Fort Hill Malone Lillie (c) r 116 Rockhill la Mallard John J (Macon Mirror Wks) r 1015 Malone Lillios D emp C of Ga Ry r 865 Orange Walnut Malone Louis S (Carolyn) 1 tex wkr Bibb Mfg Mallard Mattie (wid J L) opr Happ Bros Co h Co h 217 Chappell (SM) 317 Chappell (SM) Malone Minnie r 126 Stratton Mallard Richd (c; Estia) (o) emp So Ry h 117 Malone Myrtle Mrs r 324 Jenkins Tindall (SM) Malone Pauline Mrs elk McCommon Bros Mallard Wm D (Marie) elk P O h 111 Madden Malone Pearl (c) 1 h 1215 3d Mallary Caroline student r 117 Callaway (V) Malone Reynolds (Nattie M) 5 (o) carp C of Mallary Chas (c; Eva) r 1206 Broadway Ga Ry h 106 Heard (SM) Mallary Louise (c) cook Homer Lawrence Malone Robt (c) lab r 1215 3d Mallary Lucille B (wid F L) sec Vineville Bap- Malone Robt H (Sara) 1 eng C of Ga Ry h 288 tist Ch h 99 Vineville (V) apt F 2 Cherry Mallary Nelson D (Willie E) 1 (o) ins adjus- Malone Robt H Jr student r 288 Cherry ter FERA h 117 Callaway (V) Malone Ruth (c) maid r 1215 3d Mallary Willie E (Mrs N D) agt Mut Life Ins MALONE WM J (Annie C) 8 (o), Asst Mgr Co of N Y r 117 Callaway (V) Broadway Trading Co, h 2834 Houston--Tel Malock Chas E pntr r 771 1st Mallory Albert (c) r 110 (772) Nussb'aum Mallory Annie (c) r 110 (772) Nussbaum 765-R Maloney Lenora Mrs r 653 Hemlock Manard Chas H (c; Louise) 1 (o) cement fnshr Mallory Bettie (c) h 201 Antioch rd h 1103 Dempsey Mallory Boria (c) emp Art Furn Mfg Co r 201 Manchester Elmer E hlpr Proctor & Gamble Antioch rd Mfg Co r Fickling Hotel Mallory Buford (c) emp Art Furn Mfg Co r Manderson Lucy (wid J F) r 118 Willingham 201 Antioch rd Manderson Maggie r 15 Willingham Malloroy Camilla (c) lndrs h 311 Blount Mallory Chas (c; Ruby) 1 sta atndt Brad Wall r 308 (443) Alabama (SM) Mallory Early (c; Louise) emp Art Furn Mfg Co r 126 (706) Henderson (SM) Mallory Elbert (c) jan N H Parker r 410 Crisp Manderson Mildred (Mrs S D) slswn H L Green & Co r 307 Forsyth Manderson Steph D (Mildred) doormn Ritz Theatre r 307 Forsyth Manderson W Steph (Leila) 4 h 15 Willingham Maner Roy C (Norma) 2 electrn Ga Power Co h 104 Lamont (LCHts) 1935 Macon City Directory 341 Mangels of Georgia Inc Mrs Anna Stubbs mgr women's clo 420 3d Mansfield Willis S (Ethel) 3 gro 951 (901) Oglethorpe r Smith rd RD 2 Manget Victor (Nell) 2 (o) h 317 Corbin (V) Mangham Billie cash Life & Casualty Ins Co Manson Anna (c) cook r 207 Ocmulgee Manson Carrie (c) 3 dom r 116 Price (V) h 213 Bond apt 3 B Manson Chas (c; Mary) 2 lab h 432 Monroe Mangham Effie (c) maid The Clinic Mangham Jas D (Lillian) (o) brklyr h 105 (V) Manson Clinton (c; Elvenia) (o) h 604 Broad (372) 3d (SM) Manson DeWitt (c; Annie)l lab Macon Mill- Maning Sarah (c) cook T E Greene ing Co h 1039 3d Manley James (c; Eva) 3 emp C of Ga Ry h Manson J Wiley (c; Willie) 1 emp Nu-Icy 107 Short la Btlg Co h 604 Center (EM) Mann Adam (c; Annie) 4 chauf h 268 2d (V) Manson John (c; Hattie) 5 emp Cherokee Mann Annie B (c) tchr Pleasant Hill Sch r 242 Middle Brick Co h 306 Crisp Manson Mack (c; Lubella) 4 lab Carling Tile Mann Annie L student r 109 Clayton (V) Mann Chas O (Julia) slsmp. Taylor Iron Wks r 217 College Mann David G (Gertrude C) 2 extension sec So Co h 504 Fulton (EM) Manson Mary (c) dom G W Bailey r 432 Monroe Manson Monroe (c; Mary) 1 lab r 1039 3d Manson Perry (c; Lois) jan So Bell Tel Co h Ga Conference Bd of Christian Education h 109 Clayton (V) 500 Fulton (EM) Manuel Cora (c) 2 lndrs h 608 (308) Smith Mann Edw L (Martha R) (Ga Mkt Hse) r RD 2 (EM) Manuel Fannie (c) r 402 (150) Hall (EM) Mann Geo (c) r 212 Plant (SM) Mann Georgia (c) r 220 Grant (V) Manuel Fannie M (c) dom R L Lassetter r 608 (308) Smith (EM) Mann Hazel (Mrs J N) bkpr Jack Mann Battery Co r 321 1st Mann Horace J (Florrie) 2 hlpr h 301 Applewood Mann Ivan H Jr emp C of Ga Ry MANN JACK BATTERY CO (Jack N Mann), Manuel Felton (c) r 608 (308) Smith (EM) Manuel Henry (c; Janie L) 1 lab h 401 Chest- nut Manuel Rosa (c) 2 r 370 Flanders Manuel Wilbur (c; Mary) 2 r 12 Parker (V) Mapes Ada A (wid S B) r 263 Georgia apt 2 669 3d--Tel 6296 Maple Chester A slsmn Snow's Ldry r 185 MANN JACK N (Hazel B) (Jack Mann Battery Co), h 321 1st--Tel 2644-J Mann John (Eula) 2 carp h 303 White (SM) Mann Joseph (Ruby) lab r 26 (211) Bellevue rd Laurel Maple Orlie E (Pearl A) (o) supvr Nat Re- employment Serv h 185 Laurel Mapp Edw (c; Felva) lab C of G Ry h 861 Mann Julia C (Mrs C O) bkpr E Tris Napier (867) Broadway Co r 217 College Mapp Emil (c) dom r 116 (135) n Holt Mann Lillie M (c) maid Mrs B L Willingham Mapp Lula (c) dom h 116 (135) n Holt r 220 Grant (V) Mapp Lula B (wid A H) r 2346 Forsyth rd Mann Martha R (Mrs E L) elk Ga Mkt Hse Mapp Susie (c) 1 r 330 Barfield al r RD 2 Mapp Wm (c; Julia) lab h 109 (122) Tracey's Mann Mary (wid Chas) r 552 Hemlock la Mann Pearl (wid T B) emp Southland Knitting Mar-able Charlotte manicurist Hotel Dempsey Mills r 4 Gustin pi MANN RAYMOND R bkpr Eves Elec Co r Barber Shop r 855 New Marchman James C (Berta) 2 slsmn h 208 3984 Houston Spring MANN ROBT E JR (Corneil G) 1 (Coggin & Marchman Leola (c) 3 (o) dom h 400 Roye Mann), h 217 College--Tel 1552-J Marchman Robt W (Ruth) bus opr Ga Power Mannard Julia (c) maid B F Barden r 806 3d Co r 257 Orange , (Mar- tin, Martin & Snow), h 102 Vista cir (I)-- Tel 832 Martin Thos O r Arcadia Hotel Martin Troy S (Neeley B) 5 pntr h 133 Roff Home la Martin W F creeler Bibb Mfg Co r RD 2 Martin W M emp USPO r 553 Orange apt 23 Martin W Raymond (Eithel) 1 meat ctr Mulberry Mkt r 5 Gustin pi Martin Walter T (Eva) 2 carp h 126 Pinson (SM) Martin Wesley W (K Mary) br mgr Rogers Inc. r 115 Beech Martin Willard R (Louise) 1 mech Adams Buchanan Mtr Co h 301 Ormond ter Martin Wm (c) hlpr Lee & Smith Mule Co r 217 Watkins al Martin Wm A (Sarah) 3 (o) elk Proctor & Gamble Mfg Co h 302 Jones (EM) Martin Wm A (Nora) 1 serv sta 1143 Milledgeville rd r 865 Walnut Martin Wm B (Gladys) pharm Chichesters Tatnall Sq Drug Store r 101 Coleman Martin Wm E (Marcella) (o) lawyer 6 Washington bldg h 263 Bond Martin Wm F (Rachel M) 2 h 1109 Napier Martin Wm M (Bessie) slsmn Freeman-DentSullivan Co h 115 Florence Martin Wm N (Mamie) 2 blrmkr C of Ga Rv h 3501 Houston (SM) Martin Zora (c) r 539 Calhoun Marvin's Grocery (M Z Bailey) 2105 Vineville Mary Ann Beauty Shop (Mrs Mattie M Pettey, Doris Huff, Sadie Johnson) 620% Cherry Mary Elizabeth Shop Mrs Mildred Johns mgr wns clo 566 Cherry Maryland Casualty Co Morris Harris mgr 210 Bibb bldg Masivic Club R C Cropper pres meets Thurs 1:10 p m 518 Walnut Mason Abner (c; Eunice) 1 h 222 Thomas (EM) Mason Alice E (wid J G) r 1336 2d Mason Bonylin student r 219 (23) Holt Mason C Brown r 141 (r) Carling Mason Cliff A (Connie) 2 tex wkr Willingham Mills h 217 Duncan 344 Baldwin's and Telegraph's Mason Dalzie waitress Walgreen Oo r 251 New Mason Danl M r 141 (r) Carling Mason De Witt (c; Annie M) 1 emp Macon Milling Co h 1200 3d Mason Dovie (wid W C) 2 tex wkr Bibb Mfg Co r 962 Oglethorpe Mason Eliz Mrs r 251 New Mason Emma (Mrs C B) r 1023 Ash Mason Ernest B (Nannie) 4 bus opr Ga Power Co h 1336 2d Mason Estelle r 119 Beverly pi Mason Fred L (Bonnie) 2 tex wkr Willingham Mills h 219 (23) Holt Mason Fred L Jr tex wkr Willingham Mills r 219 (23) Holt Mason Geo (c; Laura) chauf h 162 College Mason Geo L (c) emp So Cotton Oil Co h 405 Charles Mason Geo L Jr (c) lab So Cotton Oil Co r 405 Charles Mason Geo W (c; Lillian) 2 (o) reprmn John- son Bros r 512 3d (V) Mason Hazel sten T H Hall III r 121 Coleman Mason Herbert (c) student r 1200 3d Mason Irene emp Macon Cafeteria r 235 Wash- ington Mason James (c) r 158 Phillips la Mason James D (Louis) 2 lab h 506 Telfair (SM) Mason Janie (c) lndrs r 418 Ward (V) Mason John W (Frances A) 1 mach C of Ga Ry h 2216 Forsyth rd Mason Johnnie M (c) student r 1200 3d Mason Joseph (c) 5 h 158 Phillips la Mason Joseph (c; Leila) emp Paul Williams Co h 308 Madison (V) Mason Joseph M slsmn Macon Sup Co Mason Julian r 555 Broadway Mason Leila (c) maid Massee Apts r 308 Madi- son (V) Mason Lillian E (c) 1 tchr Unionville Sch r 512 3d (V) Mason Louis r 506 Telfair (SM) Mason Louisa (wid M M) r 141 (r) Carling Mason Mildred waitress Woolworth's r 235 Washington Mason Minnie H (wid J M) (o) h 151 2d Mason Monroe (c; Mary) 1 r 1200 3d Mason Nathan (c) r Lawton rd (B) Mason Newell tchr Lanier High Sch for Girls h 280% Orange Mason R Holmes (Estelle) (o) dentist 405 First Nat Bk bldg h 119 Beverly pi Mason Robt M (c; Lula) h 240 Orange Mason Robt M (c; Mary) 1 porter Freeman- Dent-Sullivan Co h 242 Orange Mason W H Jr student r 301 Blackburn Mason W Frank (Emily) (o) emp C of Ga Ry h 223 (226) Log Cabin dr Mason Wiley A (Olive M) 1 ins agt h 902 Boulevard Mason Wm (c) emp Winton's Pharm Mason Wm (c; Lillie) lab h 403 Mason Mason Wm D (c) r 158 Phillips la Mason Wm E (Julia) 2 emp C of Ga Ry h 801 Adams Mason Wm F emp C of Ga Ry r RD 2 Mason Wm W (Eliza) 3 r 235 Washington Mason Willie B (c) 1 emp Atlantic Cotton Mills r 217 (218) Cedar (U) Masonic Hall 111 Cotton Masonic Hall (c) 411% Cotton MASONIC HOME OF GEORGIA, Harrison Dougherty Supt, Nottingham dr extd--Tel 1021 Masonic Temple 710 Mulberry Massee Annie C (wid M H) h 239 College Massee Apartments 401 College Massee Eug (Eliz) trav slsmn r 105 Clay- ton (V) Massee Irene r 354 College Massee W Jordan Jr student r 558 College Massee Wm J (Ethel) (o) vp Standard Brick & Tile Co h 558 College Massee & Felton Lumber Co end Division Massenburg Geo Y phys 567 Walnut r RD 5 Shirley Hills Massenburg Rosa r 116 Hines ter (V) Massengale Gladys (Mrs W A) emp Happ Bros r 709 Main (EM) Massengale Leonard interne Macon Hosp r do Massengale Myrtice r 224 Chappell (SM) Massengale Sarah r 1015 (2009) Log Cabin blvd Massengale Wm A (Gladys) r 709 Main (EM) Massey Alex (Laura) 1 h 29 (77) Randolph pi Massey Alma A (wid Orren W) (o) h 255 Har- deman Massey Camilla (c) 2 h 852 Foster's al Massey Daisy M Mrs r 277 College Massey Dawson G (Frances) ins agt Liberty Nat Life Ins Co r 1520 2d Massey E Carroll shpg elk C of Ga Bkg Co r Milledgeville rd Massey Edmond C (Jewell) slsmn C of Ga Bkg Co 1105 Walnut Massey Eva r 101 Peachtree Massey G T ins agt Liberty Nat Life Ins Co r 1520 2d Massey Harry dental tech Dixie Dental Lab- oratory r Miller Field rd Massey Hattie F (wid J B) h 234 (7-8) Clinton Massey Henry A (Evelyn) agt Met Life Ins Co r 2403 2d Massey Herman B (Minnie L) tex wkr Bibb Mfg Co h 10 Schell (EM) Massey Ida M r 29 (77) Randolph pi Massey Irvin B (Willie) h 627 Main (EM) Massey J Morgan (Martha) slsmn r 165 Cherokee Massey J Preston (Mary L) tex wkr Bibb Mfg Co h 214 (60) Clinton Massey J Rufus hlpr r 1016 Ash Massey Jodie (wid H B) r 476 College apt 10 Massey Jos B (Lucky Strike Bowling Alleys) h 476 College apt 10 Massey Malachi (c; Annie) 1 lab Atlantic Ice & Coal Co h 1433 Broadway Massey Mary (c) 2 h 1221 Reynold al Massey Mary L (Mrs J P) tex wkr Bibb Mfg Co r 214 (60) Clinton Massey Minnie (Mrs Herman) tex wkr Bibb Mfg Co r 10 Schell (EM) Massey N Roy elk Alf Macks Pharm Inc r RD 6 Massey Nathl W b'kpr Jake H Wilensky Leath- er Co r 165 Cherokee Massey Ralph (Hazel) 6 tex wkr Payne Mill h 311 Fairmont (B) Massey Wm W (Alma) 1 dispr C of Ga Ry h 102 Holmes Masten Lovie L (c) r 8 Chestney Masten Toysie (c; Corinne) porter Plum St Serv Sta h 784 Reynolds al Master Plumbers Association of Macon T L Wood pres C V Millirons vp H F Roller sectreas meets Tuesday nights at 8 p m 512 1st Masters Waring R (Nannette) (Shorty's Place) h 3105 Houston (SM) Matheny James A (Ruth M) 1 slsmn C-M-P Drug Co h 635 Vineville (V) Matherson Edw (c; Clara) 1 lunch rm 302 Telfair h 123 Army Lot 1935 Macon City Directory 315 Mathes James A (Virginia) slsmn r 686 College Mathes Lewis (c) orderly Oglethorpe Private Infirmary Mathes Mabel (c) maid W L Huff r 326 Calhoun Mathews Adeline (c) cook J H Whitehead r 601 (269) Prince (SM) Mathews Arth (c; Annie) lab Carling Tile Co r 359 HBjZcI Mathews Chas (c; Millie) 4 h 320 Hammond Mathews Clara B (c) h 406 (150) Bartlett Mathews Cora slswn The Dime Store r 204 Center (EM) Mathews Descena (c) r 115 Moccasin Slide Mathews Donald elk Mulberry Mkt r 204 Center (EM) Mathews Dorothy student r 315 Buford pi (V) Mathews Emma J r 455 Carling Mathews Erma nurse 436 Carling r do Matthews Etna D Mrs tchr Bellevue Sch res Walden Ga Mathews Garfield (c; Bertha) swtchmn GS&F RR h 11 Cheatham al Mathews J Mae (c) v/aitress I L Cobb Mathews J Northrop (Helen) 2 mach C of Ga Ry h 109 (107)3 Log Cabin Mathews J Wm r 109 (707) Log Cabin dr Mathews James (c) r 406 (150) Bartlett Mathews James M mgr Eastern Air Transport Co r 328 Buford pi (V) MATHEWS JAMES W C (Myrtice L) (o), Sec-Treas A T Holt Co, h 328 Buford pi (V) Tel 4075-J Mathews Lemuel F (Janie) 3 city firemn h 204 Center (EM) Mathews Lillian student r 204 Center (EM) Mathews Rebecca (c) cook B S Russell r 642 4th (WH) Mathews Thos E printer Macon Teleg Pub Co r 717 1st Mathews Thornton L (Louise D) 1 (o) trav slsmn h 315 Buford pi (V) Mathis Addie (c) dom E H Branan r 303 Womack Mathis Alice (c) maid Macon Hosp r 126 (125) Shamrock Mathis Amanda (c) r 6 Berthadale dr (V) Mathis Bertha emp Macon Cafeteria r 1921 2d Mathis Buford elk Fenner & Beane r 400 Vineville Mathis Carl C (Hazel) batterymn Chapman's Garage h 467 Hazel Mathis Carrie (c) dom r 115 May Mathis Chas (c) r 363 Monroe (V) Mathis Chas P formn So Ry h 1921 2d Mathis Claude (c; Nettie) 3 h 820 Elbert Mathis Danl (c; Louise) 1 atndt Bob Steven's Serv Sta r 103 (212) Peacock Mathis Dock (c; Wilile M) lab h 505 (504) Martha Mathis Edw (c; Alice) 3 lab Willingham Mills h 126 (125) Shamrock Mathis Edw (c; Annie) 1 ydmn h 365 3d (U) Mathis Edw Jr (c) r 365 3d (U) Mathis Eliz (c) student r 152 Fulton Mathis Floy (c) cook L N Snyder r 111 Rose Crest Mathis Frank (c) r 126 Green Mathis Frank (c; Louise) 5 shoe repr r 341 2d (V) Mathis Hattie (c) cook r 501 Edison Mathis Hazel (Mrs C C) cash Union Dry Gds Co r 467 Spring Mathis Henry (c; Mary) 5 h 117 Sapp (U) Mathis Henry (c; Irene) cook Macon Cafeteria h 355 Boardman's al Mathis James (c; May L) pntr h 131 (20) Frank al Mathis John (c) elk Jos Berg r 235 Middle (V) Mathis John (c) student r 506 (708) Camp- bell (SM) Mathis Jos (c) r 100 Phillips la Mathis Katie M (c) r 110 (158) DeBorde (SM) Mathis Lula M (c) 1 r 141 e Ell Mathis Mary (c) emp Bibb Mfg Co r 117 Sapp (U) Mathis Mary L (c) emp Snow's Ldry h 505 Moore Mathis Mary L (c) maid A D Schofield r 131 (20) Frank al Mathis Obie (c) r 506 (708) Campbell (SM) Mathis Oline (c) 1 r 642 4th (WH) Mathis Rebecca (c) 3 h 1335 Broadway Mathis Rebecca (c) dom r 642 4th (WH) Mathis Robt (c) r 132 Pecan Mathis Robt (c) r 365 3d (U) Mathis Robt L (c) r 101 (100) Adams Mathis Saloanie L (c) r 505 Moore Mathis Susie (c) r 608 4th (V) Mathis Wiley (c; Annie M) 1 lab C of Ga Ry Creosote Plant h 150 (147) Sycamore (V) Mathis Wm (c; Hattie M) lab Bibb Mfg Co h 203 Patterson Mathis Wm L (c; Katie) 6 (o) gro 325 Monroe (V) h 363 do Mathis Wm M (c; Mentrous) 3 emp Atlantic Ice & Coal Co h 110 (158) DeBorde (SM) Matson Joyce r 823 Patterson Matson Robt G (Willin) 1 credit mgr Goodrich Silvertown Stores h 823 Patterson Matthew Claude A emp C of Ga Ry r 221 Jones (EM) Matthew Oeo (Dorothy) 2 formn Morris Putzel Inc h 248 Church Matthew Grace r 221 Jones (EM) Matthew John A (Jennie) (o) supt Macon Mill- ing Co h 221 Jones (EM) Matthew Newton r 221 Jones (EM) Matthew Paul (Marie) electm Morris Putze! Inc h 230 Jones (EM) Matthews Allen R Jr trav slsmn r 221 Coleman Matthews Anna (c) maid C F Petzinger r 243 3d (V) Matthews Arth (c) cook 140 Georgia Matthews Arth L (c) r 728 (628) Prince (SM) Matthews Betty r 415 Winship Matthews Beulah (c) cook S A Elkan r 103 (100) Thomas (EM) Matthews C Mason (Era I) 2 (o) agt Bankers H&L Ins Co h 576 Boulevard (NH) Matthews Clarence M Jr student r 576 Boule- vard (NH) Matthews Cobb student r 108 Corbin (V) Matthews Curtis B (Marian) 3 shpg elk A G Rhodes & Son r,311 Johnson Matthews D W mgr Woolworth's r 110 Bu- ford pi Matthews Dolly sch tchr r 221 Coleman Matthews Eldredge G tex wkr Bibb Mfg Co r 661 Walnut Matthews Eliza (wid M M) r 415 Winship Matthews Emory C (Helen H) 3 asst sec-treas City Bd of Water Comrs h 123 Nottingham dr Matthews Ernest (c; Annie) 4 emp Birdsey Flour Mills h 173 Lincoln (V) Matthews Eunice (c) 1 dom Sara Simpson r 859 Broadway Matthews Evelyn (c) maid J J Connell r 512 Fort Hill Matthews Evelyn A sten r 309 Johnson Matthews F Theo (Margt M) asst mgr Citizens Loan Co h 356 New apt 4 346 Baldwin's and Telegraph's Matthews Fannie sch tchr r 221 Coleman Matthews Flossie (e) maid Josephine Middle- brooks r 173 Lincoln (V) Matthews Frances student r 143 Rose pk Matthews Frank B (Emma) r 1014 Ash Matthews Geo (c; Beulah) hlpr Gibson Vine- gar Wks h 103 (100) Thomas (EM) Matthews Gladys (c) 5 r 114 Morris (B) Matthews Hardy Mrs slswn Dannenberg's r 143 Rose pk Matthews Henry (c) lab Atlantic Ice & Coal Corp r 872% Hazel Matthews Isaac (c; Ruth) emp C of Ga Ry h 628 4th (WH) Matthews J Oscar (Daisy) emp Taylor Iron Wks h 107 (266) Pearce Matthews Jack student r 108 Corbin (V) Matthews James W (o) cbntmkr Macon CKnt Wks h 309 Johnson Matthews James W Jr (Lennie) (o) dept mgr Huckabee Auto Co h 506 Beech Matthews Jetta (wid J D) h 717 1st Matthews John msngr W U Teleg Co r 560 Arch Matthews John A (Merle) 1 slsmn h 838 Win- ton Matthews John B (Ruth) 1 asst cash Am Bak- eries Co h 710 Pine Matthews John N mach C of Ga Ry Matthews John T (Anna L) (o) emp So Cotton Oil Co h 108 Corbin (V) Matthews Kenneth r 720 1st Matthews L C (c; Elnora) 1 hlpr Carling Tile Co h 109 Johnson (SM) Matthews Lillian C Mrs bkpr Standard Brick & Tile Co r 116 Seminole Matthews Lula (c) cook W J Massee r 217 Roosevelt (V) Matthews Maggie (c) r 855 Willow Matthews Margt S (wid B B) (o) h 710 An- derson (SM) Matthews Margt Mrs beauty opr Union Dry uds Oo Matthews Margt (o) tchr Lanier High Sch for Girls h 221 Coleman ^ 221 ColemMaanrtha tchr Chas H Bl-uce Sch r Matthews Martha (c) maid Wesleyan Conserv- atory r 364 Elm Matthews Mary (wid P W) (o) h 110 Crisp Matthews sey la Mary (c) 2 lndrs h 154 (701) Guern- Matthews Ruth (Mrs J B) opr So Bell Tel Co r 710 Pine Matthews Sami (c) r 103 (100) Thomas (EM) Matthews Willie L (c) r 728 (628) Prince (SM) Mattox Buford Mrs opr Happ Bros Co r 407 Walnut Mattox R S emp Greyhound Lines r Central Hotel Mattricks Sallie (c) lndrs h 958 Ocmulgee Mauldin John D h 103 Putnam (Clara) (SM) 2 (o) emp C of Ga RJy Maund Edna F r 203 1st Maund John (c) solr h 108 Franklin Maund Lydia C r 456 Center (EM) Maund Mary (e) r 108 Franklin Maund Sarah F (wid A P) (o) h 456 Center (EM) Maund Wessie V sten h 203 1st Mauney John T (Maggie) r 174 Palace (B) Maxey Geraldine elk Newberry's r 314 Winship Maxey Henry E (Bertie) 1 rep Macon Better Hsg Program h 314 Winship Maxey Lewis E electrn J W Wilson Elec Shop r 314 Winship Maxwell Benj (c) lab r 935 Montpelier Maxwell Bert Jr bkpr Maxwell Bros Furn Co r 455 2d Maxwell Bros Furniture Co W G Blackwell Jr mgr 455 2d Maxwell Bros Inc C R Miller vp box mfrs ft Poplar Maxwell Chas (Ellie) 2 h 106 Emerald Maxwell Dock (c) 1 lab h 935 Montpelier Maxwell Evelyn student r 106 Emerald 44 J C Hydrolia (Ruth) 1 tex wkr Bibb Mfg Co h Maxwell James L tex wkr r 210 (57) Clinton M921i0r(L57)KaCt,lMineteonn A tex wkr Bibb MfS Co r Maxwell Louise (e) dom L E Owen r 935 Montpelier Maxwell Marvin B (Alice) 1 (o) formn C of Ga Ry h 181 Cedar (SM) Maxwell Ruth L tex wkr Bibb Mfg Co h 210 (57) Clinton May Agnes E (c) tchr Hudson High & Indus- trial Sch r 302 (303) Clark May Charity (c) cook r 862 Willow May Chas (c; Irene) h 108 (212) Green (V) May Chas Jr (c) r 108 (212) Green (V) May Dorothy Mrs 2 r 108 Whitehead Matthews Mary B (c) maid r 326 Calhoun Ss psSrir"H 01 opr Happ Bros r 406 alo^larUett} C00k r Matthews Miles E r 710 Anderson (SM) (EM)WS Naomi student r 1026 Clinton rd Matthews Pauline r 720 1st Matthew, P6arl, (,C) r 103 (100) Thomas (EM) 857 M Pearl (C) C00k Bopular Cafe r MTreIsTMVS H Bobt Matthews Sec- ^See Page goT8' Broadway- Tel Matthews Remella (wid Hugh) 1 h 560 Arch Matthews Robt A r 710 Anderson (SM) atthewSdRobt A (Lula I) (o) firemn So Ry S5LS- 106 Ac*d">' ^emy1TM18 L (Wid E D) smstrs h 106 AcadMay Ethel (c) r 1 Barnharts Bottom May Evelyn cash Burden Smith & Co r 312 Carling May Fannie (c) maid C A Yarbrough r 857 Ocmulgee May Freida r 311 Boulevard (NH) May Geo A 3 h 312 Carling May Geo A Jr student r 312 Carling May Irene (c) maid H E Burson r 108 (212) Green (V) May Louise student r 312 Carling MTinrTM gtLR^ piL^^H8 ,In(Ac>nnre11B2) 1 (>. Sec<*) Buck- May Lucius J (c; Mamie) (o) (Wage Earners Shop) h (303) Clarks (V) May Nathan D (o) printer Macon Teleg Pub Co h 311 Boulevard MCohr H8RDororhyemP & KinSman Lbr Matthews Roy L usher Capitol Theatre r 143 ^ose pk May Nathan D Jr (Amanda B) (o) accnt Buckeye Cotton Oil Co h 120 De Soto pi May Ralph E (Odessa) 1 slsmn International Shoe Co h 99 Vineville (V) apt A2 1935 Macon City Directory 347 May Sami J (Julia G) dept mgr R S Thorpe & Sons h 211 Boulevard (NH) May Thos (c; Fannie) chauf h 857 Ocmulgee Maye Jas (c) lab r 6 Harris al Mayes Lucius (c; Lillie) tr dr Bibb Mfg Co r 504 (555) Maynard Mayfield Danl (c) 1 porter Chapman's Garage r 903 Pio Nono Mayfield Isham A (Katb) h 864 Mulberry apt 5E Mayfield Julius (c; Lillian) 1 delmn T M Raines Gro Co r 924 Pio Nono Mayfield Lillian (c) maid Isaac Flatau r 924 Pio Nono Mayfield Rosa L (c) r 903 Pio Nono Mayfield Wm (c; Emma M) h 903 Pio Nono Mayham Chas S (Helen) 1 b 163 Cotton Maynard Alice (c) nurse 110 Middle (V) h do Maynard Amanda (c) h 420 (327) Straight (U) Maynard Apts 109 Washington Maynard Aurie r 316 Belmont Maynard Chas A (Maynard's Lbr & Sup Co) res RD 2 Columbus rd Maynard Elijah (c; Mary) 1 lab Claude Tra- wick Coal Co h 361 Chestnut Maynard Elijah W lawyer 403 Macon Sav Bk bldg r Central Hotel Maynard Gertrude (c) dom r 420 (327) Straight (U) Maynard Irene (c) cook K E Carswell Maynard Lavinia case wkr Macon Transient Bur r 62 Arlington pi Maynard Lena (c) maid W R Brown r 133 Ritchey Maynard Lois tchr Jos Clisby Sch r Oglesby pi Maynard Louise (c) cook L M Happ Maynard Louise tchr Alex Sch No 4 r Colum- bus rd Maynard Olivia (c) cook M L Shadburn r 204 Fargason (V) Maynard Silas (c; Amanda) 6 h 133 Ritchey Maynard Thos (c; Willie) carp h 1127 Napier Maynard Thos F (c; Julia) jan W J Grace r 806 3d (V) Maynard Victoria (wid E T) r 109 Washing- ton apt 3 Maynard Wm (c; Emma) 1 h 716 Hazel Maynard Wm G (Hazel) slsmn r 106 Rogers (V) Maynard Willie (c) maid C W Foster r 1127 Napier Mays Annie E asst librarian Mercer Univ r 1155 Ash Mays Carrie (c) cook J L Morris Mays Dena (c) cook r 103 Brooklyn (S) Mays Dollie (c) 1 r 86 Bay Mays John (c; Bessie) gdnr h 103 Brooklyn (S) Mays John C (Susie) (o) h 1155 Ash Mays Lena (c) maid G P Jones r 103 Brook- lyn (S) Mays Lillian (c) r 101 (20) Franklin St la Mays Rachel mus tchr 1155 Ash r do Mays Robt (c; Emma) h 165 Bay Mays Schley (c) r 253 North Mays Wm (c; Eliza) lab r 2 Ross St pi Mayson's S L Friedman mgr womens clo 359 3d Maze Beulah spinner Bibb Mfg Co r 839 Hazel Maze Julia Mrs 1 h 839 Hazel McAbee C Noyes (Isabelle) 1 emp Atlantic Cotton Mills h 26 Atlantic Village McAbee C Noyes Jr emp Atlantic Cotton Mills r 26 Atlantic Village McAbee Elsie r 26 Atlantic Village McAbee Georgia r 26 Atlantic Village McAbee Magnolia emp Atlantic Cotton Mills r 26 Atlantic Village McAdoo Wm (c) r 15 (8) Sparks al McAfee Candy (C O McAfee) mfrs 657 Poplar McAfee Chas O (Lucy) 3 (o) (McAfee Candy Co) h 123 Crescent (CH) McAfee Drucilla student r 102 Florida McAfee Eulah (wid J C) 1 (o) (Sou Adv Co) h 2515 Forsyth rd McAfee Jesse W (Teresa) 2 bkpr Moyer Lbr Co r 422 Johnson McAfee Linton C phys 567 Walnut r 2515 Forsyth rd McAfee Louise sten Bibb Mfg Co r 561 Hillyer McAfee Major (c) r 34 (498) White (SM) McAfee Mattie (wid ST) r 561 Hillyer McAfee Montgomery student r 102 Florida McAiee Oscar H (Frances) 1 mgr Volunteer Stores h 102 Florida McAfee Robt K (Maude) 1 (o) gro 2101 Vine- ville (V) h 175 Hendley McAlister Andrew T slsmn Taylor Iron Wks r 312 Adams McALISTER CHAS a (Fannie M) (o), Pres Taylor Iron Wks & Sup Co, h 311 (312) Adams--Tel 684 McAlister Annie Mrs 3 tex wkr Willingham Maynard's Lumber & Supply Co (C A May- Mills h 15 Randolph pi nard) 979 Montpelier McAlister Mary (c) r 108 (770) Nussbaum MAYNESS WALTER C, Supt Tomlinson Paper Box Co, r 201 Simmons McAllister Rebecca tex wkr Willingham Mills r 15 Randolph pi Mayo B Tillman (Ethel) 3 tex wkr Willingham Mills h 113 (44) Holt Mayo Ethel (Mrs B T) tex wkr Willingham Mills r 113 (44) Holt Mayo Ethel tex wkr Willingham Mills r 23 (64) Mill McAllister Robt emp Willingham Mills McAn Thom M H Dey mgr shoes 576 Cherry McArrell James T grinder The S E Optical Co r YMCA McArthur James pntr r 554 1st McArthur Louise L teller First Nat Bk & Trust Mayo Geo W (Annie) h 135 Ross Mayo Georgia (c) emp So Crate & Veneer Co Co r 354 College McArthur Lucile (Mrs P A) physio therapist r 354 Ash 353 1st r do Mayo Herman tex wkr Willingham Mills r 113 (44) Holt Mayo James '(c) 1 emp So Ry h 4 Toombs McArthur Paul A (Lucile) 1 genl sec YMCA h 353 1st McArthur Sarah sten Juliette Milling Co r 114 (SM) Mayo Mary (c) h 755 Center (EM) Coleman McArthur Thos E 1 emp C of Ga Ry r 129 Mayo Wiley (c; Ethel) 1 delmn Sami Shier h 82 (131) Forest (V) Mayo Wm r 113 (44) Holt Mayo Wm J (c; Aurelia) lab The Standard Highland McAtee Delia (wid C H) r 809% Cherry McBaine Ammie uphlstr Odom Variety Wks McBrearty Chas (Mary E) 4 barber Gerone's Tool & Handle Co r 136 Pecan Mayo Willie M (c) 5 h 124 Bright al Mays Annie (e) cook J W Wynn r 215 (216) Barber & Beauty Shop h 216 College McBrearty John elk Busy Corner Lunch Rm r 849 Pine Cedar (U) McBrearty John F (Margt) (o) elk h 849 Pine 348 Baldwin's and Telegraph's McBride Almeta F (c) cash Afro-Am Life Ins McCarthy Belvin (c) delmn Ivey-Turner Ice Co r 221 (134) Grant (V) Cream Co r 129 Wood al McBride Alonzo (c; Mary) h 1310 Broadway McCarthy Clarence (c; Clifford) (o) lab h 263 McBride Archie (c; Eliz) h 514 Elliott 3d (V) McBride Bemon G (Ethel L) 3 (o) meat ctr McCarthy Gordon (c) (o) lab C of Ga Ry h 548 Piggly Wiggly h 332 Hanson (SM) Hazel McBride Chas P (Trudie) 1 tex wkr Payne Mill McCarthy Henry (c; Mary) 1 soft drinks 459 h 46 Brigham (PM) Clinton h 474 do McBride Eliz W (Mrs J E) tel elk W U Teleg McCarthy John F (Florence C) bus opr h 417 Co r 412 Napier Cleveland (SM) McBride Elnora (c) h 221 (134) Grant (V) McCarthy Joseph A (Eleanor E) 3 mech C of McBride Howard (c) r 717 Dempsey Ga h 127 High McBride Howard G (c) carp h 315 Forest (V) McCarthy Raymond A (Gwendolyn) 1 emp McBKIDE JOHN E (Eliz) (o), Sec-Treas The Buster Btlg Co h 94 Osborne pi (I) Dannenberg Co, h 412 Napier--Tel 2528 McCarthy Reddick (c; Mary) h 323 Green McBride Letha (wid J M) r 412 Napier McCarty Chas (c) (o) h 1113 (222) Woolfolk McBride Rheta (c) maid C A Smith r 227 McCarty Guy S (Opal) 1 linemn So Bell Tel Norris Co r 620 Pine McBride Robt E printer Murray Printing Co McCary Donald M (c; Rosa L) emp Ga Power McBride Sidney (c; Laura) 1 lab S E Com- Co h 618 Monroe (V) press & Whse Co h 128 (227) Norris McCary W Porter (c; Leola) h 927 Clinton rd McBride Wm formn So Ry r RD 1 McCaskill Alex student r 708 Napier McBride Wm R (c; Mamie) 3 (o) carp h 1717 McCaw Dellie R (Mrs J N) tchr Wesleyan Dempsey Conservatory r 274 Georgia McBryant Obbie L elk FERA r 553 Hemlock McCaw Eliz R slswn C D Kenny Co 274 McCahill Tinus soft drinks 2314% 2d r 2998 Georgia Houston McCaw James N (Dellie R) (o) agt Mut Life McCaleb Dee (Myrtice) 3 (o) signmn C of G Ins Co of N Y h 274 Georgia Ry h 214 Log Cabin dr McCaw Mary D tchr Lanier High Sch for Boys McCall Carrie (c) 2 h 138 1st (V) r 274 Georgia McCall Elsie Mrs 2 r 204 Washington McChesney Willie M Mrs opr Happ Bros Co McCall James F (Thelma) r 155 1st r 119 Plant (SM) McCall John P (c) emp Nehi Btlg Co 1032 McClain Fate (c) (o) brklyr h 469 Edison Broadway McClain John (c; Florie) 3 h 207 3d (B) McCall Joseph (c) barber Brown's Barber Sho r 272 3d (V) McCall Mary (c) dom A R Rozar r 403 Taylc McCall Penny (c) (o) h 406 Short (EM) McCall R Wm (Josephine) r 250 Washingto McCall Robt (c; Rosa) (o) carp h 502 (52C McClain Lilly (c) 2 emp Bibb Mfg Co h 205 3d (B) McClain Marie (c) Indrs Crescent Ldry McClamroch earner B (Jeannye) store mgr Goodrich Silvertown Stores h 118 Oak Haven Maynard McClanahan Geo A (Leonar) carp h 626 McCall Thelma (Mrs J F) sten Frank Robert r 155 1st Church (CH) McClanahan Lester (Etta) emp Happ Bros Co TMMCc2Caa!l!l LWemsley(c; (cM; aCryo)ra)1 1(0l)abbh'ar2b2e5r B5trhow(nV' r 452 Elm McClanahan Paul (Mattie L) 1 tr dr r 304 McAC1a1'l,1l?6u1m' Shop h Alma 403 opr HTaapyplorBr(oEsMC) o res Moran Ga Bailey McClanahan Trevie M (wid J F) 2 r 213 Car- ling MMontpTlterHubert emp Colbert Mfg Co r 70 McClary Lawrence (c; Mary) porter Mulberry Mkt r 321 Middle (V) McClary Mary (c) cook r 321 Middle (V) W1"mlh H C " McClary Mary (c) cook J E Tappan r 321 B," Bo',y * F"as M McCloud Adam (c) delmn Nipper's Pharm r 809 Edgewood McCloud Armenda (c) r 104 (4) Wise (V) McCloud Blanche (c) 3 maid Chas H Bruce Sch r 809 Edgewood McCloud Kimbrough sta atndt Tank Car Serv Sta r 544 Forsyth McCloud Washington (c; Annie) 1 lab h 482 Chestnut McClung Plinnie J (Florence) 3 bus opr Ga Power Co h 1240 College McCLURE ANDREW W (Julia D) (o), Pres- Treas McClure Ofc Equipment Co, h 110 Cleveland (V)--Tel 963 McClure Elmer tex wkr Bibb Mfg Co r 740 Oglethorpe McClure Francis M (Mary E) 1 elk Ry M S h 116 Clayton (V) McClure John W (Mattie) r 1310 3d McCLURE OFFICE EQUIPMENT CO, Andrew W McClure Pres-Treas, Chas W Baldwin Vp, Russell F Briggs Sec, Office Supplies and Equipment, 560 Mulberry--Tel 903-904 (See side lines and page 94) McClure Robt E (Edith O slsmn Industrial Life & Health Ins Co r 854 New McCluskey Rebecca (wid J D) r 5001 (4041) Houston McCluster G Mack (c) r 318 Edgewood McCluster Shote (c; Maggie) 2 lab h 318 Edgewood McCluster Thos (c) r 318 Edgewood McCollum Anna (c) h 112 6th (B) McCombs Lovely (c) 1 (o) h 155 Middle (V) McCombs Sami T (c) shoe repr Economy Shoe Reprs & French Dry Clnrs r 155 Middle (V) McCommon Alma J (Mrs J C) bkpr City Bd of Water Comrs r RD 2 Bloomfield rd McCommon Bros G W McCommon pres J C McCommon vp R L McCommon sec treas dept store 456 3d and 466 Mulberry McCommon Geo W (Rebecca R) (o) pres-mgr Atlantic Cotton Mills & pres McCommon Bros h 196 Buckingham pi McCommon J Clarence (Alma) vp McCommon Bros res Bloomfield rd McCommon Jewett slsmn G R Kenney & Co Inc r 471 Orange McCommon Lavonia r 419 Montpelier Giles h do McConnell H Harold (Maxine) formn Independ- ent Ldry Co r 605 Carling McConnell Harriet (Mrs Reynolds) slswn Bur- den Smith & Co res RD 2 McConnell Irene waitress Betsy Ross Coffee Shop r 855 Mulberry apt 107 McConnell Lincoln (Laura B) state dir Nat Re- employment Serv 223 Boulevard (NH) McConnell Odessa S (Wid H H) (o) slswn h 605 Carling McConnell Reynolds (Harriet) (o) h 425 Bur- ton McConnell Thos H (Vissie) (o) h 605 Main (EM) McConnell Willie M (wid B T) 1 (o) gro 607 Main (EM) h 606 do McCook C B lino opr Lyon, Harris & Brooks res Lizella Ga McCook Clyde F (Tressie I) 6 (o) (The Red Front) confr 117 5th (SM) McCook D Oscar (Kath R) 3 (o) emp J W Mc- Cook Lbr Co h 437 (403) Forest (V) McCOOK J W LUMBER CO (James W Mc- Cook) Ash nr Broadway--Tel 4177-4178 McCOOK JAMES W (Essie) (o) (J W McCook Lbr Co), h 520 College--Tel 1609 McCook James W Jr emp J W McCook Lbr Co r 520 College McCook L E mech Cliff Walker Co res Lizella Ga McCook Lula (wid A J) h 119 5th (SM) McCook Melvin (Grace) emp Bibb Mfg Co r 654 Elm McCook Newsome slsmn Empire Furn Co r 135 Highland McCook Vera (wid V V) hsekpr 373 Clinton r do McCord C Rudisill Jr elk McCord Used Auto Parts r 108 Crumps Pk McCord Cajah R (Willie M) (o) (McCord's Used Auto Parts) h 108 Crumps Pk (CP) McCord Carrie (c) 1 r 138 1st (V) McCord Carolyn F (Mrs W F) 1 tchr Lanier High Sch for Boys r 205 Hines ter (V) McCord Chas R (Hattie) (o) h 220 Hines ter (V) McCord Chas R Jr (Laura) 1 (o) chem supv Procter & Gamble Mfg Co h 215 Hines (V) McCord Christine (c) r 138 1st (V) McCord Ethel Mrs 2 tex wkr Willingham Mills h 102 (341) Green (V) McCord Frank (c; Mollie) porter Worsham & Sherrill r 131 Gibson McCord Green (c; Mae) waiter Dempsey Hotel r 231 3d (V) McCord J Alf (Fannie) 1 h 12 Randolph pi McCord John S (Lawson M) asst sis mgr R A McCord Mtr Co h 99 Vineville (V) apt F3 McCord John W student r 220 Hines ter (V) McCord Joseph C (c; Polly) 2 barber Jack Shef- tall h 302 North (V) McCord Marjorie E student r 108 Crumps Park (CP) McCord Martha r 396 (405) Suwanee McCommon Rebecca R (Mrs G W) sec-treas McCORD R A MOTOR CO, Robt A McCord Atlantic Cotton Mills r 196 Buckingham pi Pres, Robt A McCord Jr Vp, Loraine Zellner McCommon Robt L (Lessie) 2 (o) sec-treas Sec-Treas, Distributors for Ford and Lincoln McCommon Bros h 501 Beech Motor Cars, 215-21 2d--Tel 11 McCommon Rosa (Mrs J A) slswn McCommon Bros r 471 Orange McCommon Sarah R (wid Clayton) (o) h 419 Montpelier McCORD ROBT A (Rose), Pres R A McCord Mtr Co, h 221 Georgia--Tel 140 McCORD ROBT A JR, Vp R A McCord Mtr Co, r 221 Georgia--Tel 140 350 Baldwin's and Telegraph's McCord Used Auto Parts (C R McCord) 671 Broadway McCord Wm E (Zula B) condr MD&SRR h 396 (405) Suwanee McCord Winifred r 396 (405) Suwanee McCord Zula B (Mrs W E) policewn CPD r 396 (405) Suwanee McCordle Janies r YMCA McCorkle Wm T r 106 (203) Grand (B) McCormack John E (Johnnie) formn So Ry h 314 College McCormack Lillie (c) (o) cook h 225 Orange McCormack Minnie (wid A P) h 308 Jones (EM) McCormick Deering Store International Har- vester Co of America F J Morgan mgr 660 Broadway McCormick Ezekiel (c) r 100 (144) Elizabeth (SM) McCormick Frank (c) hlpr Standard Oil Co r 151 Franklin McCormick John (c; Alice) h 293 2d (V) McCormick Julius B pressmn J W Burke Co r 122 Cedar McCormick Leon (c) emp Buckeye Cotton Oil Co r 807 Elbert McCormick Mary (e) cook Wesleyan Conserv- atory r 151 Franklin McCormick Mary (c) maid r 100 (144) Elizabeth (SM) McCormick Sami (c; Mary) emp Buckeye Cot- ton Oil Co h 100 (144) Elizabeth (SM) McCowan Aurelia (c) maid Eden Taylor Jr r 324 1st McCowan Mamie Mrs (o) h 724 Napier McCowell Lizzie smstrs h 621 Pine McCowen Albert I (Frances) elk Bibb Mfg Co r 62 Arlington pi McCowen Clarence D (Lena M) (o) dept mgr J N Neel Co h 359 Orange McCowen Geo S (Doris) 4 (o) slsmn h 708 Courtland McCowen James C (Ada D) (o) meter reader City Bd of Water Comrs h 115 Calhoun McCowen James C Jr (Alma) 1 mech R A Mc- Cord Mtr Co r 115 Calhoun McCowen Richd B (Margt) 4 (o) lawyer 601 Grand Bldg h 805 Mikado McCowen Roy N (Alta V) 2 (o) condr Co of Ga Ry h 102 St James (SM) McCoy Beulah (c) r 620 Spring McCoy Cath (c) student r 451 e Academy (EM) McCoy Clarence (c) r 111 Wyche McCoy Collins W elk C A Couch r 269 Maple McCoy Florence (c) ins agt h 620 Spring McCoy Frank (c; Mollie) 2 h 134 e Ell McCoy Green S (Viola) tex wkr Bibb Mfg Co h 758 Oglethorpe McCoy Gus (c; Rena) r 115 Armond McCoy Jack (c; h 612 4th (V) Annie) 1 elk C-M-P Drug6 Co McCoy James D (c) r 104 (4) Orchard McCoy Joseph (c; Mattie) barber r 272 3d (V) McCoy Julia student r 269 Maple McCoy Julius (c) porter r 620 Spring McCoy Leroy (c; Josephine) 2 porter B A Joiner h 260 Madison (V) McCoy Louise r 132 Knott (SM) McCoy S Julia h 715 2d McCoy Sami (c; Sereatha) 1 emp Cherokee Brick Co h 2118 Wyches al McCoy Viola (Mrs G S) tex wkr Bibb Mfg Co r 758 Oglethorpe McCoy Walter R (Bessie) 1 blrmkr C of Ga Ry h 556 Ocmulgee McCoy Willie M (c) r 115 Moccasin Slide McCracken Lula (c) cook Ruth Tanner r 1017 Edgewood McCranie Helen opr Lueree Beauty Shop r 821 Cherry McCranie Ulmer B waiter The Cherrio r 852 New McCrary Alex (c; Nora) 3 h 102 (85) Craft (V) McCrary Bennie (Mrs F D) beauty shop 127 Lawson r do McCrary Chas H (Mary) 1 emp R A McCord Mtr Co h 250 Hardeman McCrary Chas J (c) hlpr r 1129 Broad McCrary Dennie L (Marguerite) h 303 Jeffer- son McCrary DeWitt (Dora L) (o) (DeWitt-Mc- Crary Drug Co) h 304 Hydrolia McCrary DeWitt Drug Co Inc A P Balkcom mgr 336 Main (EM) McCrary Easter (c) cook J T Dent r 114 TEtndJl McCrary Eliz (wid A J) h 804 Elm McCrary Ella (c) h 316 Division St la McCrary Ella emp Nat Pecan Mkting Assn r 1017 Hazel McCrary Elmer (Lillian) 2 h 2020 Broadway McCrary Elsie (c) cook W M Murphey McCrary Ethel (c) r 14 (131) Malloy's al McCrary Fannie r 276 Willingham McCrary Felton D (Bennie C) 2 h 127 Lawton McCrary Geo (Anna) r 276 Willingham McCrary George D (Mary M) 1 gro 421 Monroe (V) h 480 Grange McCrary Henry M (c) r 218 Woodliff McCrary Herbert (c) r 400 (401) Colquitt McCrary James (c; Mary) h 206 Harris McCrary Jos (c; Lizzie) lab r 203 Yates al McCrary Josephine (c) h 915 Ash McCrary Julia (c) 3 h 527 (6) Grant Chapel al McCrary Julia r 668 1st McCrary Lela (c) emp So Crate & Veneer Co r 206 Harris McCrary Lena M slswn Dannenberg's r 456 Walnut McCrary Lily M (c) lndrs r 107 (355) Spring la McCrary Lizzie (c) r 113 Linden McCrary Louise (c) 4 h 5 (458) Steins al McCRARY LUTHER A (Clyde W), Sec-Treas Hatcher & McCrary Inc r Southland Hotel-- Tel 3047 McCrary Margt r 276 Willingham McCrary Marguerite (Mrs D L) sten Otis Elev Co r 303 Jefferson McCrary Mary (Mrs G D) sten Harris, Russell, Popper & Weaver 480 Orange McCrary Mary E Mrs mgr Suzanne Hat Shop r 250 Hardeman McCrary Mattie smstrs r 804 Elm McCrary Minus (c; Mary) emp C of Ga Ry h 1129 Broad McCrary Nolan (Winnie) 2 (o) slsmn C-M-P Drug Co h 717 Date McCrary Robt r 804 Elm McCrary Robt (c; Lula) lab h 505 Monroe (V) McCrary Rollie B (Frances) 2 h 2169 2d McCrary Rosa r 304 Hydrolia McCoy Sarah (wid D W) 1 h 269 Maple McCrary Wanzie (c) student r 114 Tatnall MWcheereatha (C> maid Macon HosP r 2118 McCrary Willard L (Lillian) 2 pntr h 1917 Hazel McCoy Simon (c; Mary L) (o) lab h 209 Mid- McCrary Wm B (c) delmn r 114 Tatnall dle (V) ' McCrary Willie B (c) lab r 5 (458) Steins al 1935 Macon City Directory 851 McCray James (c; Susie) 1 lab Procter & Gamble Mfg Co h 137 Hazel McCray Littleton (c) r 518 Calhoun McCray Mary (c) 1 (o) sausage linker T&T Pkg Co h 210 Tindall (SM) McCrea Wm K (Clyde G) (o) h 110 2d McCreary Grace (c) cook C B Hatthews r 114 Tatnall McCreary John J (Teresa L) 3 (o) lawyer 353% 3d h 753 Hemlock McCreary Wm T (Sadie) (o) gro 1002 Ogle- thorpe h 126 Appleton McCreary Wm T Jr elk W T McCreary r 668 1st McCrewell Emmett (c) bus boy DeLuxe Cafe r 453 Arch McCrey Albert (c; Emily V) (o) emp MD&S RR h 234 (138) Cowan McCrey Emily V (c) dir City Playgrounds r 324 (138) Cowan McCrimmons Lester M (Myrtle) 2 h 110 Em- ory (SM) McCrorey Lawrence (c) pastor Washington Av Presbyterian Ch r 236 2d (V) McCrum Robt W (Isabel) 3 ofc engr State Hwy Bd h 128 Buford pi (V) McCuen J Vasco (Edna) 5 h 120 Piedmont (SM) McCullough Edw L (Eula) 1 h 1710 2d McCullough Eula (Mrs E L) opr Happ Bros McDaniel Lonnie (Gladys) 3 (Mack's Place) h 121 (115) Colquitt McDaniel Mackie L (Estelle) (o) emp C of Ga Ry h 213 Applewood McDaniel Ophelia (Mrs J A) (McDaniel Hdwe Co) 205 College pi McDaniel Oscar L r 1241 College dr McDaniel Oscar P (Avaleen) 1 patrolmn CPD h 720 Pine McDaniel Oscar P Jr student r 720 Pine McDaniel Susie tex wkr Payne Mill r 122 Comer ter (PM) McDaniel T Fincher interne Macon Hosp r do McDaniel W A mach C of Ga Ry Creosote Plant r 1906 (r) Vineville (V) McDaniels Chas A (Mary F) emp C of Ga Ry h 305 Newberg (SM) McDermott Sarah W (wid W L) h 206 Ruther- ford (SM) McDonald Annie (c) r 325 3d (V) McDonald Chanie M (c) maid Wesleyan Con- servatory r 210 Middle (V) McDonald Donald (Frances D) 1 teleg ed Macon Evening News h 190 English McDonald Eliza (c) h 257 4th (V) McDonald Eunice I student r 1001 Napier McDonald Gordon L (Viola) elk Gulf Refining Co h 808 Hemlock McDonald Howard (c; Mary) 4 h 214 Plant (SM) Co r 1710 2d McCullough Francis C dep sheriff Municipal Ct res Recreation pk McCullough Geo R (Marie) mech Huckabee Auto Co r 558 Hemlock McCullough Howard (Lushion) 4 h 300 Cen- ter (EM) McCullough Hulett (Naomi) formn C of Ga Ry h 713 Main (EM) McCullough James C (Emma) 3 (o) emp C of Ga Ry h 606 Holt McCullough James C Jr (Jimmie) 1 elk C-M-P Drug Co h 659 1st McCullough Joel S (Mary R) 3 slsmn h 1083 Walnut McCullough Louise sten Huckabee Auto Co r 327 Hanson (SM) McCullough Lucy (wid C T) (o) h 327 Han- son (SM) McCullough Matilda (c) cook W W Wynn McCullough Ruby slswn r 1710 2d McCullough Ruth r 327 Hanson (SM) McCune John (Susie) h 1541 1st McDaniel Estelle (Mrs M L) opr Happ Bros Co r 213 Applewood McDaniel Fannie tex wkr Payne Mill r 122 Comer ter (PM) McDaniel Florence spinner Bibb Mfg Co McDaniel Fred M (Ward's Bar-B-Q PI r 906 Napier McDaniel Hardware Co (J A & Mrs Ophlia McDonald Jack B (Lucy) hlpr Macon Gas Co r 202 Coleman McDonald Jacob student r 130 Cleveland (V) McDonald James F (Esther) 3 h 240 Washing- ton McDonald John W (Dora M) 3 swtchmn So Ry h 314 Plant (SM) McDonald Jos P r 911 Cherry McDonald Lucy (Mrs J B) dist sec County Re- lief Admn r 202 Coleman McDonald Mary (c) cook r 214 Plant (SM) McDonald Mason B (Pattie) elk h 131 High McDonald Mildred L r 127 James (LCHts) McDonald Ruth C (wid T W) 1 opr Adams Mfg Co r 611 Duncan McDonald Sami H (Eunice E) electrn City Elec Dept h 1001 Napier McDonald Sami S student r 1001 Napier McDonald Susie (c) r 311 (114) Smith (EM) McDonald Vera (c) lab C of Ga Ry r 104 Empire (V) McDonald Vernon E (Ruth) 1 emp Com Bar- ber Shop h 112 (108) Pineview McDonald Viola (Mrs G L) emp Heard Bros r 808 Hemlock McDonald Wm H (Ruth R) 5 carp h 279 Ruth- erford (SM) McDonald Wm T (Dirlie S) h 127 James (LCHts) McDonnell Maude r 135 Dixie McDONNELL PETER REV S J Pastor St. McDaniel) 462 Poplar McDaniel Harmon C (Mabel) 2 pharm Gloss' Pharm h 252 Oakland McDaniel Henry V (Mabel) 1 mech C of Ga Ry h 104 Buena Vista Joseph's Ch, h 814 Poplar--Tel 1428 McDonnell Raymond M emp C of Ga Ry r 1921 3d McDonell Roy H elk E W Tipton r 135 Napier McDonnell Teresa (wid J M) (o) h 1921 3d McDaniel J Bruce (Jewel) wtchmkr S L Orr Co McDonnell Wm S (Mishie) 2 emp C of Ga Ry h 317 Vineville (V) h 135 Dixie McDaniel J Robt (Edna) 2 h 127 Wililams (SM) McDougald Geo R )Luna) 2 tex wkr Payne Mill h 179-80 Gardner (PM) McDaniel J Thos (Dollie M) 3 (o) metal wkr h McDougald Kathleen tex wkr Payne Mill r 106 Mill 179-80 Gardner (PM) McDaniel Joseph D (Betty) 2 r 127 Williams McDougald Lamar tex wkr Payne Mill r 179 (SM) 80 Gardner (PM) McDaniel Julius A (Ophelia) (o) (McDaniel McDougald Ralph tex wkr Payne Mill r 179-80 Hdwe Co) h 205 College pi Gardner (PM) 352 Baldwin's and Telegraph's McDougald Thelma tex wkr Payne Mill r 17980 Gardner (PM) McDow Mary L (c) 4 r 100 Forest (V) McDow Wyatt (c) chauf A R Rozar r 100 Forest (V) McDowell David (c; Viola) presser Porters McElroy Jessie (c) 2 cook Willie M McConnell h 107 (907) Pringle McElroy Margt tchr Burke Sch r 201 Buford pi (V) McElroy Maude E elk Prudential Ins Co r 22 Progress Dry Cleaning Co h 115 Woodliff McDowell Evalan tchr Jos Clishy Sch r 100 McElroy Nathan B (c) student r 107 (907) Pringle Vineville McElroy Sarah tchr Whittle Sch r 15 Progress McDowell John (c; Mattie) hlpr Power Oil Co McElroy Virginia sch tchr r 201 Buford pi (V) r 408 e 2d (EM) McDowell Lucius L (c) hlpr r 408 e 2d (EM) McElroy Walter (c; Lillie) emp Hotel Dempsey r 112 Pringle McDowell Louise (c) h 453% Bay McElroy Wm J (Emma) h 15 Progress McDowell Sarah B (c) cook J L Owings r 408 e 2d (EM) McElveen Wm C (Lillian) 1 slsmn h 261 Georgia apt B2 McDowell Sophia (c) r 416 Glen McDowell Viola (c) maid B K Henderson r McElWee Pearl (wid C J) h 808 3d McElyea John (Ollie) formn Macon Cooperage 115 Woodliff McDuffie Bernice emp Carling Tile Co Co r 1538 2d McEver H M formn Ga Hwy Exp Inc r 556 Pine McDuffie Ella nurse 321 Orange r do McEvoy Margt r 926 College McDuffie Janie (Mrs W P) elk FERA r 419 Beech McEvoy Wm (c; Annie C) h 310 Middle (V) McFadden Richd A (Mary L) 3 auto mech 2104 McDuffie Nathan J (Mildred L) drftsmn r 378 Vineville (V) h 2110 (r) do Orange McFarland James F (Margt) (o) slsmn Burden McDuffie Walter B (Janie) flgmn C of Ga Ry Smith & Co h 787 Holt h 419 Beech McFarlin James (c) delmn Bibb Poultry Co McDuffie Wilbur E (Villa) 1 (o) condr So Ry r 107 3d (U) h 329 Buford pi (V) McFarlin Mabel (c) h 107 3d (U) McDuffie Wilbur E Jr student r 329 Buford McFee Mary (c) cook r 711 (r) Broadway pi (V) McFerrin Frances student r 107 Elizabeth pi McDuffy Wm (c) emp Central Cotton Oil Co r 701 Church al (SM) Mc(VFe)rrin James M (o) acct 604 Bibb Bldg h McEACHERN HARRELL W, Sec-Treas Wash- 107 Elizabeth pi (V) burn Storage Co Inc r 306 Hines ter (V>-- McFerrin James M Jr r 107 Elizabeth pi (V) Tel 1219-J McGahee Bernard B (Maggie) patrolmn CPD McEACHERN LLOYD F (Louisa W) 1 (Bibb r 655 A.rcii Supply Co) Vp Washburn Storage Co Inc, h McGahee Chas M (Lillie) 2 tex wkr Bibb Mfg 306 Hines ter (V)--Tel 1219-J Co h 236 (5-6) Clinton McEachern Robt L elk F S Royster Guano Co McGahee Lillie (Mrs C M) tex wkr Bibb Mfg r 568 Walnut Co r 236 Clinton McElhaney Robt (c; Katie) 5 lab h 232 Telfair McGahee Lonnie J tex wkr Bibb Mfg Co r McElheney H Grady student r 259 Church 236 (5) Clinton (EM) McGahee Luther L speeder hd Bibb Mfg Co McElheney James T emp Barnett Mfg Co r r 1043 1st 259 Church (EM) McGahee Luther M student r 236 (5) Clinton McElheney John W (Nellie) 2 pipe ftr C of Ga Mahee Maggie (Mrs B B) opr Happ Bros Co Ry h 259 Church (EM) r 655 Arch McElheney Preston student r 110 Montpelier McGahee Marcus M sta opr The Texas Co r McElhenny Nina L smstrs Happ Bros Co r 426 32 Marion pi Ridge (I) McGahee Myrtice (Mrs W C) tex wkr Bibb McElheny Duffie L (Martha V) elk State Hwy Mfg Co r 234 (7) Clinton Bd h 164 Cherokee McGahee Thos W (Mary) 2 twister Bibb Mfg McElheny Martha W student r 164 Cherokee Co h 1043 1st McElmurray Abbie beauty opr Dannenbergs McGahee Wm C (Myrtice) tex wkr Bibb Mfg r 767 Poplar Co r 234 (7) Clinton McElmurray Amos (c; Eliz) (o) h 1015 Pio McGahey Wm C formn Swift & Co r 163 Nono Spring apt 4 McElmurray Herman (Jefferson) 1 (o) city McGailliard Mary student r 201 Piece (V) firemn h 518 Johnson McGarr Ella (c) (o) h 314 e 1st (EM) McElmurray Thelma case wkr FERA r River McGarr Willie Mae (c) marker Crescent Ldry rd r 314 e 1st (EM) McElrath Emma M tchr Lanier High Sch for McGarrah Alice E (Mrs F S) emp Bibb Mfg Girls r 100 Cleveland Co r 560 Arch McElrath Florence (wid W H) h 100 Cleveland (V) McGarrah Annie L Mrs (o) tex wkr Bibb Mfg Co h 127 Steele McElrath John M (Anne) 2 (o) sec-treas Jef- McGarrah Faulkner (Alice) knitter Bibb Mfg freys-McElrath Mfg Co 224 Albemarle pi (I) Co r 560 Arch McElrath Wm student r 100 Cleveland (V) McGarrah Hubbard B (Jimmie M) waiter r McElroy Chas B (Jennie I) (o) asst post mstr 815 Poplar P O h 201 Buford pi (V) McGarrah Pinkie (wid T J) r 1905 Broadway McElroy Eli (c; Willie) 1 lab h 110 Tindall (SM) McGaugh Wesley (c; Leola) emp Willingham S&D Co h 103 Douglas (V) McElroy Eliz sch tchr r 15 Progress McGaw John M (Margt) (Cherokee Pharm) McElroy Frank F (c; Marie) (o) lab MD&RR h 112 Pringle McElroy Jack pastor Ch of Christ h 726 Date res R D 2 Columbus rd McGee A B (Willie) 1 slsmn C-M-P Drug Co h 105 Rogers (V) 1935 Macon City Directory 353 McGee Adolphus (c; Lizzie) 5 gdnr h 935 Pio Nono McGee Buford (Mrs Sami) smstrs Happ Bros Co r 404 Cedar (SM) McGee Carrie (c) maid h 539 e 2d (EM) McGee Chas (c; Senie) h 504 O'Hara la McGee Chas (c; Janie) trdr Atlantic Ice & Coal Co h 522 Ross McGee E Lee (Ethelyne) printer Macon Teleg Pub Co h 862 New McGee Elijah (c; Anna) h 44 Harris McGee Ellen (c) lndrs h 337 Maple McGee Emma (c) h 721 Whitehead al McGee Ennie C (Annie) (o) detective CPD h 122 Cole McGee Erith nurse 862 New r do McGee Felix (c; Gussie) 2 lab h 11 Ross St pi McGee Geo (c; Alma) h 100 e Ell McGee Geo (c) clo presser 1012 Ocmulgee r 130 (181) Williams la McGee Irene opr Happ Brs Co r 706 2d McGee Ivey (Mrs PM) opr Happ Bros Co r 706 2d McGee J Lane night mgr Colored Taxi Co r 974 Walnut McGee Janie (c) cook H A Parker r 522 Ross McGee Jesse (c) h 297 Harris McGee Jesse R formn Mansfield Dray Line Co 122 Cole McGee Joseph (c; Mary) lab City St Dept h 972 Pio Nono McGee Jos S (Lillie) (o) ofc sec County Solr General h 974 Walnut McGee Hath (c) h 601 (1270) Elbert McGee Leo E r 974 Walnut McGee Marie (wid A F) h 521 College McGee Mary student r 862 New McGee Mozelle (c) 1 h 708 Elm McGee Nannie J slsmn H L Green & Co r 974 Walnut McGee Perry M (Ivey) farmer r 706 2d McGee Pearl r 325 Adams McGee Robt L student r 862 New McGee Sami (Buford) 1 opr Happ Bros Co h 404 Cedar (SM) McGee Wm W (Kath) 3 artist h 224 Belmont McGehee Claude S student r 123 Pierce McGehee Fannie tchr Alex Sch No 4 r 123 Pierce McGEHEE JAMES T (Nell S) 3 , Genl Mgr Jos N Neel Co, h 1357 Oglethorpe--Tel 819 Neel Senie J (wid D O) (o) h 622 Main (EM) Neel Wm R r 622 Main (EM) Neely Jesse (C) (o) lab h 112 Kitchens Neely Jos (c; Emma) 1 lab h 108 Johnson's al NEHI BOTTLING CO, Thos J Jones Genl Mgr, 1911 Broadway--Tel 9286 (See Page 48) Neighbors Jean tchr A L Miller High Sch r 302 Hines (V) Neighbors Jos B (Jean) 2 (0) claim agt C of Ga Ry h 302 Hines (V) Nelms Claude L (Sallie) 6 h 142 Ell J M Wimberley pas- Newman Clayton (Azalee) 1 tex wkr Bibb tor 3d Mfg Co h 58 Davis (PM) 1835 Macon City Directory 375 Newman Florida (o) nurse 34 Arlington pi h do Newman Gladys B (Mrs J D) opr So Bell Tel Co r 2401 2d Newman Glen (c; Annie L) h 105 (124) Stripling al Newman Horace L (Lucile) 1 slsmn h 853 Cherry apt 3 Newman John D (Gladys) policemn CPD r 2401 2d Newman Julius r 34 Arlington pi Newman Katie (e) 1 h 100 (723) Wings al Newman Lucile (Mrs H L) dept mgr Dannen- berg's r 853 Cherry apt 3 Newman Lucius (c; Camilla) 2 lab Atlantic Ice & Coal Co h 404 (726) Campbell (SM) Newman Lula B (wid M E) (o) h 224 College Newman Mary (c) r 159 (345) Nussbaum Newman Nicholas L emp'PO r 34 Arlington pi Newman Quintus (c; Claudia) 2 lab h 206 (276) Astor Newman Quintus Jr (c; Ida) (o) bellmn Lanier Hotel h 459 (472) Broad Newman Robt L (c) r 804 (440) Hall (EM) Newman Rosa (c) r 804 (440) Hall (EM) Newman Rosa (c maid Mae Mitchelil Newman Wm A (Anne G) phys 310 Doctors bldg h 234 High Newsome Bradford (Mary) 4 (o) slsmn Union Furn Co h 612 Forsyth Newsom Minnie (wid R G) drsmkr 717 Cherry r do Newsome Clifford C (Ida L) asst engr State Hwy Bd h 110 (200) Elizabeth pi (V) Newsome Edw (c; Arrie) 1 hlpr Ga Roofing & Sup Co h 720 Hawthorne Newsome Frances E Mrs r 755 Poplar Newsome Frieda J student r 110 (200) Eliza- beth pi (V) Newsome John P bkpr Millirons Plmbg & Htg Co r 103 1st Newsome Joseph (c; Lily) hlpr Crawford's Barbecue Lunch h 113 Woodliff Newsome Lily (c) maid r 113 Woodliff Newsome Marie (c) lndrs Crescent Ldry Newsome Marie student r 103 1st Newsome Marion K emp State Hwy r 110 (200) Elizabeth pi (V) Newsome Wm F (Elabert) 1 vault custodian Citizens & So Nat Bk h 103 1st Newson Annie (c) r 998 Montpelier Newsome Carl (c) porter Palm Barber Shop r 140 Washington (EM) Newson Henry (Lydia) h 1011 Montpelier Newton Ada (Mrs C G) spinner Bibb Mfg Co r 9 Bibb Newton Alice Mrs bus sec YWCA r 622 College Newton Andrew (c) lab F S Royster Guano Co Newton Andrew Jr (c) lab F S Royster Guano Co Newton Arth F (Sarah) (o) (Newton & New- ton) tax assessor Bibb county h 754 1st Newton Bertha M Mrs r 41 White (SM) Newton Beverly A student r 206 Delaware Newton Carrie M Mrs (o) cash Ry Exp Agcy h 26 Progress Newton Cecil G (Ada) 3 emp Bibb Mfg Co h 9 Bibb Newton Chas (c) emp Bibb Mfg Co Newton Chas E (Eliz) (Newton & Newton) h 401 College apt 5G NEWTON CHAS E JR (Edith) 1, Vp The First Nat Bk & Trust Co In Macon, h 206 River. .dale dr (I)--Tel 281 Newton David P (Ruby) 3 r 912 Walnut Newton E Lee bkpr Swift & Co r 758 2d Newton Felton (c; Irene) emp Vineville Drug Store h 203 Moughon (V) Newton Frances nurse 286 Winship r do Newton Frank (c) dairy wkr r 174 College Newton G E interne Macon Hosp r do Newton John W (Ida) 2 mgr J J Newberry Co h 206 Delaware Newton James (c) bellmn Arcadia Hotel r 270 Madison Newton Jasper (c) lab r 729 Ocmulgee Newton John (c; Irene) h 107 (12) Striplings al Newton Lillian (c) 2 h 3 Turpin Newton Linton S (Nina M) 3 slsmn Sears Roe- buck & Co h 281 Masonic Home rd Newton Lucille doffer Bibb Mfg Co r 9 Bibb Newton ML (c) r 103 Franklin Newton Minnie B (c) 2 maid Artistic Beauty Shop h 115 (98) Long la Newton Mollie (c) lndrs r 144 Bowman Newton Noland (c; Orrie Z) 5 h 103 Franklin Neweton Othera L speeder hd Bibb Mfg Co r 9 Bibb Newton P Merwon r 3304 Houston (SM) Newton Pearl (Mrs J C) r 758 2d Newton Percy W (Bertha I) 1 (o) car inspr C of Ga Ry h 3304 Houston (SM) Newton Ralph G (Irma) 2 (o) phys 805 Ga Casualty bldg h 217 Buford pi (V) Newton Victoria (wid A R) h 400 Forsyth Newton Victoria student r 26 Progress Newton Virginia (c) emp Independent Ldry Co r RD 3 Newton & Newton (A F & C E Newton) ofc 610 Mulberry Neylans Oscar S (Cath E) 3 acct Bibb Mfg Co h 654 Forsyth Niblett Lucile Mrs tex wkr Bibb Mfg Co r 65 Davis (PM) Nicely Buford (c; Emma) gdnr H M Woodruff h 121 (721) Railroad Nicely Jennie (c) r 121 (721) Railroad Nicholas Cynthia Mrs h 824 Orange Nicholas Dona student r 824 Orange Nicholas Irene student r 824 Orange Nicholas Lucile waitress Newberry's r 824 Orange Nicholas Nick shoe repr Jake's Shoe Store r 824 Orange Nichols Arie (c) (o) h 106 Brooklyn (S) Nichols James (c) porter J W Burke Co Nichols John W (Mattie) 2 carp h 200 Georgia ter Nichols L C elk F W Williams 515 Oglethorpe Nichols Nell W Mrs tel opr Ga Power Co r 653 New Nichols Wm E (Frances) tex wkr r 110 Bell Nicholson Dessie tex wkr Bibb Mfg Co r 728 Oglethorpe Nicholson Emmett (Jennie L) tex wkr Bibb Mfg Co r 728 Oglethorpe Nicholson Guy emp Pepsi-Cola Btlg Co r YMCA Nicholson Ida (wid Leonard) h 728 Oglethorpe Nicholson Jennie L (Mrs Emmett) emp Bibb Mfg Co r 728 Oglethorpe Nicholson Mildred (c) 1 r 403 (541) Stevens (SM) Nickerson Albert (c) lab r 303 (205) Water- ville rd Mickles Henry H (Amanda) 2 h 134 Highland Nicopoulos Geo (Palace of Sweets) r 304 Cherry Nightingale Harry (Mary) slsmn r 460 Orange Nikula Kath (Mrs O A) sten Phoenix Mut Life Ins Co r 218 Georgia Nikula Oliver A (Kath) emp So Bell Tel Co r 218 Georgia Nims Arthur L Jr (Edwina) 2 (o) sec-treas Dr Pepper Btlg Co h 208 Vista cir (I) Nims Hayes (c; Uzel) jan h 226 (125) Grant (V) 376 Baldwin's and Telegraph's Nims Otis (c; Ruby F) 4 emp Jefferys-McEl- Noble John (c; Bessie) 3 lab h 949 Pio Nono rath Mfg Co h 174 Lincoln (V) Noble Lucius (c) porter Mitchell & Williams Nipper A C (Bessie P) refrigerator repr r 758 Co r 126 (1) e Spring la 2d Noble Nell (c) cook C P Dean r 949 Pio Nono Nipper Andrew (Janie) r 127 Steele Noble Wm (c; Lela) lab T L Wood h 114 2d NIPPER CHAS a (Lucille M) 2 (Nipper's (V) Pharm), h 5 Rose pi--Tel 2623 Noble Willie B (Mrs Howard) tex wkr Bibb Nipper Parchia Mrs r 5 Rose pi Mfg Co r 12 Schell (EM) Nipper Partishan (wid S S) r 1154 Milledge- Nobles Archie M h 607 Plum ville rd Nobles Claude (Edna) emp Bibb Mfg Co h 232 Nipper Robt K (Mamie L) 2 mach So Ry h Jackson 1136 Milledgeville rd Nobles Edna (Mrs Claude) emp Bibb Mfg Co Nipper Ruth (Mrs Sami) tex wkr Happ Bros r 232 Jackson r 1154 Milledgeville rd Nobles Emma L opr Happ Bros r 659 2d Nipper Sami C (Ruth) mach r 1154 Milledge- Nobles Jack tex wkr Bibb Mfg Co r 736 Ogle- ville rd thorpe NIPPER'S PHARMACY (Chas A Nipper) 700 Nobles James D (Laura W) 2 civ engr U S Spring--Tel 1900-1901 Coast & Geodetic Survey h 118 Log Cabin dr Nirenstein Fulton (Kathleen) elk Macon Teleg Nobles James J (Sallie L) agt Progressive Life r121 Grady Ins Co r 663 Hemlock Nirenstein Geo L (Leah) 1 emp T&T Pkg Co Nobles Laura W (Mrs J D) cash Economy Shoe h 778 Walnut Reprs r 118 Log Cabin dr Nirenstein Leon (Mollie) 1 elk PO h 6 Rose pi Nobles Mamie (Mrs Wm) spooler Bibb Mfg Co Nirenstein Lillian bkpr Kaybee Clo Store r 760 r 10 Bibb Patterson Nobles Oscar W (Gladys) 4 tex wkr Willing- Nirenstein Myer (Sarah) h 760 Patterson ham Mills h 1331 (34) Holt Nirenstein Sami emp Macon Linen Sup Co r Nobles Sallie L (Mrs J J) mach opr Happ Bros 760 Patterson Co r 663 Hemlock Nisbet Andrew (c; Nicie) 2 h 313 Jefferson Nobles Terrell (c) emp Bibb Mfg Co r 904 Nisbet Martha slswn Burden-Smith & Co r 202 Forest Hill Nobles Wm (Mamie L) emp Bibb' Mfg Co h 10 Nisbet McDougald (Zadie) h 202 Forest Hill Nisbet Tibbie K (wid J W) (o) h 221 Bond Bibb Nobles Wyolene r 736 Oglethorpe Nivins Ella J (c) maid r 100 (20) Kahn's al Nolan Alvin E (Calna) 1 h 369 1st Nix A Elyert (wid A E) (o) h 114 Rose Pk Nolan Anne student r 221 Buford pi (V) Nix Clara (c) (o) soft drinks 406 Campbell Nolan Cailie M student r 201 Pierce (V) (SM) h 408 do Nolan Chas L (c) porter Myrick Hilsman r Nix Doris r 2546 Broadway 512 3d Nix Edgar C (Emma) mach So Ry h 2526 Nolan Mark A (Leila) (o) h 615 (719) Log Broadway Cabin blvd Nix Essie (c) cook Holt Chapman r 118 Forest Nolan Qunicy R (Ruth) 3 (o) plant engr Bibb Nix Romey (c) tr dr Buck Ice & Coal Co r 509 Mfg Co h 221 Buford pi (V) Monroe Nolan Walter K (Lillian) 2 (o) dept mgr Bird- Nixon Albert (c; Virda) lab So Crate & Veneer sey Flour Mills h 507 Ridge (I) Co h 227 Turpin Noland Co Inc C P Ward mgr plmbg supplies Nixon Alex (c; Minnie) lab Willingham Cotton 550 Broadway Mills h 780 Reynolds al Nolen L Edw (Viola) emp Macon Typewriter Nixon Alston (c; Minnie) h 48 Harris Co r 322 New Nixon Boisy (c) h 511 Calhoun Nolen Viola (Mrs L E) opr Avalon Beauty Shop Nixon Clifford (c; Hattie) 1 h 215 (131) Vir- r 322 New gin la (V) Nolley Jane (c) r 821 3d (V) Nixon Cora (c) r 107 2d (U) Nollman Chas A ticket agt Union Bus Terminal Nixon Danl (c; Sara) (o) h 116 2d (V) r Central Hotel Nixon Effie (c) 3 (o) lndrs h 216 Northern Noonan Benj C (Lucile) formn Dublin Ga h 100 Nixon Eleanor Carr Mrs 1 h 401 College apt 4 I Highland (LCHts) Nixon Gena H (wid H C) tel opr First Bk & Noonan Minor B (Katie) (o) engr Central Ho- Trust Co h 285 Orange tel h 501 Bailey Nixon H Cecil r 285 Orange Noonan Rawlins student r 201 Pierce (V) Nixon Henrietta (c) r 130 (181) Williams la Norbert Wm (c; Dora) 5 h 227 Woodliff Nixon Julia (c) dom r 107 2d (U) Norman Clara (wid J M) r 112 Branch Nixon M Eugenia sten r 285 Orange Norman Clarie emp Southland Knitting Mills Nixon Margt (c) 1 lndrs h 107 2d (U) r 138 Rembert Nixon Martha (wid J A) r 285 Orange Norman Elsie Mrs 2 tex wkr r 267 Orange Nixon Mazie (c) emp Snow's Ldry r 408 (541) Norman Grady (Josephine) 3 h 1603 College Elizabeth (SM) Norman Hazel emp Southland- Knitting Mills Nixon Minnie L (c) maid Fannie J Shelverton r 138 Rembert r 780 Reynolds al Norman Ishmael emp Southland Knitting Mills Nixon Odessa (c) 6 r 234 2d (V) r 138 Rembert Nixon Pinkie (c) 1 (o) cook H M Block h 541 Norman J Ernest (Louise) 2 (o) shpg elk e 2d (EM) Southland Knitting Mills h 138 Rembert Nixon Rob't (c) peddler r 239 (131) Moore la Nixon Ruby (c) dom J W Byington Nixon Sami (c; Issie) h lli 1st (U) Noble Howard A (Willie Bell) tex wkr Bibb Mfg Co h 12 Schell (EM) Noble Ida (c) dom Macon Woman's Club r 579 Norman Marion (c) porter The Texas Co r 18 11) Malloy's al Norman Ruby opr Happ Bros Co r 213 Henry (Lynmore) orman Thelma (c) r 337 Maple Siam orred Wallace P (Lalar) 1 linemn So Bell Noble Jimmie (c) r 302 (258) Roye Tel Co h 522 Giles 1935 Macon City Directory 377 Norrell Addie (o) sten Hall & Block h 965 Walnut Norrell Dorothy (wid JL)r 965 Walnut Norrie Geo (Edna) golf pro Idle Hour Club res RD 2 Norris Albert L (Lorine) 1 (o) (Geoghegan & Norris) h 326 (105) Ingleside (I) Norris Amanda (c) h 114 Virgin (V) Norris Annie (wid R F) r 119 Lee (EM) Norris Carl R (Tiny S) parts mgr Yates Mtr CO r 1242 College Norris Chas (Leila) 2 h 206 (306) Pio Nono Norris Chas B (Sallie) formn C of Ga Ry h 905 (1919) Log Cabin blvd Norris Daisy M (c) cook Roland Neel r 114 Virgin (V) . Norris Emma student r 905 (1919) Log Cabin blvd Norris Ethel nurse 556 College r do Norris Eug (c) lab F S Royster Guano Co Norris Frank E (Vada) (o) mach C of Ga Ry h 967 Walnut Norris Harold student r 1444 Edgewood Norris J Leslie (Bessie) pntr T E Crimmins Sign Co h 567 1st Norris John C (Lura) formn Postal Teleg- Cable Co r 126 Grady . Norris Joseph R emp C of Ga Ry r Ficklmg Hotel Norris Lillie student r 615 (301) Woolfolk Norris Lula (wid J F) (o) h 339 Ross Norris Martha (Mrs R O) elk Union Dry Gds Co r 615 (301) Woolfolk Norris Martha R r 116 Corbin (V) Norris Napoleon (c) r 114 Virgin (V) Norris Nellie r 339 Ross Norris Robt B (Hazel) sports editor Macon Teleg r 272 College Norris Robt O (Martha) elk Union Dry Gds Co r 615 (301) Woolfolk Norris Ruth (wid T P) dept mgr Burden Smith & Co r 952 Elm Norris Sol (c; Irene) lab h 307 Norris Norris Ward 1 emp Taylor Fum Co r 1414 Edgewood Norris Will J confr 809 Broadway h do Norris Willard C student r 116 Corbin (V) Norris Willet r 615 (301) Woolfolk Norris Wm M (Nevada) 2 (o) slsmn Met Ins CO h 116 COrbin (V) North Carolina Mutual Life Insurance Co (c) C W Moore dist mgr 412 Knights of Pythias Bldg North Highland Grocery (Arth Stamm) 121 North (NH) North Pole (W M Cox) restr 3447 Houston (SM) Northern Lula (c) cook R T Jones r 104 (105) Pringle Northington Harry F (Allye) 3 (o) pastor Mal- lary Baptist Ch h 908 Napier Northington Harry F Jr emp Happ Bros Co r 90S N&picr Northington Henrietta (wid J F) r 908 Napier Northwestern Mutual Life Ins Co J Clay Mur- phey dist agt 470 Cherry Norton Cleveland (Florence) 1 emp C of Ga Ry h 801 Mikado Norton Dock O (Mildred) dairy wkr r 1238 Norwood Annie (c) emp Crescent Ldry r 598 (506) Smith (EM) Norwood Annie K (c) maid Doctors Bldg h 540 e 2d (EM) Norwood Ernest (c; Eva) porter Ry Exp Agcy h 224 Chestnut Norwood Ethel (c) r 7 Harris al Norwood Geo M (Dora) 1 (o) fit agt MD&SRR Co h 124 Lawton Norwood J Ernest (Ossie) 1 slsmn r 608 2d Norwood Jennie (c) 4 h 3 Franklin St la Norwood John (c) trkr So Ry r 406 (106) Lex- ington (EM) Norwood Lillian (c) r 101 (437) North St la Norwood Loretta H student r 124 Lawton Norwood Ossie (Mrs J E) mgr Lemer Shops Inc r 608 2d Norsworthy Eug student r 201 Pierce (V) Nottage Danl A (Edna) 1 ry wkr h 3802 Hous- ton Nottingham Delores J student r 212 Ridge (I) NOTTINGHAM GEO M (Zera P) 2, (Notting- ham & Nottingham) Lawyer 409-10 Ga Cas- ualty Bldg---Tel 1147, h 311 Hardeman--Tel 3883-J . ., NOTTINGHAM HARRY E (Jennie B) 1 (o), (Nottingham & Nottingham), Lawyer 409-10 Ga Casualty Bldg--Tel 1147, h 212 Ridge^- Tel 4242-J Nottingham Ida C (wid R V) r 108 Hines ter (V) Nottingham James (c; Florence) lab h 109 Johnson's al Nottingham John J r 415 Vineville (V) Nottingham Warren G Jr ofc 206 Macon Sav Bk Bldg h 103 Pio Nono NOTTINGHAM & NOTTINGHAM, (Geo M and Harry E), Lawyers 409-10 Ga Casualty Bldg--Tel 1147 Noutos Andrew (Silver Moon Cafe) r South- land Hotel Nowell Lillie (wid J P) r 5 Roff Home pi Nowell Marjorie opr Happ Bros r 44 Mikado Nowell Myrtie B r 484 Orange Nowell Nonie (wid L E) (o) h 440 New Noyes Deanie r 117 Rogers (V) Nu-Icy Bottling Co Inc H M Johnson pres C E Potts mgr 512 Broadway Nunn Addie J (Mrs D S) mgr Viavi Co r 460 Cherry Nunn D Shelton (Addie J) 1 (o) dist sis mgr Viavi Co h 460 Cherry Nurses Official Registry Mattie P Blount mgr 130 High NUSSBAUM ROBT (Bertha), VP The Dan- nenberg Co, h 818 Cherry apt 3--Tel 8904-J Nutting Annie M elk Dunlap-Peeler Hdwe Co r 585 Hillyer Nutting Floral Co (G G Nutting) 171 Cotton Nutting Geo G (Crystal) (o) (Nutting Floral Co) h 119 Crescent (CH) Nutting Geo G Jr student r 119 Crescent (CH) Nutting Jennie E tchr Fort Hawkins Sch r 585 Hillyer Nutting John B (Ruth) 2 (o) asst mgr Nutt- ing Floral Co h 121 Crescent (CH) Nutting John B Jr student r 121 Crescent (CH) Nutting Leila (wid CM) (o) h 585 Hillyer Nutting Mattie (Woman's Exch) r 400 Forsyth College dr Nutting Sarah C (wid Wm) (o) fum rms 468 Norton Earl r 1521 Broadway Walnut h do Norton Mildred (Mrs DO) opr Happ Bros Co Nu-Way Weiner Stand (Nick Gioldas Gus Lo- r 1238 College dr las) restr 218 Cotton Norton Rosalind student r 206 Forsyth Norton Sally Mrs r 1521 Broadway Norton Wm A (Frances) flgmn C of Ga Ry h 206 Forsyth Norton Wm R student r 206 Forsyth Nye Elbert C (Emma) 1 mgr The Nat Cash Register Co h 478 College apt 1 Nye Odorless Incinerator Co A C Felton pres J T Moore vp J E Wright sec-treas 2l8 3d 378 Baldwin's and Telegraph's O K Grinding Co (Mrs Rose Filsinger) tool sharpening 356% 2d O K Shoe Repair Shop (L C Josey) 607 Cherry Oak Art & Gift Shop The (Mrs Clare J Walkker) 2514 Forsytr rd Oak Ridge Cemetery F R L Strobery supt ft Madison (V) Oates Arth (c; Ethel) h 130 (6) Tinsley la Oates Edwin R (Pearl) 3 (o) mkt mgr Piggly Wiggly h 509 American blvd Oates Robt elk Crescent Ldry r 965 Cherry O'Berry Anne marker Snow's Ldry r 803 Cherry Oberry Geo G stock slsmn r 1206 Ridge (I) Oberry John W (Anna G) slsmn h 1206 Ridge (I) O'berry Ona student r 201 Pierce (V) Oberry Ruth sten K T Alfriend r 1206 Ridge (I) O'Brien Agnes winder Bibb Mfg Co r 107 St John (EM) O'Brien Bertha Mrs opr Happ Bros Co h 219 Adams O'Brien Martin r 219 Adams O'Brien Spurgeon student r 107 St John (EM) O'Brien Thos (Etna) 1 hlpr h 107 St John (EM) O'Bryant Jack (c; Nettie) hlpr Maxwell Bros h 252 Broad O'Bryant Nettie (c) maid W S Payne Jr r 252 Broad O'Cain Harry P slsmn Gay Clo Co r 191 Oak- land O'Cain Walter L (Mattie S) 3 patrolmn CPD h 153 Park pi Ocmulgee Camp No 938 WOW J L Henderson sec meets Thurs 8pm 338% Main (EM) O'Connell Hath M (o) h 858 Cherry O'Connor Alma student r 619 Elm O'Connor Dollie (Mrs J B) 1 h 619 Elm O'Connor Lillian smstrs r 619 Elm O'Connor Marion A dept rep Nat Reemploy- ment Serv r Hotel Lanier O'Connor Sami B (Sallie) 2 (o) condr C of Ga Ry h 1927 2d O'Daniel Pearl N (wid Mark) h 401 College apt 4 F Odell Arth B (Ruby) florist Idle Hour Nurser- ies res RD 1 Forsyth rd Odell Kate (wid C W) 2 opr Happ Bros Co h 324 Ross Odell Shealy L (Lizzie B) h 103 (206) Grant (B) Odom Adolphus K mech Bibb Mfg Co r 601 Log Cabin blvd Odom Albert (c; Thelma) 2 presser New York Clnrs h 854 Ocmulgee Odom Alberta K (Mrs J R Jr) elk TJ S Dist Atty r 549 Hillyer Odom Alonzo U (c; Inez) porter Genone's Bar- ber & Beauty Shop r 367 (334) North (V) Odom Anderson (Mattie) 4 hlpr r 1157 Mill- edgeville rd Odom Arwellow H (c) clnr Bibb Mfg Co r 203 (408) Thompson's al Odom Athol E (Sarah L) 2 (Odom Serv Sta) h 749 Montpelier Odom Boykin B (Minnie) (o) sec-treas Ga Oil Corp h 101 Rembert Odom Chas A (Pearl) (o) pres Fraternal Or- der of Knights of Am h 668 Napier Odom Chas A Jr elk W O Swift r 668 Napier Odom darence E (Eva M) 3 (o) mech So Ry h 132 Piedmont (SM) Odom Claudia D (wid L M) office sec Fire Co's Adjustment Bur r 113 Nottingham dr Odom Cleveland (c) lab Buckeye Cotton Oil Co Odom Clifford L (Fannie B) (o) (Odom Variety Wks) h 279 Ell (SM) Odom Crockett agt Murphey Taylor & Ellis r 513 Napier Odom Daisy (c) maid r 473 (462%) Alabama (SM) Odom Eliz ofc sec FERA r 668 Napier Odom Emmett K mech Bibb Mfg Co r 601 Log Cabin blvd Odom Emory S (E Mae) cbntmkr Odom Va- riety Wks r 355 New Odom Fannie B (Mrs C L) opr Happ Bros Co r 279 Ell (SM) Odom Geo (c) r 342 Hammond Odom Inez (c) maid C P Cole r 367 (334) North (V) Odom J J Candy Mfg Co (J J Odom) 253-55 5th Odom Jas (c; Arwellow H) 1 h 203 (408) Thompson's al Odom Jas (c; Lelia) 1 porter Adams Buchanan Mtr Co h 48 Franklin Odom Jolly J (Ruby) 2 (J J Odom Candy Mfg Co) h 750 Pine Odom Jos A (Bertie) 5 (o) mech Bibb Mfg Co h 601 Log Cabin blvd Odom Julia J (c) maid W J Massee r 427 North Odom Julian R Jr (Alberta K) bk^>r Worsham & Sherrill h 549 Hillyer Odom Lillian (Mrs P W) 3 slswn Union Dry Gds Co r 402 Forest (V) Odom M Marie r 322 Forsyth Odom Margt student r 513 Napier Odom Mary (c) 1 r 114 Bostic la Odom Mary (c) maid C S Butler r 409 Apple- wood Odom Maude elk County Relief Admn r An- thony rd Odom Norman H (Irene) 2 mech Bldrs Lbr Co h 914 Log Cabin blvd Odom Ollie L (Lila) 2 formn So Crate & Ve- neer Co h 243 Winship Odom Ostell A student r 601 Log Cabin blvd Odom Pummie L (c) 1 h 330 Dempsey Odom Realty & Insurance Co (S E Odom) 620 Ga Casualty Bldg Odom Robt L (Maggie R) condr MD&SRR h 322 Forsyth Odom Service Station (A E Odom) 901 3d Odom Sherman student r 513 Napier Odom Sherman E (Mamie C) 2 (Odom Realty & Ins Co) h 513 Napier Odom Stockton emp Personal Finance Co r 513 Napier Odom Variety Works (C L Odom) fum reprs 446 Oglethorpe Odom Walter (c; Julia J) r 427 North Odom Wm (c; Idelle) 1 presser Chas Sharp h 473 (462%) Alabama (SM_) Odom Wm W (Lahah P) (o) atndt Odom Serv Sta h 757 Montpelier Odum Isaac (Mary L) (o) h 758 2d Oetter Electric & Welding Co (Rudolph Oet- ter) 440 Oglethorpe Oetter Rudolph (Opteye) (Oetter Elec & Weld- ing Co) h 120 Stonewall pi (V) Oetter Sarah student r 120 Stonewall pi (V) Ogburn Arietta (Mrs E B) cafe mgr Wool- worth's r 108 3d (SM) Ogburn Chas soda elk Glass' Pharm r 560 Woolf oik Ogburn Edw B (Arietta) waiter Blue Front Lunch Rm r 108 3d (SM) Ogburn Leon B (Fannie) 1 (o) wheelwright Paul Williams Co h 560 Woolfolk Ogburn Robt E (LaFay) 1 (Blue Front Lunch Rm) h 108 3d (SM) 1936 Macon City Directory 379 Ogden Fannie T (wid M G) tchr Wesleyan Conservatory h 520 Orange apt 1 Ogden Frances A r 520 Orange apt 1 Ogden Herbert student r 520 Orange apt 1 Ogle Chas (Eunice) 3 tr dr City St Dept li 2020 3d Oglesby E Corinne r 109 Thomas (LCHts) Oglesby G N utility mn Buckeye Cotton Oil Co Oglesby Graham (Lavell) 3 pastor Church of God h 109 Thomas (LCHts) Oglesby Jeptha D emp C of Ga Ry Oglesby Robt (c) hlpr Middle Ga Lbr Co Oglesby Thos (c) lab Cherokee Brick Co OGLETHORPE PRIVATE INFIRMARY Dr A R Rozar Pres, Dr Thos H Hall VP, Dr O F Keen Sec-Treas, 1309 Oglethorpe--Tels 2400-2401-3402 Ogletree Anna (wid R C) 1 h 612 Church (CH) Ogletree Geo W doffer Bibb Mfg Co r 612 Church (CH) Ogletree Ruth Mrs 7 h 203 (309) Grand (B) O'Handlon Jerome P (Billie) r 615 Walnut apt 4 O'Hara Ellen r 771 Hemlock O'Hara John W shpg elk Happ Bros Co r 911 New Ohio Garage (R M Lane) auto reprs 3492 Houston (SM) O'Kelly Lillie (c) cook 907 Clinton O'Kelly Lillie (c) dom r 54 New Oldham Bernice r 509 Edgewood Oldham Harry M (Martha) 1 asst div supt Ga Power Co h 261 Georgia apt B 4 Oldham Joseph E (Alice) 3 optician Am Optical Co h 129 Piedmont (SM) Oline Verna nurse Middle Ga Hosp r do Oline Virginia nurse Middle Ga Hosp r do Oliphant Annie M (wid J T) dep city elk City of Macon res RD Forsyth rd Oliphant Fred mgr G R Kenney & Co Inc h 864 Mulberry apt D 5 Oliphant Geo F (Jeannette W) supt Ga Acad for the Blind h 1501 Vineville (V) Oliphant Homer N mgr Shirley Hill Club h do Oliphant Jeannette (Mrs G F) tchr Ga Acad for the, Blind r do Oliphant Lee (c; Kathleen) (o) lab C of Ga Ry h 713 Daisy (SM) Oliphant Mamie (c) maid Joseph Waxelbaum h 316 3d (V) Oliphant Twiggs (c) trkr C of Ga Ry r 713 Daisy Oliver Addie (c) r 318 Hammond Oliver Annie H (wid W H) h 456 Orange Oliver Annie J Mrs h 217 Broadway Oliver Annie N (wid J T) emp City of Macon r 2515 Forsyth rd Oliver Annie R (c) r 606 Crisp Oliver Berta (c) r 305 Crisp OLIVER CARL S (Thelma M) 1 (o), lawyer 1007 Ga Casualty Bldg, h 797 Patterson-- Tel 854-M Oliver Cleveland (c) emp So Crate & Veneer Co r 318 Hammond Oliver Colquitt (c) pin str Lucky Strike Bowling Alleys r 112 Powell Oliver Eva (c) 2 h 110% (14) Fulton la Oliver Frances E (wid E L) (o) h 417 Boulevard (NH) Oliver Frances E tchr Lanier High Sch for Girls r 417 Boulevard Oliver Francis (c; Carrie) porter Central Ho- Oliver Jas B (c; Annie R) 2 delmn Triangle Pharm h 305 Crisp OLIVER JAMES W (Lila M) 1, Asst Trust Officer The First Nat Bk & Trust Co h 203 Corbin (V)--Tel 1834-W Oliver Johnnie (c) r 105 (112) Powell Oliver Lope (c) (Broadway Tailoring & Clean- ing Co) Oliver Lula (c) 3 h 231 (441) Alabama (SM) Oliver Mark (c; Annie) 2 emp Central Hotel h 322 Gilmer Oliver Mary D (c) r 156 Sycamore (V) Oliver Maud r 662 College Oliver Nell r 662 College Oliver P Clarence (Elba) 4 lab h 405 Bailey Oliver Rebecca (c) h 213 Fretwell al Oliver Sam (c; Martha L) 2 h 226 (126) Cowan Oliver Sarah (c) lndrs r 309 Blount Oliver Susie (c) 1 maid Terminal Hotel h 102 (104) Booker's al Oliver Warren H Jr USA r 456 Orange Olm Mildred (wid Leonard) 1 emp Bibb Mfg Co r 1023 2d Olmstead Arno (Lallie D) r 121 Plant (SM) Olmstead E Clifton (Amy W) 2 (o) (Am Printing Co) h 213 Villa Eta Olmstead Esther H bkpr Am Printing Co r 304 Villa (B) Olmstead Kermit B pressmn Am Printing Co r 304 Villa (B) Olmstead Lallie D (Mrs Arno) opr Happ Bros Co r 121 Plant (SM) Olmstead Virginia (wid T C) (o) (Am Print- ing Co) h 304 Villa (B) Olzer Eug B (Ruth) slsmn Macon Coca Cola Btlg Co r 248 Jeff Davis (SM) O'Neal Agnes (c) 1 r 530 Clinton O'Neal B P Jr & Co (BP O'Neal Jr) 712 Ga Casualty Bldg O'Neal Benj P (Anna) (o) h 138 Bond O'Neal Benj P Jr (Margt) 2 (o) (B P O'Neal Jr & Co) h 250 Vista cir (I) O'Neal Chas h 422 Plum O'Neal Dora (c) cook R S Duffell r 233 Col- linsville O'Neal Douglas (c; Mary) lab h 317 Short O'Neal Eva H tchr J W Burke Sch r 157 Sum- mit O'Neal Evelyn waitress Harry's Cafe r 359 New O'Neal Geo A mine supt Genl Reduction Co r Dry Branch Ga O'Neal Geo H (Florene) 2 engr Genl Reduction Co r 774 (812) Pio Nono O'Neal Jas (c; Florence) 7 h 210 North (V) O'Neal Jas T formn Genl Reduction Co r Cross Keys O'Neal Jessie (c) lndrs r 305 Walnut O'Neal John (c; Anhie) 2 h 1011 Edgewood O'Neal John B (Ellen M) 1 agt Met Life Ins Co h 325 North (NH) O'Neal Jos J (Mary) 1 (o) mech Bibb Chevro- let Co h 117 Nelson (SM) O'Neal Julia elk Central of Ga Bkg Co r 805 Pine O'Neal Laura Mrs mach opr Adams Mfg Co r 359 New O'Neal Leon appraiser HOLC res Decatur Ga O'Neal Lula H (wid W R) bkpr D C Harris Jr r 706 Napier O'Neal Mamie (c) maid Dr J W Lovelace r 210 North tel r 248 2d (V) O'Neal Mamie L marker Independent Ldry Co Oliver Frank (c) h 105 (112) Powell r 805 Pine Oliver Geo L mldr r 531 Boulevard (NH) O'Neal Robt (c; Ola) r 303 (314) 3d (U) Oliver Geo W (c; Amandy) (o) emp So Ry h 80 Bay O'NEAL WADE H (Margt W) 1, Mgr Bruce Terminix Co h 245 Bond apt 3 380 Baldwin's and Telegraph'8 O'Neal Wm B (Minnie D) (o) elk Standard Brick & Tile Co h 157 Summit O'Neal Wm J (Margt) br mgr Piggly Wiggly h 110 Holt (V) O'Neil Wm (c; Magnolia) h 164 Coles al O'Neill Chas O (Eliz) h 439 Calhoun Oney Chas A (Nellie) emp Ga Power Co h 459 (455) Virginia Ott Dewey elk Mitchell-Williams Inc r 121 Coleman Ott Nell r 121 Coleman Ott T Cane (Ethel) opr Tank Car Serv Sta h 121 Coleman Ottmann Daisy K Mrs librarian Y W C A r do Otto Fred R (Annie M) (o) wtchmn Willing- ham S&D Co h 125 Winship Oney Sarah r 459 (455) Virginia Ong Alma Mrs opr Mary Ann Beauty Shop r 764 Cherry Ong Benj F (Edna) mtr cycle ofc CPD h 113 Crisp Otto Harness Co (J H Otto) 355 Poplar Otto Julius H (Maggie) (o) (Otto Harness Co) h 661 New Otto Julius H III (Grace O) 2 elk C of Ga Ry h 528 Log Cabin blvd Ong Jno H (Alma) welder Acme Welding Co Our Place (c) (E R Cole) restr 353 Broadway r 764 Cherry Ousley Lula (wid S P) h 2012 Vineville (V) Open Air School Mrs Reba S Baker prin 101 Ousley S P elk Ry Exp Agcy r RD 4 North Outing Hattie (c) dom Jack's PI h Clinton rd Open Air Sch (c) Rosa Jackson prin 901 (950) extd (EM) Maynard Outlaw Alvin (c; Ruby L) 1 emp G Bemd h Opry Stella B (wid J J) r 22 (23) White (SM) 207 (252) Prince (SM) O'Quinn Alvin W (Suella C) 3 hlpr City Bd of Outlaw Edw (c) farmer r 115 Gibson Water Comrs r 1505 Third Outlay Willie M (c) 3 cook T J Lackey h 139 O'Quinn Helen E sten Piggly Wiggly r 416 Forsyth Orange Hill Apartments 871-73 Orange Orange Mary (c) 2 r 817 Elbert e Ell Outler Albert C (Carla) asst pastor Mulberry St Methodist Ch r 101 1st Outler Chuck (c; Mary) h 208 e Ell Orange Wilma (c) cook J T Hogan O'Rear Atticus H elk Ry MS r 619 1st O'Reilly Thos elk Ry MS res Walden Ga Orington Jas (c; Minnie) emp Couch & Wood- all r 1202 (1134) Woolfolk Outler Gaynor (c) hallmn Hotel Southland h 308 3d Outler Joseph S (Orrie) tr dr Bd of Education Garage r Rutland Ga Outler Sami (c) porter Gay Clo Co 308 3d Orington Minnie M (c) cook Laura Adams (PH) Orlando Celeste tile setter r 274 Winship Outler Willie M (c) maid J F Lackay Orlando Vincent (Mary) (o) tile setter h 274 Outley Agnes (c) cook Leroy Langford r 1200 Winship Orloff Nancy opr Happ Bros Co res RD 2 3d Outzs Chas E (Clara) 2 shpg elk Loose-Wiles Orme Jane student r 232 High apt 3 Orme Richd P (Helen B) rep Macon Better Hsg Program h 232 High apt 3 Orr Annie M opr Happ Bros Co r RD 2 Orr Claude O (Geneva) sta opr Wofford Oil Co r 1633 3d Orr Clifton B (Lelia J) 1 slsmn Bibb Chevrolet Co h 113 Corbin (V) Orr Clifton B Jr student r 113 Corbin (V) Orr Emily tchr A L Miller High Sch r 154 Summit Orr Geneva Mrs slswn Belle Millinery Co r 1633 3d Orr Harry student r 523 Vineville (V) Orr Jas (c; Sarah) 6 emp C of Ga Ry h 202 Short St la Orr Malcolm W (Jennie L) (o) supt Central Cotton Oil Co h 154 Summit Orr Malcolm W Jr student r 154 Summit Orr Obie (c; Annie L) 2 lab h 595 Center (EM) Orr Oliver (o) lawyer 709 Forsyth h do Orr S L Co (S L Orr) jwlrs 511 Cherry Orr Sami L (Berdie W) 1 (o) (S L Orr Co) h 523 Vineville (V) Orr Sami L Jr jwlr (S L Orr Co) r 523 Vine- ville (V) ORTH ALBERT Pres-Treas Baldwin Directory Co Inc r Charleston S C Osborne Angie M Mrs r 131 Violet Osborne Jas F (Lucile) (o) emp C of Ga Ry h 628 Anderson (SM) Osborne Lee (Jewel) 2 emp C of Ga Ry h 706 Mikado Osborne Nona (wid Frank) r 538 Telfair (SM) Osborne Otto O (Naomi) waiter Spiller's Restr h 557 1st Osborne Vannie Rue opr So Bell Tel Co res Wesleyan dr O Shaughnessey Wm J (Doris) 2 treas Cotton States Fertilizer Co h 106 Callaway (V) Otis Elevator Co C R Chamblee mgr 602 Bibb Bldg Biscuit Co h 1006 Napier Outzs Herbert brklyr Adams-Swirles Mill r 103 Ridge (I) Outzs Benj F (Alice) (o) wood turner Builders Lbr Co h 200 Beech Outzs Benj D pntr r 200 Beech Ouzts M Emmett (Corinne) 1 emp Country Mkt Hse h 1026 Clinton rd (EM) Ouzts-Mitchell & Whaley Inc C L Whaley pres W E Ryals sec-treas mdse brokers 9 Terminal Overcash Frances Mrs opr Happ Bros Co r 236 Bacon Overstreet Anna (c) h 117 Telfair (SM) Overstreet Cecil W elk Federal Transient Bur r 504 Plum Overstreet Clara (c) r 117 Telfair (SM) Overton C D emp Greyhound Lines r Central Hotel Overton Elvin E (Harriet) prof Mercer Univ h 505% Adams Overton Geo (c) r 245 5th (V) Overton Queen (c) 3 h 245 5th (V) Owen Allen L chf car inspr C of Ga Ry r Hotel Southland Owen Annie M (wid E S) 1 r 2166 2d Owen C Robt (Nellie M) 2 elk Bibb Mfg Co h 612 Montpelier Owen Logan E (Margt) 2 (o) storekpr MD&S RR h 837 Hillyer Owen W Roland (Mary R) 2 elk MD&SRR h 1013 Clinton rd Owen Willard D investigator Ga Power, Co Owen Wm L emp Ga Power Co r 855 Mulberry apt 300 Owens Frances E r 127 Hines ter (V) Owens James D (Evelyn F) (o) ticket seller Terminal Ticket Ofc h 127 Hines ter (V) Owens James S emp Penn Mut Life Ins Co r Fickling Hotel Owens John (c; Essie) 1 h 208 (409) Campbell (SM) 1935 Macon City Directory 381 Owens Lawson (Ruth) formn Adams Mfg Co h 104 Rocky Creek rd Owens Mac (c; Mamie) lab h 407 Charles Owens Mattie (e) 1 dom r 1231 Broadway Owens Philip (c; Rainey) lab Wofford Oil Co h 162 Bay Owens Ruth (Mrs Lawson) erap Adams Mtg Co r 104 Rocky Creek rd Owens Sallie M student r 115 w Grenada ter Owens Wesley P (Josephine) mldr Taylor Iron Wks h 115 w Greneda ter Owens Wm L (c; Mary) 2 (o) h Lawton rd (B) Owings John L (Lucille) (o) sec-treas Dixie Roll & Cot Co Inc h 102 Boulevard Oxford Benj student r 122 (110) Charles Oxford Helen waiteress Ward's Bar-B-Q PI r 221 Forsyth Oxford Venus student r 1354 Edgewood Oxley Benj T (Gladys E) 2 policemn CPD h 319 Beech Oxley Geo W slsmn Jackson-Wynn Co r 314 PALM PURCHASING CO INC, Harvey B Bloodworth Pres, Mrs Rachel Bloodworm Sec-Treas, Salary Assignments, 3 Hardeman Bldg--Tel 6 Palmer Alex (c) lab Macon Cooperage Co r 635 Division Palmer Amanda ofc mgr Nat Reemployment Serv r 469 Spring Palmer Anna (c) cook J W Crawford Palmer Blanche Mrs emp Collins Bakery r 720 Mulberry Palmer Clara (c) h 1027 College dr Palmer Clarence W (Naomi) 3 ins agt h 110 Dixie Palmer David (c) emp Central Cotton Oil Mill r 322 Boardman's al Palmer Florine H (wid Joseph) r 846 College Palmer John (c; Lula) lab Standard Tool & Handle Co Palmer John (c; Myrtis) 2 lab r 162 Coles al Palmer John (c; Lula) 1 lab h 109 Edgewood Palmer John E (Kate) 7 (o) sec-treas South- Oxley Harry W elk Supreme Storage Garage r 314 Beech Oxley Mary D (wid G W) (o) 1 h 314 Beech Oxley Mattie (wid C H) h 569 Hawthorne Oxley Paul R (Vera) 1 (Supreme Storage Garage) h 314 Beech Oxley Sami hlpr r 569 Hawthorns Ozbum Harwell C (Alice J) 1 (o) chf elk C of Ga Ry h 925 (1993) Log Cabin blvd Ozburn John E elk Birdsey Flour Stores Inc r 925 (1993) Log Cabin blvd Pace Florence (wid W L) smstrs Happ Bros Co h 124 Holt Pace J Floyd (Myrtle S) engr C of Ga Ry r 305 Clayton (V) Pace Wm D (Parish R) 1 (o) carp C of Ga Ry h 121 Heard (SM) Pace Wm N (Lois) 1 agt Nat L & A Ins Co n 606 Forsyth PACKER ADVERTISING CORP, John A Jones Mgr, Outdoor Advertising, 452 Plum --Tel 3661 Paddock Ford R (Edna) 2 slsmn r 318 New Padgett Benj T r 12 Lake City (EM) Padgett Clara (wid L H) 1 r 1070 Walnut Padgett E J h 553 Orange apt 22 Padgett J A chf elk Swift & Co r Capital Hotel Padgett K Bernard elk Bibb Mfg Co r 533 Orange Padgett Maggie r 12 Lake City (EM) Padgett Snow S (Eudell) 2 mech Edison Skelley h 105 Nelson (SM) PAGE HEBER (Madelyn I) Supt of Production Baldwin Directory Co Inc r Springfield, Mo Page Joseph (c; Rosa) 1 (o) carp h 601 Straight (U) Page Tressie L (c) 1 h 503 (504) Elbert PAINE GUY E (Helen M) (o), Genl Agt Penn Mut. Life Ins Co, h 329 (377) Hill Crest-- Tel 3894 Pair John E (Laura H) engr C of Ga Ry h 215 1st eastern Battery Co Inc h 114 Florence Palmer John W (Muriel) 2 emp Bibb Mfg Co h 34 Bibb Palmer Louise M (wid W A) r 114 Florence Palmer Luther D (Susie) 1 condr C of Ga Ry h 223 Adams Palmer Samantha (wid M A) h 469 Spring Palmer Sami B (o) phys 723 Bibb Bldg h 141 High Palmer Sarah F nurse 223 Adams r do Palmer Stanton (Margt) 2 h 501 Giles apt 1 Palmer Wm J whse formn So Ry r 125 Log Cabin dr Palmetto Barber Shop (c) Herbert Rutherford mgr 463 Broadway Pan-American Life Insurance Co E T Kirkland dist mgr 425 First Nat Bk Bldg Pannan Carrie (c) turner Bibb Mfg Co r 368 Bay Pannan Mattie (c) turner Bibb Mfg Co h 368 Bay Pape Harry E (Kathleen R) County Probation Officer r Holton rd Pappas Peter J (Mary) 2 (The New Yorker) r Lanier Hotel PAQUET NESSEL B (Mary E> 2, Mgr Macon Trading & Investment Co, h 116 Ninadell dr --Tel 4906 PARCEL DELIVERY CO (J Crawford Burns Jr), Schatzman al bet Cotton & 2d--Tel 416 Parchell Bessie (c) cook r 422 Ward (V) Pardue Winnie (c) maid h 153 Elm Parham Alonzo J (c; Cora L) 7 shoe repr 115 Middle h 503 (500) Moore Parham Bethena (c) 1 h 1432 Broadway Parham Dolly (c) r 156 College Parham Gerald (c) h 126 Cemetery la Parham John H (Iva G) slsmn Huckab'ee Auto Co h 125 Pierce (V) Parham Joseph R (Mary) tr dr CFD h 1707 2d Parham Mabel (wid J L) sec YWCA Sewing Rm r 2834 Houston Parham, Ralph E slsmn Huckabee Auto Co r 125 Pierce (V) Pair Laura H (Mrs J E) furn rms 215 1st r do Parham Wm (c; Mattie) 2 h 156 College Pair Sami G (Bertha B) (o) slsmn Atlantic Ice Parham Willie R (c) r 503 (500) Moore & Coal Co h 251 Belvedere dr (I) Parham Telota (wid T H) 2 supvr Bibb County Pair Virginia elk Burden Smith & Co r 215 1st Palace Barber Shop (A T Spell) 558 Mulberry Palace of Sweets (Jim Andos Geo Nicopoulos) 304 Cherry Relief Admn h 429 Ross Paris Cleo E (Ena L) gro 201 Linden h do Paris Effie L student r 113 Richmond Paris Etna (Mrs T N) elk Paris Gro Co r 113 Richmond Paldow Mamie (c) cook T J Volk Paris Grocery Co (T N Paris) 600 3d (V) Palisades Apartments 571-77 Orange Palm Barber Shop (R B Rhodenhiser, Pete Stocks) 316 2d Paris J Horry r 113 Richmond Paris Onnie slswn Union Dry Gds Co r 113 Richmond _ 882 Baldwin's and Telegraph's Paris Thos N (Etna) 1 (o) (Paris Gro Co) h Parker Frances sten W H Sanders r 137 (135) 113 Richmond Park Chas L (Mamie L) 1 (o) dispr C of Ga Oakland Parker Geo H (Clarine) 1 emp Bibb Mfg Co h Ry h 212 Clisby pi 206 College pi Park Hugh H Jr copy dept Macon Telegraph Parker Geo W carder Bibb Mfg Co r 418 Cal- r Y M C A houn Park Lemmie (c; Zadie) h 115 Spring Parker Gussie M (c) cook r 563 Monroe PARK ORVILLE A (Elmyra T) (o) (Park & Parker H Grady h 104 Whitehead Strozier), h 556 College--Tel 113 Parker Henry A (Ouida I) 1 h 705 Holt Park Robt L dispr MD&SRR r 212 Clisby pi Parker Henrietta (c) r 1343 Broadway Park View Apartments 105 Park pi Parker Hershel (c) lab F S Royster Guano Co Park Zadie (c) maid W W Miller Parker Hugh W (c; Leila) porter Citizens & PARK & STROZIER (Orville A Park, Harry So Nat Bk h 205 Madison (V) S Strozier), Lawyers 401-04 Ga Casualty Parker Ida L (c) r 201 Campbell (SM) Bldg--Tels 3667-3668 Parker Isaac (c; Gertrude) 1 h 115 Gaillard Parker Addie K (c) dom Lewis Grey (V) Parker Allen (c) (o) h 536 Smith (EM) Parker J C emp Willingham Mills r 129 (136) Parker Alton hlpr r 514 Jackson Holt Parker Amanda (c) 5 maid R D Tidwell h 211 Parker J Marion store rm elk Macon Gas Co Wood al r 247 Boulevard (NH) Parker Andrew J (c; Beulah) lab r 305 (304) Parker James (c) lab h 109 May (U) Charles Parker James B (Eliz) supt h 853 Cherry apt 1 Parker Anna (c) dom r 165 Roye Parker Jesse (c; Carrie) lab The Standard Parker Anna E r 204 Hightower (SM) Tool & Handle Co h 162 Hazel Parker Annie (c) r 168 (124) Plummer's al Parker Jesse tex wkr Willingham Mills r 129 Parker Annie M (c) 3 h 105 (921) Ocmulgee (36) Holt la Parker John carp City of Macon r 300 Ruther- Parker Arth (c) lab Macon Cbnt Wke h 719 ford (SM) Whitehead al Parker John (e) swtchtndr Terminal Co Parker Azile student r 322 New Parker John (c) lab h 110 Walker la Parker Benj (c) lab C of Ga Ry Parker John B (Elmira) 1 slsmn Freeman- Parker Bernice r 356 New apt 3 Dent-Sullivan Co h 353 Hines ter (V) Parker Bessie M (c) sch tchr r 305 Womack Parker John H (c) h 611 Center (EM) Parker Beulah (c) maid G P Estes r 304 Parker Joseph tex wkr Atlantic Cotton Mills Charles 32 Atlantic Village Parker C Hugh (Mattie) 1 tag inspr State of Parker Julius (c; Cora) r 104 Spring Ga h 2448 Forsyth rd Parker Laura (c) maid H S Lasseter r 306 Parker Carl H Jr emp Ga Power Co r 2448 Gordon (CH) Forsyth rd Parker Laurie L (Pearl) 3 gro 811 Main h do Parker Carrie (c) dom h 113 (118) Adams Parker Laura R (wid H C) 2 (o) h 547 Parker Chadwick B (Rosamond L) elk Bibb Georgia Mfg Co r 454 Center (EM) Parker Lee tex wkr Willingham Mills r 129 Parker Chas (c; Laura) lab Idle Hour Club' h (36) Holt 306 Gordon (CH) Parker Leila (c) (o) h 605 Hall (EM) Parker Chas (c; Carrie) 3 lab h 300 (200) Parker Leila G (wid M F) h 754 Plum Smith (EM) Parker Lenora r 1016 Oglethorpe Parker Chas L (Maude D) 2 (o) slsmn Am Parker Leon B (Mary R) 3 mgr Woco Pep Bakeries Co h 105 Log Cabin dr Filling Sta h 2001 Vineville (V) Parker Christine (c) r 313 Norris Parker Leonard F (Mattie S) (o) gro 501 e 2d Parker Clarine (Mrs G H) emp Bibb Mfg Co (EM) h 113 Nottingham dr r 206 College pi Parker Lillie (c) 2 h 325 Gilmer Parker Claudia (c) ofc maid J L King r 518 Parker Lucile (c) 1 r 404 Applewood Monroe (V) Parker Lucile Mrs r 206 College pi Parker Cora (c) cook J P Shouse Parker Mack A (Eliz) emp Nehi Btlg Co r Parker Cora L maid The Clinic r 105 (921) 418 Walnut Ocmulgee la Parker Maggie (c) lndrs h 313 Norris Parker Dolly (c) lndrs h 102 Adams Parker Maggie J (c) case aide County Relief Parker Dorothy (c) cook r 920 Ocmulgee Admn r 314 4th Parker Dorothy (c) maid 3202 Forsyth rd Parker Magnolia (c) r 408 (720) Campbell Parker E T formn Ga Roofing & Sup Co (SM) Parker Earle student r 110 Montpelier Parker Margt emp Bibb Mfg Co r 206 College Parker Earle R student r 2448 Forsyth rd Parker Edw J (Lizzie) h 514 Jackson Pi Parker Marie (c) maid Wesleyan College r 561 Parker Edw T (Verdie M) 5 emp Bibb Mfg Co Cotton h 418 Calhoun Parker Martha (c) maid J W Timmerman Parker Eliz (Mrs M A) opr Happ Bros Co r Parker Martha (c) maid r 230 5th (V) 418 Walnut Parker Mary L slswn Standard Stores Inc r Parker Ella (wid G F) elk r 609' Academy 102 (3) Balkcom Parker Ella (c) 1 emp Independent Ldry Co Parker Modene (c) student r 115 Gaillard (V) r 404 Applewood Parker Nancy (c) cook r 1242 Broad Parker Ernest (c; Lucille) 4 h 303 Gilmer Parker Ernest (c; Lucile) 4 lab h 319 Division Parker Ernest P (Lucile B) (o) car repr C of Ga Ry h 3327 Houston (SM) Parker Estella (c) 1 maid r 3 Woodliff Parker Nelson H (Lula) (o) bkpr h 246 Williams (SM) Parker Nelson H Jr (Phalba) 1 electrn Ga Power Co h 532 Boulevard (NH) Parker Eug (c; Martha) trkr C of Ga Ry h 230 Parker Nicholas K (Jenny K) 1 slsmn Rem- 5th (V) ington-Rand Inc r 194 Laurel Parker Eula (c) 3 h 201 Campbell (SM) Parker :Opal opr Happ Bros Co r 754 Pl um 1935 Macon City Directory 383 Parker Pauline emp Bibb Mfg Co r 418 Calhoun Parker Phillip (c) lab F S Royster Guano Co Parker Purcell (c) lab r 307 (375) Bowman Parker Ray (Ida A) 1 (Acme Sign Serv) h 109 Academy Parks Justine (c) elev opr Doctors Bldg r 217 Grant (V) Parks Lizzie M (c) 1 r 256 Garden Parks Lora S (Mrs F F) tchr Fort Hawkins Sch r 2911 Houston (SM) Parks Mabel C (Mrs M H) tex wkr Payne Mill Parker Robt (c; Anna) (o) butler J L Davis h 116 (366) Craft (V) r 94 Green (PM) Payne Mamie L (c) tchr Pleasant Hill Sch Parker Robt C (Virginia) 1 pharm Chichester's Tatnall Sq Drug Store r 1415 Edgewood Parker Robt E (c) student r 109 May (U) Parker Robt L r 206 Montpelier Parker Rosa (c) (o) lndrs h 307 (375) Bow- man Parker Sammie L (c) maid D H Mercer r 209 r 217 Grant (V) Parks Marie (Mrs H D) tex wkr Payne Mill r 178 Gardner (PM) Parks Milton H (Mabel) 1 tex wkr Payne Mill h 94 Green (PM) Parks Nelson (c; Lizzie) 1 pntr h 459 % Clinton Parks Oscar R (Irma) tex wkr Payne Mill r 603 Plum Wood al Parker Sami emp Pepsi-Cola Btlg Co r YMCA Parker Sami C (Marie) 2 h 322 New Parker Stella Mrs 1 opr Adams Mfg Co r 2023 3d Parker Sue (c) cook M P Wade Parker Susie E r 105 Log Cabin dr Parker Tabitha J (wid E N) h 132 Stratton Parker Thos (c; Cora L) hlpr Maxwell Bros r 105 (921) Ocmulgee la Parker Thos (Agnes J ) 3 bkpr Bibb County h 550 Log Cabin blvd Parker Thos B teller First Nat Bk & Trust Co - r 246 Williams (SM) Parker Thos W (Alice) 4 slsmn Corbin Sup Co h 113 Cleveland (U) Parker W B engr C of Ga Ry r Fickling Hotel Parker Walter (c; Maggie) cook Macon Cafe- teria h 314 4th (V) Parker Wildie (c) 1 h 764 (152) Whitehead al Parker Wm (c) r 307 (375) Bowman Parker Wm (c; Ida) 3 h 120 e Ell Parker Wm (c) lab F S Royster Guano Co Parker Wm (c; Beatrice) 2 lab h 598 (506) Smith (EM) .Parker Wm L (Ada L) (o) engr C of Ga Ry h 206 Montpelier Parker Wm M (Edna McH) teller City Bk & Trust Co h 247 Boulevard (NH) Parker Wm R (Lora) (o) san inspr City Bd of Health h 137 (135) Oakland Parker Woodrow W elk L L Parker r 811 Main (EM) Parker Zebedee (c; Mollie) lab Taylor Iron Wks h 702 Hazel Parkson Nancy r 530 Washington Parkerson Theo M (Frances) 1 supt Life & Casualty Ins Co h 105 Park pi apt 4 Parkman John U Mrs 3 h 317 Randolph Parka Bernard H (Velma) 3 (Parks Pharmacy) r 424 Mikado Parks Callister Mrs tex wkr Payne Mill h 32 Brigham (PM) Parks Candis Mrs emp Bibb Mfg Co h 139 Ross Parks Daisy R elk Sids Place Parks Dock L dr Yellow Cab Co r 280 (r) Main (EM) Parks Edith tex wkr Payne Mill r 32 Brigham (PM) Parks Ella M ( c) (o) tchr Pleasant Hill Sch h 217 Grant (V) Parks Floyd F (Lora S) hlpr So Ry r 2911 Houston (SM) Parks Hanson (c; Alice) lab Macon Cooperage Co h 363 Hazel Parks Hubert D (Marie) tex wkr Payne Mill h 178 Gardner (PM) Parks Irma (Mrs O R) tex wkr Payne Mill r 603 Plum Parks Joseph tex wkr Payne Mill r 178 Gardner (PM) Parks Pharmacy (B H Parks) 3498 Houston (SM) Parks Sarah P 3 r 206 Ridge (I) Parks Susie (c) maid Carrie M Newton Parks Wm (c; Christine) 2 h 130 (5) Hudson Parks Wm H (Clara) 1 emp Bibb Mfg Co h 847 Hazel Parks Wm M (Cleo) 3 slsmn Met Life Ins Co h 757 Ridge (I) Parnell Lorena (wid W T) h 111 Dixie Parrell Mamie (c) r 104 Gustin Parris Wm H slsmn Sterchis r 722 Mulberry Parrish Eliz (Mrs H H) opr Adams Mfg Co r 124 Sts6l6 Parrish G Henry (Alfreda) 2 (Parrishs Garage) h 420 Duncan Parrish Henry H (Eliz) 5 carp h 124 Steele Parrish Julia A (wid C C) h 516 Orange Parrish K Frances sten Schall Paint Co r 224 Georgia Parrish Sallie T furn rms 209 1st h do Parrish Sol A (Shirley) 2 (o) engr C of Ga Ry h 105 St James (SM) Parrishs Garage (G H Parrish) auto reprs 708 3d Parsons Carolyn (wid F J) sec r 323 Buford pi (V) Parsons Paul E (Nita) mach C of Ga Ry h 319 Duncan Partain Dennis H (Willie L) 3 carp h 110 Heard (SM) Paschal Lonnie (c; Emma) 1 lab h 16 (420) Steins al Paschan Bessie (c) maid B B Johnston r 422 Ward (V) Passmore Annie h 613 Orange apt 3 Passmore Hobson L r 578 Boulevard (NH) Passmore Mamie sec FERA h 613 Orange apt 3 Pastime Billiard Parlor (Geo Arthur, M E Field) 411 3d Patat Eliz (Mrs T D) marker Independent Ldry Co r 661 Walnut Patat J Prince (Eldora) 4 electrn Carburetor & Elec Serv Inc h 106 Log Cabin dr Patat Thos D (Eliz) mech Carburetor & Elec Serv Inc h 661 Walnut Pate Edw (c; Sarah) 1 (o) porter S Jones & Co h 215 Pond (V) Pate Edw (c; Cleo) 1 tr dr Parcel Del Co r 269 Madison Pate Elisha (c) h 140 (137) Sycamore (V) Pate Elisha Jr (c) student r 140 (137) Sycamore (V) Pate Eunice G (wid R H) r 241 Boulevard (NH) Pate Geo T (Maggie) (o) h 305 Rutherford (SM) Pate Jesse H (Louise) 2 (o) sec-treas C-M-P Co h 108 Rogers (V) Pate John M asst slsmgr Bibb Chevrolet Co r 339 Vineville (V) ______ $84 Baldwin's and Telegraph's Pate Jos (c; Mattie) 2 porter Goodrich Silvertown Stores h 336 Middle (V) Patterson Georgia (c) cook r 309 2d (U) Patterson Gertrude (c) dom H G Flynt r 653 Pate Marian (c) r 140 (137) Sycamore (V) Pate Minnie L (c) dom F B Peeler r 140 (137) Sycamore (V) Hazel Patterson Hilda nurse Macon Hosp r do Patterson Ida M (c) maid Fort Hawkins Sch Pate Sami G (Pauline) 2 h 471 Orange Pate Sarah (c) dom J A Molloy r 104 Spring Patillo Flewellyn elk FERA r 560 Hillyer Pattillo Lula W (wid J K) r 716 Napier Pattillo Wm A (Polly) (o) shpg elk Proctor & Gamble Mfg Co h 414 Napier Patrick Chas (c; Viola) 1 farmer h 919 Clinton rd (EM) Patrick Chas H (c) student r 211 Mutual (V) Patrick David (c; Aberta) 4 lab C of Ga Ry h 241 Waterville rd Patrick Floyd D (c; Emily B) agt Atlanta Life Ins Co h 222 Roosevelt (V) Patrick Henrietta L (c) 2 smstrs h 216 (314) Mutual (V)' Patrick Marie (c) lndrs h 205 TOombs (SM) Patrick Mary (c) h 385 Madison (V) Patrick Robt G (c; Charlie T) 5 (o) carp h 211 Mutual (V) Patrick Sami (c; Rosa L) emp Proctor & Gamble Mfg Co h 444 Tindall (SM) Patrick Vassar R (Carrie C) (o) h 1405 Vine- ville (V) Patterson Adaline (c) dom A C Tyler r 610 Clinton Patterson Alberta (c) r 713 (711) Elbert Patterson Alberta (c) 1 h 310 Patterson Patterson Alberta (c) lndrs r 112 (1534) Johnsons al Patterson Patterson AAlnmdarew(c1) barber r 117 (15) Wise (V) (c; Callie) hlpr MD&SRR r 237 Jones Patterson Ann (c) file elk County Relief r 301 e 1st (EM) Patterson Inez T (wid G E) 1 h 99 Vineville (V) apt El Patterson James (c; Sallie) (o) firemn C of Ga Ry h 121 Telfair Patterson Jesse (c; Marion) 3 (o) gro 622 3d (V) h 204 Forest (V) Patterson Jessie (c) r 310 1st (V) Patterson John T (Clara) 2 tex wkr Southland Knitting Mills h 3 Grand (B) Patterson Jones C (Ressie) h 430 Winship Patterson Joseph A (Carrie) (o) h 225 (51) Maynard Patterson Juanita M student r 203 Ormond ter Patterson Laura I (wid W N) (o) h 2632 Broadway Patterson Leila (c) 3 lndrs r 1006 Main (EM) Patterson Levi (c; Ida) 1 hlpr C of Ga Ry h 301 e 1st (EM) Patterson Lizzie (wid W H) h 653 2d Patterson Lonnie E (Lettie) 1 trav slsmn h 809 Woolfoik Patterson Louis (c; Georgia) (o) hlpr C of Ga Ry h 309 2d (U) Patterson Mack (c; Estella) 2 emp C of Ga Ry h 121 (119 3d (U) Patterson Mary (c) cook W F Hinesley Patterson Mary (c) 1 lndrs h 123 (116) Wood al Patterson Millard P (c) repr Paul Duval & Son r 120 Green Patterson Minnie (c) cook W F Myers Patterson N Felton (Eliz I) 1 (Riverside Cash Admn r 203 Telfair Patterson Annie Mrs (o) h 123 Ayers rd (B) Patterson Annie (c) dom r 107 (6) Fulton la Patterson Archie O (Clara) 2 (o) swtchmn C of Ga Ry h 132 Mill Patterson B Louis (Maude) policemn CPD h 415 Winship Patterson Berta sten Masonic Home of Ga r do Patterson C Ivey (Priscilla) gro 218 American blvd h do Gro) r 815 Poplar Patterson Nora (c) lndrs h 123 Ash Patterson Rilla Mae (c) r 1303 (514) Woolfolk Patterson Robt A (Mary) h 102 Whitehead Patterson Robt H waiter Union News Co r 869 Cherry Patterson Rosa A (c) 1 maid h 123 (122) Orchard Patterson W Hoke (Mary) tr dr r 760 Cherry Patterson W Joseph mach So Ry r 2632 Broad- Patterson Callie (c) lndrs Crescent Ldry r 213 Jones way Patterson W Joseph Jr student r 2632 Broad- Patterson Carl B (Nezzie) slsmn Central Cotton Oil Co h 125 Park (B) way Patterson Weston (c; Roberta) emp Willing- Patterson Carl B Jr student r 125 Park (B) ham Auto Co h 328 Short (EM) Patterson Caroline emp Bd of Health r 147 Patterson Wm (c; Emma) 1 h 603 (120) High Elliott Patterson Chas I (Willie A) 1 slsmn Natl Bis- Pattishall Annie (wid C J) r 103 Edna pi cuit Co h 203 Ormond ter (LCHts) Patterson Chas I III sch tchr r 203 Ormond ter Pattishall Steph E (Emmie) agt Carolina Life Patterson Claude H (Edna) 1 sta opr R A Mc- Ins Co r 852 New Cord Serv Sta h 413 Belmont Pattishall Vera emp Happ Bros Co r 258 Patterson Dallas D (Ida) 5 h 616 Church (CH) Columbus Patterson Edw (c; Aurelia) jan W H Beeks Patton Ada Mrs r 216 Bright (SM) r 620 3d (V) Patton Christine repr Silk Stocking Hosp r Patterson Edw W (Doris) tr dr Independent RD 4 Linen Sup Co h 266 Columbus Patton Clara (wid S A) 2 h 320 Ross Patterson Elmer (c) barber Clinton Brantley Patton Fannie W (wid J R) h 765 Poplar r 117 (15) Wise Patton Geo W student r 142 Hines ter (V) Patterson Elsie student r 132 Mill Patton Henry (Helen) slsmn Dr Pepper Btlg Patterson F Harlan student r 616 Church Co r 379 Orange (CH) Patton Jas M adv slsmn Macon Teleg Pub Co Patterson Fannilu sec Cherokee Hts Baptist r 142 Hines ter (V) Ch r 513 Hillyer Patton Joseph L student r 142 Hines ter (V) Patterson Fredk (Eliz) 1 capt CPD h 811 Patton June student r 124 Hines ter (V) Hemlock Patton Marion W student r 142 Hines ter (V) Patterson Geo E Jr student r 99 Vineville (V) Patton Mary T (wid S E) 1 (o) h 142 Hines apt El ter (V) Patterson Geo L (c) hlpr W R Werden Co Patton Nathan M atty HOLC r 124 Hines ter r 815 Edgewood (V) 1935 Macon City Directory 385 Patton Queen E (c) dom H K Brown Patton Ruby (c) 1 r 102 (302) Plummers al Patton Sami (c) firemn Proctor & Gamble Mfg Co Patton Sami student r 142 Hines ter (V) Patton Thos E (Ruth H) 2 (o) coir G G Harde- man Co h 285 Masonic Home rd (NH) Patton Woolvin student r 124 Hines ter (V) Paul Amos (c) lab James & Kingman Lbr Co r 110 Bay Paul August H mach C of Ga Ry Paul Benj S (Stella O) 3 emp Ga Power Co h 27 Hill Park Paul Cleo (Mrs M P) slswn Maysons r 135 Highland Paul Edna r 555 Broadway Paul Eunice (c) 3 lndrs h 603 (274) Crisp Paul Geo C ofc wkr Willingham S&D Co res Dry Branch Ga Paul Helen sten Smith & Smith res RD 1 Paul Laura M (c) h 101 (25) Tinsley la Paul Lena (c) lndrs r 603 (274) Crisp Paul Lola M (c) 4 emp Atlantic Mills r 210 (329) Fargason (V) Paul Lowell G student r 456 Duncan Paul Marian (c) dom R M Foster Paul Mildred L elk First Nat Bk & Trust Co r 1160 Elm Paul Oscar (Nita A) 1 slsmn Adams Buchanan Mtr Co h 129 Nottingham dr Paul A Carl (Mary) 1 atndt Goodrich Silver- town Stores h 1160 Elm Paul Ralph oiler Huckabee Auto Co r 107 Buckingham pi Paul Robt L (c) r 603 (274) Crisp Paul Thos (c; Birdie) 1 tex wkr Bibb Mfg Co h 404 (465) Alabama (SM) Paul Thos B (Winifred V) elk So Ry h 456 Duncan Pauls Place (Paul Kinley) confr 268% Main (EM) Pauli Matthew P (Cleo) 1 r 135 Highland Pauldo Clifford (c; Lucy) emp Atlantic Ice & Coal Co r 306 Crisp Pauldo Emmett (c) r 802 (803) Charles Paulette Wm J elk Ry M S r Edna Place rd Paulk Nellie M Mrs checker Independent Ldry Co r 821 Cherry Paullin Margt S (wid W B) (o) h 608 Forsyth Paulson Frank elk Rogers Stores r 301 Cleve- land (SM) Payne City Auditorium 67 Davis (PM) Payne City Community House Rose (PM) Payne Calder treas Willingham & Payne Inc r 355 Orange Payne Dewey (c) hlpr So Crate & Veneer Co r 263 North Payne Earl E (Maggie) 1 tex wkr r 1017 (2011) Log Cabin blvd Payne Eldridge P (Myrtle) 3 emp Bibb Mfg Co h 443 (506) Log Cabin dr Payne Essie (c) maid Burden Smith & Co Payne Ethel Mrs waitress Hotel Dempsey h 855 Mulberry apt 107 Payne Geo G r 739 Hawthorne Payne Geo W h 739 Hawthorne Payne Hubert A (Goldie) r 854 Cherry Payne Jacob carp Adams-Swirles Mill r 103 Ridge (I) Payne James H (c) r 256 Broad Payne John (c; Lula) (o) h 413 (456) Womack Payne Lessie r 739 Hawthorne Payne Lillian spinner Bibb Mfg Co r 139 Haw- thorne Payne Mary B (wid G W) r 203 Fulton (Lynmore) Payne Mill (see Bibb Mfg Co on Bellevue rd) Payne Myrtle (Mrs E P) spinner Bibb Mfg Co r 443 (506) Log Cabin dr Payne Robt L (Flora) 6 emp Willingham Mills h 268 Oakland Payne Robt L Jr student r 268 Oakland Payne Theo J (e; Clara) 1 swtchmn C of Ga Ry h 256 Broad Payne Verna Mrs r 407 Walnut Payne Virginia r 268 Oakland Payne Wm E (Azilee) 1 chf opr Postal Teleg- Cable Co r 422 Spring Payne Wm S (Tillie) r 525 College apt 1 Payne Wm S Jr (Mildred) (o) pres Willingham & Payne Inc h 355 Orange Payne Wm S III elk Central S&D Co r 355 Orange Payne Wm W emp Bibb Mfg Co r 739 Haw- thorne Payton Allene (c) cook r 317 King PEABODY ELBERT P (Burma B) 2 (o) cash The First Nat Bk & Trust Co In Macon h 695 Ingleside (I)--tel 5278-W Peabody Mary H (wid E P) r 402 Ingleside (I) Peabody S Walton sec-treas The Letter Shop Inc r 402 Ingleside (I) Peacock Allie M Mrs h 460 Mulberry Peacock Benj W (Bessie) 2 winder Bibb Mfg Co h 108 Emerald Peacock Bessie (Mrs B W) winder Bibb Mfg Co r 108 Emerald Peacock Carrie (c) cook Peter Derlien Peacock Cath emp Ivey-Twiner Ice Cream Co r 632 Forsyth apt 3 Peacock Clyde (Mrs C E) elk Dunlap-Peeler Hdwe Co r 115 Beech Peacock Chas H (Edith) (Peacock's Central Pharm) h 681 College Peacock Duffine (c) maid r 540 (248) Smith (EM) Peacock E Julian (Annie) (o) h 210 Clisby pi Peacock Evelyn r 108 Emerald Peacock Joel A (Rachel) 5 barber Hayes Barber Shop h 552 Pine Peacock John A (Leasie) 4 emp Bibb Mfg Co h 17 Bill Peacock John W (Ollie B) r 115 Broad Peacock Josie (c) emp Bibb Bag Co r 218 Pear Peacock Julius E (Clyde J) (o) cash Atlantic Ice & Coal o h 115 Beech Peacock Leasie (Mrs J A) spooler Bibb Mfg Co r 17 Bibb Peacock Paul (c; Fannie) emp Bibb Mfg Co h 610 (203) Smith (EM) Peacock Rachel (Mrs J A) spooler Bibb Mfg Co r 552 Pine Peacock Sarah r 175 English Peacock Willie B emp Bibb Mfg Co r 108 Emerald Peacocks Central Pharmacy (C H Peacock) 842 Vineville (V) Pearce Carrie L (wid R W) 1 emp Happ Bros Co r 1723 3d Pearce Clifford E (Birta) (o) coir Atlantic Ice & Coal Co h 204 Berkeley dr (I) Pearce Eliz (wid Z E) r 223 Tatnall Pearce Emma (wid C F) r 114 Walnut Pearce Helen elk Newberrys r 1723 3d Pearce Mabel elk Alf Macks Pharm Inc T 1723 3d Pearce Marshall H (Annie) 2 (o) capt CPD h 637 Orange Pearce Marshall H Jr radio opr CPD r 637 Orange Pearce Mary r 204 Berkley dr (I) Pearce T Oliver (Clyde) mgr L B Price Mer Co h 124 Birch (Napier Hts) 386 Baldwin's and Telegraph's Pearson Claudia I (Mrs S B) gro 1243 2d r , Peeler Wm H (Della) 3 (o) h 19 Bellevue rd 1430 3d Peeler Woodrow W tex wkr Payne Mill r 19 Pearson E Z (c) barber Browns Barber Shop Bellevue rd Pearson Evelyn nurse Oglethorpe Private Peeples Aaron (c; Lavenia) 4 emp Bibb Mill Infirmary r do No 1 h 909 (993) Cowan Pearson Florence r 1430 3d Peeples Mary T Mrs 1 r 205 Vineville (V) Pearson I D Mrs slswn Union Dry Gds Co Peggy Hale Inc Mrs Ann Cioud mgr clo 468 r Central Hotel Cherry Pearson Ila (c) r 224 Powell Pekor-Cook Jewelry Co (J T Cook) 603 Cherry Pearson James W (c) delmn Karsten & Denson Pell Anna V student r 259 Orange Co r 112 (533) Campbell (SM) Pell Louise E r 259 Orange Pearson Leon (c; Nettie) firemn Willingham Pell Sami B (Louise) 4 druggist Macon Hosp S&D Co h 449 Coles al h 259 Orange Pearson Luther (c) 3 r 131 McKays al Pell Sami B Jr soda dispenser Mitchell & Pearson Martin (c) lab h 133 Moccasin Slide Williams Inc r 259 Orange Pearson Martin (c) shoe shiner 221 5th r do Pellew James H (Marian C) (Taylor Trans Co) Pearson Mary E (c) tchr County Schs h 224 h 301 Clayton (V) Powell Pellew Jno T elk Bibb Mfg Co r 639 Forsyth Pearson Ralph E (Mary) 4 emp C of Ga Ry Pellew Sarah sten Murphy Taylor & Ellis h 1912 3d r 639 Forsyth Pearson Sami H (Patti) cotton inspr h 811 Pellew Sarah C (wid L E) (o) h 639 Forsyth Poplar apt 3 Pelt Eva (Mrs W T) tex wkr Willingham Mills Pearson Simeon B (Claudia I) b 1430 3d r 11 Randolph pi Pearson Simeon B Jr r 1430 3d Pelt James H (Hattie M) carp h 387 (257) Pearson Stokes (c; Mattie) lab Cherokee Brick Pio Nono Co h 701 Church al (SM) Pelt James R electrn r 387 (257) Pio Nono Peate Andrew (c; Annie) h 240 2d (U) Pelt Nancy L ofc sec Gilliam Clark r 387 Peavy Chas D (Ruth M) slsmn Sterchis r 320 (257) Pio Nono College* Pelt Sarah (wid W E) r 387 (257) Pio Nono Peavy Chas D III sta atndt Standard Oil Co Pelt W Thos (Eva) 4 tex wkr Willingham Mills r 669 1st h 11 Randolph pi Peavy Claude Mrs h 346 6th (SM) Pender Durward W tex wkr Willingham Mills Peavy Doris student r 2321 Broadway r 118 Holt Peavy Earl r 346 6th (SM) Pender J Wm (Maggie) 1 bldg contr 3205 Peavy Geo C (Alice) barber r 219 Lawton Houston (SM) h do Peavy Horace r 46 Brigham (PM) Pender John W (c; Ophelia) 1 porter Singer Peavy James A r 2321 Broadway Sewing Mach Co r 953 Ocmulgee Peavy James M mach Willingham S&D Co Pender Lois waitress Mitchell & Williams Co r 237 Washington r 3205 Houston Peavy Joseph K r 2321 Broadway Pender Mattie (c) dom Mrs G H Donnelly Peavy Lamar elk Melton Gro Co r 906 New Pendleton Benj H tr dr r 122 Log Cabin dr Peavy Lazarus (c; Mada) porter r 517 e 1st Pendleton Grady tr dr r 122 Log Cabin dr (EM) Pendleton Sallie P (wid C R) (o) h 311 Peavy Lora (Mrs A B) emp Happ Bros Co Hardeman h 906 New Pendleton Wm student r 201 Pierce (V) Peavy Loretta (c) r 132 Moccasin Slide Pendleton Wm E (Stella) mgr Equitable Life Peavy Mada (c) dom Wallace Miller r 517 1st Assurance Soc of U S h 233 Riverdale dr (EM) Pendley Lillie (wid W T) r 200 Melrose (B) Peavy Mallory (Florence) hlpr r 237 Washing- Pendley Mavis (Mrs W E) tex wkr Payne ton Mill r 200 Melrose (B) Peavy Mary (wid J V) h 237 Washington Pendley Ola (wid Morris) 2 tex wkr Payne Mill Peavy Mary L Mrs r 2321 Broadway h 111 Green (PM) Peavy Neal r 346 6th (SM) Pendley Waymon D (Mavis) 3 checker C of Ga Peavy Prentice elk M Abraham r 346 6th (SM) Ry Creosote Plant h 200 Melrose (B) Peavy Wm F (Emmie Lee) 2 hlpr h 105 (11) Peninsular Life Insurance Co G C Jackson Myrtle (EM) local agt 502 Grand Bldg Peck Ethan L (c; Mary) tr dr H Berliner Trans Penland Joseph S student r 403 Montpelier Co h 223 e 2d (EM) Penland Robt M (Mattie) 2 coir Federal Land Peck Rosa L (c) r 436 Tindall (SM) Bank h 403 Montpelier Peddicord Geo W (Christine) 2 (o) lard supv Penland Robt M Jr student r 403 Montpelier Proctor & Gamble Mfg Co h 734 Date Penn Danl (c; Sarah) 2 r 311 2d (U) Peddy Julian E Jr (Mary) 1 cotton broker Penn Fannie D Mrs opr Mary Ann Beauty h 401 College apt 4D Shop r 754% New Peek John W(c) barber 464A Poplar h 406 Penn Fannie M (c) student r 311 2d (U) Applewood Peek Ruth Mrs emp Bibb Mfg Co r 7 Bibb Penn Helen (c) 3 dom H S Shinholser r 501 1st (U) Peek Virginia (c) 4 h 116 Concord Penn Hulon E (Pauline G) 2 (o) elk FERA h Peele Martha r 206 Log Cabin dr 1028 Clinton rd (EM) Peeler Aaron M (Jane) (o) pres Dunlap-Peeler Penn Lucinda (c) cook H N Taylor h 941 Hdwe Co h 309 Georgia Montpelier Peeler Eliz J (wid C G) (o) h 127 Coleman Peeler Emory tex wkr Payne Mill r 19 Penn Margt (wid L A) librarian Christian Science Reading Room r 375 College Bellevue rd Peeler Jane S Mrs r 520 Washington Peeler Theo delmn W T Hendley Gro r 19 Bellevue rd Peeler Thos B (Jacquelyn) elk Dunlay-Peeler Hdwe Co h 99 Vineville apt E3 PENN MUTUAL LIFE INSURANCE CO Guy E Paine genl agt 306-08 Grand Bldg--tel 887 (See cards BD) Penn Mutual Life Insurance Co W C McMillan supvr farm loan div 511-13 Ga Casualty Bldg Penn Orman student r 143 Laurel 1935 Macon City Directory 387 Term Robt (c) ydmn H N Taylor r 941 Mont- Perkins John (c) h 218 Bartlett pelier Perkins John J (cl emp Buck Ice & Coal Co Penn Sami (c; Florine) jan Cherokee Hts Bap r 307 (220) Dure (U) Ch h 187 (561) North (NH) Perkins John W (Annie P) 2 tex wkr Willing- Penn Tessie M Mrs nurse 865 Orange r do ham Mills h 103 Brookdale (B) Penn Virginia student r 114 Beverly pi Perkins Johnnie (c; Lillian) 1 emp C of Ga Penn Wm J (Hester) 1 h 114 Beverly ,pl Ry h 503 Pio Nono la Pennamon Lillie (c) lndrs Crescent Ldry r 700 Perkins Josephine L Mrs. r 225 High Center Perkins Lee (c) Nettie) 4 lab h 307 (220) Pennamon Robt (c; Lillie) (o) h 700 Center Dure (U) (EM) Perkins Leola (wid E L) 1 (o) h 114 Forest Penney J C Co A L Grubbs mgr dept store (B) 362 3d Perkins Lozier r 108 (171) Forest (B) Pennington Claude L (Evelyn) 2 (o) phys Perkins Lucy M (c) student r 821 Fort Hill h 420 Overlook (I) Perkins Lula (c) 4 lndrs r 109 Neal (V) Pennington Leola (c) (o) lndrs h 478 Chestnut Perkins Melvina (c) maid Mrs. Addie C Stone Pennington Willis (c; Hattie G) (o) glazier Cen- Perkins Raymond emp Bibb Mfg Co r 114 tral S&D Co h 235 (237) Fargason Forest (B) Penny James F (Minnie) 1 elk Bennett & Co Perkins Robt 1 tex wkr Bibb Mfg Co h 216 r 758 Cherry American blvd Penny Martha opr Adams Mfg Co r 758 Cherry Perkins Robt N (Jimmye) 2 adv slsmn Macon Penny Minnie (Mrs J T) opr Adams Mfg Co Teleg Pub Co r 813 Poplar apt 1 r 758 Cherry Penny Profit Store (M J Avera) gros 2402 Perkins Perkins Roberta (c) 2 Rufus (Annie hP)1:032 Hicks al tex wkr Payne Broadway Mill h 56 Davis (PM) Pennyman Albert (c; Mary L) 1 h 96 Shamrock Perkins Sara (c) r 337 Elbert Pennyman Andrew (c; Annie) 3 hlpr h 214 Perkins Thos (Gazella) 1 supt Nat L & A Ins Woodliff Co h 906 College Pennyman Anna (c) 2 h 861 Edgewood Perkins W Elmer tex wkr Payne Mill r 108 Pennyman Chas (c; Leva) 4 h 326 Green (171) Forest (B) Pennyman Ernest (c) r 210 Woodliff Perkins Wallace (c; Emmie) 4 (o) h 1245 Pennyman Herman (c; Pearl) r 92 (4) Schofield Dempsey Pennyman Joseph W (c; Ella) h 210 Woodliff Perkins Walter E (Corine) 1 tex wkr Payne Pennyman Mary (c) maid R L Garrett r 96 Mill h 4 Grand (B) Shamrock Perkins Wm (c; Ada) h 337 Elbert Pennyman Wm (c) r 210 Woodliff Perkins Wm I (Frances) 1 slsmn h 109 High- Pennyman Wm cook 98 Osborne pi (I) land (LCHts) Pentecost Clras (Ophelia) h 558 Elm Perkins Wm L (c; Annie) gro 821 Fort Hill Pentecost Wm H r 558 Elm h do Peoples Grace Mrs spinner Bibb Mfg Co Perkle Fredk (Virginia) elk FERA r 1120 Peoples Sarah (c) cook W R Allen h 653 Walnut Oglethorpe Perminter John J formn So Ry r RD 1 Perdue Alonzo (c; Suela) lab C of Ga Ry h Perriot John M (Julia) 1 slsmn Armour & Co h 369 3d (U) 242 Belvedere dr Perdue Chas H (Lucile E) (o) dentist 303 Perry Ada M (wid M M) r 203 (103) 3d (SM) Macon Savings Bk Bldg h 106 Buford pi (V) Perry Addie (c) 1 (o) h 436 Tindall (SM) Perdue Dennis (c) lab C of Ga Ry Perry Albert (c; Florence) lab Cherokee Brick Perdue Gertrude (c) dom E G McKenzie Co h 1 Harris al Perdue Wm R (Edna K) shpg elk Freeman Perry Coile T r 806 Cherry Dent Sullivan Co h 126 North (NH) Perry E Barbara nurse 556 College r do Perdue Wm R Jr student r 126 North (NH) Perry Edwina tchr Alex Sch No 3 res Perkins Addie M tex wkr Willingham Mill r Columbus rd RD 2 1015 (2009) Log Cabin blvd Perry F Marvin elk Ry M S res Columbus rd Perkins Albert (c; Bertha) lab h 513 Hazel RD 2 Perkins Anna (c) cook Edith R Killian Perry Geo (c) dish washer Macon Cafeteria Perkins Annie (c) (o) h 1239 Dempsey r 526 Middle (EM) Perkins Annie M (c) r 307 (220) Dure (U) Perry Georgia M (wid C T) r 108 1st (CP) Perkins Annie P (Mrs Rufus) tex wkr Payne Perry Grace (c) r 12 Cheatham al Mill r 56 Davis (PM) Perry Hattie L (c) cook C M Cork Perkins Arth D (Estelle) 3 supv Ga Power Co Perry Irene (c) student r 70 Spring h 1171 Ash Perry J C (c; Minnie) archt r 111 Tatnall Perkins Bessie tex wkr Payne Mill r 108 Perry J Cecil slsmn Marilyn Slipper Shop r (171) Forest (B) 806 Cherry Perkins Chas (c; Pinkie) r 101 Hicks al Perry James (c; Camila) h 11 Parker al Perkins Columbia (c) 2 h 566 Hammond Perry John C (c; Esther) 3 gro 70 Spring h do Perkins Cora (c) 1 dom r 216 (159) Grant (V) Perry Joseph (c; Mary) chauf Mrs Carrie Perkins Emma (c) maid h 410 Monroe (V) Colbert h 115 (112) Lynwood (V) Perkins Ernest (Lyda) 216 American blvd Perry L Emmett r 203 (103) (SM) Perkins Eunice tchr Lanier High Sch for Perry Mary (c) maid G O Wynn r 115 (112) Boys h 553 Orange apt 6 Lynwood (V) Perkins Frances (c) r 1256 2d Perry Mildred h 306 Fairmont (B) Perkins Geo (c; Ollie) 2 cook Spillers Restr * Perry Minie (c) maid Annie L Battle r 111 h 5 Cheatham al Tatnall Perkins Henry (o) tex wkr Payne Mill h 108 Perry Nell sec-treas Juliette Milling Co r 810 (171) Forest (B) Mulberry Perkins J T gro 3 Grand (B) r 18 do Perry Patsy (c) (o) lndrs h 806 (820) Cowan Perkins James (c) r 8 Toombs (SM) Perry Pearl (wid O M) 1 (o) h 203 (103) 3d Perkins Jasper (e) lab r 1239 Dempsey (SM) 388 Baldwin's and Telegraph's Perry Robbie L r 806 Cherry Perry Robin T (Lula) 2 emp Jeffreys-McElrath Mfg Co h 307 Ridge (I) Perry Speer (c; Ruth) lab C of Ga Ry h 98 Bay Perry Tom M lawyer 1 Hardeman Bldg res Columbus rd RD 2 Perry Warren r 306 Tairmont (B) Perry Wm L (c) trkr C of Ga Ry r 709 (619) Prince (SM) Perry Wm F (c) delmn Carstarphen Inc r 1211 1st Perryman Frances r 2524 2d Perryman Henry C (Grace) 1 (o) condr C of Ga Ry r 2524 2d Persall Pearl r 516 Oglethorpe Persley Thos K (c; Maxie) (o) ins agt h 215 Madison (V) Person Alonzo (c) r 154 Broad Person David P (c; Lillie H) 4 barber J W Peeks h 228 Roosevelt (V) Person Eug G (Hattie) dispr C of Ga Ry h 2116 Forsyth rd Person Josephine tel opr So Bell Tel Co r 2116 Forsyth rd Person Mollie N (wid R L) r 1134 College dr Person Pink (c) lab h 502 Academy al (EM) Person Ulysses (c; Fannie M) 1 h 110 (109) Mitchell Person Wm B (c; Ora) lab Birdsey Flour Mills h 1524 1st PERSONAL FINANCE CO Emory C Smith mgr Salary Loans 411-13 First Nat Bk Bldg --tel 366-367 Persons Alva G slsmn Ga Caro Oil Co r Southland Hotel Persons Alva G Jr shpg elk Ga Caro Oil Co r 123 Violet Persons Annie Mrs opr Happ Bros Co r 123 Violet Persons Dinah (c) r 750 Center (EM) Persons Essie M (c) 3 r 426 Flanders Persons Henry P (Ruth) 2 (o) slsmgr R A McCord Mtr Co h 122 Buford pi (V) Persons Hudson (Veola) 1 tex wkr Payne Mill h 63 Davis (PM) Persons James (c) lab r 750 Center (EM) Persons John W (c; Rosamond) 3 r 114 (532) Campbell (SM) Persons Veola (Mrs Hudson) tex wkr Payne Mill r 63 Davis (PM) Persons Willie M (c) r 750 Center (EM) Pete Edw (c) student r 524 Calhoun Peterman Franklin (Gladys) 1 r 119 Ell (SM) Peterman Ida r 614 Church (CH) Peterman Nina waitress Roberts Cafeteria r 220 1st Peterman Oscar E (Gladys) mech Henry Koplin h 624 Church (CH) Peters Eliz (c) h 244 5th (V) Peters Frank (c) lab City St Dept h 4 (123) Paradise al Peters Geo (Margt) 3 (o) h 217 Adams Peters Joseph (c; Eldora) h 542 3d (V) Peters Maybelle (c) maid r 210 Middle (V) Peters Minnie (c) h 438 O'Hara la Peters Robt F (Mary) 4 (o) h 1155 Napier Peters Roy (c) r 244 5th (V) Peters Thos (c; Mattie) 1 r 214 Woodliff Peterson Clarice Mrs r 322 Georgia Peterson Elmer L embalmer Pitts Mortuary r 814 Mulberry Peterson Pearl (c) 2 h 417 Bright al Peterson Thelma sten So Ry h 810 Mulberry apt 8 Peterson Vivian h 516 Ocmulgee Peterson Wm (c) h 245 Harris 1985 Macon City Directory Pettey David student r 103 Ridge (I) Pettey Lillie (wid S D) h 338 Ross Pettey Mattie M Mrs (Mary Ann Beauty Shop) r Hotel Arcadia Pettey Noma L (Mrs S A) sten Bankers H & L Ins Co r 129 Edna pi Pettey Oscar D (Margt) 1 h 249 Belmont Pettey Robie J (Gussie) 2 r 328 Ross Pettey Seth A (Nona L) (o) lard formn Proc- tor & Gamble Mfg Co h 129 Edna pi (LCHts) Pettigrew John (Mary) h 225 (51) Maynard Pettigrew Mary (Mrs J S) tex wkr Bibb Mfg Co r 225 (51) Maynard Pettis Addie (wid W J) r 408 American blvd Pettis Hattie r 817 Broadway Petty Arth M (Mae M) 1 (o) slsmn Sterchis h 3708 Houston Petty Arth M Jr (Eliz S) mgr Sterchis Poplar St Store r 1150 Milledgeville rd Petty Beatrice student r 3708 Houston Petty J Melton dr Yellow Cab Co r RD 2 Petty James C (Murray H) radio serv mn Sterchis r 3708 Houston Petty Ruth student r 3708 Houston Petzinger Chas F (Mary A) (o) genl formn C of Ga Ry h 742 Courtland Peyton Blanche r 129 Pearl Peyton C Elijah (Pearl) 2 carp C of Ga Ry h 129 Pearl Peyton Eunice (Mrs Thos) winder Bibb Mfg Co r 664 Elm Peyton James (c) r 724 Hazel Peyton Thos (Eunice) 1 emp Swift Oil Mill r 664 Elm Pharm James (c; Bessie) lab h 704 (262) Charles Pharmes Amos (c) hlpr Flanagans Camp r 110 Antioch rd Pharmes Jesse (c; Naomi) 1 (o) brkm% C of Ga Ry h 102 (170) DeBorde Pharr Tillmon I (Eliz) 1 carp r 1521 Broadway Phelps Addie M (c) r 223 Price (V) Phelps Alice (c) r 418 Elliott Phelps Bernice case wkr Macon Transient Bur r 860 Pine Phelps Chas (c; Zelta) 3 lab- So Crate & Veneer Co h 515 Flanders Phelps Claude (c) r 313 (320) Bowman Phelps Glasgow (c; Fannie) 4 jan Massee Apt h 223 Price (V) Phelps Hattie (c) tex wkr Bibb Mfg Co r 9 Short (EM) Phelps Homer (c; Hattie) h 9 Short (EM) Phelps J C (c; Rosa) r 313 (320) Bowman Phelps Jerry (c; Etta) jan Block Apts h 861 Ocmulgee Phelps Jessie (c) r 313 (320) Bowman Phelps Joseph (c; Edna) h 157 Elm Phelps Josey (c) r 157 Elm Phelps Lee O (c) h 418 Elliott Phelps Mason B (Lucile) 2 r 130 Appleton Phelps Richd (c; Ophelia) 3 tex wkr Bibb Mfg Co h 313 (320) Bowman Phelps Richd Jr (c) r 313 (320) Bowman Phelps Rosa L (c) cook E H Dunn r 313 (320) Bowman Phelps Wm (c) 2 h 118 (37) Craft (V) Phelps Wm (c) hlpr h 109 Curds al Phelps Wm B (c; Maggie) porter Anderson Clayton & Co h 209 Mutual (V) Phelts Amos M (c) carp r 211 Grant (V) Phelts Emma C (wid R J) (o) h 1070 Walnut Phi Delta Theta Fraternity 315 Coleman Philadelphia Hat Cleaning Co (Chas Chirbas) 615 Cherry Phillips A Lionel (Ethel J) 4 supt Nat L & A Ins Co h 255 Oakland Phillips A Maynard (Julia G) 1 phys 818 Ga Casualty Bldg h 107 Alabama (V) Phillips Abbie nurse Middle Ga Hosp r do Phillips Annie r 553 Orange apt 2 Phillips Annie L (c) maid S V Anderson r 123 Roosevelt Phillips Benj (e) lab Macon Milling Co r 140 Jones Phillips Bessie (c) 5 h 226 (133) Tindall (SM) Phillips Cha3 student r 131 Culver (V) Phillips Chas H (Lena F) (o) slsmn h 2601 Forsyth rd Phillips Chas M plant supt Gulf Refining Co rY M CA Phillips Clarence A (Geneva) maintenance supv State Hwy Bd h 316% Cherokee Phillips Daisy (wid J A) r 111 School Phillips David G mgr The Grand Bldg and Macon Academy of Mus Co r 216 2d Phillips Eug G (c; Mamie) (o) carp h 712 Elm Phillips Eunice (c) 1 tex wkr Bibb Mfg Co h 159 (345) Nussbaum Phillips Eva E (c) tchr Pleasant Hill Sch r 419 North Phillips Fannie (c) r 653 Dunlap al Phillips Fanny L (c) checker Hotel Dempsey r 219 Elliott Phillips Garrett L elk Ga Power Co h 213 Bond apt B2 Phillips Harry (Ethel) r 1024 2d Phillips Henrietta Mrs r 869 Hemlock Phillips Henry (c) r 419 North Phillips J Quitman (Mollie) jan A L Miller High Sch h 285 Winship Phillips J Robt (Viola) 2 h 112 Duncan Phillips Jack elk Log Cabin Serv Store r Bloomfield rd Phillips James r 222 Coleman Phillips James (Mary) carp h 111 Dewitt Phillips Jos J (Faye) 2 supt So Crate & Veneer Co h 301 Brentwood Phillips Joshua (c; Lillie) tr dr A G Rhodes & Son r 84 (133) Forest (V) Phillips Leslie r 131 Culver (V) Phillips Lessie Mrs r 563 Hemlock Phillips Lillie (c) cook Morris Michael r 84 (133) Forest Phillips Lizzie (c) maid Martha L Hatcher r 653 Dunlap al Philipps Lonnie emp Jacks Place r RD 6 Phillips Mae Mrs slswn r 225 Adams Phillips Maggie G (c) 3 cook S P Sanford r 123 Roosevelt (V) Phillips Mattie (c) cook H W Deaton Phillips Mitchell (c) r 205 Powell Phillips O D opr Happ Bros Co r 317 Cleveland (SM) Phillips Robt (c) student r 84 (133) Forest (V) Phillips Sallie (c) maid h 419 North Phillips Sarah (Mrs W S) mach opr Happ Bros Co r 669 New Phillips Susie Mrs 1 (Sous Place) h 1931 2d Phillips Verna (c) maid r 317 Coles al Phillips Virginia sch tchr r 131 Culver (V) Phillips Wade S (Sarah) emp Happ Bros Co r 669 New Phillips Wm (c; Lizzie) 2 jan r 653 Dunlap al Phillips Wm L (c) r 408 Ward (V) Phillips Wm L (c; Hattie) (o) pastor Vineville Baptist Ch h 408 Ward (V) Phillips Wm M (Mattie) h 317 Cleveland (SM) Philmon Eliz (Mrs M P) opr Happ Bros Co r 460 Virginia Philmon Homer A (Thelma) 1 (o) brklyr h 122 Pearl Philmon Marvin P (Eliz) jan Winship Sch h 460 Virginia Philmon Thos D (Beulah) (o) farmer h 113 Rocky Creek rd Philmon Willie B sten W E Dunwody Jr r 460 Virginia Philson Lula (c) maid A B Birdsey r 205 Forest (V) Phinazee Henry (c; Ledonia) lab h 101 Dure (U) Phoenix Chas (c; Carrie) (o) h 152 Lynwood (V) Phoenix Mutual Life Insurance Co A J Lyndon local rep 203 Macon Sav Bk Bldg Pi Kappa Alpha Fraternity Hall 419 Johnson Pi Kappa Phi Fraternity 219 Coleman Pickard H Frank (Eliz) 2 flgmn C of Ga Ry h 766 New Pickens Tempie (c) r 408 (467) Alabama (SM) Pickens Thos (c; Annie) 1 lab h 408 (467) Alabama (SM) Pickering Geo A (Willie P) 2 (o) mech Steve M Solomon h 110 Mill Pickett Chas A (Agnes) 3 (Quality Food Store) h 149 Laurel Pickett Clifford (c) lab r 116 1st (U) Pickett Eug W (Louise) (o) elk Central City Auto Parts Co h Clinton rd extd (EM) Pickett Ida M elk Ga Power Co r 1015 Clin- ton rd (EM) Pickett Ida T (wid E W) h 1015 Clinton rd (EM) Pickett Jerry (c; Annie) 1 emp C of Ga Ry r 126 Edgewood Pickett Wm H elk Quality Food Store r 1015 Clinton rd (EM) Pierce Annie Mrs r 911 Orange Pierce Chas (c) r 361 (3) 7th Pierce Courtland C (Mary) 2 wtchmn h 302 Fairmont (B) Pierce Crawford N (Mary) r 726 College Pierce Eliz Mrs 1 sten W B Holmes r 854 Cherry Pierce Essie (c) emp Snows Ldry h 421 (520) Elizabeth (SM) Pierce Estelle emp Burden Smith & Co r 911 Orange Pierce Frances r 129 Virginia Pierce Gordon I (Mamie T) 2 inspr Ga Power Co h 106 St James (SM) Pierce Helen D student r 560 Broad Pierce Ira (c; Annie) h 125 (541) Railroad Pierce Irene (c) student r 102 (342) Grant (V) Pierce J Albert (Melba tr dr McNair Lbr & Sup Co r 606y2 Forsyth Pierce John E (Griggs Swap Mkt) r RD 6 Pierce Lucia r 620 (520) Mikado Pierce Manson C (Iris E) 1 bldg supt Mercer Univ h 624 Adams Pierce Maxie (c) emp Macon Cafeteria r 421 (520) Elizabeth (SM) Pierce Minnie (wid C W) 4 h 2109 Broadway Pierce N Allen (Lillian) 2 h 620 (520) Mikado Pierce O Eug (Alma) gdnr h 117 (123) Grady Piercy Alex Z (c) barber Browns Barber Shop h 140 1st (V) Piercy Jehu (c) porter Dannenbergs r 377 Monroe (V) Piercy Sophie E (c) maid h 377 Monroe (V) Pierson Emma (c) r 508 (605) Henrietta (SM) Pierson Frank (c) firemn Bldrs Lbr Co h 512 Martha Pierson John S (Willie M) 2 (o) h 706 Wool- folk Piggly Wiggly Stores R H Kingman Jr pres M E Everett v-p J H Brown sec-treas gros 464 2d, br stores 358 Hardeman 458 Mulberry 818 and 1913 Vineville 452 1st 474 and 1007 2d 390 Baldwin's and Telegraph's Fig-in-Sax (J A Smith) barbecue 2005 Vineville (V) Pig-in-Whistle Sandwich Shop J B Bryan mgr 605 Georgia Pike Sam doffer Bibb Mfg Co Pike Thelma Mrs spinner Bibb Mfg Co Pilcher Elsie Mrs emp Happ Bros Co r 328 Columbus Pilcher J Alton (Mary J) (Pilchers Serv Sta) r 307 Duncan Pilcher Julian student r 124 Charles Pilcher Marie (wid H R) 2 r 414 Jackson Pilcher Mary F (wid J L) (o) gro 301 Duncan h 307 do Pilcher Reuben V mech Ga Power Co r 115 Flamingo dr Pilcher Rosalie sten r 307 Duncan Pilcher S Lois student r 307 Duncan Pilcher T Roger (Susie E) 3 mech Ideal Stor- age Garage h 124 Charles Pilcher Vivian asst W C Boswell r 414 Jackson Pilchers Service Station (J A Pilcher) 918 Napier Piland Chas A (Mary E) claim adjuster So Ry h 104 Courtland Piland Eliz L r 104 Courtland Pilgrim Health Life Insurance Co (c) Henry Wynn dist mgr 527% Cotton Pilot Club Thelma Peterson pres meets 1st and 3d Tues 6:30 p. m. 200 Baconsfleld (NH) Pilot Club Dental Clinic Olivia Gleason dentist 1818 Broadway PINDAR GEO A (Pindar & Custer) r 335 College PINDER & CUSTER (G A Pinder O C Custer) lawyers 705-06 Bibb bldg--tel 683 (See page 104) Pine Ridge Primitive Baptist Church (c) 388 Robinson rd Pinholster James C (Marian) 3 stmftr h 123 James (LCHtS) Pinholster Raymond A elk Great A&P Tea r RD 2 Pinholster Sidney L elk Great A&P Tea Co r RD 2 Pinkerton Marie D (Mrs R H) bkpr McCommon Bros r 123 Log Cabin dr Pinkerton Mattie (wid PH) (o) h 123 Log Cabin dr Pinkerton Robt A (Marion R) 1 (o) elk P O h 212 (215) Log Cabin dr Pinkerton Roy H (Marie) elk L A Thomas Drug Co r 123 Log Cabin dr Pinkett Edw (c) 2 h 219 (258) Garden Pinkett Eliz (c) r 219 (258) Garden Pinkney Lillie (c) cook Macon Cafeteria Pinkney Willie M (c) r 303 Elbert Pinkston Alf (c; Kate) 1 h 325 4th (V) Pinkston Alf Jr (c) shoe shiner Jack Sheftall r 325 4th (V) Pinkston Beatrice (c) student r 325 4th (V) Pinkston Ethel (c) cook Lamar Harrell r 325 4th (V) Pinkston Eura (c) maid r 266 4th (V) Pinkston Gordon P (c; Lelia) 2 lab So Ry h 360 Hazel Pinkston J David (Jewell) 2 elk W S Mansfield r 207 College pi Pinkston James (c) r 266 4th (V) Pinkston Katie (c) cook W L Roberts r 325 4th Pinkston Leo (e; Darnell) 6 h 216 Fargason Pinkston Lucille (c) student r 325 4th (V) Pinkston Martha (c) 1 r 502 (453) Alabama (SM) Pinkston Mary Mrs 1 r 218 Georgia Pinkston Mary (c) 1 cook H S Popper r 103 Richard (U) Pinkston Mina (c) dom h 107 Walls al Pinkston W Asberry (c; Annie B) 1 porter h 115 Sycamore (V) Piper Bernard H (Frances) 1 elk P O h 425 College Piper Kansas tex wkr Atlantic Mills r 64 Roff Home pi Piper Wm r 64 Roff Home pi Pipkins Corinne (c) cook P V Chambliss r 111 (187) May* Pipkins Henry (c; Corinne) emp C of Ga Ry h 111 (187) May Pipkins Wassie (c) r 111 (187) May Pippen Lillian r 422 Spring Pippin Laura (Mrs R R) slswn Mangels r 309 Peachtree Pippin Marie (Mrs T M) opr Dixie Roll & Cot Co r 105 Capital (Mikado pi) Pippin Raymond R (Laura) elk Ry Exp Agcy r 309 Peachtree Pippin Thos M (Marie) 1 (o) coir Kaybee Clo Store h 105 Capital (Makado pi) Pittman Agnes tchr A L Miller High Sch r 609 Anderson Pittman Carolyn student r 609 Anderson (SM) Pittman Chas W (Maude) 1 (Sta J O Y Bar- becue) res RD 1 Forsyth rd Pittman Chas W atndt Rays Serv Sta r 117 Rogers (V) Pittman Clarence G (Pauline) 3 (o) engr C of Ga Ry h 508 Ridge (I) Pittman Dovie mach opr Happ Bros Co r 702 1st Pittman Durham student r 437 Ross Pittman Durham A delmn College Hill Pharm r 437 Ross Pittman Grovenia r 270 Astor Pittman Guy W (Hattie) emp Bibb Mfg Co h 317 Main (EM) Pittman Harriet S student r 105 Culver (V) Pittman Henry W (Mary L) (o) fety mgr Bibb Mfg Co h 117 Rogers (V) Pittman Herman A (Coleta) 3 patrolmn CPD h 330 Columbus Pittman John H (Ruth) (o) meat ctr L D Brown h 609 Anderson (SM) Pittman Jos F elk Bibb Mfg Co r 117 Rogers (V) Pittman Josephine (c) 3 h Lawton (B) Pittman Louise D tchr Alex Sch No 3 r 117 Rogers (V) Pittman Lula Mrs r 609 Anderson (SM) Pittman M C Roofing Co (M C Pittman) r 559 Mulberry Pittman Mary (Mrs) 1 tex wkr h 270 Astor Pittman Mary R r 317 Main (EM) Pittman Marvin C (Hulda S) (o) (Pittman Roofing Co) h 105 Culver (V) Pittman Marvin C Jr student r 105 Culver (V) Pittman Nadine r 270 Astor Pitts Abner C (Lillie Y) 1 (Pitts Pharm) h 104 Park (B) Pitts Abram (c; Annie H) lab Willingham S&D Co r 1406 Ardvines al Pitts Alberta (c) maid r 215 Jefferson Pitts Alice (c) maid W O Kinney r 415 (464) 3d (V) Pitts Andrew J (c; Louise) 3 lab h 406 (508) Maynard Pitts Andrew J Jr (c) emp Bibb Mfg Co r 406 (508) Maynard Pitts Annie (c) (o) h 115 Hartley (Lynmore) Pitts Annie (c) h 109 May Pitts Annie (c) dom J P Hadarits res RD 3 Pitts Annie (c) sch tchr r 602 Broad 1936 Macon City Directory 391 Pitts Berry T (c; Lula) h 520 Ross Pitts Bessie (c) maid R H Pitts h 450 City Hall la Pitts Bettie A (c) hairdrsr h 1154 Edgewood Pitts Carrie (wid MB) r 703 Woolfolk Pitts Carrie M (c) r 432 Peters al (EM) Pitts Celton R (c; Harriett) porter Acme Fish & Oyster Co h 610 Broad Pitts Chas (c; Louvenia) 9 emp C of Ga Ry h 518 (118) e Academy Pitts Chas (c) emp C of Ga Ry r 610 Center (EM) Pitts Chas L (c) r 509 Straight (U) Pitts Chas N (c; Zephyr) (o) tailor 22 Wall h 659 Spring Pitts Clarence (c; Emma) 2 lab Maxwell Bros h 215 (858) Moore la Pitts Cleo (c) r 418 Hawthorne Pitts Daisy (c) r 542 3d (V) Pitts David (c) emp Kingman & Everett r 710 3d (V) Pitts David (c) ydmn 712 Hillyer Pitts Edw (c) r 710 3d (V) Pitts Eliz (c) r 610 Center (EM) Pitts Eliz (c) dom r 509 Straight (U) Pitts Emma (c) r 902 Broad Pitts Emma (c) cook S P Maddox r 109 May Pitts Eug (c; Jessie) h 224 Lynwood (V) Pitts Eug (c; Doshia) emp Kingman & Everett h 710 3d (V) Pitts Felton (c; Beatrice) delmn J B White r 235 Cedar (U) Pitts Florence (c) 2 r 1406 Ardvines al Pitts Fredk D (Ruth D) 3 mgr Pitts Mortuary h 2Q3 Nottingham dr Pitts Geo (c; Esther) 2 lab C of Ga Ry h 148 Turpin Pitts Geo (c; Alice) lab h 415 (464) 3d (V) Pitts Hattie (c) 1 (o) r 200 (129) Grant (V) Pitts Hattie L (c) sch tchr r 200 (129) Grant (V) Pitts Henry (c; Fannie M) lab r 109 May Pitts Herman (c) hlpr Moffett Transit Lines r RD 2 Pitts Homer B (c) (o) carp h 902 Broad Pitts Ida L (c) lndrs r 406 (508) Maynard Pitts Jacob (c) emp C of Ga Ry h 610 Center (EM) Pitts James (c) cook D F Brown r 451 Martha Pitts James (c; Mattie) (o) firemn C of Ga Ry h 503 (470) Alabama (SM) Pitts James (c) lab C of Ga Ry r 255 Plant (SM) Pitts Jesse (c) emp Independent Ldry Co r 224 Lynwood (V) Pitts Jessie M (c) cook W C Liles r 402 (504) Maynard Pitts John (c) h 450 Dunlap Pitts John (c) emp Paul Williams Co r 115 Hartley (Lynmore) Pitts John N (c; Henrietta) h 413 (354) May- nard Pitts Josephine (c) lndrs Crescent Ldry r 609 (241) Hall (EM) Pitts Juanita (c) student r 123 Lexington Pitts Juby (c; Annie) 2 lab James Lbr Co h 17 Turpin la Pitts Lee (c; Annie) h 206 Collins pi Pitts Leroy (c) r 215 Jefferson Pitts Lillie (Mrs A C) asst Pitts Pharm r 104 Park (B) Pitts Louise (c) r 273 1st (V) Pitts Malcolm C bkpr First Nat Bk & Trust Co r Y M C A Pitts Mamie (c) cook W R McCoy r 4 (123) Paradise al Pitts Mortuary F D Pitts mgr 814 Mulberry Pitts Nancy (c) 1 h 1406 Ardvines al Pitts Otelia (c) cook B F Bethune r 103 Price (V) Pitts Pharmacy (A C Pitts) 2902 Forsyth rd Pitts Richd (c; Betsy) h 302 Texas Pitts Robt lab r 125 (143) Tatnall Pitts Robt H (Dorothy) 1 h 516 Hemlock Pitts Roberta (c) matron r 209 Middle (V) Pitts Rolland (c) student r 123 Lexington Pitts Rosa (c) cook J J Daly Pitts Rosebud (c) h 868 Willow Pitts Ross (c; Lillie) 5 (o) jan h 123 Lexington Pitts Thos (c; Stella) h 113 Walls al Pitts Thos E (c; Tessie) (o) carp h 602 Broad Pitts Velma (c) maid J C McMillan r 509 Straight (U) Pitts Vernon (c) student r 123 Lexington Pitts Walter (c; Nellie M) 2 (o) sexton Lyn- wood Cemetery h 122 Moughon (V) Pitts Wm (c; Martha) carp h 402 (401) Mit- chell Pitts Wm M (c) h 21 Parker (V) Pitts Wm T mgr So Paint & Varnish Co r James Ga Pitts Willis (c; Roberta) r 209 Middle (V) PIZER HERBERT J (Irene) mgr Riverside Ice & Coal Co r 810 Mulberry apt 1--tel 484 Plaskitt James M (Mary) 4 mech So Ry h 118 Buford pi (V) Platt Ada R (wid James) tchr Winship Sch r 365 Cherokee Platt Harold A elk Bearings Sup Co r '207 Clisby pi Platt Mary S (Mrs HA) (o) h 207 Clisby pi Player Sami T Jr slsmn Dannenberg & Waxel- baum Co r 635 Vineville Plaza Cafe (Steve Zalomis Louis Belos & Peter Callianos) 310 2d Plears Henry (c) r 690 Center (EM) Pleasant Ella (c) r 851 Broadway Pleasant Hill Beer Parlor (Barney Stein) 630 Washington Pleasant Hill Grocery (Mrs Mary Weinberg) 425 (424) 3d (V) Pleasant Hill School (c) Zella C Benton prin 323 Ward (V) Pleasant Mardina (c) maid r 224 Collins pi Pleasant Robt (c; Mardina) h 224 Collins pi Pless Essie M (c) cook R A Hill r 102 (2) Bartlett Pless Euna M (c) cook Mrs V R Napier r 502 Jay Pless Fannie (c) lndrs r 110 (815) Amos (V) Pless John (c) farmer h 407 (127) Edison Pless Norman (c; Eunice) 6 chauf h 219 Pond (V) Pless Wm (c; Euna M) 2 emp C of Ga Ry Creo- sote Plant h 502 Jay Plezz James (c; Melissa) 6 h 209 Lynwood (V) Plezz Lillian (c) 5 dom r 169 Roye Plowden L R elk So Crate & Veneer Co r 554 1st Plum Street Service Station (H C Wallace) 570 1st Plumber Cora (c) 3 r 238 1st (V) Plumbers & Steamfitters Union G L Lewis sec meets 2d and 4th Tuesdays 8:00 p m 1502% Broadway Plummer Jessena (c) cook W G Allen r 315 Patterson Plummer Laura M (c) maid J E Clay Plummer Walter (c; Jessena) porter Ry Exp Agcy h 315 Patterson Plunkett Blanche C r 3145 (r) Houston Plunkett Carrie (Mrs Ernest) tex wkr Bibb Mfg Co r 845 Hazel 392 Baldwin's and Telegraph's Plunkett Clarence G (Nannie) 2 (o) (The Storage Battery Co) h 224 Lynmore Plunkett Ernest (Carrie) pntr h 845 Hazel Plunkett J Rudolph shoe repr Dannenb'ergs r 3145 (r) Houston Plunkett John P (Ola) 1 mach Bibb Mfg Co h 3145 (r) Houston Plunkett M H emp State Hwy Dept r Arcadia Hotel Plunkett Ruth (wid W H) r 109 Washington apt 2 Plunkett Robt G (Portland) (o) lawyer 408 Ga Casualty Bldg r 2518 Forsyth rd Plunkett Thelma B opr Adams Mfg Co r 3145 (r) Houston Plunkett W Hazel sten R G Plunkett h 109 Washington apt 2 Poe Annie S Mrs (o) h 95 Lawton Poe Harry H slsmn r 17 Arlington pi Poe Hugh J asst aud Hotel Dempsey r 95 Lawton Poe J Ellis elk FERA r 95 Lawton Poe Lena V (wid W A) h 17 Arlington pi Poe Mary R r 17 Arlington pi Poe Mattie Mrs r 401 College apt 8G Poe Ouida tchr Jos Clisby Sch r 95 Lawton Poe Wm P (Ethel) 3 elk Bibb Mfg Co h 241 Belvedere dr (I) Poe Wm R (Willie May), 2 trav rep Buckeye Cotton Oil Co h 99 Vineville apt B1 (V) Poe Willie N sten r 17 Arlington pi Poissant Lila M (wid W A) sten Macon Transient Bur r 476 College Poke Sallie (c) r 817 Fort Hill Poland DeWitt M (Ida R) 1 pharm L & N Drug Co h 452 Cherry Poland Harold C (Jeanette) drftsmn Ga Power Co h 321 New apt 1 Polar Bear The (R B Wadley) restr 2915 Forsyth rd Polenz Augustus (Hannah) umbrella repr 618 New r do Poline Joseph (c) lab City Storage Garage r 75 New Polk Lenora Mrs 2 r 467 Cotton POLK R L & CO directory publishers, 431 Howard Detroit Michigan Poliak Arnold r 401 College apt 2D Pollard Carrie (c) 2 emp Bibb Mfg Co h 13 (561) Witkowskis la Pollard James (c; Annie) hlpr McCormick Deering Store r 7 Harris al Pollard Odus P (Evelyn) 2 emp Bibb Mfg Co h 849 Hazel Polley H Wm (Gertrude N) (o) (So Paint & Varnish Co) h 229 Nottingham dr Pollock Cath (c) (o) h 111 (557) Campbell (SM) Pollock Ella (c) r 378 (384) Monroe (V) Pollock J Allison (Susie) 2 tr dr Power Oil Co h 210 Central (SM) Pollock H Wesley dispr So Ry r 106 2d Pollock London (c) h 235 5th (V) Pollock Mattie (c) (o) tchr Pleasant Hill Sch r 235 5th (V) Ponder Allen T (EUa L) 1 barber Vineville Barber Shop h 406 (408) Forest (V) Ponder Amos Jr (c; Myrtle) 1 delmn h 104 Hazel Ponder Annie B (c) r 1115 (221) Woolfolk Ponder Ella (c) r 114 Wings Hill Ponder Elmer (c) hlpr r 157 May Ponder Essie (c) 3 cook W F Allen r 157 May Ponder Evelyn C r 406 (408) Forest (V) Ponder Isabella (c) lndrs h 124 (750) New St la Ponder Jettie (c) r 157 May Ponder Lillie M (c) r 416 Hammond Ponder Lula (c) cook r 117 (531) Railroad Ponder Mary (c) r 253 North Ponder Mary (c) maid Arth Griffith r 117 Jones Ponder Maybelle (c) emp So Crate & Veneer Co r 531 Gilmer Ponder Minnie (c) r 117 (531) Railroad Ponder Oliver (c; Fannie) 1 emp Standard Tool & Handle Co h 619 Division Ponder Pink (c; Mary) 1 lab h 1115 (221) Woolfolk Ponder Robt (c; Maybelle) lab Macon Tool & Handle Co h 531 Gilmer Ponder Rose mach opr Happ Bros Co r Y W C A Ponder Thos (c; Lula) h 117 (531) Railroad Ponder Wm (c; Mamie) 3 emp Willingham S&D Co h 303 Norris Ponder Wm (c; Georgia) emp C of Ga Ry h 115 Powell Ponder Wm C (c) r 157 May Ponder Wm T hlpr Abel Ice Co r 422 Johnson (NH) Pool Jeanette student r 157 New POOL JOHN T (Addie) marshall City of Macon h 157 New--tel 4836-J Pool John W elk Power Oil Co r 157 New Pool Julian T (Sadie) 3 elk City of Macon h 153 New Pool Wesley S dep sheriff Municipal Ct h 305 Fort Hill Poole Benton elk Bibb Mfg Co r 38 Schell (EM) Poole E Derry (Lola) 1 r 302 Ell (SM) Poole Eva Mrs 1 tex wkr Bibb Mfg Co h 38 Schell (EM) Poole Freeman P student r 157 New Poole Flora (Mrs J S) tex wkr Bibb Mfg Co r 38 Schell (EM) Poole Harold B (Margt L) 2 stereo Macon Teleg Pub' Co h 121 Edna pi (LCHts) Poole Jack W (Jacquelyn) slsmn Snows Ldry r 316 Linden Poole James (Lena) 1 r 439 Calhoun Poole Jesse V tex wkr Bibb Mfg Co r 38 Schell (EM) Poole John S (Flora) tex wkr Bibb Mfg Co r 38 Schell (EM) Poole Joseph B (Ruth) tr dr Macon Coca Cola Btlg Co h 1707 2d Poole Joseph C (Beulah) (o) emp C of Ga Ry h 113 (137) Charles Poole Louise r 38 Schell (EM) Poole Mabel sec Nat L & A Ins Co r 632 Orange Poole Manny (c) 5 h 104 (7) 4th (B) Poole Roy tr dr Macon Paper Co r 619 1st Poole Russell M (Bessie) 1 yeoman U S Navy Recruiting Ofc r 536 Log Cabin blvd Poole Wm (c; Mary) lab r 801 Charles Poole Wm J chf spec agt C of Ga Ry res Atlanta Ga Pope Bruce G (Nollie) 4 barber Flynts Barber Shop h 101 Emory (SM) Pope Cecil (Lois) r 1331 3d Pope Chester C (Gladys E) 4 mgr Interstate Life & Accident Ins Co h 3905 Houston Pope David (c; Frances) 2 emp Heard Bros h 127 Ritchey Pope Elder (c; Willie K) 1 h 212 Shamrock Pope G Raymond (Emma H) 1 barber Flynts Barber Shop h 112 Montpelier Pope G Raymond Jr student r 112 Montpelier Pope G Wm r 334 Ross Pope Gertrude Mrs r 621 Log Cabin blvd Pope Grady (c; Mary J) emp Heard Bros h 503 (19) Hall (EM) 1935 Macon City Directory 393 Pope Gussie (c) r 111 Wise (V) Pope James M (Ena) (o) condr So Ry h 618 Hemlock Pope Jewell (Mrs M M) food checker Hotel Dempsey r 422 Spring Pope Lizzie (c) Indrs r 505 (504) Hall (EM) Pope Pope Maggie Mamie (wid Roy) smstrs r 335 Calhoun (c) dish washer Macon Cafeteria 1 r 212 Shamrock Pope Marion M (Jewell) 5 h 422 Spring Pope Mary Mrs 2 h 1012 Oglethorpe Pope Mary (c) Indrs r 551 Ward (V) Pope Roy lab r 1012 Oglethorpe Pope Sallie (wid GW) 1 h 334 Ross Pope Thos A barber H W Williams r 552 Hem- lock Pope Walter (c) porter Hotel Dempsey Barber Shop r 713 3d (V) Pope Wm (c; Annie) (o) h 111 Wise (V) Poppell Beulah (Mrs J E) gro 1650 Broadway h do Poppell Winnie Mrs opr Happ Bros Co r 754 Cherry Popper Harry S (Blanche) (o) v-p Dannenberg & Waxelbaum Co h 231 Stanislaus cir Popper Harry S Jr student r 231 Stanislaus cir POPPER JOSEPH W (Marjorie K) 2 (o) (Harris Russell Popper & Weaver) h 113 Buford pi--tel 174 Popper Peggy C student r 231 Stanislaus cir Popper Steve (Steve Popper Gift Shop) r 231 Stanislaus cir Popper Steve Gift Shop (Steve Popper) antiques 186 Magnolia Popular Cafe (Angelo Poulos) 512 Mulberry Porch Leon D (Clara) (o) phys 810 Ga Casual- ty Bldg h 1403 Oglethorpe Porter Annie (c) 1 r 12 (750) Steins al Porter Arminta (c) maid R T Lerison Porter Buster (c; Mary) lab Cherokee Brick Co r 301 (552) Waterville rd Porter Claudia (c) 1 r 12 Harris Porter Clinton C (Beatrice) 1 mgr Cooks Beer Co r 235 Stanislaus cir Porter Dicey (c) h 135 (115) Wood al Porter Edith (c) nurse Chiropractic Health Home r 349 Middle (V) Porter Ernest C (Lou Dell) 1 (Porters Dry Cleaning Co) r 756 New Porter Frances (c) maid G G Toole Jr r 203 (310) Railroad Porter Frank slsmn r Hotel Southland Porter Fredk (c; Mary E) 1 lab h 920 Ocmulgee Porter Geo (c) ydmn Chiropractic Health Home r 121 Rockhill la Porter Geo P (Mabel) elk So Ry h 756 New Porter Jas H (Olive S) (o) v-p Bibb Mfg Co h 532 College Porter John (c; Erdell) hlpr C of Ga Ry r 515 e 2d (EM) Porter John A (Annie L) (o) h Nottingham dr Porter John A (Loraine) emp Jefferson Stand- ard Life Ins Co r 768 Mulberry Porter Lucile (c) Indrs h 801 (181) Colquitt Porter M Virginia (wid H G) r 605 Main (EM) Porter Mary (c) hlpr Independent Ldry r 920 Ocmulgee Porter Ruby S (c) maid C W Roberts Porter Sami (c) jan 623 Main (EM) r do Porters Dry Cleaning Co (E C Porter) 610 New Porterfield Garden Club Mrs W G Middlebrooks pres meets 1st Friday 4pm RD 3 Portese Wm (c; Elnora) mech r 1014 Main (EM) Post M Davis (Jewell) 2 h 227 American blvd Posey Ethel opr Adams Mfg Co r 1521 Broadway Posey Eugenia Mrs matron Masonic Home of Ga r do Posey Joseph (Ethel) 4 tr dr City St Dept h 1521 Broadway Posey Oscar C (Alva J) 2 dispr MD&SRR h 556 Boulevard (NH) POSTAL TELEGRAPH-CABLE CO F B Gabriel mgr 451 Cherry--tel call "Postal" br 262 Main (EM) Postell Lizzie W (wid J G) r 856 Mulberry Postell Minnie (c) dom E S Lee r 309 Jefferson Poston Julia smstrs Bibb Mattress Co r 617 Carling Potter Bertha (c) maid Lerner Shops r 806 Edgewood Potter Chas (c; Bertha) lab So Ry h 806 Edgewood (SM) Potter Eva (Mrs James) tex wkr Payne Mill r 114' Forest (B) Potter James (Eva) 2 r 114 Forest (B) Potter Lamar (c) r 807 Edgewood Potter Ras G (Eva) pntr h 629 Main (EM) Potts Clyde E emp Nu Icy Btlg Co r 859 Walnut Potts Julian (Effie) 1 (o) mach C of Ga Ry h 118 Glynn Potts Ralph C (Carolyn) 1 coir A G Rhodes & Son h 104 Nelson (SM) Poulos Angelo (Popular Cafe) r Fickling Hotel Poulos Geo (Kate) restr 314 3d h 653 Hemlock Pound Arline Mrs. r 100 Kemper Pound Frank (c) emp F S Royster Guano Co h 112 (6) Davis al (EM) Pound Henrietta (c) dom Essie Cosby Pound Isaac (c; Marie) 1 lab h 217 Orange Pound Jerry E Jr (Vera) 1 slsmn Adams Buchanan Mtr Co r 533 Orange apt 14 Pound Ruby L (c) r 442 Mitchell Pound S David (c; Cora) 1 h 442 Mitchell Pound Wm elk Jacob's Pharm r 533 Orange apt 14 Pounds Annie B (c) Indrs Crescent Ldry h 315 Norris Pounds Fannie (c) 3 cook r 961 Hazel Pounds Georgia (c) h 219 Jordans al Pounds Ivory A tr dr Ga Power Co r 357 1st Pounds Sina (c) h 118 Cowan Pounds Wm (c) hlpr Bibb Mfg Co r 523 e 1st (EM) Powell Addle (wid J O) emp Adams Mfg Co r 3 Bond (LCHts) Powell Alex (c; Paralee) 4 (o) emp C of Ga Ry h 135 (325) Clark (EM) Powell Annis (c) maid H N Mitchell Powell Bessie (wid R D) 2 tex wkr r 202 1st Powell C Lester r 318 Cherokee Powell Calvin G 1 r 750 Oglethorpe Porter Mozella (c) emp So Crate & Veneer Co Powell Chas (c; Cora) 1 emp Hotel Macon h h 12 Harris 236 Orange Porter Pauline (c) r 903 (884) Maynard Porter Riley (c) (o) emp C of Ga Ry h 509 (476) Alabama (SM) Porter Rob't (c; Susie) 1 presser Economy Shoe Reprs h 381 Middle (V) Powell Chas M (Lillie) 2 serv sta supvr The Texas Co h 755 Ridge (I) Powell Chas M (Latha) 1 tex wkr Bibb Mfg Co h 750 Oglethorpe Powell Clarence (c) r 320 Cedar (U) Porter Roxie (Mrs J A) 1 r 1206 Ash Porter Roy (c) student r 903 (884) Maynard Powell E Eug (Ruby C) meats 202 Forsyth h do 394 Baldwin's and Telegraph's Powell Elbert (c) lab r 430 (329) Straight (U> Powell Wallace (c; Jessie M) lab So Ry h 531 Powell Ella (c) Indrs h 110 May Cotton Powell F Rogers (Gladys) 2 (o) asst mgr Jar- Powell Winifred r 138 Virginia rett Paint & Glass Co h 109 Avon rd Power Oil Co Georgia Carolina Oil Co oprs Powell Florence Mrs 3 r 558 Hemlock bulk plant 1053 5th serv stas 1240 Broadway Powell Forrest student r 475 Orange apt 2 342 Cherry 223 Forsyth 659 Georgia and Powell Frank pntr Acme Sign Co r 853 Cherry 687 3d apt 2 Powers Aris (c; Oca) 5 emp Birdsey Flour Powell Fred C (Conia L) 3 (o) emp P O h 618 Mills h Clinton rd extd (EM) Duncan Powers Gladys (c) 4 dom r 391 (290) Neel (U) Powell Geo H (Jeanette) dept mgr Dannenbergs Powers Helen waitress Plaza Cafe r 871 Mul- h 475 Orange apt 2 berry Powell Geo H Jr br mgr Rogers Inc r 475 Powers Jas (c; Nell) 1 r 275 4th (V) Orange apt 2 Powers James E chem Buckeye Cotton Oil Co Powell Geo T (Dorothy) 2 (o) engr The Grand res Loraine Ga Bldg h 117 Beech Powers John R slsmn Corbin Sup Co res Powell Geo T Jr sign pntr Brown-Kline Sign Loraine Ga Co r 117 Beech Powers Joseph (c; Bertha) lab r 138 1st (V) Powell Hazel (c) student r 430 (329) Straight Powers Joseph B (Fannie) (o) phys 168 Riley (U) (CP) h do Powell Henry (c; Viola) h 514(310) Straight Powers Julia H sten Bibb Mfg Co h 420 Forest (U) (V) Powell Herbert tr dr r 150 Bailey Powers Lucille r. 168 Riley (CP) Powell Herman (c; Annie) emp C of Ga Ry h Powers Mary H Mrs tchr Virgil Powers Sch 40 (540) Clayton (V) r RD 1 Powell Ina M elk H L Green Co r 750 Ogle- Powers Ray (c) brkmn C of Ga Ry h 325 thorpe Powell J Eug soda elk Greyhound Sandwich Hammond Powers Riley C (c) r 321 Douglas (V) Shop r 209 1st Powell James doormn Rialto Theatre r 853 Cherry apt 2 Powell Juanita M r 618 Duncan Powell Julia (wid F C) tex wkr h 1026 2d Powell Julia H Mrs r 22 Progress Powell Kath (c) r 511 e Academy (EM) Powers Rosa (c) h 222 Division Powers Viola (c) r 391 (290) Neel (U) Powers Virgil School Minnie Robertson prin 1200 2d Powers Wm (c) hlpr Central S&D Co r 719 Whitehead al Poythress Elwin M (Dorothy A) br mgr Piggly- Powell Kath student r 853 Cherry apt 2 Wiggly r 407 Forsyth Powell Lanty J (Lillie M) 2 (o) emp C of Ga Poythress John M (Dorothy B) 1 flltermn City Ry h 275 Ell (SM) of Macon h 486 Orange Powell Latha (Mrs E M) tex wkr Bibb Mfg Co Prater Albert (c) porter The Texas Co r 106% r 750 Oglethorpe (47) n Holt Powell Leon (c) emp 430 Cowan Prater Alice (c) 1 r 314 (326) Short (EM) Powell Love (c; Lula) carp h 430 (329) Straight Prater Myrtle (c) 1 emp Economy Shoe Reprs Powell Mack H (Lula) 3 emp Wofford Oil Co h 106 Piedmont (SM) Powell Mae student r 275 Ell (SM) Powell Margt elk Macon Teleg Pub Co r 853 Cherry apt 2 Powell Mary (c) maid Hotel Macon r 234 Orange Powell Mary A nurse 335 College r do Powell Max H tr dr Wofford Oil Co Powell Merlin student r 275 Ell (SM) Powell Milton (c) lab Buckeye Cotton Oil Co Powell Moses (c) lab Carling Tile Co r 508 (430) Cowan Powell Nell billing elk Bibb Mfg Co r 204 Albemarle pi (S) Powell Nellie (c) maid h 430 Madison (V) Powell Nellie (c) maid Lewis Jackson r 430 (329) Straight (U) Powell Nina (c) cook k 511 e Academy (EM) Powell O K formn Abel Ice Co r 853 Cherry Powell Odessa nurse Macon Hosp r do Powell Ola (c) 2 maid Hotel Macon h 605 (108) Elliott Powell Ollie (c; Eva) lab Birdsey Flour Mills h 507 Flanders Powell Ozrow K (Kath) h 853 Cherry apt 2 Powell Paralee (c) emp Barnett Mfg Co r 13E (325) Clark (EM) Powell Raymond W waiter Busy Corner Lunch Room r 117 Beech Powell Rena (c) r 531 Cotton Powell Robt (c; Mary) emp Maxwell Bros h 234 h 807 Edgewood Prater Wm (c; Adeline) 1 tr dr C-M-P Drug Co h 208 Lincoln (V) Prather Bonnie (c) h 507 (508) Elbert Prator Pearl A (wid W G) r 103 Pierce (V) Prator W Glenn slsmn Trading Post r 103 Pierce (V) Prator Wm M (Maude) barber Palm Barber Shop r 871 Mulberry Pratt Clarence E emp J H Brown r Central City pk Pratt Everett H (Log Cabin Serv Store) h 805 (1800) Log Cabin blvd Pratt Kermit (Log Cabin Serv Store) r 805 (1800) Lob Cabin blvd Pratt Parks W (Emma) 7 h 2 Glynn Pratt Royce R (Noami) 2 sawmn H C Fowler Lbr Co h 120 Highland (LCHts) Pratt Vermont (Log Cabin Serv Store) r 805 (1800) Log Cabin blvd Prayer Angie (c) r 236 Plant al Prentiss Otis G (Mary J) frt agt So Ry h 401 Carling Prentiss Wm C emp So Ry r 401 Carling Prescott Thos E (Annie) 1 (o) emp C of Ga Ry h 100 Harrold Pressley Harry M (Clara B) emp So Ry h 105 (135) Colquitt Pressley Julia nurse 669 New r do Preston Cassie (c) r 756 Edgewood Preston Chas M (Odell) (o) h 227 Bond Preston Cornelia (wid Thos W) r 203 Fairview Orange Preston Della (c) h 601 (269) Prince (SM) Powell Roscoe (c) chauf r 430 Madison (V) Powell Tobe (c) lab So Crate & Veneer Co Preston Eden T emp Ga Power Co r 227 Bond Preston Fred (c; Monnie) h 756 Edgewood 1935 Macon City Directory 395 Preston Henry (Nancy) 1 presser Happ Bros Co r 720 Plum Preston James E (Ruth M) 1 asst supt Central Cotton Oil Co h 158 Hugenin Pridgen J F ofc mgr Firestone Auto Sup & Serv Stores r 203 High Priester Pretto L (Eva) agt Nat L & A Ins Co r 213 North (NH) Preston James E Jr student r 158 Hugenin Priester Wyman J (Bessie) 3 (o) supt Nat L Preston Leola (c) h 1426 Ardvines al Preston Mary S (wid J D) r 306 Rutherford (SM) Preston Odell (Mrs C M) cafeteria mgr Miller & A Ins Co h 195 Belmont Primus Isaac Jr (c; Lilia) 2 cook h 150 Lin- coln (V) Primus Lewis (c) r 308 (111) Industrial Home High Sch r 227 Bond rd Preston Oscar lab h 306 Rutherford (SM) Preston Robt (c; Annie) trkr C of Ga Ry Primus Mary (c) 1 h 308 (111) Industrial Home rd h 1060 Hazel Preston Sara student r 227 Bond Preston Thos S (Effie) 2 emp So Ry h 203 Prince Benj (c; Mattie) 7 lab h 1059 Pio Nono Prince Chas S r 1109 Oglethorpe Fairview Prince Frank tr dr r 361 1st Preston Tony W (c; Velma) lab Rose Hill Cem Prince James emp Ross Co r 102 (341) Green r 180 Northwest Boundary (V) Preston Walter opr Adams Mfg Co r 405 Cleve- Prince Sylvanus P (o) coir The Alliance Corp land (SM) Preston Wm (c) r 111 1st (U) h 1109 Oglethorpe Pringle A Bernard (Therese) 1 crane opr h Preston Wm L (Annie) h 124 Violet 212 Adams Price Alma Mrs smstrs Union Dry Gds Co r 2516 2d Price Anna J (c) 3 lndrs h 310 Coles al Pringle Bevelry r 240 Chestnut Pringle C Ernest (Virginia) pntr r 814% 2d Pringle Robt L (Pauline) r 207 Washington Price Bessie (c) maid r 2 (530) Sparks al Price Bryant H (c) sch tchr r 520 Clinton Price Cora (Mrs J G) winder Bibb Mfg Co r 841 Hazel Price Dorothy student r 679 Courtland Price Emma L (c) tchr Hazel St Sch r 520 Pringle Terese (wid B A) r 240 Chestnut Pringle Virginia (Mrs C E) opr Happ Bros r 814% 2d Printers Union H H Dunham sec meets 4th Mondays 8:00 p m 502% 2d Pritchard Chas emp W U Teleg Co r 220 Clinton Chappell (SM) Price Geo (c; Minnie) lab h 100 Roberts (U) Price Hattie (c) h 1015 Elbert Price Idus H (Senora) tex wkr Bibb Mfg Co Pritchard Frances (c) case aide County Relief Admn r 214 Mutual Pritchard Harriett dept mgr Burden Smith & h 1 Flanders Co r 5 Dessan pi Price Irma Mrs 1 r 627 Main (EM) Price Israel (c; Eva) jan Wesleyan College Pritchard Helen (wid H E) (o) h 5 Dessau pi Pritchard Jane student r 117 Crescent (CH) h 212 Northwest Boundary Price J Gilbert (Cora) 3 tex wkr Bibb Mfg Co h 841 Hazel Price J Marvin (Willie M) engr C of Ga Ry h 724 Pine Pritchard John T r 220 Chappell (SM) Pritchard Mollie Mrs r 220 Chappell (SM) Pritchard Regina sten Sterchis r 117 Crescent (CH) Pritchard Ruel (Willie M) emp L B Price Mer Price James T (Anne) 2 emp Ga Power Co h 209 Newberg (SM) Co r 209 Hardeman Pritchett Alonzo P 1 formn So Crate & Veneer Price Jesse (c; Ruby) lab Elkan-Stone Tile Mfg Co r 857 3d Price Julia F (o) h 276 Campus Co h 262 Columbus Pritchett Alpha slswn The Reliable Outfitters r 460 Spring Price L B Mercantile Co The T O Pearre mgr genl mdse 650 2d Pritchett Bessie (wid T W) smstrs h 156 Holt Pritchett Claudius T (Gladys) 3 (Spivey & Price Lottie M (c) (o) tchr Macon Sch h 520 Clinton Pritchett) h 124 Lamar (V) Pritchett Davis G (Bibb Auto Wrecking Co) Price Lula (c) cook h 123 (102) Holmes r 1426 2d Price Mamie (wid Sol) 1 h 103 Emory (SM) Price Mary (c) h 223 (220) Lynwood (V) Pritchett Eliz (Mrs W P) slswn The Globe Dress Shop r Miller Field rd RD 5 Price Mary (c) h 310 1st (V) Pritchett Emory B r 100 (190) Melrose (B) Price Mary L (wid SB) (o) h 225 High Price Mellie (wid I H) r 1 Flanders Pritchett Eug B mach C of Ga Ry r 440 Ross Pritchett Gertrude r 262 Columbus Price Minnie L (c) lndrs r 306 Ward (V) Price Patk H coir r 554 Hawthorne Pritchett Henry T (Mary L) 3 (o) inspr So Ry h 100 Flamingo dr Price Roger L r 103 Emory (SM) Pritchett Lecie opr So Bell Tel Co r 460 Spring Price Rosa (c) 4 maid M R Ross r 211 Pond Pritchett Luther (Louise) 1 (o) lab h 158 Jeff (V) Price Ruby (c) cook Poplar Cafe r 857 3d Davis (SM) Pritchett Mary E (wid F R) h 1426 2d Price S B Free Library Mrs Hattie White Pritchett Rachael (wid J L) h 440 Ross librarian 1st cor Orange Pritchett Walter H (Blanche) 1 h 100 (190) Price Sami (c) r 310 1st (V) PRICE SAML J T accnt Mercer University h 679 Courtland--tel 6098-R Melrose (B) Pritchett Ward H student r 440 Ross Pritchett Wm P barber R G Stripling res RD 5 Pritchett Wm S (Florence L) ins agt h 308 Price Senora Mrs tex wkr Bibb Mfg Qo r 1 Clayton (V) Flanders Proctor Eliz (c) (o) cook Mary Bond Smith h Price Thos (c; Sallie) h 124 Concord 228 Moughon (V) Price Wm (c) sch tchr r 520 Clinton Proctor Geo D (Hessel I) 1 mach C of Ga Ry Pride Mary (c) 1 h 202 (423) Plummers al h 854 Pine Pridgen Guardrow (Helen) 1 (o) mgr Mut Proctor Ruby E slswn C D Kenny Co r 28 Investment Co h 227 Vista cir (I) Arlington pi 396 Baldwin's and Telegraph's Proctor & Gamble Mfg Co G A Gardiner supt cotton seed products Hammond cor Hazel Proffit Carrie (c) maid J W Spruce r 439 (443) Chestnut Progressive Life Insurance Co W A Yeomans supt 309 Grand Bldg Pruden Nona (c) (o) tailor h 555 Monroe (V) Prudential Insurance Co of America Albert Adams mgr 301 Ga Casualty Bldg Pruett Arth P slsmn Sawyer Coal & Ice Co res RD 6 Pruett Elisha L (Mary) (o) gro 601 Main (EM) h do Pruett Geo (Eunice) 3 slubber hd Bibb Mfg Co h 236 Jackson Pruett Ira A (Ada) (o) emp Bibb Mfg Co h 109 Yates Pruett Joel F ( Jerry) slsmn McCormick Peer- ing Store h 401 College apt 6 E Pruitt James E (Lillie) hlpr r 600 Main (EM) Pruitt James H (Sallie) 1 h 251 Peachtree Pruitt John S tex wkr Bibb Mfg Co r 251 Peachtree Pruitt Lillie M (c) 2 maid J E Cozine r 32 (532) Clayton Pruitt Norman (Ruby) 3 tex wkr Bibb Mfg Co r 251 Peachtree Pruitt Ruby (Mrs Norman) tex wkr Bibb Mfg Co r 251 Peachtree Pryor John (c; Helen) 6 hlpr Sterchi's h 1701 Broadway Pryor Otis (c; Amanda) draymn 338 Ham- mond h do Pryor Ridley H (Lillie J) 3 barber Palace Bar- ber Shop h 719 Anderson (SM) Pryor Willie (c) emp Independent Ldry Co Pryther Wm H (Rena) 1 emp Bibb Mfg Co h 647 Ash Puckett Benj C (Margt) asst mgr Riverside Lbr Co r Walden Ga Puckett Clyde C emp Ga Power Co Puckett Homer asst mgr Ivey-Turner Ice Cream Co r RD 1 Puckett Mary D (Mrs W E) opr So Bell Tel Co res Skipperton Ga Puckett Otis (Ruby H) mgr beauty shop Dar- ling Shops r RD 2 Puckett Riley (Blanche) 1 r 817 New Puckett Rosamond B (Mrs R T) bkpr Piggly Wiggly r 114 Ninadel dr Puckett Roy C (Rosamond B) atndt Gulf Re- fining Co h 140 High Puckett Roy T serv slsmn Gulf Refining Co r 114 Ninadel dr Puckett Ruby H (Mrsi Otis) beauty opr Dar- ling Shops r RD 2 Pugh Amanda (c) cook A F Holt Jr r 230 Jones Pullen Cottray (c; Willie) emp Standard Co r 75 Coleman al Pullens Emma (c) maid R E Campbell r (119) Lynwood (V) Pullens Essie (c) 2 maid G S Woodruff r Bostic la Pullens Wm (c) hlpr C of Ga Ry h 129 (1 Lynwood (V) Pulliam Bonnie J (Mrs R L) tchr Lanier H Sch for Girls r 409 Adams Pulliam Christine slswn Dannenberg's r Cherokee Pulliam Elijah (c) porter Swannac Sweet s; r 304 (605) Prince (SM) PuHJJ!iagTMh SRchbth L409(BAondnaime sJ) 1 (o) tchr Mi Pulliam Robt L Jr student r 409 Adams Pu(.1S^M?)1 Wm (c; Annie) 1 h 304 (605) Pri Pulling Norman (c) hlpr Plum St Serv Sta r 639 Elm St la Pullins Essie (c) dom G S Woodruff Pullins Fannie (wid H J) 1 r 611 2d Pullins Preston (c; Annie) h 75 Coleman al Pullum Denie (c) lab C of Ga Ry Pulsifer Lillian r 224 Georgia Purkes Eliz educational director Methodist Orphan Home r do Purnell Dempsey (c; Willie M) 2 h 503 Flan- ders Purnell Homer (c; Elnora) h 221 Elliott Purnell Jas (c; Lizzie) gdnr h 159 (237) Clara Purnell Lula (c) tchr B S Ingram Sch r 503 Flanders Purnell Ruth student r 503 Flanders Purnell Thos (c; Willie) 4 emp Birdsey Flour Mills h 410 (512) Maynard Purofoy Jos (c) plmbr h 725 Ocmulgee Purser Alvin (Mary) 1 tex wkr Payne's Mill r 2336 (r) Forsyth rd Purser Dollie Mrs r 525 Jackson Purser Hoyt tex wkr Payne Mill r 202 (103) Grand (B) Purser Minnie emp Bibb Mfg Co r 525 Jackson Purser Robt S (Mamie) 2 gro 651 Elm h 653 dp Pursley Frances (wid C E) r 103 Brookdale (B) Pursley Sami C (Lila) h 627 Adams Purvis Alice nurse Macon Hosp r do Purvis Charlton A (Reba) 4 tex wkr Willing- ham Mills h 127 Roff Home la Purvis Ernest (Lucile) 2 slubber hd Bibb Mfg Co h 851 Hazel Purvis James student r 806 Woolfolk Purvis Reuben (Nonie) 4 h 806 Woolfolk Putnam Amanda Mrs r 1234 College dr Putzel Isadore (Rose) 1 (o) sec-treas Morris Putzel Inc h 521 Georgia Putzel Milford S (Ida B) 2 sec-treas Coplan Junk Co r 870 Orange Putzel Morris pres Morris Putzel Inc r 521 Georgia Putzel Morris Inc Morris Putzel pres Isadore Putzel sec-treas elec contrs 519 Cherry Putzel Rose (Mrs Isadore) dress shop 810 Montpelier r 521 Georgia Pye Findley H (c; Maude C) agt Pilgrim Health Life Ins Co h 225 Chestnut Pye Maude C (c) prin Wheatley Sch r 225 Chestnut Pythian Lunch Room (c) (Julia Hawes) 455 Cotton Quaintance Geo (c; Mamie) lab h 118 Hicks al Quality Food Store (C A Pickett) gros 170 New Quarles Gilford G (Ethel) prof Mercer Univ h 505 Adams Quarterman Allie (Mrs J N) slswn Globe Dress Shop r 801 Main (EM) Quarterman Cora L (wid J N) h 260 Church (EM) Quarterman David r 260 Church (EM) Quarterman Evelyn student r 260 Church (EM) Quarterman James N (Allie) 1 barber E C Bateman h 801 Main (EM) Quarterman Vivian Mrs 1 r 1015 Walnut Quarterman Wm (c; Janie) tr dr Parcel Del Co h 7 Ross St pi Quave Evelyn (Mrs V L) opr Happ Bros Co r 753 Pine Quave Victor L (Evelyn) 3 photogr Dannen- berg's h 753 Pine Quick Emma (c) lab So Crate & Veneer Co r 405 (305) Cowan Quick John (c) h 5 Harris row Quick Judson (c; Emma) 1 lab James & King- man Lbr Co h 405 (305) Cowan 1935 Macon City Directory 397 Quick Mabel (c) r 405 (305) Cowan Quickel Albert F (S Nevada) (o) pres-mgr Taylor-Quickel Eng Co h 3012 Forsyth rd Quickel S Nevada (Mrs A F) sec-treas Taylor- Ragland Ella (c) maid A W Stillwell res Stinsonville Radgsdale Bartow D h 1353 Edgewood Ragsdale Susie F (wid T B) (o) h 910 Walnut Quickel Eng Co r 3012 Forsyth rd Rahn Hattie G (wid N H) r 202 Berkley dr (I) Quillian Marvin C (Carrie) (o) prof Wesleyan Col h 418 Ridge (I) Quin Hugh W (o) pres Central City Bag Co h 104 Lamar (V) Quinlan J Joseph atndt Independent Ldry Co r 213 (159) Center (EM) Quinlan Lula (wid J J) 1 (o) h 213 (159) Rahn Mattie bkpr Sparks Mtr Co r 413 Springs Raible J R Cooperage Co H J Smith mgr 7th cor Poplar Raiford Mark (c; Irene) 3 h 137 2d (V) Raiford Mark Jr (c) student r 137 2d (V) Railey Bertha (c) r 108 Harris la Center (EM) QUINLAN ROBT C, dept mgr Kernaghan- Goodman Inc, r 105 2d--Tel 5654-W Railey Boysie (c; Maude) emp So Crate & Veneer Co h 922 Pio Nono Railey Chas hlpr r 605 Main (EM) Quinn Clarence H br mgr Postal Teleg-Cable Co r 766 Cherry Railey Ira D (Martha) 1 r 605 Main (EM) Railey John D (c; Louise) 1 delmn Wilson's h Quinn Jesse B (Eliz) hlpr City Bd of Water Comrs h 384 (332) Pio Nono Quinn Katie (c) h 520 Cahoun 356 Madison Railey Maude (c) cook N B Piquet r 922 Pio Nono Quinn Martha A (Mrs J J) h 216 Bright (SM) Railey Walter E (c) porter C D Kenny Co r Raarup Dewey (Alice) 1 slsmn r 165 2d Rable Robt lab r Ocmulgee cor 6th RABORN FRED S (Allene) asst riding mstr 458 Bay Railway Express Agency Inc S D Stainton agt Horace D Walker route agt 119 Terminal Sta Rivoli Riding Club r do Rainbow Division Veterans Assn Julian Poole Rabun Sallie (Mrs CL) 4 h 202 Clisby pi Raby Allen emp St Hwy Dept r 756 Mulberry Raby Allen C (Mettie) (o) engr So Ry h 804 Hemlock commander 221 Forsyth Raines Anna B Mrs h 866 3d Raines Bert r 855 Pio Nono Raines Cleve A (c; Mattie) 1 emp Bibb Mfg Co Raby Hubert D emp Atlantic Ice & Coal Co r 804 Hemlock r 107 Bowman Raines David B emp Walgreen Co r 811 Poplar Raby Wm P (Josie) emp Willingham Mills h 398 Morgan Rachels Alvin C (Annie H) fum repr 100 Bartlett h 1017 Napier Rachels Clemmie (wid CL) (o) h 3044 Hous- apt 4 Raines Edgar M student r 278 Ell (SMi Raines Frank (c; Leola) 3 car washer Power Oil Co h 2 Bright al Raines Frank (c; Rebecca) 2 emp So Crate & ton (SM) Veneer Co r 321 Dure (U) Rachels Henry waiter Spiller's Restr 470 Mulberry Rachels John T elk r 3044 Houston (SM) Rachels Wm F Jr r 129 (324) w Grenada ter Raines Frank G (Bessie) bldg contr 294 Cherry h do Raines Geo (c) r 246 Dempsey Raines Geo G electm Hurley Elec Co r 278 Rackley Benton T (Lucile) 1 elk Rogers Stores Ell (SM) h 610 Duncan Rackley Ernest W (Kath) 1 (Vineville Dog & Cat Hosp) h 106 Rogers (V) Rackson David (Fannie) 3 (o) (So Dry Gds Store) h 510 Beech Radcliff Edna F r 308 Rutherford (SM) Radcliff James E (Geneva A) 1 lab h 308 Rutherford (SM) Raines Hazel J student r 294 Cherry Raines Henry (c) lab r 228 Cedar (U) Raines Hillard (c) jam J T Ross r 363 (r) Col- lege Raines Irene (c) dom h 230 (130) Cowan Raines John r 228 Cedar (U) Raines Kath V student r 278 Ell (SM) Raines Lewis exp msngr C of Ga Ry r 108 Radcliff Thos E (Lorene) Auto Co res Wayside Ga mech Huckabee Yates Raines Lillie W (wid B B) 3 (o) h 278 Ell (SM) Rader Kath (wid L C) emp Washington Memorial Lib r 509 Vineville Raines Lizzie Lou slswn S H Kress Co r 422 Duncan Rader Vivian Mrs ofc sec U S Dept of Agr r 303 Hendley Raines Lynn elk Snow's Ldry r 406 (412) Montpelier Radford Carrie (wid J G) r 2 Roff Home pi Raines Margt (c) 2 h 228 Cedar (U) Radford Eliz Mrs tex wkr Atlantic Mill h 2 Raines Martha sten Sinclair Refining Co r 249 Roff Home pi Cherry Radford Lee S (Lavine) in charge State Income Raines Mary r 911 New Tax Ofc h 541 Georgia Radford Mamie (c) 1 (o) h 418 (202) Bartlett Raines Mattie (c) cook P G Blitch r 228 Cedar (U) Radford Wm (c) porter Burden Smith & Co r Raines Mittie C (wid W T) h 855 Pio Nono 418 (202) Bartlett Radio Service Co (D H Mullenix) reprs 722 1st Raines Rosalie student r 796 Hillyer Raines T M Grocery Co Inc (T M Raines) 805 Radio Service Sound Co (J W Geeslin) reprs 652 2d Montpelier Raines Troy M (Emma) 1 (o) (T M Raines Radney Guy M (Louellen) 1 (Macon Cycle Co) Gro Co Inc) h 796 Hillyer h 106 Jeff Davis Raines Wm (c; Vinie) lab So Crate & Veneer Radney Wiley R (Ella M) steel wkr Taylor Iron Wks h 419 Duncan Radney Wm r 325 White (SM) Co h 12 (559) Witkowski's la Raines Wm G (Gussie I) trav slsmn h 406 (412) Montpelier Radney Zelma C (Marguerite) Taylor Iron Wks h 2136 2d 4 steel wkr Rainey Cherry (c) r 110 Robert (U) Rainey Editha W (Mrs H T) spinner Bibb Mfg Ragan James (c; Ella) 1 (o) cook L D Huckabee h 217 Summit Hill (S) Co r 241 Belmont Rainey Edw elk Rogers Stores r 241 Belmont 398 Baldwin's and Telegraph's Rainey Enoch J (Sarah L) dep sheriff Bibb County h 402 Forest Rainey Geo (c; Eula L) porter Worsham & Sherrill r 532 (510) Grant Chappell Rainey Georgia (c) 2 maid h 119 (28) Frank's al Rainey Hight (Mae) dep sheriff Bibb County r 122 Cleveland (V) Rainey Horace T (Editha W) emp City Bd of Water Comrs h 241 Belmont Rainey Irene C (Mrs J B) spooler Bibb Mfg Co r 124 Comer ter (PM) Rainey James B (Irene) emp Bibb Mfg Co h 124 Comer ter (PM) Rainey John W (Annie B) 1 engr Hotel Dempsey h 321 Ross Rainey Lorine student r 241 Belmont Rainey Mae (Mrs Hight) bkpr Pekor-Cook Jewelry Co r 122 Cleveland (V) Rainey Willie Bell r 321 Ross Rainey Rome (c; Leila M) 2 porter Worsham & Sherrill h 112 Wyche Rainey S Clifford Jr (Martha) 1 (o) trav slsmn h 110 Delaware Rainey Sami C (Georgia) (o) slsmn Worsham- Sherill h 122 Cleveland (V) Rainey Wm (c; Mary E) h 110 Roberts (U) Rainwater Lester F (Ruby B) inspr HOLC h 110 Park pi Raleigh Leola (wid Walter) 4 smstrs h 467 Elm Raleigh Walter H r 467 Elm Raley Albert A (Lois) dep sheriff Bibb County r RD 2 Raley Bernard H (o) patrolmn CPD h 2418 2d Raley Danl W (Ella) hlpr City Scavenger Dept h 114 Stratton Raley Evie Lou (wid W F) emp Willingham Mills r 38 Melrose (B) Raley Harvie emp Bibb Mfg Co.r RD 6 Raley Hattie (wid J S) r 2418 2d Raley John (Florine) 2 r 277 College Raley Laban L (Mary) welder C of Ga Ry r 110 Rogers (V) Raley Nora Mrs sten Ryals, Anderson & An- derson r Smith rd RD 2 Raley Ralph B delmn Mitchell & Williams Co r 114 Stratton Raley Romus H (Orrie M) dep sheriff Bibb County h 221 Forsyth Ralls Mary (c) r 400 Robins rd Ramboe Tony (c; Jimmie) 1 hlpr Central Hotel r 220 Powell Ramer Fredk H (Exie R) 1 supt Am Nat Ins Co r 623 Forsyth Ramey David R r 953 Elm Ramey Frank L student r 953 Elm Ramey Leslie C elk Bibb News Co r 953 Elm Ramey Marion S student r 953 Elm Ramey Reese L (Mary) 2 (o) emp MD&SRR h 953 Elm Rammage Jack r 107 Dewitt Rammage Ruby r 107 Dewitt Rammage Thelma r 107 Dewitt Ramsey Bernard B sta atndt Power Oil Co r 650 Ridge (I) Ramsey Eliz R sch tchr Alexander Sch No 2 r 650 Ridge (I) Ramsey Gertrude L (Mrs J F) cash Rialto Theatre r 650 Ridge (I) Ramsey James F (Gertrude L) treas Industrial Loan & Investment Co r 650 Ridge (I) Ramsey John W (Mabel) 1 (o) pres Industrial Loan & Investment Co h 650 Ridge (I) Ramsey Max E (Virginia M) (o) mach C of Ga Ry h 113 Ponce de Leon 1935 Macon City Directory Ramsey Prince (c; Annie) lab h 405 (532) Henrietta (SM) Ramsey Rosa J (wid Marion) receptionist H C Warlick h 533 Orange apt 5 Ramsey Wm C (Mae) 1 (o) engr GS&FRR h 129 Richmond Ramus Ernest W (c; Jessie) (o) peddler h 1116 Napier Rand Edward H (Blanche M) (o) cotton buyer h 110 Lamar (V) Randall Annie B (c) lndrs h 452 (25) Mitchell Randall Arth (c) r 304 Patterson Randall B T prsmn Lyon, Harris & Brooks r RD 3 Randall Bradley (c; Mary) clnr Bibb Mfg Co h 127 (129) Nussbaum Randall Buford (c) h 431 Telfair Randall Dora (c) h 121 Middle (V) Randall Edw (c; Dora) 3 (o) h 153 (157) Broad Randall Frank (c; Eva) lab h 516 Coleman al Randall Fredk (c) (o) jan Washington Memor- ial Lib h 222 5th (V) Randall Harry T (c; Carrie) 1 h 304 Patterson Randall Herschell (c; Adline) 1 tr dr h 109 Patterson Randall Katie (c) maid Joseph Clisby Sch r 806 3d (V) Randall Lee Roy (c; Lillian) porter Newberry's h 405 1st (WH) Randall Louise (c) 1 maid Am Legion Home r 121 Middle (V) Randall Mamie (c) r 431 Telfair Randall Mary (c) 1 r 127 (229) Nussbaum Randall Mary E elk Liggett's Drug Store r RD 2 Randall Rita (c) r 452 Hazel Randall Rufus (c) lab Bibb Mattress Co h 110 (522) Fulton la Randall Theodore (c) student r 304 Patterson Randall Viola (c) cook J B Whitehead h 139 Culver (V) Randall Watson (c; Eunice) 4 emp Bibb Mfg Co r 429 e 2d (EM) Randall Wm (c; Hattie) 1 emp Wesleyan Col h 415 Bay Randall Wm (c; Lillian ) 2 lab r 109 Patter- son Randall Willie (c) r 431 Telfair Randall Willie P (c) r 152 5th Randle Dora r 871 Mulberry Randle John H (Katie) 1 hlpr h 757 Hemlock Randolph Dolly (c) r 159 May h 393 Hill Crest Reid Hattie (c) 3 r 83 Bay Reid Henry (c) wtchmn r 361 Edison Reid Isaac (c; Bertha) 2 soft drinks 414 (516) Maynard h do Reid J Bernard (Libby) tr dr Central Ga Bak- ing Co r 519 Pine Reid Jacob C (Evie) 3 brklyr -h 317 Reid Reid James (c) pastor Seventh Day Adventist 9h r 518 Clinton R^RL Josephine) 1 emp So Cotton Oil Co h 500 (409) Colquitt Roberts Wm (Emily farmer r 207 West End Roberts Wm C (c; Eliz) emp Birdsey Flour Mills h 336 Jackson Roberts Wm F (Carrie) 2 hlpr h 353 Walnut Roberts Wm J (Lucile) emp C of Ga Ry h 310 Peachtree Roberts Wm L (Lizzie) supt S E Compress & Whse Co h 814 Cherry Roberts Wm M (Evelyn P) lbrmn h 105 Laurel Roberts Wm R mech Proctor & Gamble Mfg Co r RD 2 Roberts Wm T r 432 Carling Robertson Alberta (c) 1 maid Freeman Beauty Parlor r 163 Roye Robertson Annie M (c) r 1055 Pio Nono Robertson Beatrice H (wid B W) 2 instr Ma- con Vocation Sch r 100 Daisy Park Robertson Calvin W (Lois) mgr Southeastern Optical Co Inc r 375 College Robertson Chas D (Alma D) 1 sec-treas Robertson-Walker Inc rep Jefferson Mortgage Co h 93 Osborne pi Robertson Fannie (c) r 716 Hazel Robertson Frank L student r 219 Ormond ter Robertson Geo student r 219 Ormond ter Robertson John (c; Kath) lab So Crate & Ve- 1935 Macon City Directory 409 Robertson Herman W (Nell) (o) condr C of Ga Ry 219 Ormond ter Robertson James E (Mattie) 2 asst dept mgr Huckabee Auto Co h 109 Inverness Robertson John (c; Kath) lab So Crate & Veneer Co h 320 Gilmer Robertson Lafayette (c; (Lucille) clo presser 315 Broadway r 122 (488) Virgin (V) Robertson Lucille Mrs slswn Union Dry Gds Co r 2921 Houston Robertson Margt Mrs nurse 203 Edna pi (LCHts) r do Robertson Matilda (c) r 305 (310) Campbell (SM) Robertson Minnie C (o) prin Virgil Powers Sch h 405 Hill Crest Robertson Nan Mrs social serv wkr r 147 Daisy Park Robertson Noah (c; Eva) 3 lab h 273 (159) Willingham la Robertson Simon (c) lab r 9 Murray al Robertson Susie (c) 2 maid W F Johnson r 341 2d (V) Robertson-Walker Inc B S Walker pres, C D Robertson sec-treas real est 415 2d Robertson Wesley (c; Bertha) 1 emp Central Cotton Oil Co h 115 Opera Hse al Robertson Wm L h 761 Hemlock Robertson Wm L Jr dep sheriff Bibb County r 761 Hemlock Robertson Zack (c; Lizzie) 1 barbecue 315 Telfair h do Robinson A H (Jessie) emp So Ry r Central Hotel Robinson Abraham (c) 2 h 103 (107) 2d (V) Robinson Albert (c) porter Union Bus Terminal Co Robinson Albert (c) delmn Fulford's Pharm h 112 (148) Adams Robinson Alberta (c) maid Robt Freeman Robinson Alice (c) 2 maid h 216 Lynwood (V) Robinson Anderson H (c) butler r 123 Roose- velt (V) Robinson Anna (c) r 158 2d (V) Robinson Anna (c) (o) restr 129 Middle (V) h 131 do Robinson Arlee (c) emp So Ry r 406 (542 Stevens (SM) Robinson Bert (c; Mattie) lab h 801 Fort Hill Robinson Belle (c) 2 h 320 3d (V) Robinson Betty (wid R G) r 716-18 Oglethorpe Robinson Buster (c) h 269% 4th (V) Robinson Carlton (Anna) wtchmn C of Ga Ry r 305 Linden Robinson Carrie O Mrs r 205 Oak Haven Robinson Chas (c; Eva M) 1 lab h 107 Drew's Qtrs Robinson Chas W (Roberta) 1 (o) condr So Ry h 104 Pio Nono Robinson Chas W Jr elk Rogers Inc r 104 Pio Nono Robinson Cleon A (Clover E) (o) farmer h 1317 Vineville Robinson Cleveland (c) jan The New Yorker r 103 (107) 2d (V) Robinson Daisy (c) r 418 (432) North Robinson David A (Lois) 1 r 2344 Forsyth rd Robinson Dorothy (wid J L) r 150 Summit Robinson Eddie L (c) h 9 (132) Malloy's al Robinson Edgar (c; Lettie M) emp Swift & Co h 1 3d St la Robinson Edw (c; Rachel) atndt B J Champion h 616 Chapman al Robinson Edw (c; Alice) lab The Standard Tool & Handle Co h 115 Elm Robinson Edw (c; Rosa) porter S E Exp Co r 269% 4th (V) Robertson Edw B (Willie V) 3 signalmn C of Ga Ry h 3404 Houston Robinson Ellen (c) r 115 Cherry Robinson Emma (c) 2 dom h 106 Cowan Robinson Emma (c) maid J W McCook Robinson Essie (c) r 103 (107) 2d (V) Robinson Esteele beauty shop 215 Bibb Bldg r Houston rd RD 3 Robinson Evelyn (c) r 358 Robinson rd Robinson Evelyn tchr Alexander Sch No 2 r 632 Orange Robinson Florine (c) r 325 Madison Robinson Fredk (c) r 406 (542) Stevens (SM) Robinson Geo (c; Doris) r 105 4th (B) Robinson Geo F r 167 Magnolia Robinson Georgia Mrs r 1 Roff Home pi Robinson Gus (c) presser Economy Shoe Reprs r RD 2 Robinson Hattie (c) cook Early Barton h 105 4th (B) Robinson Henry (c) chauf r 118 (114) Railroad Robinson Henry (c; Buna) 2 lab C of Ga Ry h 458 Hazel Robinson Henry (c) lab Idle Hour Nurseries r RD 1 Robinson Hester (c) (o) h 358 Robinson rd Robinson Horace (c) lab Proctor & Gamble Mfg Co r 91 (107) Hazel Robinson Ida M (c) maid H G Weaver h 1021 Oglethorpe Robinson lone slswn Burden Smith & Co r 110 Laurel Robinson Isaiah (c; Laura) porter R A Mc- Cord Mtr Co h 3 Chestnut la Robinson James (c; Sallie) 1 h 388 Neel (U) Robinson James (c) r 652 Ross Robinson James (c) emp Dunlap Roofing Co Robinson James (c; Minnie) opener Bibb Mfg Co h 214 (229) Roye Robinson James Jr (c; Minnie) emp Bibb Mfg Co r 388 Neel (U) Robinson James M (Hattie L) crane engr C of Ga Ry h 808 Spring Robinson James M Jr student r 808 Spring Robinson Jean M (c) 1 h 112 Middle (V) Robinson Jennie (c) maid R E Stubbs r 320 3d (V) Robinson Jessie L hlpr r 453 Woolfolk Robinson John (c) porter Union Bus Terminal r 107 2d (V) Robinson John L (c; Lessie B) lab h 109 Drew's Qtrs Robinson John W (c) r 214 Pond (V) Robinson Jos (Mary E) prof Mercer Univ h 503 Adams Robinson Joshua (c; Ida) (o) h 332 Robinson rd Robinson Julia (c) 1 h 106 (342) Rock Robinson Julia (c) nurse 107 2d (V) r do Robinson Laura (wid A J) h 453 Woolfolk Robinson Laura (c) maid Mrs Minnie H Mason r 231 Norris Robinson Leroy H (c) r 123 Roosevelt (V) Robinson Letha (c) maid 355 College Robinson Lettie M (c) maid Dessie Grant h 1 3d St la Robinson Lizzie (c) 1 cook H M Reid r 302 Hawkins Robinson Lola M (c) 1 tex wkr Bibb Mfg Co h 615 Maynard Robinson Louis (c; Julia h 107 2d (V) Robinson Louise (c) maid r 102 (150) Mag- nolia la Roberson Louise (c) maid J R Hamilton r 320 3d (V) Robinson Lucile B Mrs slswn Union Dry Goods Co r 2921 Houston 410 Baldwin's and Telegraph's Robinson Mandie L (c) maid r 9 (132) Malloy's al Rocquemore Annie B (c) cook R A Hightower r 690 Center (EM) Robinson Mary R (c) student r 573 Monroe Robinson Minnie L (c) 5 r 245 Cowan Rocquemore Della (c) mkr Central City Bag Co r 512 (112) Elliott Robinson Minnie S (c) cook C H Davis r 214 (229) Roye Robinson Nannie (c) r 341 2d (V) Robinson Ola L (c) r 1 Bear's al Robinson Quillie (c; Annie) lab h 107 (6) Roddenberg Martha student r 304 Orange Roddenbery Mary C (wid J W) hostess Betsy Ross Coffee Shop r 304 Orange Rodgers Chas A (Mabel) 3 welder C of Ga Ry h 105 Capital Fulton la Robinson Ralph (c) jan The New Yorker r 103 Rodgers Edw hlpr r 659 Elm Rodgers Eliz F r 429 Ridge (I) (107) 2d (V) Rodgers Geo T (Fannie) 1 (o) carrier PO h Robinson Ray pntr r 226 Applewood 602 Duncan Robinson Richd (c; Minnie) (o) emp C of Ga Rodgers L Oliver (Mary E) elk Citizens & So Ry h 406 (542) Stevens (SM) Robinson Robt L (c) butler Mrs Cecil Morgan r 315 (720) Short (EM) Robinson Roy J (Betty) 1 r 453 Woolfolk Nat Bk r 602 Duncan Rodgers Lonnie (c; Laura) (o) emp C of Ga Ry h 102 Blount (SM) Rodgers Minnie (wid K W) h 659 Elm Robinson Ruth elk FERA r 104 Pio Nono Robinson Sallie J (c) lndrs r 388 Neel (U) Robinson Sami (c; Emma) 2 emp Dunlap Roof- ing Co h 214 Pond Rodgers T Furlow (Lucile) 2 (o) vulc Mulberry Serv Sta h 429 Ridge (I) Rodgers W Emory student r 602 Duncan Roe Milton (Openell) electrn r 758 Cherry Robinson Sara F student r 104 Pio Nono Robinson Sarah E (wid Floyd) r 135 Highland Rogero Chas J Jr (Mamie) 1 (o) emp W T McCrary h 711 Holt Robinson Savannah (c) cook C E Newton Jr r 344 Patterson Robinson Stella (c) maid r 1012 Elbert Robinson Susie (c) 2 r 358 Robinson rd Robinson Thos W (Eunice L) 1 meat ctr Mel- ton Gro Co h 208 Montpelier Robinson Tommie L (c) h 431 Elbert Robinson Viola (c) h 123 Roosevelt (V) Robinson Walter (c; Annie) h 340 2d (V) Robinson Walter H (Loree) 2 hlpr h 1420 3d Robinson Wilfrid (Thelma) 2 bkpr h 112 Branch Robinson Wm (c; Savonoh) chauf W A Har- ris h 344 Patterson Robinson Wm Jr (c) r 344 Patterson Robinson Wm F (c) emp Sinclair Serv Sta r 106 (342) Rock Robinson Wm F Jr (c) r 106 (342) Rock Robinson Wm S (Ruby) 1st sgt USMC Recruit- ing Sta r 209 1st Robinson Willie M (c) emp Bibb Mfg Co h 407 (307) Waterville rd Robinson Zebie (c) hlpr Maxwell Bros Box Fcty h 4 Harris row Robison Virginia (c) cook R A Williams r 414 Lawton Robison Wm (c) r 505 Monroe Robles Chas W It commndr USMC Recruiting Sta r 407 Ingleside Robson Estelle (c) maid Floy B Gans Robson Julia r 322 Hardeman Robson Mary W (wid Norwood) r 322 Hardezman Robson Wm (c) emp City St Dept r 330 Bar- field al Roby Elva M slswn Woolworth's r 411 Winshir Roby Ida L sten Macon Better Housing Pro- gram r 411 Wtnship Roby James student r 411 Winship Rogero Chas J III r 711 Holt Rogero Wm H r 711 Holt Rogeres A Thos (Mary) 2 emp C of Ga Ry h 36 Arlington pi Rogers Ada (c) r 210 Division Rogers Alice (c) h 150 e Ell Rogers Anne nurse 147 Rose pk r do Rogers Annie M (c) r 123 Bell Rogers Art (c) emp Birdsey Flour Mills h 119 (225) Elliott Rogers Arth (c) porter Piggly Wiggly r 409 e 1st (EM) Rogers Benj B (c) shoe repr Economy Shoe Shop r 215 Jones Rogers Bennie (wid J M) 2 h 329 North Rogers Carl D (Rose M) 2 (O) appraiser HOLC h 617 (613) Johnson Rogers Carrie (c) 2 h 777 Reynold al Rogers Carrie (wid Marshall) h 668 Walnut Rogers David (c) r 301 Blount Rogers Edna r 668 Walnut Rogers Edw (c) hlpr Buck Ice & Coal Co r 210 Industrial Home rd Rogers Elisha H (Hattie) swtchmn So Ry h 3401 Houston Rogers Eliza (c) h 132 (131) Sycamore (V) Rogers Emmie (c) dom E G McKenzie r 342 Madison Rogers Estelle (c) h 305 Long St la (SM) Rogers Florence r 415 Oak Rogers Frank tr dr Gamble Mtr Exp r For- syth rd RD 1 Rogers Geo (c) lab r 301 Blount Rogers Georgia (c) 2 cook r 129 (210) Clara Rogers Georgia (c) maid Louise Tharp h 204 Pear Rogers-Hansom (c; Ethel) firemn r 803 Oc- mulgee Rogers Hardy (c; Lela) trkr C of Ga Ry h W^RU^y Mrs 2 h 411 Winship 118 (9) Fulton la R Central City BaS Rogers Jerry E bkpr Packer Adv Corp r 3401 Houston 1935 Macon City Directory 411 Rogers John (c; Rosa) emp C of Ga Ry r 332 Rogers Waiter S (c; Miranda) (o) elev opr PO J ackson h 210 (207) Grant (V) Rogers John (c; Mattie R) lab h 131 (202) Clara Rogers Willa (c) 3 r 1019 Pio Nono Rogers Wm R (Serena) h 1065 Walnut Rogers Joseph W (Gussie B) phys 201% Cot- Rogier Helen waitress Betsey Ross Coffee Shop ton h 877 Orange Rogers Lawson D (Nellie) 2 (o) engr C of Ga r 360 New Rohlin Einar C spec agt New Hampshire Ins Ry h 4016 (3948) Houston Rogers Lawson D Jr (Stella) 2 slsmn Macon Co r Lanier Hotel Rokins Laura (c) (o) h Lawton rd (B) Coca-Cola Btlg Co h 204 Newberg (SM) Roland Harvey L (Ruby) tr dr r 2010 2d Rogers Lemuel P (Eliz) 2 carp h 316 6th (SM) Rogers Lesora (c) 1 r 1219 3d Roland Henry P (Mary B) 3 tex wkr Willingham Mills h 139 Rembert Rogers Lester (Flavia) shpg elk Freeman-DentSullivan Co h 300 College apt 3 Roland Jeanie (c) 1 lndrs r 124 Cowan Roland Jos A (Pearl) (o) car inspr C of Ga Rogers Lila slswn Union Dry Gds Co r 217 Ry h 2305 2d Tatnall Roland Prentice E elk Bibb Mfg Co r 2305 2d Rogers Lois prof Wesleyan Col r do Roland Rachel (c) dom r 204 (255) Bowman Rogers Louise (c) h 124 (449) Orchard Roland Virgil Air 310 Cedar (SM) Rogers Lucius (c; Minnie) 2 lab h 215 Plant Roland Walter (c) r 207 Ocmulgee (SM) Rolland James (c; Roxie) h 123 (121) Cowan Rogers Lula (wid A L) r 1120 Walnut Roller H Freeman (Bulah L) 2 (A B Lee Plmbg Rogers M Evelyn tchr Chas H Bruce Sch r 329 & Htg Co h 102 Courtland North Rollins Isadore (c) pntr h 439 Peters al (EM) Rogers Malcolm elk Mitchell & Williams Co r 217 Tatnall Rollins Leila (c) r 247 1st (V) Rollins Mitchell (c) tr dr r 439 Peters al (EM) Rogers Marie (c) r 355 Elm Rogers Mary A (wid R E) (o) h 1011 Clinton rd (EM) Rolston Clifford J (wid W C) (o) tchr Lanier High Sch for Girls h 714 Forsyth Romine Lillian (wid H A) 1 (o) h 102 Chrest ROGERS MARY B, Associate Lawyer Pindar Hill (B) & Custer, h 476 College, apt 9--Tel 2962-J Roney Jack student r 517 (513) Napier (EM) Rogers Mattie r 274 Georgia Roney Nicholas (Christine) 1 (Macon Hat Clng Rogers Maurine spooler Bibb Mfg Co r 26 Schell (EM) Co) h 855 Walnut apt 4 Roney Sami G (Margt) train mstr C of Ga Ry Rogers Melba R student r 617 (613) Johnson h 517 (513) e Napier Rogers Michl r 4011 Houston Roney Sami G Jr student r 517 (513) e Napier Rogers Minnie (wid O F) 4 opr Happ Bros Co Roobin Max route formn Independent Ldry Co h 752 Anderson (SM) res Cordele Ga Rogers Minnie (c) maid W L Sutton r 215 Rooks Bee waitress Harry's Cafe Plant Rooks Chas T (Hazel) emp Nu-Icy Btlg Co h Rogers Nell O opr So Bell Tel Co r 4016 (3948) 1141 Milledgeville rd Houston Rooks Lula J (c) sch tchr r 354 5th (V) Rogers Orville D capt USA r 877 Orange Rogers Paul (Frances) 2 hlpr r 1005 Walnut Rooks Mary opr Happ Bros Co h 168 1st Roosevelt Bell (c) dr Kinnett-Odom Co r 19 Rogers Pearl (wid J R) 1 h 217 Tatnall Wall St la Rogers Philip W (Lucile D) 1 elk State Hwy Roosevelt James P cotton buyer r 629 Walnut Bd h 209 Clisby pi Rope E Palmore slsmn McCommon Bros Rogers Pringle (c) cook Mrs Martha Ellis r 263 5th (V) Roquemore Clifford J hlpr r 1015 2d Roquemore Grace slswn Dannenberg's r 415 Rogers R Malcolm (Lenora) (Rogers Serv Sta) h 4011 Houston New apt 3 Roquemore J Asa (Norma) emp Ga Roofing Rogers Robt (Maggie) h 215 Applewood & Sup Co r 1222 2d Rogers Robt (Mary) dep sheriff Bibb County Roquemore James (c; Carrie) emp C of Ga Ry h 508 Walnut h 715 (615) Prince (SM) Rogers Robt (c) 5 (o) sch tchr h 515 Monroe Roquemore James T (Esther) 1 (o) car inspr Rogers Robt B (Mary) 1 sign pntr r 854 So Ry h 1322 2d Cherry Roquemore Minnie (wid W D) emp Happ Bros Rogers Roosevelt (c; Minnie) tr dr Willing- Co h 415 New apt 3 ham S&D Co h 130 (208) Elliott Roquemore Thos (c) butler A D Williams h Rogers Ruth (c) cook W A Steadman r 214 103% (r) Rocky Creek rd Elliott Roquemore Walter (Berta) 2 h 144 Piedmont Rogers Sarah (c) 2 h 73 (136) Forest (V) (SM) Rogers Service Station (R M Rogers) 4005 Roquemore Wm (c; Carrie) emp C of Ga Ry h (3917) Houston 110 1st (U) Rogers Simpson B (Edna) 1 (o) car inspr C of Roquemore Wm D r 415 New apt 3 Ga Ry h 36 (104) Randolph pi Rosall Geo (c; Maude) lab Birdsey Flour Mills Rogers Stella (c) cook Dixie Cafe & Commis- r 361 Flanders sary r 210 Division Rose Carl P (Eliz) - slsmn W J Bailey Auto Rogers Stores (See Rogers Inc) Parts Co h 120 Ninadell dr Rogers Susie M (wid W R) (o) h 595 Carling Rose Ella L nurse Macon Hosp r do Rogers Thelma r 415 Oak Rose Emma (c) cook Isaac Flatau h 158 Cedar Rogers Theo W (Lucile) 2 (o) elk PO h 147 (U) Beverly pi Rose Ernest C (Annie) 3 (o) slsmn Ga-Caro Rogers Thos E (Hazel H) 1 (o) phys 330 Doc- Oil Co h 2404 Forsyth rd tors bldg h 120 Clisby pi Rose Hattie (c) (o) lndrs h 607 Straight (U) Rogers Thos E Jr student r 120 Clisby pi Rose Hill Cemetery F R L Stroberg supt end Rogers Thos H (Lola) r 268 Willingham Orange Rogers Virginia R r 329 North (NH) Rose Ira (c; Fannie) 2 emp Dempsey Hotel h Rogers W Roy student r 595 Carling 100 2d (U) 412 Baldwin's and Telegraph's Rose John (c) r 607 Straight (U) Ross Jas M (c) pntr h 240 Dempsey Rose Joseph (c; Amanda) (o) meat ctr h 355 Ross James T (Belle) (o) phys 509 Bibb Bldg Harris (U) h 363 College apt 1 Rose Louise (c) sch tchr P S r 607 Straight Ross Jerome F (Laura) 1 emp C of Ga Ry (U) r 717 Main (EM) Rose Margt (c) maid T L Adams r 233 Cedar Ross Jessie (c) sch tchr r 114 (132) Neal (V) Rose Marian J (c) bellmn Dempsey Hotel r Ross Jimmie r 319 Walnut 355 Harris (U) Ross John (c) r 247 (246) Cowan Rose Mildred (c) dom r 321 Ernest Ross John (c; Lucile) 3 h 617 (12) Gilmer Rose Sami Jr (c) mus r 607 Straight (U) Ross John L (c) emp Kinnett-Odom Co r 115 Rosebud Viola (c) cook r 362 Pine (460) Shoals la Rosencrance Rubin W night supt So Cotton Ross Jbs (c; Annie M) jan Lanier High Sch Oil Co r 550 Edgewood for Boys h 965 (723) Clinton rd Rosengreen Vivian J (Winifred) 1 mechl supvr Ross Jos L (c; Annie) 1 lab F S Royster Procter & Gamble Mfg Co h 113 Avon rd Guano Co h 160 Astor Ross Allen (c) r 247 (246) Cowan Ross Josie (c) dom h 527 Academy al (EM) Ross Beatrice (c) r 214 Division Ross Kuter (c) Indrs Macon Hosp Ross Brigie W (c; Mary) emp Knights of Pyth- Ross Lee (c; Della) 1 (o) h 200 (201) Colquitt ias bldg h 108 May Ross Lettie (c) emp C of Ga Ry h 144 Bay Ross Bros (c) (R L Ross) gros 159 Middle (V) Ross Lois r 124 Log Cabin dr Ross Carrie (c) h 247 (246) Cowan Ross Lucile (c) cook My Own Restr Ross Chas (c; Lilile B) 1 jan Grand bldg h Ross M Summerford (c; Mattie) cook h 416 970 (720) Clinton rd (EM) Oglethorpe Ross Chas (c) shoe shiner Clinton Brantley r Ross Major (c; Pearl) 1 emp C of Ga Ry h 4 Plant al 721 Daisy (SM) Ross Chas H (c; Marie Y) (o) h 203 Doug- Ross Malcolm R (Sarah J) 2 (o) dept mgr las (V) Adams-Buchanan Mtr Co h 212 Buford pi Ross Chas W (c; Josephine) h 202 3d (U) Ross Martha (c) r 607 (683) Elbert Ross Claude F (wid F) (o) h 320 Orange Ross Martha sch tchr r 212 Buford pi Ross Clifford M (c) 3 cook J J McCreary h Ross Mary (c) h 152 Madison 350 5th (V) Ross Mary (c) cook C E Paul r 275 Garden Ross Co The M G Ross pres O W Hays sec- Ross Mary Mrs 2 tex wkr Willingham Mill h treas bldg sups ft Poplar 100 (206) Green (V) Ross Dallas L (Margt E) (Cherokee Barber Ross Mary E (c) cook h 115 (460) Shoals la Shop) h 811 Montpelier Ross Mattie (c), r 200 (201) Colquitt Ross Edgar (c; Fannie) h 303 Charles Ross May tchr Pearl Stephens Sch r 101 Ross Edgar J (Carrie) carp h 116 Richmond Grand (B) Ross Edmund W (Mildred) 2 inspr Art Furn Ross Minnie (c) r 109 Bostic la Mfg Co r 116 Richmond Ross Murrell G (Sarah T) (o) pres The Ross Ross Edna (c) Indrs h 14 (305) Hanson (SM) Co h 534 College Ross Elijah E (c; Ada) (o) emp C of Ga Ry h 107 May Ross Nora (c) 1 emp Macon Hosp r 225 Division St la Ross Eliz (c) r 75 Bay Ross Patsy (c) emp So Crate & Veneer Co r Ross Eliz (Mrs E H) mgr Dolly Grayson Cos- 111 (14) Clara metic Co r 101 Grand (B) Ross Paul hlpr City St Sweeping Dept r 353 Ross Eliz tchr Wesleyan Conservatory r 101 Flanders Grand (B) Ross R Wallace (Carrie B) 2 (o) slsmn h 124 Ross Emmett H (Eliz) radio repr Wade & Co r 101 Grand (B) Ross Eunice M (wid E H) (o) h 101 Grand (B) Ross Fannie (c) h 222 Gilmer Ross Fannie Mrs r 129 Rogers (V) Log Cabin dr Ross Ralph (Hattie) 3 slubber hd Bibb Mfg Co h 761 Hawthorne Ross Richd (c; Mattie) h 220 Patterson Ross Richd D (c) (o) (Ross Bros) h 247 1st (V) Ross Felton (c) tr dr Sawyer Ice & Coal Co r 855 Ocmulgee Ross Florence (c) dom r 1430 Broadway Ross Roosevelt (c; Mary) hlpr F S Royster Guano Co h 275 Garden Ross Rose r 124 Log Cabin dr R02os09 FErlamnk (c) emp Vineville Packing Co h Ross Hartley (c; Annie) 1 carp C of Ga Ry h 1430 Broadway Ross Rose (c) Indrs Crescent Ldry Ross Ruby P emp Macon Cafeteria r 116 Richmond Ross Sami (c; Eliza) (o) tr dr Piggly Wiggly Ro629 HOeriaenngetchr Lanier High Sch for Girls r Ross Henry (c; Leila) 2 emp So Crate & Ve- neer Co h 719 Fort Hill Ross Heria (c) r 203 Toombs (SM) h 114 (132) Neal (V) Ross Sarah student r 212 Buford pi (V) Ross T L Lumber Co (T L Ross) 507 First Nat Bk bldg Ross Thelma (c) 1 r 203 Toombs (SM) R r 14 Parker (V) Scott Wm (c) lah h 4 Murray al 114 Tatnall Searcy Lillie M (c) 1 dom r 110 (121) n Holt Scott Wm (c) lab r 246 Willingham al Sarcy Louis (c) emp C of Ga Ry r 143 Middle Scott Wm (c; Leila) 5 (o) porter So Ry h 261 (V) Broad Searcy Mary J (c) lndrs r 22 Berthadale (V) Scott Wm C (Margt) (o) (Scott Filly Sta) h Searcy Ollie M (c) cook Mrs Leila Colquitt 215 (211) Park (B) Searcy S Jackson (c; Della) 1 h 356 Edison Scott Wm E (Georgia) 1 emp MD&SRR h 1073 Searcy Sol (c) lab So Crate & Veneer Co h 325 Walnut (233) Division Scott Winelle student r 1073 Walnut Searcy Titus (c; Frankie) lab So Crate & Ve- Scoven O Raymond (Delores) 3 shpg elk Swift neer Co h 210 Division & Co r 1821 Broadway Searcy Wm (c) h 601 122 Elliott Scoven Sami G (Mattie) (o) emp C of Ga Ry Searcy Wm maid J R Baxley r 147 (r) High Sherman Lucille (c) maid Lee Barfield r 115 (101) Orchard Sherman Mamie (c) clnr Bibb Mfg Co r 408 (467) Alabama (SM) Sherman Marie (c) 2 h 529 Forsyth Sherman Mary (c) cook A E Gilmore r 116 4th ^ Clr Citizens & Sou Nat 1935 Macon City Directory Bk 1 Shirley Annie R (Mrs J L) r 464 Orange Shirley Hills Club Homer 427 slswn Dannenberg's N Oliphant mgr Nottingham dr extd Shuford Naomi (wid S B) 2 r 321 Montpelier Shirley Jasper L (Annie R) agt Life & Casual- Shuften Olivia (c) r 236 1st (V) ty Ins Co r 464 Orange Shuler Frances W (Mrs W E) opr So Bell Tel Shirley Louis A (Mamie) agt Equitable Life Assurance Soc of U S h 414 Hines ter (V) Co r i1x5io6lfoCr*risTTp. W^ aSf.t LT it & Shiver A Estelle (Mrs W H) tel opr Ga Peach Casualty Ins Co r 156 Crisp Growers Exch r 297 Orange Shults Dec (Mary) 4 r 126 (102) Charles Shiver Lillian r 653 Elm Shuman Julius B r 864 Mulberry apt 1 B Shiver Louise (c) cook D D Kinnett r 855 (856) Shupe Elmer L student r 1133 College dr 3d (V) Shupe Leroy R (Hallie) emp Mercer Umv h Shiver Walter (c; Mary) 1 City St Dept h 16 1133 College dr (116) 5th (SM) Shupe Sarah L student r 1133 College dr Shiver Wm H (A Estelle) slsmn Am Printing Shumey James (c) cook Dempsey Hotel r 330 Co h 297 Orange Dempsey Shoates Maria (c) h 367 (334) North Shurney Nina (c) 8 h 753 Edgewood Shoates Mattie (c) presser Union Dry Gds Co Shurney Vine (c; Lenora) waiter Dempsey r 105 (141) Richard Hotel r 330 Dempsey Shoats Chas (c; May Bertha) 5 emp Birdsey Shy (see also Shi) Flour Mills h 102 Smith (EM) Shy Eula B (c) 5 h 505 (504) Hall (EM) Shoats Ella (c) maid Lee Watson r 435 North Shy Isaac S elk Geo Hardin r 724 Montpelier Shoats Lillie M (c) maid Lee Watson r 435 Shy Lamar waiter Spiller's Restr r 172 Ell North Shy Robt I (Thelma) 3 slsmn Nu-Icey Btlg Co Shoats Nottie (c) r 703 (362) Charles h 172 Ell Shoats Sallie (c) r 701 (608) Crisp Sicurella Josephine (wid PS) (o) h 270 Main Shockley Edw (Jean) 1 slsmn r 920 College (EM) apt 1 Sid's Place (W S Simmons) restr 414 2d Shoemake Linton (c) firemn C of Ga Ry h 233 Siegel Alvin E phys 609 Ga Casualty Bldg r Gilmer Dempsey Hotel Shoenfelt Henry E (Estella) 3 dist mgr G R Sigman John M (Leila R) (o) phys 406 Grand Kinney Co h 660 Hillyer Bldg h 705 Napier Shores Edw elk The Green Front r Arlington Sikes Amos M (Minnie) (o) dispr So Ry h 110 Hotel (100) Avon rd Shores John M r 458 Spring Sikes Bernice registrar FERA r 110 (100) Shores S Ann (wid F M) (o) h 2338 2d Avon rd Shores Willard M cash Spiller's Restr r RD 4 Sikes Doris waitress The New Yorker r 90o Short Susie (c) emp Independent Ldry Co Cherry Shorter Butler E (c) pdlr h 674 (507) Douglas Sikes Edna student r 110 (100) Avon rd (V) Shorter Daisy M (c) maid W D Argo Sikes En'dtrwininrMrV2a32T Cftlednanrr(SRMib)b Mfff Co r 1920 Shorter Edw S (o) artist 130 Georgia h do Shorter Geo (c) butcher r 1 Berthadale dr (V) Sikes Hattie emp Macon Coca Cola Btlg Co h Shorter Joseph W (c) lab r 1 Berthadale dr 401 College apt 6 I (V) Sikes Helen student r 860 Mulberry Shorter Theodosia (c) 1 r 28 Parker (V) Sikes J Simeon (Evie) hlpr Millirons Plmbg Shorty's Place (W R Masters) tourist camp & Htg Co h 1920 2d 3105 Houston Sikes James C (E Leonora) 1 pressmn J W Shouse Alex S emp C of Ga Ry r 205 Peach- Burke Co h 1526 2d tree Sikes Julian M slsmn Fenner & Beane r HO Shouse Annie G r 2400 Forsyth rd (100) Avon rd Shouse Benj B (Roberta) engr MD&SRR r 618 Sikes Marguerite r 1526 2d Hemlock Sikes Mattie (wid J G) 1 emp Adams Mfg Co Shouse Edger S (Ethel S) 1 eng C of Ga Ry h r 1526 2d 2400 Forsyth rd Sikes Thos H (Annie) 5 emp Ga Kaolin Mines Shouse Edgar S Jr (Nellie) 2 r 1020 Oglethorpe h 232 Cedar (SM) Shouse Harry student r 106 Park pi Silas Edw (c; Tommie) lab r 108 (8) Clara Shouse James P (Lucile) 4 (o) condr GS&FRR Silas Henrietta E (wid J P) r 131 High h 106 Park pi Silas Julia tchr Chas H Bruce Sch r 141 High Shouse Julius S sta atndt Standard Oil Co r Silas Sarah (c) h 409 (452) Womack 2400 Forsyth rd Silas Tommie (c) lndrs r 108 (8) Clara Shouse Melvin r 106 Park pi Silk Stocking Hospital (G R Schelling) 119 Shouse Preston G (Ira) r 106 Academy Cotton Shrem Abram (Emma) 1 gro 432 Flanders Silver Dollar (J M Simmons) confr 316 Broad- (EM) h 428 do Shrem Jack (Mollie) 1 (Daylight Cash Gro) b Silver Moon Cafe (c) (Andrew Noutos) 311 702 Daisy (SM) Broadway Shrem Mollie (Mrs Jack) elk Daylight Cash Silver Mark (Fay) pres Burns Boot Shoppe Inc -Gro r 702 Daisy (SM) r 308 Buford pi Shrem Nunie (Sarah) r 704 Daisy (SM) Silvester A H (c) porter R W Edenfield r RD Shrem Rachel r 428 Flanders (EM) 2 Columbus rd Shrem Sarah elk Abram Shrem r 428 Flanders Silvius Chas T (Duchia) (o) emp Birdsey Flour (EM) Mills h 603 Log Cabin blvd Shrem Sarah student r 702 Daisy (SM) Silvius Duchia R Mrs tchr Bellevue Sch r 603 Shropshire James (c) pastor Grants Chapel Log Cabin blvd AME Ch r 502 (481) Charles Simmerville Francis r 140 Georgia Shropshire John T (Eula) plmbr 517 Cotton b Simmons Ada J (c) maid G E Rosser r 222 1021 Hazel Forest (V) Shropshire John T Jr r 821 Mulberry Simmons Addie F (Ethel) 8 lab h 560 Edge- Shuford H Virginia student r 321 Montpelier wood 428 Baldwin's and Telegraph's Sim(Vm) ons Alice (c) maid C R Owen r 3 (2) 5th Simmons Alonzo (c; Alice) 3 carp h 308 (238) Roye Simmons Arth (c) lab h 217 Fretwell al Simmons Asalee (c) 1 cook M M Pope r 208 Woodliff Simmons Bessie M (c) lndrs r 649 Elm St la Simmons Brantley K (Frances) asst wire chf W U Teleg Co r RD 2 Bloomfield rd Simmons Chas (c; Louise) emp Maxwell Bros r 301 (306) Bowman Simmons Chas (c; Mattie) lab h 402 Craft la Simmons Clarence (c) emp Jeffreys-McElrath Mfg Co r 104 Morgan (U) Si^(551)ns2od?o(lUli)er (c; Lucinda) 1 peddler h 306 Simmons Collins (c) r 120 1st (U) Simmons Cornelia (c) maid Ga Acad for the Blind r 225 190 Fargason (V) Simmons Della (c) maid Ida Lester r 8 Buck ner al Simmons Dorothy tchr Whittle Sch r 110 Clis- by pi Simmons Edna M (c) maid Lenora Wachstein n 121 Woodliff Simmons Janet (c) 1 lndrs r 105 (141) Richard (U) Simmons Job C brklyr r 600 Elm Simmons John (Emma M) carp h 655 Elm St la Simmons John (c; Leola) delmn Melton Gro Co r 120 1st (U) Simmons John (c; Sallie) lab r 801 (181) Colquitt Simmons John (c; Mabel) tr dr J W McCook Lbr Co h 943 Pio Nono Simmons John H brklyr r 660 Elm Simmons John R (Sybil D) 3 atndt Tank Car Serv .Sta h 821 Montpelier Simmons Joseph (c) r 1014 Broad Simmons Joseph (c; Odessa) 4 lab Proctor & Gamble Mfg Co h 722 (632) Prince (SM) Simmons Joseph L (Mary) r 106 (203) Grand (B) Simmons L Kate Mrs h 325 White (SM) Simmons Lance B (Berta H) (o) trav slsmn h 110 Clisby pi Simmons Lucille (c) cook 806 Napier Simmons Lula (c) 2 cook A B Eubanks r 80 (136) Forest (V) Simmons Lula (c) lndrs h 5 (122) Malloy's al Si?SMr EdW 1 1(.,,,3 (255) h 817 RIuellen (O (o) h 121 Wise (V) Simmons Maybelle (c) r 118 Bay Simmons Moses I (Aline) 1 (o) (Simmons Gro Co) h 514 Beech Simmons Mosilee (c) cook H W Pittman r 620 4th (V) Simmons Nancy (c) r 427 Liberty (SM) Simmons Nora (c) r 225 (190) Fargason (V) Simmons Norman (c; Greenie) emp So Ry r 511 Calhoun :^oGhV8%2^ree4nT^) " ** & Simmons cS^ash r 210 Gremda ter Prgress"lv2e22LiFfoe rest (V) Co Simmons Ola M (c) maid Capitol Hotel r 519 Chappell (SM) Simmons Olive D (wid W S) (o) h 457 Spring Simmons Patk 3 hlpr r 103 Washington Simmons Perry D (c; Minnie) r 111 Tindall (SM) Simmons Phil E elk Broadway Cash Mkt r 129 Merritt Simmons Robt (c; Sarah) 1 lab r 299 Blount Simmons Rosa cash Chapman's Pharm r 660 Elm Simmons Gds Co Hr e2r1b9eN/toVrtrhwil^a)i 2S?lS2mFnoU rensiton(VD> r^ Simmons James (c; Sallie) h 519 Chappell Simmons Sarah (c) 1 lndrs h 216 (206) Virgin x3> Simmons Sipp r 218 Georgia Simmons Stokes T (c; Carrie) druggist 251 5th h do S Pa"onTv)S (C: Crnelia> h 225 ") *Lames (c) r 716 3d (V) TMftdai?r (C: Henriea) 1 (o) gdnr h Simmons James (c) student r 251 5th Simmons Thos A (Eliz) h 111 Brentwood 1 electrn C of Ga RJv Simmons Thos S (Laura) bldg contr 660 Elm h do Simmons Victor L (Lucille) 4 (o) slsmn Ga Caro Oil Co h 124 North Bmerrbbeer &I"Breauty Shop (oh) 2b1a0rbGerrenGaednaontee'rs Simmons Vinie (c) 2 h 262 (250) Bright (SM) Simmons W Henry (c; Christine) 2 tr dr WillMkktt,nSSilnvaemr eD^oillfar)(Ahgn1e2s9> M(Berrroiattdway Cash ingham S&D Co h 114 May Simmons James T (Mattie) 1 brklyr h 1726 3d Simmons Walter (c; Ada J) 5 ydmn h 222 1935 Macon City Directory Forest (V) 429 Simmons Walter B (Marie) teller First Nat Bk Simpson Wemyss I (Ethel) meter mech Macon & Trust Co h 203 1st Gas Co r 407 Forsyth Simmons Walter J traffic'surveyor r 457 Sims Ada Mrs r 140 Hines ter (V) Spring Sims Alf F (Ola) r 115 Plant (SM) Simmons Walter S (c) r 222 Forest (V) Sims Andrew W (c; Addie) peddler r 306 Simmons Webster D (c; Annie M) (o) agt N C Berry Mut Life Ins Co h 123 Penn (V) Sims Andrew W Jr (c) student r 306 Berry Simmons Wesley (c; Gussie) h 967 Ocmulgee Sims Anna (c) h 156 Bay Simmons Wm (c) peddler r 120 1st (U) Sims Callaway (c) r 953 Pio Nono Simmons Wm C (c; Frances) h 15 Alabama Sims Carrie (c) h 165 (237) Elbert (SM) Sims Chas L (c) porter Cudahy Pkg Co r 953 Simmons Wm M (Bert) 1 hlpr h 2639 2d Pio Nono Simmons Wm S (Janie) 1 (Sid's Place) r 457 Sims Early (c) r 122 Sycamore (V) Spring Sims Edgar (c; Rosa) 1 emp Vineville Pkg Co Simmons Willie 2 r 308 (238) Roye h 325 5th (V) Simmons Willie (c) cook G E Paine) r 116 Roff Sims Eliz (c) (o) h 953 Pio Nono Home Sims Fannie (c) cook J W Harrison h 986 Simon Leila M (c) maid r 411 Short, (EM) Montpelier Simone Alice (wid J E) r 467 Elm Sims Frank (c; Eula) emp Bibb Mfg Co r 157 Simone Jacob S (Emma) coir J Backer Furn Coles 3,1 Co h 2107 Broadway Sims Frank E (Sallie) h 131 (30) Bellevue rd Simone Sami I r 2107 Broadway Simms Frank R slsmn Standard Parts Co r Simons Huling T shpg elk Dixie Dairies r 203 140 Hines ter (V) Clisby pi Sims Harris W r 124 Appleton Simons Robt (c; Lillie) lab h 93 Harris al Sims Henry (c) lab r 986 Montpelier Simpkins M Hulon (Nell) 1 tr dr Gamble Mtr Sims Irma (c) 1 emp Snow's Ldry r 1003 Pio Exp h 115 Academy Nono Simpson Annie B (c) 1 dom r 169 Roye Sims James (c) r 986 Montpelier Simpson Annie L (o) h 117 Lawton Sims James (c; Pearl) h 75 (82) Schofield Simpson Arth B (Ethel) 3 doffer Bibb Mfg Co Sims James (c; Mattie) 2 lab SE Exp h 106 h 1414 3d (113) Davis la Simpson Bessie M (c) 1 r 207 (123) Virgin la Sims James (c; Maggie) 2 (o) pntr h 222 (165) (V) Grant (V) Simpson C Robt (Eva) barber Brockmans Sims Jenkins H (Rosalyn) trav slsmn h 124 Barber Shop r 817 New Appleton Simpson Carlton (Juliette) 1 r 173 Cedar (SM) Sims John (c) hlpr C of Ga Ry h 23 Spring Simpson Chas (c; Pinkie) lab Macon Coca- Sims Joseph J r 104 3d Cola Btlg Co h 357 Hazel Sims Joseph S bus opr Ga Power Co Simpson Clarence I (Bertha) 1 engr C of Ga Sims Lizzie (c) ldry wkr h 9 Ross St pi Ry h 109 Capital Sims Lula (c) cook L B Simmons Simpson Ethel (Mrs W I) case wkr FERA r Sims Maggie (c) cook Mary S Burke 407 Forsyth Sims Marion B student r 124 Appleton Simpson Etta Mrs h 137 Cole Sims Mary (wid E L) (o) h 309 Melrose (B) Simpson Eva opr Happ Bros Co r 913 2d Sims Mattie (c) maid B C Snow Simpson Frances (Mrs R A) mgr Swannee Sims Mattie (c) maid r 125 (10) Jordan Sweet Shop r 623 Ingleside Sims Oliver (c; Nora) 2 (o) farmer h 986 Simpson Iola (c) cook J C Sheehan r 541 3d Montpelier (V) Sims Oliver Jr (c) farmer r 986 Montpelier Simpson J Thos (Lula) fir fnshr h 908 New Sims Ralph L (Gladys E) 4 emp Collins Bak- Simpson Jack r 109 Capital ing Co r 504 Hemlock Simpson James F tr dr Jeffreys-McElrath Mfg Sims Smith M (c; Beatrice) instr Central City Co r 202 Davis (SM) Col r 1035 Clinton rd Simpson Jas W (Mollie Y) 1 lab City Bd of Sims Sylvia (c) 3 h 227 (219) North Water Comrs h 854 Elm Sims Wilhelmina (c) r 402 Roye Simpson John J tr dr Jeffreys-McElrath Mfg Sir is Wm (c) lab So Crate & Veneer Co r 156 Co r 202 Davis (SM) Bay Simpson John L (Sarah) (The Brass Rail) h Simson James C carp Kinmore Burns Inc r 448 Edgewood Cherry cor 8th Simpson Jos A (Lucy) 4 doffer Bibb Mfg Co h Sinclair Alice emp Bibb Mfg Co r 1503 2d 1419 3d Sinclair Alice (Mrs WE) winder Bibb Mfg Co Simpson Levora (wid C R) r 1 Flanders r 1333 2d Simpson Lucy (Mrs J A) emp Bibb Mfg Co r Sinclair Birdell (c; Arlena) 3 emp Maxwell 1419 3d Bros h 102 Thomas Simpson Mabel (c) r 207 (123) Virgin la (V) Sinclair Chas (Ruby) 2 emp Gantt Mfg Co h Simpson Martha (wid C E) r 1227 2d 1503 2d Simpson Mattie (Mrs J W) opr Happ Bros la Sinclair Clarence hlpr Bibb Mfg Co r 1503 2d r 854 Elm Sinclair Eug (c; Mabel) 6 h 800 Cowan Simpson Newton A tr dr Jeffreys-McElrath Sinclair Joseph (c; Abbie) (o) h 812 (809) Mfg Co r 202 Davis (SM) Cowan Simpson Otis (Alma) 3 h 202 Davis (SM) Sinclair Jos (c; Mary) 2 h 607 Flanders Simpson Robt A (Frances) 1 coir Macon Sinclair Lena M Mrs 4 opr Adams Mfg Co h Chamber of Com h 623 Ingleside 1120 Oglethorpe Simpson Sami (Mattie) r 141 Lamont (LCHts) Sinclair Mary (wid C E) r 1503 2d Simpson Sara h 810 Broadway SINCLAIR REFINING CO, Reginald Trice Simpson Wm A mkr Otto Harness Co r RD 6 Mgr, 333 Hammond at So Ry--Tel 3211 Cross Keys Sinclair Ruby smstrs Bibb Mfg Co r 1333 2d Simpson Wm A Jr (Lois) 1 printer Jones & Sinclair Walker (c; Anne B) porter J W Burke Coney r 852 Walnut Co r 812 (809) Cowan 130 Baldwin's and Telegraph's Sinclair Walter E (Alice) 1 pntr h 1383 2d Sisk O Clyde (L Mae) 1 civ engr h 854 Hem- Singer Sewing Machine Co W R Clark mgr 618 Cherry Singletary David (c; Corinne) butcher T & T Packing Co h 329 Hammond Singletary James (c) r 329 Hammond Singletary Willie B (c) maid Vincent Canipelli r 8 Woodliff Singletary Julia (c) Indrs h 206 (156) Guern- sey la Singleton Alice (c) r 114 Wyche Singleton Bertha (Mrs C C) spinner Bibb Mfg Co r 1530 Broadway Singleton Ceola (c) r 210 Lee (EM) Singleton Chas C (Bertha) 4 h 1530 Broadway Singleton Cleveland (c) lab r 311 Short (EM) Singleton D Lucile elk Newberry's r 613 Orange apt 2 Singleton Eula (c) r 218 5th (V) Singleton Fredk L (Edna R) slubber hd Bibb Mfg Co h 1019 Ash Singleton Gordon G (Hallie) prof Mercer Univ h 509% Adams Singleton Hattie (c) dom r 110 Powell Singleton Hazel r 14 (86) Randolph pi Singleton John (Frances) 2 slubber hd Bibb Mfg Co h 733 Hawthorne Singleton John W (c; Katie) barber G W Hat- field h 119 Ritchey Singleton Jordan (Sallie) (c) h 308 Berry Singleton Laura (c) maid W M Collins r 327 2d (V) Singleton Louise tchr Lanier High Sch for Boys h 559 Orange apt 6 Singleton Mary (c) h 843 Main (EM) Singleton Mary (c) Indrs h 311 Short (EM) Singleton Mary sten U S Dist Atty res Laurine Ga Singleton Minnie (c) colored ed Macon Teleg Pub Co r 369 2d (V) Singleton Naomi (c) maid J N Birch h 101 Rose Crest Singleton Paul (c; Viola) elev opr Macon Sav Bk Bldg r 122 Hill Singleton Robt (c) hlpr So Crate & Veneer Co r 526 e 2d (EM) Singleton Sylvester (Ethel) 3 speeder hd Bibb Mfg Co h 323 Calhoun Singleton Walter H (Sarah) pntr r 1019 Ash lock Sisk Walter E (Edna M) (Mutt & Jeff Lunch) h 2008 Vineville Sisson Jay D waiter Smitty's Barbecue Lunch r 855 Mulberry Sissons Mary E (wid P W) r 621 Duncan Sistare Marion M (Susan) sis mgr Macon Coca-Cola Btlg Co r 654 Vineville Sisters of Mercy 665 Orange Sistrunk Adam (Hattie) h 312 Harris la Sittler Alphonso asst rector St Peter Claver Catholic Ch r 430 Ward (V) Sitton Emmett L (Lois) 1 (o) emp So Ry h 1335 3d Sitton Myrtle (wid J C) opr Happ Bros Co r 1335 3d Sitwell Jennie B (c) r 318 Walnut Sitwell Thos L (c) emp Bon Ton Lunch Rm r 318 Walnut Six Point Weiner Stand (J C Mumford) 471 Cotton Skelley Edison (Clyde) auto repr 1034 Broad- way h 123 Rogers (V) Skelley Hattie Mrs r 108 Lamar (V) Sketch Club Edw Shorter pres meets Tues & Fri at 8 p m 130 Georgia Skinner Bonnie (May) 2 tex wkr h 154 Lee (EM) Skinner Chas r 1442 2d Skinner Emma (wid J E) r 954 Oglethorpe Skinner Ephraim J (c; Emma) (o) emp Bibb Mfg Co h 401 Taylor (EM) Skinner Ephraim J Jr (c) student r 401 Taylor (EM) Skinner Ernest E (Marie) 1 agt Life Ins Co of Va h 426% Johnson Skinner Georgia M slswn r 627 Arch Skinner John V (Mary) 2 (o) sis mgr Happ Bros Co h 405 Hines ter (V) Skinner Johnnie (Lillian) 1 lab r 954 Ogle- thorpe Skinner Jos D (Jessie) 1 blrmkr MD&SRR h 1442 2d Skinner Jos D III printer Macon Teleg Pub Co r 1442 2d Skinner Julia (wid J P) h 627 Arch Skinner Lila M (c) maid S P Boles r 102 Ruby Skinner Marshall elk Macon Telegraph r 1442 TMl6y, T 2 h 14 (86) Randolph pi Hilfn Wl" (C) lab Bibb Co h 806 Fort Singleton Willie (c) cook A D Sanders r 410 Monroe (V) Sintell Carl r 4 Grand (B) Sintell Emma Mrs r 4 Grand (B) Sintell Nellie Mrs 3 r 4 Grand (B) Smtell Wm r 4 Grand (B) 2d Skinner Roosevelt (c; Lila M) pntr r 102 Ruby (V) Skinner W Bryan (Myrtle) 1 serv mgr Good- rich Silvertown Stores h 792 Holt Skinner Walter A (Carrie L) (o) blr inspr MD&SRR h 100 Corbin (V) Skinner Wm L r 128 Thomas (LCHts) Skipper Benj F (o) h 162 Emory (SM) IITM S01? ,(ersPWriandge l&a Co r ( Crisp Skipper Chas B elk Rogers Inc res Skipperton Ga Skipper Chas J (Lucille) 2 printer Flynn SlSpringdla(C) emP DemPsey Hotel h 114 (7) qjPP aif.er (c; Mary) 2 lab r 402 Crisp Printing Co h 127 Violet Skipper Clarence (Rose R) 2 elk Macon Trans- ient Bur h 120 Pinson (SM) ^Charles6 M (c^ Ck L F burden r 602 (119) Sires Kathleen student r 315 Duncan Skipper Jack C (Minnie L) winder Bibb Mfg Co r 111 Capital Skipper Jas S (Eddie) 1 dist supt Ga Power Co SIRES MELVIN J/ E(A) nn(0ie)) h310(0o5) O(gSlmetihthorp&e Watson), h 315 Duncan--Tel 1978-W h 860 Hillyer Skipper John W (Julia A) (o) h 3904 Houston Skipper Julius W (Jennie B) crane opr r 3904 131 KRfo^spel1 M pk (Grace) elk Smith & Watson r Houston Skipper Minnie L (Mrs J C) emp Bibb Mfg Co Slblv?elphiS R (Louise> 1 b 106 American r 111 Capital Slade Edna C (Mrs J W) ofc sec Brown & Sisk Fredk L r 319 Melrose (B) Groover r 855 Mulberry apt 100 Sisk Harry L (Thelma) 1 lab C of Ga Ry Creosote Plant h 319 Melrose (B) Slade Gladys (wid J B) 4 (o) h 107 Lob Cabin dr Slade Jos B delmn r 107 Log Cabin dr 1985 Macon City Directory 481 Slade Jos W (Edna) emp Ga Peach Growers Exch h 855 Mulberry apt 100 Slade M Elizabeth r 107 Log Cabin dr Slade Truman J dentist 607 Bibb Bldg h 401 College apt 3 I Slappey Bertha (c) r 109 (5) Braswell la Slappey Evelyn r 205 Oak Haven Slappey Joshua (c; Willie) 2 lab So Ry h 1052 Hazel Slappy Loretta (c) lndrs h 426 (r) Main (EM) Slappey Lovie L (wid W F) h 632 Orange Slappey Mary (wid T J) (O) h 617 (1753) Log Cabin blvd Slappey Robt (Velma) emp MD&SRR h 255 New Slappey Robt A (Madge E) 1 slsmn Firestone Auto Sup & Serv Stores r 604% Forsyth Slappey Ruby (c) dom J C Dumas r 1052 Hazel Slappey Thelma sch tchr Andersonville Ga r 617 (1753) Log Cabin blvd Slappey Virginia R nurse 865 Orange r do Slappey Wilbert (c; Bertha) emp Kinnett- Odom Co Slater Fredk (Cleary) 1 emp So Crate & Ve- neer Co r 204 Washington Slater L Laughdon slsmn Sunlite Electrik Bake Shop r 663 Walnut Slater Madison (c) r 160 Lincoln (V) Slaton Chas r 351 Fairview Slaton Leonard P (Maggie D) 2 tr dr Ga Hwy Exp Inc h 351 Fairview Slaughter Chas H (Bessie) 6 county tr dr City Bd of Health h 2552 Broadway Slaughter Ether r Hotel Macon Slaughter James C (Mattie) (o) tr dr City Bd of Health 226 Fairview Slaughter Jerry (c) r 613 Georgia Slaughter John (c) ydmn 204 Buford pi (V) Slaughter Louis (c) h 205 Coles al Slaughter Marie emp Willingham Mills r 2552 Broadway Slaughter Mattie (Mrs J C) emp Carling Tile Co r 226 Fairview Slaughter Maybelle r 2552 Broadway Slaughter Oscar (c; Fostell) 4 emp So Crate & Veneer Co h 6 Plant al Slaughter Robt (c; Carrie) hlpr So Crate & Veneer Co h 240 Woodliff Sledge Augustus (c; Bertha) carp A T Holt Co r 120 (222) Green (V) Sledge Bernice (c) cook P W Stripling r 119 (112) Green (V) Sledge Chas (c; Bernice) 2 h 110 (304) Green (V) Sledge Collie (c; Anna) 2 h 115 Sapp (U) Sledge Frances (c) r 119 (112) Green (V) Sledge Lillie (c) (o) dishwasher Ga Acad for the Blind h 119 (112) Green (V) Sleep Ophelia (c) r 753 3d Slim's Lunch Room (R E & Lois Middleb'rooks) 364 Pine Sloan Apartments 290 College Sloan Clarence G (Celeste) mgr Hotel Macon r do Sloan Crowel L (Hattie) (o) bkpr Central S&D Co h 709 Walnut Sloan Harry L (Mildred) mgr Jax Brewing Co r 709 Walnut Sloan Helen slswn The Hat Box r 155 1st Sloan Kyle D dept mgr D H Adams Mtr Co r 155 1st Sloan Mildred (Mrs H L) sten Bibb Chevrolet Co r 709 Walnut Sloan Nora C (wid C H) (o) h 155 1st Slocum Ada (c) cook S A Connor r 908 Mont- pelier Slocum Amelia E student r 112 Courtland Slocum Annie M (c) r 829 Montpelier Slocum Clara (c) lndrs r 829 Montpelier Slocum Claudia (c) cook G T Powell r 232 Plant (SM) ' Slocum Curtis (c; Ada) lab h 908 Montpelier Slocum James R bkpr Genl Reduction Co r 112 Courtland Slocum Jewell (c) 2 cook G N Thomas h 829 Montpelier Slocum Karl R (Louise) genl mgr Genl Re- duction Co h 112 Courtland Slocum Karl R Jr student r 112 Courtland Slocum Louise B student r 112 Courtland Slocum Mamie (c) 2 dom r 100 Roberts (U) Slocum Pearl (c) h 232 Plant (SM) Slocum Sol (c) r 992 Montpelier Slocum Wesley (c; Sophie) 1 (o) delmn Cliff Rushing h 992 Montpelier Slocum Wm (c; Rebecca) 1 h 405 (375) Plummer's al Slocum Wm (c; Tommie S) 3 emp C of Ga Ry h 106 May (U) Slocum Wm (c; Queen) lab Taylor Iron Wks h 109 1st (U) Slocum Willie M (c) emp Independent Ldry Co r 829 Montpelier Slocumb Annie (c) 1 emp Happ Bros h 110 Mason Slocumb Arth G (o) h 722 Napier Slocumb Benj F slsmn Union Furn Co Slocumb Burke L (Lily) 1 (o) (Macon Mach Shop) h 121 Cleveland (V) Slocumb Chas (c) hlpr C A Couch r 110 Mason Slocumb Chas A (Mary) r 2220 Broadway Slocumb David H student r 139 Hines ter (V) Slocumb Ellen C student r 139 Hines ter (V) Slocumb H Roy student r 110 Napier Slocumb Hattie (c) 1 r 110 Mason Slocumb Henry L (Effie) 5 opr Happ Bros Co h 104 Stratton Slocumb Henry L (Nell) 3 vp D H Adams Mtr Co h 107 Clayton (V) Slocumb Howell E (Hazel) bkpr h 110 Napier Slocumb Jacob (c; Willie) 2 hlpr Atlantic Ice & Coal Co r 204 Elliott Slocumb Margt tchr Lanier High Sch for Girls r 715 College Slocumb Martha (wid B F) h 715 College Slocumb Susie (c) r 110 Mason Slocumb T Hugh (Lena) 2 slsmn Hayes Clo Store h 489 Orange Slocumb W Clifford (Annie L) (o) slsmn Dun- lap-Peeler Hdwe Co h 139 Hines ter (V) Slocumb W Clifford Jr elk C-M-P Drug Co r 139 Hines ter (V) Small A Bailey student r 115 Rogers (V) Small Animal Clinic (J L Wurtzel, W M Ful- ler) 612 3d Small Annie K (Mrs R B) intr dec 115 Rogers (V) r do Small Aug T (Evelyn) 1 r 116 Summit (NH) Small Corbin C (o) h Sunset dr (SH) Small Edw T (Mary) 1 pastor First Christian Ch h 132 Rembert Small Geo C (Ruth) 1 mach City Bd of Water Comrs h 135 Piedmont (SM) Small Henry M elk Bibb Mfg Co r 115 Rogers (V) Small John (c; Mary) (o) h 306 Clarks (V) Small Mabel (c) h 605 (1281) Elbert Small Mary (c) smstrs 306 Clarks (V) r do Small Prentice (c; Lou) 2 ice sta mgr Atlantic Ice & Coal Co h 409 Peachtree Small Ralph B (Annie K) (o) dep U S Int Rev Coir h 115 Rogers (V) Small Ralph B Jr slsmn Bibb Chevrolet Co r 115 Rogers (V) Small Tullie r 135 Piedmont (SM) 43S Baldwin's and Telegraph's Smalley Lula (c) 1 dom r 543 (215) Mitchell Smalley W Talmadge (Mabel) 2 prof Mercer Unlv h 98 Mercer ter Smalling Alf r 2515 2d Smalling Chas E carpi r 2515 2d Smalling Chas R (Beatrice) 1 (o) (R H Small- ing's Sons) h 2515 2d Smalling Helen r 2457 (2455) 2d Smalling John H (Johnnie) 2 (o) (R H Small- ing's Sons) h 2457 (2455) 2d Smalling John H Jr (Annie K) 2 carp r 104 Mill Smalling Rebecca r 2515 2d Smalling Robt H emp R H Smalling's Sons r 2515 2d Smalling's R H Sons (C R & J H) genl contrs 301 Bibb Bldg Smallwood Arnett r 361 (341) Hydrolia Smallwood Augustus r 130 Concord Smallwood Clarence r 314 Chappell (SM) Smallwood Della (Mrs T L) winder Bibb Mfg Co r 807 Main (EM) Smallwood John (Buford) slubber hd Bibb Mfg Co r 252 Broadway Smallwood John J (Mattie C) (o) h 345 Clin- ton Smallwood Lula (wid Elijah) 1 r 928 Walnut Smallwood May Mrs 1 r 314 Chappell (SM) Smallwood O Kelton (Jessie M) 1 (Small- wood's Garage) h 928 Walnut Smallwood Oscar B (Florence) elk The Red Front h 330 Calhoun Smallwood Ray (Lola) r 1820 Broadway Smallwood Susie A (wid J C) (o) h 359 Clinton Smallwood Thos L (Della) 3 elk City Finance Co h 807 Main (EM) Smallwood W Preston (Edna) 1 dairymn r 807 Clinton Smallwood Wm H (Martha) agt Mut Benefit Life Ins Co r 817 Walnut Smallwood Wm J (Bessie) 4 emp MD&SRR h 361 (341) Hydrolia Smallwood's Garage (O K Smallwood) 257 5th Smarr Cecil waiter Mitchell & Williams Co r 720 Anderson (SM) Smarr Christine emp Macon Cafeteria r 720 Anderson (SM) Smarr Walter E (Emily G) stereo Macon Evening News res Forsyth Ga Smart Fannie (c) 1 r 124 Bright al SMART HERBERT I HON (Alberta K) (o), Pres Herbert Smart Clo Co Inc and Mayor City of Macon, h 111 Culver (V)--Tel 2979-W SMART HERBERT CLOTHING CO INC, H I Smart Pres, T A Jacobs V-P, Bob L Thombley Sec-Treas, 559 Cherry--Tel 951 Smart John (c; Geneva) emp Bibb Mfg Cb h 155 Lincoln (V) Smelter Alice (c) student r 717 Fort Hill Smelter Isom (c) emp Bibb Mfg Co r 700 (690) Hall (EM) Smelter Thos (c; Eddie E) 4 emp C of Ga Ry h 717 Fort Hill Smerling Elsie G (Mrs Moe) slswn Williams Mus Co r 776 Walnut Smerling Moe (Elsie G) slsmn r 776 Walnut Smith A Christyne sten HOLC r 111 w Grenada ter Smith A Edw (Mary L) (o) asst to U S Dist Atty h 201 Berkley dr Smith A Guy radio repr Stanton Sound Serv r 175 Cherokee Smith A H Buster slsmn Penney's r 802 Mulberry Smith A Louise r 742 College Smith A T (c; Minnie) (o) bellmn Macon Hotel h 304 Hawkins Smith Aaron (c) lab So Cotton Oil Co r 12 Toombs (SM) Smith Ada (c) (o) h 108 Empire (V) Smith Ada emp Happ Bros r 813 Main (EM) Smith Adah C (wid D G) r 561 Hillyer Smith Addie (c) r 231 e 2d (EM) Smith Adeline (wid Merrick) r 317 American blvd Smith Adell (wid A D) r 463% Cotton Smith Adolphus (c; Anna) h 15 Fordwille la Smith Albert (c; Annie) lunch rm 1124 Broad- way Smith Albert C (Emmie) slsmn Macon Paper Co h 192 Oakland Smith Albert N (Myrtle) 1 slsmn h 257 Harde- man apt 2 Smith Alex emp Fried's Garage r 654 New Smith Alf (c) h 4 (456) Stein's al Smith Alice (c) r 109 Forest (V) Smith Allen J (Mary) (o) engr S Ry h 761 Courtland Smith Allene (c) cook O T Feagin h 102 (214) Short (EM) Smith Alma r 330 Calhoun Smith Alma (c) maid C B Orr r 113 Galliard (V) Smith Alma C (wid Roy) h 1052 Walnut Smith Alma M Mrs 2 opr So Bell Tel Co r 760 Cherry Smith Alonzo (c; Margt) hlpr Ga Roofing & Sup Co r 1045 Pio Nono Smith Alonzo (c; Anna) 3 lab h 223 Cedar (U) Smith Alonzo (c; Aurelia) 4 lab h 604 (111) Colquitt Smith Alonzo Jr (c) r 223 Cedar (U) Smith Alver R (Ruby M) 2 r 706 2d Smith Alvin D (Lucille) 5 pdlr h 2 Bond (LCHts) Smith Amelia (c) lndrs r 843 Main (EM) Smith Andrew C (Estelle) 4 emp Singer Sew- ing Mach Co h 223 (263) Willingham Smith Andrew L (c; Ruby) emp Smitty's Bar- becue Lunch h 734 Hazel Smith Anna r 232 Ross Smith Anna (c) maid C B Campbell r 436 Telfair Smith Anna M (wid G E) h 767 Poplar Smith Annie (c) r 123 Broad Smith Annie (c) h 158 Madison Smith Annie (c) (o) h 154 Sycamore (V) Smith Annie (wid CL) h 1823 3d Smith Annie (c) cook J T Webb r 106 Wool- folk Smith Annie (c) (o) lndrs h 211 (600) Wil- liams (EM) Smith Annie L r 104 (17) New St al Smith Annie L (c) h 301 Wood al Smith Annie L (c) 3 cook R H Mabry r 584 Everybody's Crossing Smith Annie L (c) sausage mkr T & T Pkg Co r 313 Madison Smith Anne Lindsey r 20 Arlington pi Smith Annie M (wid Emanuel) (o) h 365 Church (EM) Smith Annie M (c) dom S S Chandler r 422 Northern Smith Annie M (c) emp Proctor & Gamble Mfg Co r 1325 Broadway Smith Annie R student r 4004 (3910) Houston Smith Arch (c; Willie) 1 tr dr Standard Oil Oo h 409 (501) Crisp Smith Archie J (Edna O) (o) slsmn Sawyer Ice & Coal Co h 137 Laurel Smith Arth (Gladys) carp r 818 Walnut Smith Arth (c; Annie M) 2 emp So Crate & Veneer Co h 813 (836) Fort Hill 1935 Macon City Directory 433 Smith Arth H slsmn A S Hatcher Co r 340 Columbus Smith Arzeta (c) maid Hotel Southland r 420 Hawthorne Smith Asa R (Tessie) (o) slsmn Ga Power Co 127 Richmond Smith Bailey P (Mildred) 2 elk So Ry h 868 2d Smith Benj (c) r 364 Bay Smith Benj (c) emp Buckeye Cotton Oil Co b 934 Elbert Smith Benj B (Venton) r 1020 Oglethorpe Smith Benj C Adelle) (o) supt City St Sweep- ing & Scavenger Depts h 570 College Smith Benj C Jr elk Crane Co r 570 College Smith Benj F (Maud) 4 swtchmn So Ry h 318 Cutters Green (EM) Smith Benj T (Bessie) engr C of Ga Ry h 107 Capital (Mikado pi) Smith Bernard (Betty) 2 tmkpr FERA h 2134 2d Smith Bertha (c) dom L A Thomas r 205 Bartlett Smith Bertha (c) lndrs h 224 Moughon (V) Smith Bertha (c) maid r 120 Lynwood Smith Bertha (Mrs H G) opr Happ Bros Co r 262 Niagara Smith Bessie (c) 3 h 307 (419) Elizabeth (SM) Smith Bessie M (c) r 523 Coleman al Smith Beulah (c) maid C A Tyler r 113 Spring Smith Bewel B (Gertrude E) 1 mach Happ Bros Co h 103 St James (SM) Smith Blanche (Loyce) cash Dannenberg's r 1019 Clinton rd Smith Bluford E (Ettie) (o) engr C of Ga Ry h 2131 Broadway Smith Bluford E Jr emp Smith & Watson r 2131 Broadway Smith Bridges Jr emp Snow's Ldry r YMCA Smith C Fred (Willie) (o) condr C of Ga Ry h 112 Madden Smith Carl B (Sally) trav slsmn h 104 Dela- ware Smith Carl B Jr trav slsmn r 104 Delaware Smith Carlos H bus dr So Stages Inc r RD 3 Houston Smith Carrie (c) h 741 Edgewood Smith Cath r 134 Ponce de Leon (SM) Smith Celestine (c) r 219 (224) Mutual (V) Smith Ceola (c) maid C W Sellers r 354 Maple Smith Charity (c) maid r 309 Blount Smith Chas (c) r 1021 Edgewood Smith Chas batterymn Wade & Co 566 2d Smith Chas (c; Lottie J) carp h 109 Forest (V) Smith Chas (c; Emma) hlpr So Ry r 751 Edge- wood Smith Chas (Estelle) tr dr Nehi Btlg Co h 134 Rembert Smith Chas A (Estelle) (Charlie's PI) h 2447 Broadway Smith Chas A (Velma) 3 emp Ga Power Co r 357 Fairview Smith Chas B (Loula) slsmn Lyon, Harris & Brooks h 742 College Smith Chas C (Sally M) 1 twister Bibb Mfg Co h 11 Bibb Smith Chas E r 4004 (3910) Houston Smith Chas E (Pearl) tex wkr Payne Mill h 152 Comer ter (PM) Smith Chas F student r 520 Edgewood Smith Chas H h 262 Georgia Smith Chas H r 400 Richmond Smith Chas H (c; Mattie) cook So Ry h 130 Jones Smith Chas L (Walton) 2 (o) mgr Odom Realty & Ins Co h 701 Winton SMITH CHAS M (Eliz A) (o) (Smith & Wat- son), h 105 Napier--Tel 1725-W Smith Chas M (Sarah R) (o) carp Taylor Iron Wks h 1905 Vineville Smith Chas P (Erin) 1 elk. Ry MS h 1302 Ridge (I) Smith Chas S (The Cricket) r 671 2d Smith Chancey J (Jennie) (o) 2 (Wade & Co) h 214 Buford pi (V) Smith Christopher (c; Tommie) hlpr Birdsey Flour Mill r 103 Franklin Smith Clarence (c; Irene) lab City St Dept r 464 Liberty (SM) Smith Claude W (N Louise) slsmn h 111 Grenada ter Smith Claudelle student r 111 w Grenada ter Smith Cleveland (c; Eva) lab h 229 5th (V) Smith Clifford (c; Maggie) h 234 Jones Smith Clifford C (Fannie) h 1538 Broadway Smith Clifford S (Martha L) 2 hlpr So Ry h 1922 3d Smith Clyde (c) maid R E Cleaveland r 411 (201) Industrial Home rd Smith Clyde L (Mrs D H) sten C E Nash r 3912 Houston Smith Coleman (Emmie) shpg elk Swift & Co r 260 Washington Smith Coleman D (Helen) 1 policeman City r 426 Cherry Smith Coot (c) lab Freeman-Dent-Sullivan Co r 782 Reynolds al Smith Cora (wid J S) h 553 Ash Smith Cosby r 686 College Smith Curtis (c; Willa) emp Atlantic Ice & Coal Co r 1106 Elbert Smith Daly elk Dunlap-Peeler Hdwe Co r 570 College Smith Danl (c; Mary) 8 h 411 (201) Industrial Home rd Smith Danl emp Jeffreys-McElrath Mfg Co r 307 Ridge (I) Smith Danl A (Minnie M) 1 h 763 Poplar Smith David (c; Mary) h 136 Bay Smith David L (Mary) 4 pntr Jesse Taylor h 257 Jeff Davis Smith Della (c) maid A A Drake h 208 Green Smith Dena M (c) emp Snow's Ldry r 512 Clinton Smith Dessie B (Mrs D S) spinner Bibb Mfg Co r 1015 2d Smith Dock S (Dessie) B) 2 emp Bibb Mfg Co r 1015 2d Smith Donald H (Lee & Smith Mule Co) res Perry Ga Smith Dora (c) 1 h 409 e 1st (EM) Smith Dora hair dresser 211 Powell r do Smith Dora M r 1905 Vineville Smith Doris r 553 Ash Smith Dorothea Mrs 1 r 306 Lynmore Smith Dorothy student r 192 Oakland Smith Dove door mkr Willingham S&D Co r 106 (265) Pearce Smith Doyle hlpr r 1052 Walnut Smith E Elon cash H L Green & Co r 753 Mulberry Smith E Jack div eng State Hwy Bd Div No 2 r Lanier Hotel Smith Early (c; Annie) porter Palace Barber Shop r 206 Collins pi Smith Easter (c) waitress Lilies' Grill r 112 Spring Smith Ebb (c; Victoria) lab Heard Bros r 710 (75) Maynard Smith Ed Grocery (Edw P Smith) 2636 Broadway Smith Eddie L (c) porter Genone's Barber Shop r 313 Madison Smith Edna nurse Macon Hosp r do Smith Edw (c; Rosa) 3 lab MD&SRR h 455 Hazel 434 Baldwin's and Telegraph's Smith Edw (c; Jennie) lab r 112 4th (V) Bf'mith Fletcher C (c) (o) h 219 (224) Mutual Smith Edw J (Callie) 2 plmbr T L Cole h 218 Bright (SM) (V Smith Florence (c) r 375 Middle (V) Smith Edw P (Mattie L) 2 (o) (Ed Smith Gro) Smith Florine sten Ga Power Co r 170 Macon h 2646 Houston Smith Edw P Jr elk Ed Smith Gro r 2646 Houston Smith Edw S (c; Mamie) h 448 Curd (SM) Smith Edw W Jr (Aline) (o) dispr C of Ga Ry h 102 Oak Smith Edwin G (c; Ella) (o) pdlr h 83 (132) Forest (V) Smith Eleanor waitress Glass' Pharm r 654 New Smith Elgie P (Alberta) 1 furn repr G P Estes h 102 Pryor Smith Elijah (e; Mary L) porter Lindsey Bar- ber Shop h 340 (79) Dempsey Smith Eliz (wid Vennie) 2 r 108 (12) Balkcom Smith Eliz Mrs h 412 Chappell (SM) Smith Eliz (c) 1 (o) cook Mrs Delle Bronson h 113 May (U) Smith Eliz (c) 1 dom h 216 (123) Plummer's al Smith Ella (c) h 106 (4) Fulton la Smith Ella (c) h 782 Reynolds al Smith Ella (c) cook r 119 (28) Frank al Smith Ella (c) 1 lndrs h 11 Short (EM) Smith Ella B (c) -r 124 2d (V) Smith Ella J (c) tchr East Macon Sch r 405 e 2d (EM) Smith Ella O (wid J P) r 198 Hightower (SM) Smith Elmira (c) h 560 Chappel (SM) Smith Elmore (c; Fannie) 1 atndt Balkcom Serv Sta h 111 5th (B) Smith Elnora (c) 2 r 211 Roosevelt (V) Smith Elvis T (Edna H) 1 agt Life Ins Co of Va r 126 Laurel Smith Emanuel F accnt r 365 Church (EM) Smith Emma (c) 5 h 438 Bright al Smith Emma (wid J H) (o) h 186 English Smith Emma (wid W G) r 109 Forest (B) Smith Emma (c) (o) h 854 Foster's al Smith Emma (c) lndrs r 266 (666) Hall (EM) Smith Emma (c) maid r 751 Edgewood Smith Emma L sten Herbert Smart Clo Co Inc r 220 New Smith Emma O prin Fort Hawkins Sch r 335 College SMITH EMORY C (Eloise) 1, mgr Personal Finance Co, r 103 Rogers--Tel 1813 Smith Enoch (c) h 1 Harris row Smith Enoch (c; Laura) lab r 110 Kitchens Smith Ephraim (Lilly) 9 h 317 American blvd Smith Eric (Willie) 1 h 405 Marion (Lynmore Estates) Smith Ernest E (Annie L) 1 (Smitty's Battery Serv) h 771 y2 Hemlock Smith Estella Mrs r 615 Duncan Smith Estella (c) 1 h 241 Tindall (SM) Smith Estella (c) elk Jos Davis h 142 2d (V) j Smith Fluellyn (c) bellmn Dempsey Hotel r 127 Forest (V) Smith Frank (c; Lola) h 641 4th (WH) Smith Frank (c; Samatha) (o) chauf H M Reid h 302 Hawkins Smith Frank (c) delmn Donovan Prod Co r 409 e 1st (EM) Smith Frank S agt Washington Nat Ins Co r 962 Oglethorpe Smith Fredk H (Della) r 1536 Broadway Smith Freeman (c) emp Bibb Mfg Co r 114 Morris (B) SMITH FURMAN (Smith & Smith) r 20 Ar- lington pi--Tel 5229 Smith G Harvey (Martha) 1 bus opr Ga Power Co h 608 1st Smith Gatsy R (wid S D) h 813 Main (EM) Smith General (c) emp L A Shirley Smith Geneva (c) emp Macon Linen Sup Co r 230 Calhoun Smith Geo (c; Nellie) h 218 Elliott Smith Geo (c) agt Atlanta Life Ins Co r 318 (320) Patterson Smith Geo (c; Bessie) tr dr The Ross Co Smith Geo B r 318 Cutters Green Smith Geo B (Gertrude) 1 (o) (Macon Elec Co) h 418 Walnut Smith Geo B Jr student r 418 Walnut Smith Geo C (Belle) dairymn Jones County r 753 Mulberry Smith Geo M (Audrey N) chf elk So Bell Tel Co h 137 Boulevard Smith Geo W (Lula) (o) h 811 Walnut Smith Gertrude r 418 Walnut Smith Gertrude (c) (Richmond Hotel) 319 Broadway r 522 Monroe Smith Gertrude (Mrs Wilbur) opr Happ Bros Co r 403 Cedar la (SM) Smith Gertrude T tel opr Citizens & So Nat Bk r 102 Rogers (V) Smith Gibson (Carrie) emp GS&FRR r 715 2d Smith Gladys E Mrs nurse Met Life Ins Co r 818 Walnut Smith Gussie (c) h 112 Spring Smith Gustave E (Ella) (o) mech h 3800 Hous- ton Smith Guy L carp Taylor Iron Wks r RD 2 Smith H B r 131 Rose pk Smith H Grady (Bertha) 1 emp FERA h 262 Niagara Smith H Wilburn mach Taylor Iron Wks r 553 Ash Smith Hallie I emp Carling Tile Co r 107 Cabaniss (EM) Smith Hammond student r 201 Pierce (V) Smith Harry elk r 616 Oglethorpe Smith Harry (Nell) 2 slsmn r 852% Cherry (296)EHu&aw(kci>nsemP Willingham Mills r 323 Smith Eug W (Martha) (o) h 117 Summit Smith Eugenia (wid R L) r 445 College Smith Eunice (c; Amanda) lab h 858 Willow Smith F O Jr emp State Hwy Dept r YMCA Smith Fannie (c) r 107 Tindall (SM) Smith Fannie (c) (o) lndrs h 1045 Pio Nono Smith Fannie C (wid R W) (o) h 205 Peachtree Smith Fannie M (c) cook F W Evans r 12 Toombs (SM) Smith Felicia (c) tchr Wheatley Sch r 219 (224) Mutual Smith Harry H (Charlotte) 1 emp C of Ga Ry h 3912 Houston Smith Harry M (Nora L) 2 gro 102 Elm h 3501 Houston Smith Hartford A (c; Dora) (o) h 211 Powell Smith Hattie (c) cook W W Hartness r 603 Telfair (SM) Smith Hattie (c) sch tchr r 281 1st (V) Smith Henrietta (c) 1 r 560 Chappell (SM) Smith Henrietta (c) 3 lndrs h 7 Gunn's al (V) Smith Henry elk Lyons Cash Mkt r 1541 3d Smith Henry (c) cook Busy Comer Lunch Rm r 230 Calhoun Smith Felix carp P T Anderson h Clinton rd extd (EM) Smith Felix (c; Ada) 2 lab h 113 (9) Jordan Smith Henry (c) emp Kenmore-Burns h 408 Mitchell al Smith Henry (c) farmer r 231 e 2d (EM) 1935 Macon City Directory 435 Smith Henry (c; Mattie) (o) hlpr F S Royster Guano Co h 251 Broad Smith Henry (c) lab h 310 (260%) Bowman Smith Henry student r 318 Cutters Green Smith Henry D r 324 Forsyth Smith Henry I (Omie) 3 (o) 912 Log Cabin blvd Smith Henry J mgr J R Raible Cooperage Co r 7th cor Poplar Smith Henry P (Vera) 2 formn mail rm Macon Evening News h 95 Coleman Smith Herman student r 1541 3d Smith Herman H twister Bibb Mfg Co r 765 Pine Smith Heyward (c; Rosa Lee) bell mn Hotel Southland r 520 New Smith Holmes J (Angela) eng C of Ga Ry r 131 Ross Smith Homer (Lorene) 2 tr dr McPittman Rfg Co r 457 Edgewood Smith Howard B mech Cherokee Brick Co r 520 Edgewood Smith Howard E emp Nehi Btlg Co r 1905 Vineville Smith Inez (wid R F) r 1002 Commodore Smith Inez (c) cook J E Bankston h 257 Broad Smith Irene (c) lndrs Crescent Ldry r 464 Liberty (SM) Smith Irene night supv Middle Ga Hosp r do Smith Irwin (c; Minnie) 2 lab Bibb Mfg Co h 456 Bay Smith J Allen (Sarah) 1 phys 230 Doctors bldg h 106 Florida Smith J Edw (Bertha May) pntr r 603 Plum Smith J Hardy (Thelma) furn rms 619 2d Smith J Lundie (Leila) (o) h 686 College Smith J Lundie Jr (Marjorie B) lawyer 401 Ga Casualty Bldg r 686 College Smith J Monroe (Mary B) trav slsmn h 616 Oglethorpe Smith J Northrup (Eliz S) 1 (o) pharm Alf Mack's Pharm Inc h 210 Forsyth Smith J Otis (Olgie S) formn Central S&D Co r RD 3 Smith J Thos (Ruby) 1 mtrcycle ofcr CPD h 2446 2d Smith J Virginia beauty opr R S Thorpe & Sons r 209 1st Smith Jack S chf elk Am Oil Co r 116 Napier Smith James (c; Geneva) h 230 Calhoun Smith James (c; Sallie) h 212 Fargason (V) Smith James (c) r 1 Plant al Smith James (c) r 544 (540) 3d (V) Smith James (c; Bessie) emp C of Ga Ry h 606 4th (WH) Smith James (c; Carrie) lab h 614 (540) May- nard Smith James (c) lab Taylor Iron Wks r 9 Plant al Smith Jas A (Margt D) agt Methodist Or- phans Home h 103 Clayton (V) Smith James A (Mattie V) emp Carling Tile Co h 314 Cutters Green Smith James A (Maggie M) (Pig-in-Sax) h 2218 Forsyth rd Smith James A Jr (Marguerite) 2 (o) (Smit- ty's Barbecue Lunch; Wisteria Cafe) h 1512 Vineville Smith Jas B (Mary) 1 emp GS&FRR h 1541 3d Smith James C (Dessie) 4 bus opr Ga Power Co r 115 Rose pk Smith James H (Cora O) (o) h 2911 Houston Smith Jas M (Pearl) oil mill supt Swift & Co h 1510 3d Smith James O (Olgie) 1 (o) formn Central S&D Co h 252 Rocky Creek rd Smith Jas O formn Elkans Stone-Tile Co r 1905 Vineville (V) Smith James Q (Lelia L) 2 mach C of Ga Ry h 810 Cherry Smith James S (Margt E) (o) bldg contr 107 Toombs (Mikado pi) h do Smith James V (Mattie A) bus opr Ga Power Co h 555 2d Smith Jane (c) r 610 (105) Elliott Smith Janie (c) lndrs r 595 (501) Smith (EM) Smith Janie (c) maid Sami Karesh r 53 (50) Green's al Smith Janie (c) maid W P Fleming r 23 Spring Smith Jasper r 315 Beech Smith Jennie (wid J B) r 206 1st Smith Jennie (c) 4 h 112 4th (V) Smith Jerry (c) r 323 (296) Hawkins Smith Jerry T (Lillie M) 4 (o) (Smith's Bat- tery & Elec Co) h 101 Davis (SM) Smith Jesse (c; Beatrice) emp C of Ga Ry h 610% Center (EM) Smith Jessie (wid R W) (o) h 1016 Ash Smith Jewel r 462 Oak Smith Jodie B (Gladys) hlpr City Scavenger ' Dept r 909 Orange Smith John (c; Cherrie) 3 h 246 (244) Church la (SM) Smith John (c; Mary) h 113 Edgewood Smith John (c) r 601 (1270) Elbert Smith John (Lila) r 224 (2) Forest (B) Smith John (c) r 109 Forest (V Smith John (c r 417 Monroe (V) Smith John (c) r 641 Pebble Smith John (c; Lizzie) 1 h 70 Schofield Smith John (c; Rosa) barber Wayne Snipes h 102 (202) Elliott Smith John (c) emp Snow's Ldry r 1402 Ard- vines al Smith John (c) emp C of Ga Ry Creosote Plant r 1 Berthadale dr (V) Smith John (c; Sarah) 4 emp C of Ga Ry h 162 (706) Guernsey la Smith John (c; Hattie) 2 lab h 603 Telfair (SM) Smith John A Jr (Louise) 2 mgr oil mill Swift & Co h 318 Cherry Smith John C r 327 Clinton Smith John C (Gldays) 2 bur supt CPD h 476 College apt 1 Smith John D elk McCord Used Auto Parts r 150 Bailey Smith John D student r 120 Yates Smith John E (Susie) 2 mech Cudahy Pack- ing Co h 1407 2d Smith John I (Eunice) 1 (o) farmer h 1019 Clinton rd (EM) Smith John L (c; Lena) (o) h 606 Mitchell Smith John O r 103 Stratton Smith John R (Arline F) slsmn Industrial Life & Health Ins Co h 346 Hardeman SMITH JOHN R L (Kath F) (o) (Smith & Smith), h 20 Arlington pi--Tel 5229 Smith John T (Ida) dairymn 1242 College h do Smith John T (Mittie) slsmn Standard Oil Co h 327 Clinton Smith John T (Claudie) 1 tex wkr h 64 Roll Home pi Smith John W (Mattie M) 1 dr Yellow Cab Co r 319 Walnut Smith John W emp Art Furn Mfg Co r 400 Richmond Smith Jonnie (Mrs W A) r 810 Broadway Smith Jos (c; Nora) h 130 Moughon (V) Smith Jos A (c) h 109 Ward (V) Smith Jos B (c; Ella) (o) tailor h 405 e 2d (EM) Smith Jos E (c; Pearl) 2 h 109 (9) Orchard Smith Jos L (c; Annie L) 2 (o) h 639 4th (WH) 436 Baldwin's and Telegraph's SMITH JOSEPH LE CONTE (Margt B) 1 (o) Smith Louis C Jr slsmn r 25 Marion pi (Smith & Smith), h 308 Hines ter--Tel 1933-R Smith Louise slswn Snyders Ready-to-Wear r Smith Joshua C slsmn Huckabee Mtr Co r 652 Mulberry Smith Josie M (c) h 1 Plant al 296 College Apt 3 Smith Love (c; Fannie! h 236 Lynwood (V) Smith Love (c; Minnie) 2 h 114 Price (V) Smith Josie M (e) lndrs h 507 Coleman al Smith Lovia (c) nurse County Relief Admn r Smith Julia (c) maid H L Ligon r 440 Liberty (SM) 116 Ward (V) Smith Lucile (c) cook A E Hatcher r 100 Smith Julius (c; Annie) 3 cook M H Pearce h 313 Madison Antioch rd Smith Lucille opr Adams Mfg Co r 822 1st Smith June (c) maid H S Strozier r 208 Far- Smith Lucy (c) lndrs r 527 Calhoun gason Smith Lucy (c) 1 lndrs h 131 (230) Norris Smith Kate (c) 1 h 120 Lynwood (V) Smith Kathryn student r 192 Oakland Smith Luela (c) h 440 Liberty (SM) Smith Lula (c) h 100 Antioch rd Smith Kath F sch tchr r 175 Cherokee Smith L Alfred (c) r 236 Lynwood (V) Smith L C Typewriter Agency N S Jones mgr 506 Mulbrery Smith Larkin (c; Sarah) (o) lab C of Ga Rv h 133 Adams Smith Laura (c) maid R A Matthews h 166 Hazel Smith Laura (c) lndrs h 125 (10) Jordan Smith Laura B (c) r 403 (441) Forest (V) Smith Laura P (wid Philo) r 126 Washington Smith_La Velle student r 771% Hemlock Smith La Verne student r 613 Log Cabin blvd Smith Lavosier V (Cassie) buyer C-M-P Drug Co h 167 Magnolia Smith Lawrence C (c; Sue) agt Atlanta Life Ins Co r 239 2d (V) Smith Lawrence O (Alice) formn Macon Iron & Paper Stock Co h 315 Beech Smith Leanna (c) cook r 436 Telfair Smith Leila M (c) 1 lndrs r 611 (240) Hall (EM) Smith Lei a (c) r 332 Gilmer Smith Leland (c) lab r 1142 Broadway Smith Lelia (c) maid W L Miller r 422 Telfair Smith Lem (c; Rosa) h 114 Davis (U) Smith Lena (wid J C) (o) h 116 Napier Smith Lennie r 7 Roff Home pi Smith Lula (c) (o) h 217 (218) Cedar (U) Smith Lula P (wid J T) bdg 768 Cherry h do Smith Lydia E (wid H L) h 555 New Smith M Eliz tchr Lanier High Sch for Boys r 104 Clayton (V) Smith M Louise tchr Winship Sch r 105 Napier Smith Maggie opr Happ Bros Co r 134 Strat- ton Smith Major (c) r 236 Lynwood (V) Smith Mamie (c) (o) h 510 Flanders Smith Mamie (c) h 175 Hazel Smith Mamie M (c) 1 h 115 Chestnut Smith Marian W (wid Lee) bkpr Luther Wil- liams & Son r 453 Boulevard Smith Marie 417 Hazel (c) emp Macon Linen SupF Co r Smith Margt cash Hotel Dempsey r 116 Napier Smith Margt (c) cook F J Bishop r 1045 Pio Nono Smith Margt (c) 1 dom r 337 Ernest Smith Marshall B (Vivian M) supt Macon div C of Ga Ry, supt Macon Terminal Co r 401 College apt 4A Smith Martha opr Happ Bros Co r 210 Fla- mingo dr Smith Mary (c) 3 h 1402 Ardvines al Smith Mary (wid W T) r 205 Brentwood Smith Mary Mrs r 2132 Broadway So5M?iIiTHHLLLeoEnOAN hPlPr(LSinoniRe)y r 125 Dean WStersalettyoann Col- s_mith tel Leon P637(1c,; Rho1sa0)4 pColratyetroRn em(Vin)--gtotenl R5a7n5d8 Inc r 281 1st (V) Smith Leona (c) clnr Bibb Mfg Co h 403 (545) Prince (SM) Smith Leona emp Met Life Ins Co 219 New Smith Leonard L (Alma) 4 elk Ry MS h 219 (218) Log Cabin dr Smith LeRoy (c) lab r 4 (456) Steins al Smith Mary (c) r 127 (153) DeBorde (SM) Smith Mary r 186 English Smith Mary (c) r 208 Green Smith Mary (c) h 416 Hammond Smith Mary (c) h 116 (554) Magnolia la Smith Mary (wid W S) h 16 Marion pi (WH) Smith Mary (c) h 114 Morris (Bj Smith Mary (c) r 123 Woodliff Smith Mary h 812 3d Smith Mary (c) dom Fredk Shaw r 108 May Smith Lessie (c) maid r 114 Gaillard (V) Smith Letha (c) h 383 Robinson rd Smith Letha E Mrs (wid C E) (o) h 4004 (3910) Houston Smith Lettie (c) maid J C Cauthen r 515 For- syth Smith Lilia (c) dom h 232 Orange Smith Lillian r 213 Bond apt D4 Smith Lillie (c) 3 h 11 Alabama (SM) Rllhe Elbert () cook A D Steerman r 824 Smith Lizzie (c) r 111 (3) O'Neal's al S"Clotat Bizzie G Co h 120 Y(watieds J D) opr Dixie Roll & Smith Lizzie M (c) cook r 120 Lynwood (V) i1m01h9Q ^TMC0l1-i1SnS*tL otcnhrr(dBBla(eEnllcMehv)eu)e Sch cond r 2911 Houston C of Ga Ry r Rottie (tcc)hrr V10i9rgFilorPeoswt e(rVs) Sch r 365 enurch (EM) Smith Mary (c) emp Bibb Mfg Co r 1142 Broadway Smith Mary (c) lndrs h 253 (169) Plant row Smith Mary maid Mrs Louise W Cater r 810 3d (V) Smith Mary (c) sausage mkr T&T Pkg Co r 113 Edgewood Smith Mary Mrs smstrs h 453 Ash Smith Mary B Mrs 1 r 900 Orange Smith Mary Bond (o) h 525 Vineville (V) Smith Mary C (wid W H) r 112 Laurel Smith Mary E (c) 2 cook R H Mason h 427 Ward (V) Smith Mary L (c) h 243 Jones Smith Mary L (c) Co h 301 Elbert emp Procter & Gamble Mf6g Smith Mary L (Mrs C A) 3 sten Macon Tran- sient Bur h 100 Dairy Pk Smith Mary Lee emp Southland Knitting Mills r 620 Duncan Smith Mattie (wid L N) r 763 Cherry SlMm h0,ii8( Hiiieanette) 1 hlpr So Cotton oil Smith Mattie (wid C C) (o) h 203 Oak Haven SlrGnammwbl2eUhiS G 25 M(Laersioline) 2 pi P^e ftr Procter & Smith Mattie (wid J W) h 206 1st Smith Mattie (c) 2 cook h 360 Ash 1935 Macon City Directory 437 Smith Mattie (c) cook W E Smith h 323 (296) Hawkins Smith Mattie (c) cook r 130 Jones Smith Mattie (c) 1 (o) dom h 176 Astor Smith Mattie (c) dom 116 Grenada ter Smith Mattie A (Mrs J V) (Magnolia Inn) r 555 2d Smith Mattie E (wid J W) r 107 Cabaniss (EM) Smith Mattie K (wid A F) sec-treas Liberty Candy Co r 866 Mulberry Smith Mattie L (wid E W) h 507 (501) e Napier Smith Maude h 113 e Eli Smith Maude (c) maid W M Herman h 140 Jones Smith Maude W (wid Grady) 4 sec Ga Acad for the Blind h 188 English Smith Maurice D elk Ga Power Co r 570 Col- lege Smith Maynard (c) lab r 106 (300) Spring la Smith Mildred r 318 Cutters Green (EM) Smith Milo W (Eva) 2 tex wkr Bibb Mfg Co h 39 Taylor Smith Milton (c) delmn Abrams Gro r 825 (227) Daisy (SM) Smith Milton (c; Rosa) 4 lab h 163 Hazel Smith Milton B (Irene) 2 trav slsmn h 619 Walnut apt 5 Smith Minnie (c) 1 h 231 e 2d (EM) Smith Minnie (c) h 633 Pebble Smith Minnie (c) 1 h 231 e 2d (EM) Smith Minnie (wid C W) emp Happ Bros Co h 400 Richmond Smith Minnie (c) maid r 304 Hawkins Smith Minnie (wid W E A) matron Methodist Orphans Home r do Smith Minnie B opr Happ Bros Co r 616 1st Smith Minnie L (c) h 8 Barnhart's Bottom Smith Minnie L (c) (o) sch tchr h 116 Ward (V) Smith Mintie r 813 Main (EM) Smith Mittie (Mrs J T) opr Happ Bros Co r 327 Clinton Smith Mollie (c) 1 r 303 (608) Colquitt Smith Moody L (Edna) gro 261% Madison r 427 College Smith Morris (c) waiter Pig-in-Sax Smith Morris O (Mae S) 2 (o) trav slsmn h 113 (195) Elizabeth pi (V) Smith Mozell (c) lndrs r 224 Moughon (V) Smith N Eliz (wid C C) h 319 White (SM) Smith Nancy (c) (o) h 1233 Dempsey Smith Nancy (Mrs T F) smstrs Happ Bros r 124 James (LCHts) Smith Naomi (c) maid C L Toole r 354 5th Smith Nathl (c) porter G L Watkins r 966 Ocmulgee Smith Nell (Mrs Rosser) r 476 College apt 12 Smith Nell Dix Mrs hostess Chiropractic Health Home r 501 College Smith Nellie (c) emp Independent Ldry Co r 452 Hazel Smith Nellie Mrs 1 opr Happ Bros Co r 1004 Oglethorpe Smith Nina night supv Middle Ga Hosp r 860 Pine Smith Nollie (c) r 114 Davis (U) Smith Nora Mrs r 324 Forsyth Smith Nora (c) cook Eug Anderson r 130 Moughon Smith Norris (c) delmn Acme Fish & Oyster Co r 117 (14) Tinsley la Smith O M (Evelyn) chf elk Met Life Ins Co r 804 Mulberry Smith Oak asst funeral dir Burghardt-Connally r 718 Cherry Smith Ola (c) cook N T Weaver r 513 e 2d (EM) Smith Olis waitress De Luxe Cafe r 855 Mulberry apt 302 Smith Olive (o) h 105 Piedmont Smith Oliver C slsmn Buck Ice & Coal Co r 2080 3d Smith Oliver F (Beatrice P) 2 (o) welder So Ry h 3028 Houston Smith Ollie (c; Clyde) hlpr Stewart Oil Co h 503 e 1st (EM) Smith Oneita G sten Bankers H&L Ins Co r 520 Edgewood Smith Oreneda (c) r 219 (224) Mutual (V) Smith Oscar (c) student r 614 (540) Maynard Smith Oscar B (L Ella) 4 mach Taylor Iron Wks h 454 Edgewood Smith Oscar B Jr student r 454 Edgewood Smith Oscar L (Jessie) hlpr h 516 Elm Smith Otis emp Willingham Mills r 109 (46) Holt Smith Otis soda elk Hotel Dempsey r 134 Rembert Smith Patricia (c) tchr Unionville Sch r 219 (224) Mutual (V) Smith Pauline (c) r 111 5th (B) Smith Pauline (c) student r 113 Gaillard (V) Smith Pearl (Mrs C E) winder Bibb Mfg Co r 152 Comer ter (PM) Smith Pearl F Mrs 1 (o) h 175 Cherokee Smith Peter (c; Annie) firemn Procter & Gam- ble Mfg Co r 161 Hazel Smith Peyton B student r Clinton rd extd (EM) Smith Philip J (Lora) 1 printer Macon Teleg Pub Co h 854 Courtland Smith Phoenix (c) r 142 2d (V) Smith Price (c; Mattie) 2 auto mech h 114 Thomas (EM) Smith Priscilla (c) cook J C Wyche h 122 Tindall Smith Quea r 1823 3d Smith Rahl emp T&T Packing Co r 550 Edge- wood Smith Regina (C) tchr Wheatley Sch r 230 5th (V) Smith Relliford S (c; Gertrude) (o) phys 319% Broadway h 522 Monroe Smith Rhoda A (wid J T) r 217 Hardeman Smith Richd (c; Lucille) 4 porter Ry Exp Agcy h 426 Ward (V) Smith Richd N (Jacqueline) 1 slsmn R A Mc- Cord Mtr Oo r 99 Vineville apt F2 Smith Rita slswn Dannenberg's r 205 Peachtree Smith Robt (c) r 8 Barnhart's Bottom Smith Robt (c; Eliz) 1 r 228 Moughon (V) Smith Robt (c) emp B F Merritt Coal Co r 713 Ash Smith Robt (c) emp Swift & Co r 29 Reid Smith Robt (c) lab Procter & Gamble r 1232% Broadway Smith Robt (c) lab Paul Williams Co r 9 Cheatham al Smith Robt E r 340 Columbus Smith Robt E (Louise) 2 emp Bibb Mfg Co h 26 Bibb Smith Robt L (Ellen M) 3 emp Bibb Mfg Co h 31 Taylor Smith Robt L (Madonna) 2 formn Cotton States Fertilizer Co h 290 College apt 3 Smith Robt L (c; Nice B) ins agt h 127 Forest (V) Smith Robt L (c; Debbie A) 4 (o) lawyer 411% Cotton h 129 Jones Smith Robt M serv mgr Firestone Auto Sup & Serv Stores r 220 1st Smith Robt S (c) jan Gresham Sch h 124 2d (V) Smith Roosevelt (C) r 116 (554) Magnolia la Smith Rosa (c) r 112 Spring Baldwin's and Telegraph's Smith Rosa (c) dom Mrs M F Cole r 281 Smith Thos (c; Mary) lab h 317 (47) Plum- 1st (V) tree Smith Rosa L (c) r 8 Barnhart's Bottom Smith Thos (c) peddler h 124 Cedar (U) Smith Rosa L (c) (o) maid h 225 2d (V) Smith Thos S (Alto) 3 emp Bibb Mfg Co h Smith Rosa Lee opr Adams Mfg Co r 822 1st 775 Hawthorne Smith Rosa M cash Dannenberg's r 16 Marion Smith Tommie L (c) 2 r 804 (440) Hall (EM) pi (WH) Smith Travis H (Osie) 3 elk C of Ga Ry h Smith Rosa M (c) cook Cozy Comer Cafe 905 Orange Smith Rosetta (c) tchr Unionville Sch r 115 Smith Trudy Mrs candy wrapper Carstar- Chestnut phen Inc Smith Ross r 616 Oglethorpe Smith Valerie (c) r 405 e 2d (EM) Smith Ross B (Kath R) slsmn r 102 Oak (I) Smith Veator (c) 3 maid Len Berg Chili Par- Smith Roy r 16 Marion pi (WHts) lor r 150 New Smith Ruby (c) emp Bibb Mfg Co h 620 Smith Veleria beautician Flynt's Beauty Shop Chapman al Smith Venton (Mrs B B) opr Happ Bros Co Smith Ruby M r 1823 3d r 1020 Oglethorpe Smith Rupert L (Jannie) mldr Taylor Iron Wks Smith Vernon (Mary) emp Atlantic Mills h 25 h 863 Orange Atlantic Village Smith Ruth Mrs furn rms 515 Plum h do Smith Victoria (c) cook Mrs Maud Ricken- Smith Ruth nurse City Bd of Health r 186 baker r 708 Clinton English Smith Violet (c) lndrs h 309 Blount Smith Ruth student r 701 Winton Smith Virginia dancing tchr Am Legion Home Smith Ruth I (c) 1 cook C C Small r 457 e r 133 Summit Academy (EM) Smith W Arth student r 742 College Smith Sadie (c) maid A T Worsham r 325 Smith W Stanford (Willie) 1 sec treas Gantt Middle Mfg Co h 814 Winton Smith Sallie M (wid J N) h 111 2d Smith W Stanford Jr student r 814 Winton Smith Sami r 152 Comer ter (PM) Smith Walter elk Lanier Hotel r 555 Broadway Smith Sami (c; Carrie) 1 h 547 (447) Smith Smith Walter (c) r 223 Cedar (U) (EM) Smith Walter (c; Hattie) mus r 281 1st (V) Smith Sami elk Jacob's Pharm Smith Walter D statistician Macon Transient Smith Sami (c; Cora L) 1 tr dr Taylor Iron Bur r YMCA Wks h 1134 Broadway Smith Walter E (Henrietta) 2 bkpr h 1701 Smith Sara (c) h 212 Gantt pi Vineville Smith Sara (c) 2 r 411 (201) Industrial Smith Walter E (Nancy) emp Willingham Home rd Mills h 109 (46) Holt Smith Sara (c) cook r 328 Monroe (V) Smith Walter S slsmn Dannenberg's r 16 Smith Sarah (c) 3 maid D S Jones h 111 (157) Marion pi Elizabeth (SM) Smith Wesley (c; Leola) 3 hlpr Standard Oil Smith Sarah L emp Happ Bros r 327 Clinton Co h 403 Charles Smith Sheldonia (c) cook T B Elfe r 413 (433) Smith Wesley (c) ydmn r 121 Walls al Forest (V) Smith Wesley L (Mary L) carp So Ry h 198 Smith Sidney (c; Carrie) 1 hlpr Royal Peanut Hightower (EM) Co r 332 Monroe (V) Smith Wilbur (Gertrude) 2 h 403 Cedar la (SM) Smith Simms M (Evie) 1 paymstr Bibb Mfg Smith Will (c; Nellie M) 5 lab h 110 Edge- Co h 574 Boulevard wood Smith Sol (c; Essie) 3 barber T Ellen Jack- Smith Willene elk Woolworth's r 306 Lynmore son h 100 Smith (M) Smith Wm (c; Rosa) 1 h 236 (161) Disroon al Smith Steiner (c; Carrie) lbr grader Willingham S&D Co r 330 Barfield al Smith Stella (Mrs T L) (o) h 340 Columbus Smith Stella (C) 1 r 314 (66) Plummer's al Smith Sue (c) bkpr Hutchings Funeral Home r 239 2d (V) Smith Susie (c) (o) h 397 Neel (U) Smith Susie (wid R L) (o) h 111 Yates Smith Susie (c) 1 maid W B Willingham r 238 1st (V) Smith Susie (c) restr Clinton rd extd (EM) r do Smith Susie J r 525 Vineville Smith T Ellis (Willa) poultry 422 2d h 115 Rembert Smith T Freeman (Nancy L) (o) carp h 124 James (LCHts) Smith Tarpley M lintermn Buckeye Cotton Oil Co r 550 Edgewood Smith Thelma (Mrs J H) furn rmst 654 2d h do Smith Thelma waitress De Luxe Cafe r 720 Mulberry Smith Thos (c; Hattie) 8 h 411 Douglas (V) Smith Thos (c; Johnnie) 1 elk Wm Davis r 606 4th (WH) Smith Thos (c) delmn Piggly Wiggly r 114 Price (V) Smith Thos (Ethel M) door mkr Willingham S&D Co r 338% Main (EM) Smith Thos (c; Nettie) hlpr J H Knight r RD 2 Columbus rd Smith Wm r 216 Elliott Smith Wm (c; Sheldonia B) h 413 (433) Forest (V) Smith Wm (c; Janie) h 53 (50) Greens al Smith Wm (c) r 318 (319) Williams (EM) Smith Wm (c) emp C of Ga Ry r 317 Ham- mond Smith Wm (c; Laura) 1 firemn C of Ga Ry h 416 Hazel Smith Wm (c; Nell) jan h 542 Hazel Smith Wm (c; Willie) lab Atlantic Ice & Coal Corp h 1409 Broadway Smith Wm (c) lab City Scavenger Dept r 372 Flanders Smith Wm (c; Clara) lab h 966 Ocmulgee Smith Wm (c; Avah) (o) restr 323 Broadway h 357 Middle (V) Smith Wm (c; Estella) 2 tr dr Noland Co h 114 (557) Magnolia la Smith Wm A (Alline) (Macon Sup Co) h 810 College apt 2 Smith Wm A (Annie C) 1 (o) car inspr So Ry h 134 Ponce de Leon (SM) Smith Wm B (c; Lucy) clothes presser J T Bishop Smith Wm D (o) h 559 Main (EM) Smith Wm G (Sallie V) 1 (o) gro Clinton rd extd (EM) h do Smith Wm G (Claudie) 2 gro 872 Hazel h 207 Forsyth 1935 Macon City Directory 439 Smith Wm H (Celia W) 1 slsmn Am Optical Co r 278 College Smith Virginia (c) sch tchr Wheatly Scho r 109 Empire (V) Smith Vivian S (Curtis) (o) condr C of Ga Ry h 138 Holt Smith Wm H (Cath L) tr dr r 2911 Houston Smith Wm J (Willie B) 2 barber W O Smith r 116 Heard Smith Wm J (c; Louise) 2 hlpr Macon Hat Cleaning Co h 106 Woodliff Smith Wm O (Mattie B) 2 barber 3106 Houston h 116 Heard Smith Willie (Mrs Erie) opr Happ Bros r 405 Marion (Lynmore Estates) Smith Willie L (Reb'a) hlpr r 608 1st Smith Willie M r 207 Forsyth Smith Wynell student r 262 Niagara Smith Zailee elk FERA r 214 Buford pi (V) Smiths Battery & Electric Co (J T Smith) 654 Mulberry SMITH & SMITH (Furman John R L and Joseph Le Conte Smith) lawyers 520-23 Bibb Bldg--tel 375 (See page 104) SMITH & WATSON (Chas M Smith, Melvin J Sires) printers 517 Poplar--tel 374 (See page 96) Smithson Ruby L (c) r 108 (102) Randall la Smittys Barbecue Lunch (J A Smith Jr) 421 3d Smittys Battery Service (E E Smith) 407 Mulberry Smothers Jessie McM (c) cook W L Bazemore r 227 Neal (V) Smothers Johnnie (c) cook B C Stewart r 227 Neal (V) Smothers Jos (c; Allie P) firemn Willingham S&D Co h 15 7th Smothers Laura (c) maid A R Menard r 227 Neal (V) Smothers Nancy (c) student r 227 Neal (V) Smothers Ned (c; Sallie) 3 lab Riverside Lbr Co h 113 (451) Johnsons al Smothers Robt L (c) r 113 (451) Johnsons al Smothers Thos (c; Jessie McM) 1 (o) emp McKesson Riley h 227 Neel (V) Smyly Andrew J mech r 115 Garden Smyly Frank r 111 Garden Smyly James T (Sarah) emp Cherokee Brick Co h 310 Cutters Green Smyly James T Jr electrn Cherokee Brick Co r 310 Cutters Green Snead Danl emp Art Furn Mfg Co r 211 Newberg Snead Garage (S J Snead) 617 Broadway Snead Lewis (c; Hattie) 1 lab So Crate & Veneer Co r 319 Hazel Snead Mae (c) 1 h 152 Bright al Snead Mary (c) h 6 Cheatham al Snead Ray r 211 Newberg Snead Richd mech Bartlett Sheet Metal Wks r 211 Newberg Snead Sami J (Eunice O) (o) (Snead Garage) h 211 Newberg Sneed Janie (c) h 388 Boardmans al Sneed Mary (c) peddler r 136 Phillips la Snell Cora B (c) 1 cook C E Schell r 118 Franklin Snell Eloise (c) cook r 100 (101) Thomas (EM) Snell Floride (Little Groceteria) r 113 NewWerg Snell James A (c) porter Union News Co r 100 (101) Thomas (EM) Snell Judge G (c; Mary) emp Bibb Mfg Co h 100 (101) Thomas (EM) Snell Julian E (Mattie) h 113 Newberg Snell Lorene (c) cook Paul Rogers r 119 New St la Snell Mary E (c) r 100 (101) Thomas (EM) Snell Mattie (Mrs J E) emp Happ Bros Co i* 113 Newberg Snell Wm (c) r 58 New SNELLGROVE G EMMETT (Hath K) 1 city editor The Macon Telegraph, h 33 Arlington pi--tel 275 Snellgrove Walter L (Nettie) 2 elk Belsons Cash Mkt h 343 Carling Snelling J Palmer Christian Science Practitioner 913 Ga Casualty Bldg r do Snelling Paula tchr Miller High Sch h 213 Bond apt D4 Snipes Ada (wid C E) h 131 Rembert Snipes Delia (c) r 201 (204) Alabama (SM) Snipes Herbert M (Mattie D) 2 mach h 352 Clinton Snifpes John (c) lab r 851 3d Snipes Lawrence A (Bessie) slmn Sterchis h 666 Hemlock Snipes Lawrence A Jr r 666 Hemlock Snipes Reuben W (Eloise J) 1 (o) auto repr h 188 Laurel Snipes Roland (c) emp G P Estes r 726 (8) Reynolds al Snipes Rosa (c) 1 lndrs r 103 Neel (U) Snipes Wayne (c; Flora) 6 barber 161 5th h 813 (856) Cowan Snipes Wm (c) lab r 851 3d Snipes Wm R (Leonora) (o) h 202 Church (EM) Snook Russell A (Edna) 2 slsmn h 864 Mulberry apt 5F Snooks John T r 1248 2d Snow Alzadie Mrs r 5 Grand (B) SNOW B CUBBEDGE (Frances C) 2 (O) (Martin, Martin & Snow) h 116 Calloway--tel 4863-R Snow Ernest (Winnie) r 250 Hydrolia Snow Essie (Mrs Norman) winder Bibb Mfg Co r 121 Steele Snow Georgia C ( WA) (o) h 538 Washington Snow Harmon r 1820 Broadway Snow Hazel student r 1*0 Ell (SM) Snow James r 140 Ell (SM) SNOW JAMES E sec-treas Snows Laundry & Dry Cleaning Co Inc r 538 Washington--tel 4820-J Snow Jas H (Hattie) 3 knitter Bibb Mfg Co h 140 Ell (SM) Snow John O (Leila) tex wkr Bibb Mfg Co h 553 Oglethorpe Snow Norman (Essie) 2 emp Bibb Mfg Co h 121 Steele Snow Oliver (Thelma) 1 hlpr r 553 Oglethorpe Snow Pearl M (c) r 1362 1st Snow Roy emp So Crate & Veneer Co r 554 1st Snow Sally Mrs h 1820 Broadway Snow Thos G student r 110 Montpelier SNOW WM A (Martha S) 1 (o) pres Snows Laundry & Dry Cleaning Co Inc, h 108 Osborne pi--tel 4205 Snow Wm L 1 tex wkr r 103 (264) Pearce Snow Winnie (Mrs Ernest) spinner Bibb Mfg Co r 250 Hydrolia SNOWS LAUNDRY & DRY CLEANING CO INC, Wm A Snow pres, B B Ratliff v-p, James E Snow sec-treas, 766-70 Poplar--tel 6000 (See page 92 and cards BD) Snowden Andrew (c; Lucile) firemn C of Ga Ry h 106 (102) De Borde (SM) Snowden Ernest (c) r 106 (102) De Borde (SM) Snyder Lee W (Mary) 2 (o) condr C of Ga Ry h 205 Villa Esta Snoyder Louis N (Julia) (o) (Snyders Readyto-Wear) h 515 Napier 410 Baldwin's and Telegraph's Snyder Wm I (Mary L) chf elk S E Compress & Whse Co h 135 Boulevard Snyders Ready-to-Wear (L N Snyder) 609 Cherry Snyers Cora L (Mrs) gro Clinton rd extd (EM) h do Society of Colonial Dames of Am Mrs Walter Grace Chm meets at homes of members 631 Forsyth Sockwell Chas H (Annie M) 3 (o) slsmn Taylor Iron Wks h 749 Blackburn Socks Sami (Victoria) 1 confr 555 3d h 519% Mulberry Solden Margt nurse Macon Hosp r do SOLEM EDW (Fairyland Dairy) r 279 College --tel 4138 Solomon Addie (c) (o) lndrs h 338 2d (U) Solomon Arth (c; Sophie) emp Cherokee Brick Co r 1 (201) Toombs (SM) Solomon Ave M (c) tchr County Schs r 721 3d (V) Solomon Bertha (c) r 103 (207) Henry (SM) Solomon Bessie (Mrs W G Jr) int dec Union Dry Gds Co r 218 Forsyth Solomon Beulah (c) emp Macon Coca Cola Btlg Co r 115 Powell Solomon Chas (c; Willie) r 424 Flanders Solomon Chas (c) chauf h 149 Hill Solomon Chas (c; Winnie) (o) emp C of Ga Ry h 715 Daisy (SM) Solomon Chas Jr (c) emp C of Ga Ry r 715 Daisy (SM) Solomon Chloe (c) r 211 Lynwood (V) Solomon Daisy (c) 1 cook r 149 Hill Solomon Edw (c; Irene) (o) jan Joseph Clisby Sch h 1211 Pio Nono Solomon Eliz (wid R E) (o) h 220 1st Solomon English student r 124 Oak Haven Solomon Eva (c) 2 h 273 3d (V) Solomon Jefferson (c; Mattie) 1 lab Macon Mattress Co h 534 Flanders Solomon Hattie (c) 2 h 541 (141) Mitchell Solomon Hazel student r 218 Forsyth Solomon James (c; Nancy) 2 h 319 (831) Plummers al Solomon James (c; Cora) 1 firemn C of Ga Ry h 718 Daisy (SM) Solomon James (c) jan Bruce Sch r 100 John- son Solomon John (c; Fannie) 2 lab h 215 5th (V) Solomon John C (c) student r 721 3d (V) Solomon Joseph (c; Annie) 5 hlpr T M Raines Gro Co h 204 Cedar (U) Solomon L Stuart student r 431 Johnson Solomon Lee (c; Lugene) 1 emp C of Ga Ry h 321% 3d (V) Solomon Leola (c) cook J C Midyett r 318 1st (V) Solomon Levi (c; Middie) 7 h 106 (211) Elliott Solomon Lewis (c) hlpr Wofford Oil Co r 464 Liberty (SM) Solomon Lillie (wid W G) (o) h 218 Forsyth Solomon Lina student r 309 Georgia Solomon Linton H (Hazel) dairymn r 218 Forsyth Solomon Linton M Jr student r 218 Forsyth Solomon Lola r 305 Linden Solomon Lora r 309 Georgia Solomon Louis (c; Ethel M) 2 lab h 1066 Ocmulgee Solomon Louise cash Chapmans Pharm r 117 Park pi Solomon Louise (Mrs W W) mus tchr Williams Mus Co r 226 College Solomon Lula (c) (o) h 240, Mitchell Solomon Maitland v-pres Idle Hour Club r 309 Georgia Solomon Mamie (c) h 103 (207) Henry (SM) Solomon Mary mus tchr Williams Mus Co r 226 College Solomon Mary B (c) lndrs r 123 (116) Wood al Solomon Mattie (c) cook S N Rubin r 325 Madison Solomon Mattie (c) maid r 318 1st (V) Solomon Mattie (c) 1 (o) mkr Central City Bag Co h 610 Fort Hill Solmon Mattie L (c) maid E F Cook r RD 3 Solomon Moses (c; Beatrice) hlpr Chapmans Garage r 1211 Pio Nono Solomon Nathl (c; Beulah) tex wkr Bibb Mfg Co r 115 Powell Solomon Ollie (c) r 215 5th (V) Solomon R Dennard student r 220 1st Solomon Robt (c; Estella) r 123 (121) Tatnall Solomon Robt (c) delmn Standard Mkt & Gro r 1022 Power House al Solomon Sophie (c) tex wkr Bibb Mfg Co r 1 (201) Toombs (SM) Solomon Spinks (Mamie) farmer r 226 (719) Solomon Steph (c) lab h 708 (605) Hall (EM) SOLOMON STEVE M JR (Mary E) (o) autos 462 Broadway--tels 4956-4957, h 124 Oak Haven--tel 4595 (See page 45) Solomon Steve M III slsmn Steve M Solomon r 124 Oak Haven Solomon Susie Mrs r 606 2d Solomon Theo (c; Julia) 2 h 310 Norris Solomon Vella M (c) 3 r 10 (104) Steins al Solomon W Cary (Lois) mgr Renfroes Farms h 431 Johnson Solomon Walker E (c) typist County Relief Admn r 721 3d (V) Solomon Webster (c; Trudie) 2 r 118 (552) Magnolia la Solomon Will G Jr (Bessie) 1 hlpr r 218 Forsyth Solomon Wm (c; Irene) 1 lab h 608 Norris Solomon Wm student r 124 Oak Haven Solomon Wm D (c) student r 215 5th (V) Solomon Wm L 1 elk P O r 226 College Solomon Wm W (Louise) 1 ins agt h 226 College Solomon Z Cicero (c; Exie) (o) h 721 3d (V) Solomon Zebedee (c) hlpr Mrs Mary W Eubanks r 215 5th (V) Sons & Daughters of Jerusalem Hall (c) 1020 Colemans la Sorrell Annie R (Mrs G W) opr Happ Bros Co r 107 (106) Pineview Sorrell Geo W (Alma) 1 hlpr h 107 (106) Pineview Sorrell Jack (Annie R) hlpr John Douglas r 2998 Houston Sorrells Elmer hlpr r 103 Pryor Sorrells Eug hlpr r 103 Pryor Sorrells Geo B (Josie) 2 hlpr h 103 Pryor Sorrells Gladys r 103 Pryor Sorrells J C tchr Lanier High Sch for Boys r Bloomfield rd RD 2 Sorrells W H tchr Lanier High Sch for Boys r Houston rd_ RD 3 Sorrow Benj (Essie) r 640 Pebble Sorrow Cleo (Helen) 1 r 640 Pebble Sorrow J Wesley (Annie L) 2 tex wkr Willingham Mill h 414 Pio Nono Sorrow Lois r 318 Cleveland (SM) Sous Place (Susie Phillips) confr 1931 2d Souder Gladys E student r 213 Stanislaus cir Souder Redding C (Maude S) (o) ofc mgr Jones Johnston Russell & Sparks h 213 Stanislaus cir Souder Redding C Jr student r 213 Stanislaus cir South Benj R (Theodocia O) elk The Brass Rail r 757 Pine 1935 Macon City Directory 441 South Georgia Conference Board of Christian Plum at 5th R R Kendall capt police dept Education Rev G E Clary exec sec 717 Mulberry Plum at 5th J M Plaskitt mstr mech shops Pine cor 7th South Macon Barber Shop (J P Stokes) 2661 Southern Sports Co (Henry Kaplan) athletic 2d gds 514 Broadway South Macon Primitive Baptist Church 2620 Broadway Southern Stages Inc Frank Wilkinson pres ofc and garage 609 3d bus sta 320 Broadway South Side Church of Christ K T Blankenship pastor Knott cor School Southern Textile Co G M Rhode mgr hosiery 40 Cherry South Western Railroad Co G I Hardeman sec- Southern Weighing & Inspection Bureau H W treas Wallace Miller v-p 808-09 Ga Casualty Bldg Wade supvr 5th at Pine Southland Barber Shop R Goepp mgr 565 Southeastern Battery Co Inc L J Blum pres J E Palmer sec-treas mfrs 757 Broadway Broadway Southland Barber Supply (J C Lackie) 566 Southeastern Broadcasting Co E K Cargill pres genl mgr G P Rankin Jr v-p W E Cobb sectreas oprs WMAZ Radio Sta 214 Cotton Poplar Southland Coach Line W L Whiting supt 320 Broadway Southeastern Compress & Warehouse Co W L Southland Coffee Co D F Brown pres Conrad Roberts supt Cotton ft Poplar Theiss sec-treas whol 503 5th Southeastern Demurrage & Storage Bureau A Southland Coffee Shop Mrs Daisy C Hamilton W Schmidt supvr Plum at 5th mgr 567 Broadway Southeastern Express Co G A Willis agt Ter- Southland Knitting Mills Inc L S Dure pres minal Sta W L Hanson v-p M Merritt Thurman sec- Southeastern Greyhound Lines W L Whiting treas J W Hanson genl mgr 216 Holt (V) supt ofc 320 Broadway garage 560 2d SOUTHNER MORGAN B sec-treas United Southeastern Optical Co Inc The C W Robert- Purchasing Co Inc) r RD 6 Miller Field rd son mgr whol 358 2d Southwell Marvin L (Alma B) 1 elk MD&SRR Southeastern Underwriters Assn F M Williams h 464 Orange engr 313 Bibb Bldg Sowell Clifford E (Hazel) spec del carrier P O Souther Allie (wid W J) 1 h 737 Blackburn h 463 Spring Souther Benj M auto mech R L Souther r 811 Sowell Eug O elk O R Sowell r 93 Clayton (V) Broadway Sowell Jeanette student r 93 Clayton (V) __ Souther C C chf elk Ga RR 712 Vineville Sowell Leon V (Katie M) 2 (o) elk P O h 530 Souther Chas F elk Ard Cash Gro r 616 1st Log Cabin blvd Souther Geo L (Frances) 2 (o) condr So Ry Sowell Mary A student r 93 Clayton (V) h 873 Hillyer Sowell Oscar R (Eva) 1 (o) gro 95 Clayton Souther Geo L Jr r 873 Hillyer (V) and 701 Broad h 93 Clayton (V) Souther Henry L (Myrtle) 1 (o) coir Palm Pur Sowell Wilma student r 93 Clayton (V) Co h 222 Villa Crest Spain Jane (c) 4 maid r 332 Gilmer Souther Jos J (Pearl) 2 sheet metal wkr h 119 Spain Monticello (c) r 304 Watson al Ell Spangler Geo C (Gertrude) (o) trav slsmn h Souther Louise sch tchr r 737 Blackburn 130 Coleman Souther Mack G (Annie L) 3 emp State Fish Spangler Susan asst cash Nat L & A Ins Co Hatchery r 217 Tatnall r 130 Coleman Souther Myrtle (Mrs H L) slswn Snyders Spann Clara (c) 3 maid E B Harris r 759 Ash Ready-to-Wear r 222 Villa Crest Spann Gertrude (c) cook YWCA Residence Souther Robt L auto repr 811 Broadway r do r 120 Concord Souther Sara sch tchr r 737 Blackburn Spann Marietta (c) r 759 Ash Southerland Sarah case wkr FERA r Forsyth Spann Mattie (c) maid h 759 Ash rd (The Oaks^ SPARKS AUGUSTUS O B (Mattie L) 1 (o) SOUTHERN BELL TELEPHONE AND TELE- (Jones, Johnston, Russell & Sparks) h Oak GRAPH CO, C L Kirven dist mgr, 213 Cotton--tel 9000, branch 501-05 2d, warehouse Cliff rd, Shirley Hills--tel 1009 Sparks Charity (c) (o) h 151 e Academy (EM) 650-52 Broadway Sparks Corinne (c) r RD 1 Forsyth rd Southern Cotton Oil Co A A Almand mgr Sparks Daisy H (wid O G) r 238 Hardeman Waterville rd nr Stratton Sparks Frank (c; Allene) lab James Lbr Co h Southern Crate & Veneer Co J C Tarver mgr 338 Gilmer ft Poplar Sparks Jonnie (wid R L) (o) h 450 Washington Southern Dry Goods Store (Jos Haskin David Sparks Jos R (Martha) mgr A Schulte h 321 Rackson) 468 Poplar Orange SOUTHERN FLOOR & INSULATING CO, Sparks Julia (c) (o) h 201 Lynwood (V) Albert E Sheridan mgr, 306 Oglethorpe--tel Sparks Julia A (c) tchr B S Ingram Sch h 195 3121 Lincoln (V) Southern Hardwood Flooring Co (W F Muecke) Sparks M Garten sec Sparks Mtr Co r 468 616 Poplar College Southern Investment Co (G T Dunlavey) loans Sparks Mamie r 120 Colquitt 10 Jaques Bldg Sparks Motor Co W B Sparks Jr pres M G Southern Mortgage Co Inc J B Hart pres J B Sparks sec autos 613 3d Hart Jr sec-treas 354 1st Sparks Pauline (c) sch tchr r 195 Lincoln (V) Southern Oil Stores Inc Hubert Wilcoxon br Sparks R Morgan (Sparks Specialty Co) res mgr serv sta 200 Broadway Southern Paint & Varnish Co (H W Polley) Soperton Ga Sparks Specialty Co (R M Sparks) vending 561 Mulberry machs 549 Mulberry Southern Railway System W H Cheney div Sparks Thos (c; Ida) h 15 (8) Malloys al supt 102 Terminal Sta R L Butt asst genl Sparks Wm S (c; Mamie) (o) emp McKesson- frt and pass agt Plum at 5th E F Carter Riley r 195 Lincoln (V) claim agt 102 Terminal Sta R N Lester chf Sparks Willie (c) r 227 Morgan dispr 122 Terminal Sta O G Prentiss frt agt Sparks Willis B (Mary) (o) h 468 College Baldwin's and Telegraph's Sparks Willis B Jr (Lucile) 1 pres Sparks Mtr Co h 309 Masonic Home rd Sparks Wyatt A (c; Cora) (o) h 326 3d (V) Sparrow J F slsmn Ga Power Co r Hotel South- land Sparrow John J route formn Independent Ldry Spikes Ernest (c; Lillie) 5 h 418 (118) Edison Spikes John (Vina) tex wkr r 246 Hydrolia Spikes Lucy (c) 4 r 1435 Broadway Spikes Thos J (Magnolia) 1 tex wkr h 258 Hydrolia Spikes Wm (c) delmn Marvin Gro Co r 116 Co res Hawkinsville Ga Sparrow Julia (c) r 404 e 1st (EM) Spaulding Josephine (c) h 523 Hazel Spear Jessie Mrs r 217 Broadway Spear Josie Mrs 2 tex wkr h 902 Oglethorpe Spear Marcus C (Inez) 1 emp Bibb Mfg Co r 369 (349) Hydrolia Spear Mattie (c) 3 h 245 2d (V) Spear Myrtle Mrs r 49 Hydrolia Spearman John W (c; Lizzie) 1 (o) elk Ry M (160) Brief (V) Spikes Wm F (Bessie) mech Proctor & Gamble Mfg Co r 506 Edgewood Spikes Wm I (Ellen) (o) h 506 Edgewood Spiller James A (Lucy) 1 (o) waiter Spillers Restr h 136 Edna pi (LCHts) Spiller James E (Rilla) (o) h 542 (1) Log Cabin blvd Spiller John H (Fay) 3 waiter Spillers Restr h 728 Walnut S h 253 2d (V) Spearman Robt E (Fannie L) 2 (o) chem C- M-P Drug Co h Rocky Brook dr (SH) Spears Estill (Betty L) 1 tex wkr Willingham Mills h 317 Dannenberg Spears Eurie L (Mazie G) 1 tex wkr Willing- ham Mill h 442 Lawton Spears Indiana (c) 2 lndrs h 348 (445) Forest Spiller Oliver D waiter Spillers Restr r Hotel Gordon Spiller Sara student r 728 Walnut Spiller Wm A (Spillers Restr) r RD 4 Spillers Wm H (Eliz) r 1525 3d Spillers Restaurant (W A Spiller) 470 Mul- berry Spillers Clarice opr So Bell Tel Co r 952 (V) Spears Ollie opr Adams Mfg Co r 654 Elm Spears Wade H pntr r 862 3d Speer C O eng C of Ga Ry Creosote Plant 1906 (o) Vineville Speer Eliz G (wid E G) slswn Darling Shops r 105 Rogers (V) Speer Gertrude (c) mkr Central City Bag Co r 959 (r) Ocmulgee Speer Jewel nurse 1018 Vineville r do Speer Otis V (Marvel) bkpr r 221 (220) Log Cabin dr Speir Annie B r 115 Lawton Speir Elinor student r 127 Highland Speir Hattie L Mrs opr Happ Bros Co h 1012 Hazel Speir Louis E (Louise) city firemn h 127 High- land Spell Arth T (Palace Barber Shop) r Fickling Hotel Spence Allen (Mary) 1 (Ideal Clothing Store) h 1235 Broadway Spence Claude student r 438 Ross Spence Ernest R (Dessie) car repr C of Ga Ry h 438 Ross Spence Frances slswn W T Grant Co r 438 Ross Spence John C (Marie) 2 carp h 913 2d Spence Marie (Mrs J C) opr Happ Bros Co r 913 2d Spence Norris (c) emp Wisteria Cafe r 500 Edison Spence R Morrell dr Yellow Cab Co r 913 2d Spence Virginia opr So Bell Tel Co r 438 Ross Spencer Clifford (c; Beulah) h 6 Elm Spencer Della (c) 1 h 1227 3d Spencer Henry (c) r 1227 3d Spencer Ida L (c) lndrs r 212 Fretwell al Spencer John D (Maidee D) (o) columnist Macon Teleg Pub Co h Sunset dr (SH) Spencer Lula (c) h 378 (384) Monroe (V) Spencer Mary (c) (o) h 107 (7) Orchard Spencer Mittie (c) 4 lndrs r 358 Stripling al Spencer Ruth (c) 1 r 1227 3d Spencer Willie L (c) 2 maid G L Bost r 212 Fretwell al Sperry Leola (c) h 3 Bay al Spier James G r 713 Adams Spiers Chas K (Nell B) 1 reprmn So Bell Tel Co h 930 College apt 2 Spiers Nell B (Mrs C K) opr So Bell Tel Co r 930 College apt 2 Aug M florist Idle Hour Nurseries r RD 1 Oglethorpe Spillers Clyde E (wid L M) 1 h 952 Oglethorpe Spillers Eliza (wid A P) r 772 Hemlock Spillers Eliz (Mrs H R) opr So Bell Tel Co r 861 2d Spillers Eustace (Clara) 1 emp C of Ga Ry r 722 Walnut Spillers Helen r 501 Carling Spillers Herbert R (Eliz) (Elec Dry Clng Co) h 861 2d Spillers Lorenzo A (Annie L) slsmn Ga Oil Corp r 501 Carling Spillers Martha L r 134 Winship Spillers Mattie (Mrs W C) filrwn Adams Mfg Co r 2831 Houston Spillers Minnie L student r 134 Winship Spillers Ruth student r 501 Carling Spillers S Claude (Tallulah) 5 mech Huckabee Auto Co h 134 Winship Spillers S Claude Jr elk Rogers Inc r 134 Win- ship Spillers Walter C (Mattie) sash mkr Willing- ham S&D Co r 2831 Houston Spinks Annie r 1411 Edgewood Spinks Chas r 235 Washington Spinks Chas T r 122 Daley Spinks Erman r 1411 Edgewood Spinks Hurley r 1411 Edgewood Spinks Lonnie R (Annie) 3 emp Birdsey Flour Mill h 1411 Edgewood Spinks W H r Hotel Gordon Spires Fannie r Masonic Home of Ga Spires Kendrick (Annie L) r 519 Pine Spires Ray (Emma) 3 dog catcher City r 253 Broadway Spitz Chas A (Edith) ofc mgr Goodyear Serv Inc h 864 Mulberry apt 3C Spiver Mary (c) maid Macedonia Baptist Ch h 165 Hazel Spivey Allie (c) lndrs r 113 (354) Spring la Spivey Annie (c) 1 cook J W Hightower h 585 (25) Siam Spivey Chaney (c) maid r 562 Plant al Spivey Claude (c) emp C of Ga Ry h 215 Middle (V) Spivey Claude Jr (c; Hattie) shoe shiner r 215 Middle (V) Spivey Enoch H (Othelia) 1 emp State Fish Hatchery h 1016 Hazel Spivey Eugenia L (wid Oscar) 1 r Sunset dr (SH) Spivey Felix M (Adelle) (Spivey & Pritchett) r 554 1st Spivey Genelle ofc sec The Clinic r 911 Cherry 1936 Macon City Directory 413 Spivey Geo elk Sous Place r 1931 2d Stafford Edw W r 1520 2d Spivey Harry A (c; Fannie) (o) tailor 519 Mul- Stafford Esther (c) 1 cook Eden Taylor r 196 berry h 207 3d (V) Washington Spivey Henry (c) r 11 Malloys al Stafford G Paschal (Laura B) 1 plant emp Dr Spivey Henry (c) r 215 Middle (V) Pepper Btlg Co r 2325 2d Spivey Howell D elk Pig 'n Whistle Sandwich Stafford Jennie E (c) h 196 Washington Shop r 475 Orange apt 1 Stafford Joseph (c; Mary) 6 r 257 Cowan Spivey Isaac (c; Ella) 1 lab h 406 (561) Stafford Josephine (c) (o) h 313 (327) 1st (V) Henrietta (SM) Stafford Olivia (c) 3 maid M E Plant h 541 Spivey James (Arlie) 2 h 138 Williams (SM) (441) Tindall (SM) Spivey John A r 1016 Hazel Stafford Ruby (c) r 196 Washington Spivey Lillian (c) tchr Wheatley Sch r 207 Stafford Sallie Mrs 2344 2d 3d (V) Stafford Wiley B (o) engr GS&FRR h 1520 2d Spivey Mattie (c) maid A B Watts r 406 (561) Stahle De Motte (o) h 620 Forsyth Henrietta (SM) Stahle Joseph R opr Bibb Mfg Co r 139 Spivey Milton (c; Jannie) elk h 509 Monroe (V) Flamingo dr Spivey Myrtice r 1016 Hazel Stahle Martha C opr Happ Bros r 139 Spivey Nettie R (wid Chas O) 1 r 475 Orange Flamingo dr apt 1 Stahle Ray A (Minnie C) 1 (o) mech Cliff Spivey Oliver (c; Mattie) 6 lab C of Ga Ry Walker Co h 139 Flamingo dr h 1526 1st Stainton Sami D (Mary C) 2 agt Ry Exp Agcy Spivey Robt C (c) r 20 Hall (SM) h 222 Riverdale dr Spivey Sarah (c) cook r 600 (113) Colquitt Stakley James O archt W E Dunwody Jr r Spivey Virginia (Mrs Reno) 1 r 553 Elm 278 College Spivey Walter C (Leslie L) 6 h 106 Capital Staley Carrie (c) Indrs h 413 Walnut Spivey Wiley (c) r 215 Middle (V) Staley Clara (wid A W) r 104 Ayers rd (B) Spivey Wm (c; Virginia) brklyr h 260 1st (V) Staley Edw N student r 100 Putnam (SM) Spivey Willingham (c; Willie) 3 hlpr Macon Staley James H (Edna) 2 (o) slsmn Southland Fish & Oyster Co h 261 Waterville rd Coffee Co h 104 Ayers rd (B) Spivey & Pritchett (F M Spivey C T Pritchett) Staley Martha A sten Bankers Health & Life auto reprs 444 Pine Ins Co r 104 Ayers rd (B) Spool Eliz (c) dom r 1206 Broadway Staley Oliver D (Octavia) 1 (o) formn h 100 Sportsmans Place (Abr Wolf) soft drinks 420 Putnam (SM) Poplar Staley Pierce (c; Parilee) 1 lab h 100 (406) Spradley Cecil (c; Eva) 1 emp C of Ga Ry Randall la h 614 Fort Hill Stalk Emma (c) r 1240 Broad Spratling J Hook (Pauline) (o) optometrist 652 Stalk Eug (c; Louise) 1 hlpr Carstarphen Cherry h 121 Hines ter (V) Inc h 2 Buckner al Spratling James H (Sarah) optician J H Stallings Ethel (c) maid Hotel Lanier r 342 Spratling r 261 Georgia apt 3 Middle (V) Spring Street Apartments 163-65 Spring Stallings Henry P (Sallie) paperhngr h 908 Springer Francis hlpr Ga Roofing & Sup Co Elm r 663 Plum Stallings Henry P Jr (Marie B) slsmn Huck- Springer John I (c; Annie) 2 (o) jan h 424 abee Auto Co r 908 Elm Ward (V) Stallings Jesse A paperhngr r 137% Park pi Spruce Camille student r 2 Gustin pi Stallings Lucile slswn S H Kress Co r 908 Elm Spruce John W (Eunice) mech Southland Knit- Stallings Marie B (Mrs H P Jr) opr So Bell Tel ting Mills h 2 Gustin pi Co r 908 Elm Spruce R Danl (Mary) elk Busy Bee Lunch h Stallings Wm L (Annie G) 4 int dec 1127 610 Forsyth Walnut h - do Spruce Thelma (Mrs W C) opr W TJ Teleg Co Stallsworth A H inspr Ga Power Co r RD 4 r 4 Gustin pi Stallsworth Robt L (Neva O) 1 serv sta 3505 Spruce Thurman P (Gladys) 2 elk Peacocks Houston h do Central Pharm h 106 Delaware Stallworth Amon J (Mary) barber Genones Spruce Wesley C (Thelma) 1 emp Southland Barber & Beauty Shop r RD 4 Knitting Mills h 4 Gustin pi Stallworth Asbury W (Ida) 2 (o) br mgr Spry Albert (c) delmn Lackay & Lackay r 522 Rogers Stores h 121 Academy Calhoun Stallworth Benj (c; Mattie) porter Idle Hour Spry Eug (c; Cora) 1 r 522 Calhoun Nurseries h 121 Ritchey Spry Sami (c) delmn W G Dean r 522 Calhoun Stallworth Caesar (c) 4 h 246 Mitchell Spurlin Ida (Mrs J A) mach opr Happ Bros Stallworth Janie (c) student r 246 Mitchell Co r 753 Mulberry Stallworth Lillie (c) dom h 202 (229) Astor Spurlin J Andrew (Ida) pntr R A McCord Mtr Stallworth Mack (c; Rose) (o) lab C of Ga Ry Co r 753 Mulberry h 402 (297) Cowan SPURLOCK BENJ H dentist 507-08 Bibb Bldg Stallworth Mack (c; Leila) 1 lab So Crate & --tel 751 r 855 Mulberry apt 302 (See page Veneer Co h 613 Hall (EM) 106) Stallworth Mary (c) 1 Indrs h 310 Womack Spyro Maivis cook The New Yorker r 568 Stallworth O C bus opr Ga Power Co r RD 4 Walnut Stallworth Odessa (c) 1 dom r 310 Womack Staamer Agnes (wid D G) 2 marker Crescent Stallworth Paul (Nettie) sta opr Power Oil Co Ldry h 1060 Walnut Staamer Eliz r 1060 Walnut Staedtler Frances (wid E G) 2 sten Met Life Ins Co r 761 Hemlock Stafford Benj (c; Addie) meat ctr r 307 Monroe (V) h 678 Courtland Stallworth Robt B starter Yellow Cab Co r 121 Academy Stallworth Thos (c) delmn E W Elder h 204 (212) Clark (EM) Stafford Clyde (c) r 196 Washington Stallworth Willie (c) dom H G Wilkes r 204 Stafford Early (c) r 541 (441) Tindall (SM) (212) Clark (EM) 444 Baldwin's and Telegraph's Stalnaker Marie H Mrs 1 bkpr Wood-Peavy Stanford Richd (c; Ora) 2 h 437 Cedar (U) Furn Co r 805 Woolfolk Stanford Sol (c; Etta) 1 lab h 503 (127) Stamatis Louis waiter DeLuxe Cafe r RD 2 Norris Stamm Arth (Carrie M) (North Highland Gro) Stanford Thos B (Estelle) 2 pastor Second St r RD 6 M E Ch h 203 Jeff Davis (SM) Stamps Edw R div supt F S Rayster Guano Stanford Wm H (c; Malissa) (o) h 225 Lee Co r RD 2 Milledgeville rd (EM) Stamps Dolores E dancing tchr r 452 College Stanley A Cleon (Anne) 1 firmn C of Ga Ry apt 3 h 2601 2d Stamps Dolores L (wid P D) sten Clark Stanley Anna (c) 1 r 341 Madison (V) Memorials Inc h 452 College apt 3 Stanley Carl (Minnie) r 1017 (2011) Log Stamps Wm (c; Mary) lab h 730 (8) Reynolds Cabin blvd al Stanley Carrie E (c) (o) h 347 4th (V) Stancel James (c; Julia B) (o) carp h 854 (852) Stanley Chas (c; Mary) 8 h 102 Harris 3d (V) Stanley Daisy (c) tex wkr Bibb Mfg Co r 121 Stancel Julia B (c) tchr Wheatley Sch r 854 Douglas (SM) (852) 3d (V) Stanley David W (Thelma) 2 mech Ga Power Stancell Clyde r 1512 Vineville Co h 163 Spring apt 2 Stancile Doyle T (Lena) 1 coir Toole Furn Co Stanley Eon (c) 2 clnr Bibb Mfg Co r 11 Opera h 871 Mulberry House al Stancile Katileen waitress Harrys Cafe r 871 Stanley Hayes (c; Daisy) 2 h 121 Douglas Mulberry (SM) Standard Brick & Tile Co W E Dunwody pres Stanley James (c) lab h 11 Opera House al W J Massee v-p S T Coleman sec-treas 460 Stanley James (c) lab h 807 Willow Broadway Stanley John E hlpr r 407 Walnut Standard Market & Grocery (Ralph and Mrs Stanley John H 1 furn rms 407 Walnut h do Salha Bobo) 159 Franklin Stanley Joseph M (Louise) 1 emp Birdsey Flour Standard Oil Co J M Gibson agt bulk plant Mills h 865 Cherry 307 (119) Bay serv stas 265 and 2638 Broad- Stanley Maggie (wid Z T) h 962 Oglethorpe way 501 Cotton 101 Montpelier 80 Spring 102 Stanley Oscar L r 501 Carling and 2006 Vineville 601 2d and 18 5th Stanley R C (c) r 121 Douglas (SM) Standard Paper Co S J Isaf mgr 518 Broadway Stanley Rebecca (wid R K) r 620 (520) Standard Parts Co (Harold Berliner C G Coi- Mikado lins) auto sups 702 3d Stanley Sarah (c) r 807 Willow Standard Stores Inc Arth Haskins pres Isaac Stanley Thos (c; Rosa) lab Macon Cooperage Cohen sec H C Haskins treas oprs Standard Whole Co genl mdse 360 3d Standard Tool & Handle Co R A Meadows ofc mgr C F Lamb supt mfrs ft Elm Standard Wholesale Co Standard Stores Inc oprs dry goods 360 3d Standridge Chas C (Walla) 3 shoe repr .1129 Broadway h 115 School Stanfill Mary (Mrs Roy) spinner Bibb Mfg Co r 103 Forest (B) Stanfill Roy (Mary) 4 h 103 Forest (B) Stanford Aug L (Essie) 1 emp So Ry h 435 Duncan Stanford Blair (c; Alberta) tex wkr r 150 Washington Stanford Chas (c; Opelia) 3 lab h 227 Hurley Stanford Clara (c) r 317 Hammond emp Independent LdrJy Co Stanford Dora (c) cook C P Jones r 104 (105) Pringle Stanford Doris student r 435 Duncan Stanford Dorothy student r 435 Duncan Stanford Edw (c) tr dr Willingham S&D Co r 225 Lee (EM) Stanford Floyd (c; Nora) h 197 Division St la Stanford James L (c; Ruth) dr Colored Taxi Co h 136 Woodliff Stanford John H (c; Alberta) dr Colored Taxi Co r 319 Maple Stanford Lewis (c) cook Minute Lunch r 317 Hammond Stanford Lizzie (c) dom L R Dublin Stanford Lloyd (c) Clara) 2 brklyr h 105 (107) Pringle Hanford Louis (c; Bessie) (o) lab h 435 Cedar Co h 624 Hammond Stanley Wm (c; Frankie L) porter Hotel Gordon r 501 Fulton Stanley Wm K (Lenora F) 1 (o) slsmn Adams- Buchanan Mtr Co h 104 Rogers (V) Stansbury Dale F (Mabel) 3 prof Mercer Univ h 407 Napier Stansbury Eug student r 407 Napier Stansell Potato Chip & Sandwich Co Ins W H Stansell genl mgr 508 1st Stansell Wm H (Jessie) genl mgr Stansell Po- tato Chip & Sandwich Co h 722 1st Stanley Hattie (c) tex wkr Bibb Mfg Co r 10 (78) DeBorede (SM) Stanley Marvin (c; Hattie) emp Cherokee Brick Co r 10 (78) DeBorde (SM) Stanton Aiken M (Stanton Sound Serv) r 320 Hill Crest Stanton Clarence H Jr r 102 Branch Stanton Dellie M (wid G G) (o) h 320 Hill Crest Stanton Florence (wid CH) 2 (o) h 102 Branch Stanton Frances M elk Stanton Sound Serv r 320 Hill Crest Stanton Margt student r 102 Branch Stanton Sound Service (A M Stanton) radio reprs 203 Cotton Stapler Irene M (wid MM) (o) h 203 High Staples Ernest A engr Maxwell Bros r 224 Georgia Staples Grady (Eva) carp r 854 Cherry Staples Henry G bus opr Ga Power Co r RD 3 Stapleton Harvey P (Eugenia) 3 (o) bus opr Ga Power Co h 417 Montpelier Stapleton James H (Beulah) pntr h 201 Sim- Stanford Louise r 203 Jeff Davis (SM) Stanford Maggie (c) (o) h 404 (104) Lexing- mons (SM) Stapleton Jerry (c) lab r 101 Cheatham al Stapleton John T (Stella) (o) formn C of Ga Stanford Mary (c) lndrs r 105 (597) Singletons Ry h 3218 (3200) Houston IE Stapleton Viola opr Happ Bros Co r 104 3d Stanford Nora (c) 2 h 516 Hammond Stanford Obed (ci dairy hd r 20 Parker (V) Stapleton Wm W r 3218 (3200) Houston Stapley Jennie A (wid W M) r 420 Duncan 1935 Macon City Directory 445 Star Market (Heime Ashkenazie) gros 636 Ross Stargele Eunice (Mrs J W) sten Morgan & Morgan Ins Agcy r 213 Bond apt B1 Stargele Joseph W (Eunice) elk P O r 213 Bond apt B 1 Starke Dennie student r 102 Troup Starke Dorothy A sten Idle Hour Club r 102 Troup Starke John T (Dollie) (o) dispr C of Ga Ry h 102 Troup Starke Sarah I r 102 Troup Starks Bennie (c; Georgia) hlpr Sunlite Elec- tric Bake Shop Inc h 125 e Ell Starks Chas (c; Nora) 6 lab h 436 Telfair Starks Chas Jr (c) r 436 Telfair Starks Comer (c) r 436 Telfair Starks Della (c) r 954 Hazel Starks Edw (c; Eliz) 1 hlpr Power Oil Co Inc h 420 Hazel Starks Emma (c) r 1018 Broad Starks Hattie (c) maid Wesleyan Conservatory h 210 Middle (V) Starks Ruby (c) cook C D Gammage r 436 Telfair Starks Sarah (c) maid Ken Kimbel r 407 Monroe Starling Alberta (c) r 602 3d apt 1 (V) Starling Georgia (c) r 602 3d apt 1 (V) Starling Mattie (c) 1 h 602 3d apt 1 (V) Starr Herman (Frances) 2 gold buyer h 852 Cherry Starr J Henry (Bettina) 1 (o) slsmn Lowe Elec Co h 875 Mulberry Starr J Henry Jr r 875 Mulberry Starr John H student r 852 Cherry Staten Ernest (c; Lillian) chauf G Y Massen- burg h 311 Green Staten Lillian (c) maid G Y Massenburg r 311 Green Statham Audie (c) hlpr Ga Roofing & Sup Co r 617 (208) Colquitt Statham Carl (c) r 617 (208) Colquitt Statham Cath (c) 1 r 617 (208) Colquitt Statham Eug (c; Linda) 1 h 2115 Wyche's al Station JOY Barbecue (C W Pittmaq) RD 1 Forsyth rd Steadman Andrew J (Julia) carp h 156 Lee (EM) Steadman Chas T hlpr A B Lee Plmbg & Htg Co r 156 Lee (EM) Steadman Mark S (Marie) 2 civ engr State Hwy Bd h 205 Abemarle pi Steadman Martha (Mrs W A) opr Dixie Roll & Cot Co r 306 Center (EM) Steadman Wm A (Martha) emp Bibb Mfg Co h 306 Center (EM) Stearman Sami M (Dolly) 4 mach MD&SRR r 218 Ross Stebbin Nell Mrs 3 r 918 Walnut Stecher- Traung Lithograph Corp W M Jordan Jr mgr 304-05 Bibb Bldg Steed Albert G appr C of Ga Ry r 399 Bailey Steed Clarence J msngr Postal Teleg-Cable Co r 412 Vineville Steed F Eliz cash Postal Teleg-Cable Co r 412 Vineville Steed Florence sten Ga Caro Oil Co r 412 Vineville Steed Joseph N condr C of Ga Ry h 810 Hem- lock Steed Louise sten Outz-Mitchell & Whaley Inc r 412 Vineville Steed Mary E r 399 Bailey Steed Wm H (Cassie) (o) blksmth C of Ga Ry h 105 Clay (NH) Steed Wm T (Lillian) (o) blksmth C of Ga Ry h 399 Bailey Steele Frances case wkr FERA h 213 Bond apt B 4 Steels Hattie (c) 1 lndrs h 642 4th (WH) Steerman Albert D (Myrtle) 1 h 2007 Broad- way Steerman Myrtle (Mrs A D) opr Happ Bros Co r 2007 Broadway Stefano Geo (Adelaide) 3 (o) (Florida Fish & Oyster Co) r 318% Main (EM) Stefano Luke elk Florida Fish & Oyster Co r 318% Main (EM) Steger Edna student r 1405 Oglethorpe Steger Frank B (Lucile) 1 (o) barber Palm Barber Shop h 1405 Oglethorpe Stein Barney (Agnes) 2 (Pleasant Hill Beer Parlor) h 662 Walnut Steinmeyer W Erwin student r 3007 Houston Stella's Beauty Shop (Stella M McKee) 3043 Houston Stelljes Geo (Lucy) 1 ofc mgr Snow's Ldry h 401 College apt 3 C Stelljes Margt (wid Geo) r 104 Florida Stembridge C Lloyd shpg elk Macon Paper Co r 765 Spring Stembridge Dewey L (Cleone) carp r 119% Richmond Stembridge Frank (Onie) r 659 1st Stembridge Jack C (Thelma) 2 slsmn Empire Fum Co h 700 Woolfolk Stembridge Lena (wid O H) h 723 1st Stembridge Olin L slsmn Macon Paper Co r 765 Spring Stembridge Robt E (Marion) elk Burden Smith & Co h 475 Spring Stembridge Sadye bkpr Freeman-Dent-Sulli- van Co r 723 1st Stenson Louise S (Pearl) 2 pntr r 616 2d Stephan Doris opr Adams Mfg Co r 40 Brig- ham (PM) Stephan Prentice D (Pansy) 4 emp Bibb Mfg Co h 40 Brigham (PM) Stephens (see also Stevens) Stephens Andrew (c) h 516 Womack Stephens Annie (c) h 909 Pio Nono Stephens Arizona (Mrs S M) dietitian Mercer Univ r 305 Ormond ter Stephens Arth (c; Georgia) 4 h 405 Douglas (V) Stephens Bob Barber Shop (R A Stephens) 206 Cotton Stephens Burell (c; Minnie) lab Proctor & Gamble Mfg Co r 404 (507) Prince (SM) Stephens Clara (c) 1 r 408 (503) Prince (SM) Stephens David (c; Ida) tr dr Taylor Furn Co h 730 (742) 3d (V) Stephens Deliah (c) 4 h 361 Madison Stephens Dorothy student r 37 Adams Stephens Earl (c; Eurilee) emp Bibb Mfg Co h 712 Daisy (SM) Stephens Elijah (c; Ruby) chauf Jacob Hirsch h 302 Turpin Stephens Ellen (c) dom r 204 (223) Roye Stephens Ellen (c) maid r 327 2d (V) Stephens Emanuel (c; Fannie) lab So Crate & Veneer Co h 75 Bay Stephens Ethel M (c) r 854 Willow Stephens Fannie (c) lab So Crate & Veneer Co r 75 Bay Stephens Fredk (c) emp Macon Linen Sup Co r 152 Elm Stephens Freeman (c; Alene) 3 lab h 227 Carter's al Stephens Geo C (Wylene) 1 tex wkr Willing- ham Mills h 24 (87) Mill Stephens Geo H (c) (o) swtchmn So Ry h 508 Clinton Stephens Granville (c) r 104 Cowan Stephens Henry (c; Mary) 1 emp Buckeye Oil 446 Baldwin's and Telegraph's Mill h 235 (443) Alabama (SM) Steppe Rebecca student r 821 Hemlock Stephens Henry (c; Lula) (o) lab h 514 Martha Steppe Wm A elk Volunteer Pharm r 821 Stephens Henry T (c; Georgia (o) pastor Stin- Hemlock sonville AME Ch h 711 Charles STERCHI BROS STORES INC, Wright Brown Ctephens Herbert trav slsmn r 397 Morgan Stephens Herbert A (Nell) condr Co of Ga Ry r 307 Adams Stephens Hugh L (Annie) 2 engr C of Ga Ry h 200 Crescent (CH) Stephens Isaac (c; Ellen) 3 emp C of Ga Ry h 407 Colquitt Stephens J Wm (Margt M) 2 (o) h 517 Beech Stephens J Wm Jr student r 517 Beech Stephens James L (c; Hattie) h 608 Mitchell Stephens Jesse M r 840 Courtland Stephens Julia (c) 1 r 402 1st (WH) Stephens Lee M (Annie) 2 (o) carp So Ry h 2520 Broadway Stephens Lena Mrs r 618 New Stephens Leon (c; Cora) lab Rose Hill Cem r 180 Northwest Boundary Stephens Lula (C) lndrs h 14 Plant al Stephens Marie r 200 Crescent (CH) Stephens Marion (c; Lillian) tr dr Birdsey Flour Mills h 10 (309) Hanson (SM) Stephens Mark A (Nannie L) 2 h 397 Morgan Stephens Mary E (wid A H) drsmkr 168 Spring h do Stephens Nannette slswn W T Grant Co r 397 Morgan Stephens Oran E (Minnie) slsmn Macon Coca- Cola Btlg Co h 1706 3d Stephens Parthenia (c) r 102 (147) Railroad Stephens Paul W (Frances) 1 slsmn r 324 Napier Stephens Pearl School Mrs Fielder B Goodman prin 600 Log Cabin blvd Stephens Percy (c) r 113 (118) Adams Stephens Ralph slsmn r 909 (1923) Lob Cabin blvd Stephens Robt pntr r 320 e 2d (EM) Stephens Robt A (Emily) (Bob Stephens Bar- ber Shop) h 453 Walnut Stephens Roscoe (c; Sallie) tex wkr h 488 Hill Crest Stephens Ruby Mrs 1 winder Bibb Mfg Co r 913 New Stephens Ruth r 516 Womack Stephens Sallie (wid Walter) r 909 (1923) Log Cabin blvd Stephens Sami M (Arizona) 2 (o) emp C of Ga Ry h 305 Ormond ter Stephens W Harold student r 517 Beech Stephens Walter (c) lab r 1325 Broadway Stephens Walter student r 397 Morgan Stephens Wm (c; Lovie) 1 h 152 El m Stephens Wm (c; Eula L) plstr h 102 (147) Railroad Stephens Wm A (Jean) r 51iy2 Cotton Stephens Wm B (c) h 543 (215) Mitchell Stephens Wm B (Eleanor) serv mn Nat Cash Register Co r 252 1st Stephens Wm H r 1919 2d Stephens Willie (c) r 204 (223) Roye Stephens Wylene (Mrs G C) tex wkr Willing- ham Mills r 24 (87) Mill Stephenson (see also Stevenson) Stephenson Hardy C slsmn Cannon Shoe Co r 110 Courtland Stephenson James L (Annie C) 3 (o) dept mgr Union Dry Gds Co h 110 Courtland Stephenson James L Jr (Jacqueline) slsmn Union Dry Gds Co h 559 Orange apt 2 Stephenson L Edw (Winnie) 1 h 132 Knott Mgr, "It Costs Less To Furnish Your Home at Sterchi's", Cherry sw cor Broadway--Tel 3100, 565-75 Poplar--Tel 5957 (See front cover supp, page 87 and cards B D) Sterling Gertrude elk State Hwy Bd r 220 1st Stern Morris L (Fannie P) 1 lawyer h 213 Buford pi (V) Stevens (see also Stephens) Stevens Bascom S (Louise) 6 C of Ga Ry h 108 Rocky Creek rd Stevens Belle (Mrs E I Jr) opr Happ Bros Co r 754 Cherry Stevens Bertram hlpr r 250 Peachtree Stevens Bessie (c) cook J W Johnson r 424 Monroe Stevens Bessie M (c) r 100 (172) DeBorde (SM) STEVENS BOB SERVICE STATION (Robt L Stevens), 601 Walnut--Tel 387 Stevens Bonnie (c) cook J A Gordon h 126 (1) Spring la Stevens Carlton E (Louise S) 4 genl agt Com Mut Life Ins Co h 1440 Vineville Stevens Chas (c; Willie) lab City Scavenger Dept h 224 Madison Stevens Chas student r 519 Walnut Stevens Chas M (Annie) r 250 Peachtree Stevens Claxton r 250 Peachtree Stevens Cleveland (c; Isabella) 3 pntr h 855 Ocmulgee Stevens Edgar (c) lab Adams Buchanan Mtr Co r 105 (3) Fulton la Stevens Edgar I (Clifford carp r 756 Mulberry Stephens Edgar J Jr (Belle) electrn Southland Hotel r 754 Cherry Stevens Edw (c) lab r 319 Short (EM) Stevens Eliz (wid L J) furn rms 519 Walnut h do Stevens Eliz B (wid R K) r 709 Walnut Stevens Ethel (c) cook O P Lawton r 328 Monroe Stevens Ethel (Mrs M J) opr Happ Bros Co r 619 1st Stevens Fleeta (c) dom h 168 Hazel Stevens Frances (c) r 216 (236) Thompson's al Stevens Geo (c; Rosezelle) 5 h 590 Everybody's Crossing Stevens Georgia M (c) maid The Film Shop r 160 5th Stevens Grady H (Carrie) 2 lab r 556 Ocmulgee Stevens Henry (c; Emma) lab h 46 City Hall la Stevens Icy (c) r 216 (236) Thompson's al Stevens lone slwn Williams Jwlry Co r 759 1st Stevens Isabella (c) emp Crescent Ldry r 855 Ocmulgee Stevens James (c) 1 h 160 5th Stevens James (c) emp Cherokee Brick Co r 307 Blount Stevens Jesse (c; Constance) 2 hlpr r 1226 Broad Stevens John (c; Ethel) h 328 Monroe (V) Stevens John (c; Susie) emp Jeffreys-McElrath Mfg Co h 229 (112) Disroon al Stevens John (c; Lula) 5 (o) inst agt h 307 (265) Broad Stevens John (c) lab h 100 (101) 1st (V) (SM) Stevens Lewis M car repr GS&FRR h 102 STEPP F WADE (Rivoli Riding Club) res Kemper same Steppe Rebecca Mrs 1 r 821 Hemlock Stevens Lillian D (wid L O) (o) h 367 College Stevens Lillie B (c) r 407 Colquitt 1935 Macon City Directory 447 Stevens Louise (Mrs Russell) tex wkr Willingham Mills r 201 (32) Holt Stevens Madison J (Ethel) 1 electrn Macon Elec Co r 619 1st Stevens Manuel E (Sudie) 1 lather Paul Williams Co h 207 Fulton (Lynmore) Stevens Mattie h 759 1st Stevens Mattie L serv rep So Bell Tel Co r 140 Highland Stevens Mattie L (wid Whit) 4 spinner Bibb Mfg Co h 254 Hydrolia Stevens Miller (c) hair dresser h 321 Jefferson Stevens Mona sten W D Griffith & Son r 519 Walnut Stevens Percy (c) r 228 Woodliff Stevens Retha (c) r 160 5th Stevens Robt (c; Bessie) (o) emp So Ry h 100 (172) DeBorde (SM) Stevens Robt (Minnie) 2 hlpr h 250 Peachtree Stevens Robt Jr (C) r 100 (172) DeBorde (SM) Stevens Robt B (c; Addie) (o) brklyr h 332 3d (V) STEVENS ROBT L (Berta) 2 (Bob Stevens Serv Sta), h 312 Napier--Tel 4174-J Stevens Rose (c) h 216 (236) Thompson's al Stevens Rufus (c; Fannie) h 92 (4) Schofield Stevens Russell (Louise) 3 tex wkr Willingham Mills r 201 (32) Holt Stevens Russell L (Mattie) h 201 (32) Holt Stephens Sarah (c) 2 emp Snow's Ldry r 1051 Pio Nono Stevens Susie (c) maid r 238 1st (V) Stevens Vera (wid F B) furn rms 262 Broad- way h do Stevens Viola (c) maid C M Rankin r 450 City Hall la Stevens W Albert (Ella J) (o) h 316 Rocky Creek rd Stevens W Hardy (Fannie H) h 140 Highland Stevens Walter C (Flynne) 2 judge Comity Court of Ordinary r 874 1st Stevens Wm (c; Mattie) lab h 5 Short (EM) Stevens Wm O (Ethel H) (o) druggist 1040 2d h 860 Orange Stevens Wm P (Mildred T) pres Atlantic Re- fractories Co Inc r 205 Vineville Stevens Willie (c) maid Gresham Sch r 224 Madison Stevens Wilson W (c; Frances) (o) emp So Ry h 221 Telfair Stevenson (see also Stephenson) Stevenson Alberta (c) r 18 Gustin Stevenson Glenn (c; Cora) hlpr Rose Hill Cem h 180 Northwest Boundary Stevenson Ida M (c) r 239 (122) Moore la Stevenson Robt emp Fairyland Dairy r 104 Cabaniss Stevenson Sarah Mrs 7 h 314 (224) Pio Nono Stevenson Theo (Sarah L) 1 emp Bibb Mfg Co h 101 Cabaniss Stevenson Turen B (Mittie M) 2 carrier P O h Cabaniss Stewart (see also Stuart) Stewart Amanda (c) lndrs h 118 Glen Stewart Annie (c) r 411 (311) Waterville rd Stewart Annie L (Mrs J P) r 1723 3d Stewart Benj (c; Dorothy) r 231 5th (V) Stewart Benj C (Ethel S) 2 (o) sec-treas Stewart Oil Co h 210 Corbin (V) Stewart Bert tr dr Moffett Transit Lines res Eastman Ga Stewart Bertha (wid F D) r 849 Winton Stewart Bertha (c) cook John Burgess r 418 Monroe Stewart Betty student r 712 Hillyer Stewart Chapel AME Church (e) M A Foun- tain pastor 565 Cotton Stewart Chas A (Ella F) 2 (o) sec-treas Stewart & Goette Elec Co h 849 Winton Stewart Charlie (Mrs J H) marker Crescent Ldry r 712 2d Stewart Charlie M (c) maid H L Bramlett r 110 (109) Mitchell Stewart Cornelia (c) 2 maid J F Osborne r 101 (728) Wings al Stewart David (c; Mary) 1 lab So Crate & Veneer Co r 325 Madison Stewart David (c; Mary) ydmn P T Anderson r Clinton rd extd (EM) Stewart Dicy (c) cook Mrs Avey Barnes h 104 (17) New St al Stewart Dorothy (c) maid r 231 5th (V) Stewart Edw (c) barber J W Peeks r 1021 3d Stewart Edw (c; Egertha) 2 glazier Central S&D Co h 411 (311) Waterville rd Stewart Edw D (c; Augusta) h 250 Powell Stewart Egertha (C) emp C of Ga Ry r 411 (311) Waterville rd Stewart Eliz home economist Ga Power Co r 119 Corbin (V) Stewart Eliz B ofc sec F W Farmer r 119 Cor- bin (V) Stewart Elrod r 1063 Elm Stewart Emma (wid E F) r 107 Carlisle Stewart Emmett E (Lillie) 5 firemn Truck Co No 2 h 215 Ninadell dr Stewart Ethel (c) lndrs r 118 Glen Stewart Etta (c) r 168 Astor Stewart Eula (c) 4 dom h 316 Burnett Stewart Felton (Lettie) 2 twister Bibb Mfg Co h 110 Kennington al Stewart Frank (Pauline) 1 carp r 103 De Sota Pi Stewart Fred D (Mae) 1 sta supt Atlantic Re- fining Co h 322 Coleman Stewart Geo (c; Hattie) lab Willingham S&D Co r RD 6 Stewart Geo (c; Arlie) plmbr h 104 Park (U) Stewart Goette Electric Co F W Goette Jr pres, C A Stewart sec-treas, contrs 558 2d Stewart Harry C (Gladys) 3 (o) pres Stewart Oil Co h 712 Hillyer Stewart Harry C Jr student r 712 Hillyer Stewart Henry S (Mattie E) 3 emp Dixie Dairies h 102 Duncan Stewart Horace (c) lab Idle Hour Club r 134 1st (V) Stewart Ibbie (Mrs W C) emp Happ Bros Co h 1063 Elm Stewart J D Edw (Marion) 2 hlpr h 101 (104) Pineview Stewart J Frank (Virginia) slsmn Macon Gas Co r 103 De So r 103 De Sota pi Stewart J Herman (Charlie) 2 r 712 2d Stewart J Mark (Bessie) carp r 100 Troup Stewart J Vester (Rosa L) patrolmn CPD h 2721 Houston Stewart James T (Maude) 3 steel wkr Taylor Iron Wks h 118 Cedar (SM) Stewart James T Jr (Hattie E) 1 restr 623 3d r 410 Cleveland (SM) Stewart Jessie O (Lillie F) h 125 Buford pi (V) Stewart Jewell (Mrs L H) emp Bibb Mfg Co r 1041 1st Stewart John H (c; Charlie M) 2 lab Barfield Feed Mills r 110 (109) Mitchell Stewart John P farmer Hephzibah Orphanage r 3201 Forsyth rd Stewart L Richmond (Sallie) 2 solr Elec Dry Cleaning Co h 915 Walnut apt 4 Stewart Leo H (Estelle) atndt Hightower's Serv Sta h 100 Ellis (SM) 448 Baldwin's and Telegraph's Stewart Leonard H (Jewel) 2 twister Bibb Stinson Chas doffer Bibb Mfg Co r 106 Emer- Mfg Co b 1041 1st ald Stewart Louis student r 1354 Edgewood Stinson Clarence (c) lab City St Dept r 343 _ Stewart Louise J (wid G T) 1 b 119 Corbin (V) Douglas (V) Stewart Lucrle (c) r 232 Norris Stinson Edw (c) 1 hlpr Ga Power Co h 145 Hill Stewart Martha D r 139 Lamont (LCHts) Stinson Ethel Mrs 1 r 253 Broadway Stewart Mary (c) dom W G Smith r Clinton Stinson Lewis S (Willie) 2 h 103 Clinton rd extd (EM) Stinson Louise r 106 Emerald Stewart Mary B (c) (Broadway Lunch) r 320 Stinson Lula (c) r 653 Elm St la Ward (V) Stinson Mattie (c) h 118 (552) Magnolia la Stewart Matthew (c) r 1016 Main (EM) Stinson Mattie (c) maid W L Parker r 626 Stewart Maude (c) 5 cook Julia L Anderson h Monroe 418 Monroe (V) Stinson Norwood (c) delmn Chichester's Tat- Stewart Millie W (wid Benj) r 210 Corbin (V) nall Sq Drug Store r 1020 College dr _>-Stewart Minnie (wid J T) h 119 Corbin (V) Stinson Rebecca J (wid N W) r 107 Brookdale Stewart Moses (c) cook Hotel Lanier r 325 (B) Maple Stinson Robt B wtchmn h 107 Brookdale (B) Stewart Nancy asst tchr Wesleyan Col r 320 Stinson Roland (c) r 145 Hill Orange Stinson Wm (c) r 343 Douglas (V) Stewart Nathan (c; Mary B) waiter Mary B Stinson Wm (c; Mattie) 1 h 626 Monroe (V) Stewart r 320 Ward (V) Stinson Willie (Mrs L S) tex wkr r 103 Clinton Stewart Oil Co H C Stewart pres, T J Stewart Stinsonville AME Church (c) W T Stevens pas- vp, B G Stewart sec-treas serv stas 501 Mul- tor 116 Main (S) berry and 919 2d Stinsonville Baptist Church (c) C L Reese Stewart Pearly (c) maid r 134 1st (V) pastor 107 Grant (S) Stewart Percy (c; Vinnie) lab h 854 Willow Stirewalt Mildred ofc wkr Continental Pack- Stewart Prent (c) 3 cook h 263 5th (V) ing Corp r 303 (205) Chatham Stewart Randolph (c; Ethel) h 265 (665) Hall Stirwalt Vernon P (Mae) supt Continental (EM) Packing Corp h 303 (205) Chatham Stewart Richd C ((c) (o) barber 117 Douglas Stitt C Wm (Carolina) 4 pastor East Side Bap- (V) h 147 Lincoln (V) tist Ch h 250 Church (EM) Stewart Robt A (Minnie) 2 (o) elk C of Ga Stitt Paul J elk Exch Pharm r 250 Church Ry h 109 Madden (EM) Stewart Rosa L (Mrs J V) opr Happ Bros Co Stivarius Florence (wid H H) r 200 Hill Crest r 2721 Houston Stivarius Fred W (Louise) bkpr Burden-Smith Stewart Ruth (Mrs W C) opr Happ Bros Co r & Co h 200 Hill Crest 1063 Elm Stoball Eloise (wid W E) hostess Macon's Stewart Tex (Nellie) 1 r 179 Gardner (PM) Woman's Club h 200 Baconsfield Stewart Theo R (Fannie) emp Willingham Stocks Peter C (M Annie) (o) (Palm Barber Mills h 1128 College dr Shop) h 171 Magnolia Stewart Thos J (Octavia B) (o) sec-treas Bur- Stocks Wm S (c) tailor 429% Cotton h do den Smith & Co Inc v-p Stewart Oil Co h Stokes Annie (c) r 211 Middle (V) 920 Vineville Stokes Augustus (c) porter Macon Hosp h 235 Stewart W Clifford (Ruth) r 1063 Elm Jefferson Stewart W Edw r 139 Lamont (LCHts) Stokes Bertha (c) h 105 (305) Wings al Stewart W Kenneth (Rebecca) 4 (o) phys h Stokes C Baxter (Margt D) 1 bus opr Grey- 139 Lamont (LCHts) hound Bus Line h 321 1st Stewart Walker W (Willie) 4 emp Goldgar Stokes C Julian slsmn Swift & Co r Capitol Fum Co h 111 School Hotel Stewart Willard P caddie Idle Hour Club r 668 TAYLOR IRON WORKS & SUPPLY CO, C A Hawthorne Taylor Edw (c; Janie) carp G G Hardeman Co McAlister Pres, J W Fulghum & W P Fleming Vps, F E Adams Sec-Treas, 1014 Broad- h 227 Morgan Taylor Edw (c; Jessie) 5 lab Procter & Gamble wayL--Tel 102 Taylor J A (Maude) r 727 Orange Mfg Co h 307 (308) Campbell (SM) Taylor J C (c) lab r 106 Cowan Taylor Edw F (c) instr Central City Col r 1035 Clinton rd Taylor J Walton atndt Whitehead Serv Sta r 2402 Forsyth rd Taylor Edw F lawyer 403 Macon Sav Bk bldg Taylor James (c; Clemmie) 1 emp Macon Iron r Terminal Hotel & Paper Stock Co h 4 3d St la Taylor Effie (wid W C) 2 tex wkr r 250 Hy- Taylor James (c; Azaline) lab h 104 Antioch rd drolia Taylor Eliz (c) r 109 Bostic la Taylor James (c; Caroline) 2 lab C of Ga Ry h 410 (501) Prince (SM) Taylor Eliz Mrs r 109 Cedar (SM) Taylor James (c) 1 ldry wkr Independent Ldry Taylor Eloise (wid C E) r 1416 Oglethorpe r 201 Bowman Taylor Elsie (c) Indrs r 125 Northern Taylor Jemison W (Alma C) farmer h 2402 Taylor Emanuel (c) r 124 (21) Tinsley la Taylor Emory F (c) r 400 Ward (V) Forsyth rd Taylor Jennie (c) cook O H Weaver Taylor Ernest (c; Mary) hlpr Lee & Smith Taylor Jerry (c) 4 r 115 (647) Hicks al Mule Co r 58 Spring Taylor Jesse J (Martha) 2 carp h 114 Crisp Taylor Ernest (c) r 307 (308) Campbell (SM) Taylor Jessie (c) cook Annie L Battle r 307 Taylor Eug (c; Annie A) 1 h 16 Gustin (308) Campbell (SM) Taylor Eva S (wid W A) (o) h 712 Vineville Taylor Job E (Ruth) slsmn Burden Smith & TAYLOR EZEKIEL S (o) (Taylor Transfer Co r 106 Delaware Co), h 425 Vineville--Tel 6033 Taylor John (c; Bertha) 6 h 142 Carling Taylor Fannie (c) r 1424 Broadway Taylor John (c) emp Nu-Ideal Clo Sto r 366 Taylor Fannie Mrs r 252 Columbus (365) Hawthorne Taylor Fannie Mrs r 525 Vineville Taylor John (c; Clara) 3 emp Willingham Mills Taylor Fannie (c) elk County Relief Admn r h 507 Pio Nono 209 3d (V) Taylor John (Cleo) tex wkr Payne Mill h 176 Taylor Fannie (wid L M) furn rms 860 Mul- Gardner (PM) berry h 864 do apt IB Taylor Fannie (c) Indrs h 21 Buckner al Taylor John C (c) lab So Crate & Veneer Co r 723 (612) Prince (SM) Taylor Frances (c) 1 r 136 Woodliff Taylor John M (c; Mary J) (o) emp So Ry h Taylor Frances V r 318 Hydrolia 101 Pringle Taylor Frank (Pearl J) (o) (Taylor Furn Co) Taylor John O (Georgia 6 speeder hd Bibb Mfg h 709 College Co h 14 Bibb Taylor Frank (c) r 360 Ash Taylor Johnnie M (c) 1 maid Magruder An- Taylor Frank (c; Lillar) emp C of Ga Ry h drews r 1 Sparks al 765 Ash Taylor Jos (c) jan h 125 Northern Taylor Frank (c; Fannie) 1 emp Standard Tool Taylor Jos (c; Fannie) porter Sears Roebuck & Handle Co h 108 (160) DeBorde (SM) h 155 Hill Taylor Frank Jr elk Taylor Furn Co r 709 Taylor Josephine (c) maid r 610 (19) Gilmer College Taylor Joshua (c; Lillian) 5 h 613 (16) Gilmer Taylor Furniture Co (Frank Taylor) 159-63 Taylor Julia (c) maid Celeste Cunningham r Cotton 107 (1620) Johnson's al Taylor Geo W (c; Mary) (o) hlpr C of Ga Ry h 429 e 2d (EM) Taylor Georgia (c) h 211 Roosevelt () Taylor Georgia (c dom h 210 (712) Plummers al Taylor Georgia (c) maid B P O Neal Jr h 115 Taylor Julius (c) emp Jeffreys-McElrath Mfg Co Taylor Kyne (c; Annie M) tr dr C-M-P Drug Co h 809 Fort Hill (19) Wise (V) Taylor Leah (c) h 151 (426) Forsyth la Taylor Geraldine (c) emp Procter & Gamble Taylor Lemon (c; Mary) farmer h 100 Sheri- Mfg Co r 416 Hazel dan (V) 456 Baldwin's and Telegraph's Taylor Leo (c) emp Independent Ldry Co r 307 (308) Campbell (SM) Taylor Lillie (c) maid H C Fowler r 365 Chestnut , _ . Taylor Lillie N (c) tchr Pleasant Hill Sch r 325 3d (V) Taylor Lois opr Happ Bros Co r 448 Vine Taylor Lollie dept mgr Burden Smith & Co r 514 Orange Taylor Lucille (c) h 162 (166) Plummers al Taylor Luther (Lizzie) r 252 Broadway Taylor Maggie (c) cook J A Lowrey r 602 Ross Taylor Mamie (c) 2 cook r 130 (242) Railroad Taylor Marcus T (Arilla) (o) mgr W H Cutter Novelty Shop h 602 Main (EM) Taylor Margt r 131 Oakland Taylor Margt B (wid E S) 1 h 105 Pierce (V) Taylor Margt B student r 105 Pierce (V) Taylor Martha (c) h 130 (181) Williams la Taylor Martha tchr Lanier High Sch for Girls res Rivoli Ga . ,,,,,, _ , Taylor Martha R Mrs 2 elk FERA h 205 Oak Haven Taylor Mary (c) dom A J Smith Taylor Mary (c) dom Eulalia Moore Taylor Mary (c) r 3 (3666) Duffey's al Taylor Mary L (wid J A) h 301 Center (EM) Taylor Ruby Mrs matron Methodist Orphans Home r do . , . ,_ Taylor Ruby L (Vineville av Kindergarten) r 425 Vineville (V) Taylor Rufus H (Leone) 1 mech Ga Auto Co h 131 Oakland Taylor Rufus L (c; Lillie (o) h 325 3d (V) Taylor Ruth (c) prin J A Brooks Sch r 400 Ward (V) Taylor Ruth tchr Winship Sch r 318 Napier Taylor S Henry (Winnie) 1 h 1131 College dr Taylor Sallie sch tchr r 751 College Taylor Sami A (c; Polly) (o) h 810 Fort Hill Taylor Sami L (Mattie) (o) carp h 984 (979) Montpelier Taylor Sara H (wid O W) r 103 Ridge (I) Taylor Sarah S r 425 Vineville (V) Taylor Sicey (c; Rosa L) porter Douglass The- atre h 107 (956) Ocmulgee la Taylor Sidney L (Agnes C) (o) engr C of Ga Ry h 767 Pine Taylor Susie (wid J D) r 108 Kemper Taylor Susie (c) (o) h 400 Ward (V) Taylor Susie (c) dom Mrs M F Cole r 238 1st (V) Taylor Theo (c; Corine) porter Tank Car Serv Sta h 524 Hawthorne Taylor Mathis (c) blksmth r 151 (426) For- Taylor Thos (c) h 366 (365) Hawthorne syth la Taylor Thos (c; Evelyn) hlpr Chapman's Garage Taylor Mattie D (c; Cora L) 2 r 226 (125) r 313 Walnut Grant (V) . Taylor Mattie E (wid J E (o) h 318 Napier Taylor Maude (Mrs J A) cash Nat L&A Ins TAYLOR TRANSFER CO (E S Taylor), 488 Plum--Tel 388 (See top lines and page 100) Taylor Turner (Louella) carp Sterchi's r 9 Ron Co r 727 Orange Taylor Mildred emp Adams Mfg Co r 134 Rem- bert , Taylor Mildred tex wkr Willingham Mills r 3 Home pi Taylor Taylor V Lanier Viola (c) r 2402 Forsyth rd (o) cook h 426 (425) 3<* (V) Taylor Viola (c) 1 (o) smstrs h 111 Penn (V) Randolph pi Taylor W G greenskpr Idle Hour Club r RD 1 Taylor Minnie (c) 1 h 227 Linden Taylor W Harry (Virginia) 1 tr dr Nat Biscuit Taylor Minnie J sten PO r 134 Winship Co h 141 Lamont (LCHts) Taylor Minnie L r 257 High Taylor Walter L (Gussie) pntr r 38 (102) Ran- Taylor Moina C sten Conn Mut Life Ins Co r dolph pi K. 2402 Forsyth rd Taylor Watt (c; Irene) r 602 Ross Taylor Nancy E (wid J W) h 274 Columbus Taylor Wm r 114 Crisp Taylor Nellie (c) r 151 (426) Forsyth la Taylor Wm (c) r 705 (706) Elbert Taylor Neva nurse Middle Ga Hosp r 860 Pine Taylor Wm (c) r 1 Sparks al Taylor Nina slswn S H Kress Co r 516 Orange Taylor Wm (c; Annie) butler h 468 Chestnut Taylor Odessa (c) 2 r 552 Hammond Taylor Wm (c) delmn Jacob's Pharm r 209 Taylor Ollie L (c) emp Maxwell Bros h 705 (706) Elbert Taylor Omer L (Zuma) 3 tex wkr Bibb Mfg Co h 11 Lake City (EM) Taylor Otis (c) r 460 Hazel Taylor Pearl (c) 1 h 271 North Taylor (Wm (c) lab Idle Hour Nurseries r RD 1 Taylor Wm A (Lillie M) 1 blrmkr C of Ga Ry h 207 Beech , ,, Taylor Wm B (c r 307 (308) Campbell (SM) Taylor Wm M (c; Ida) emp Macon Cooperage Taylor Pearly M (c) cook E D Burnett Co r 165 (317) Nussbaum Taylor-Quickel Engineering Co A F Quickel Taylor Wm T (Katie) 1 tex wkr Atlantic Cot- pres Mrs Nevada Quickel sec-treas 308 2d ton Mills h 112 (103) Pinkerton Taylor Raymond (c) porter Hayes Barber Shop Taylor Wm W (Jean) bkpr Cotton States Fer- r 221 5th (V) tilizer Co r 533 Orange apt 5 Taylor Richd (c) emp Macon Cooperage Co r Taylor Willis A (Ethel) 2 steam shovel opr 705 (706) Elbert Taylor Robt (c) delmn Vineville Fish Co r 7 Bear's si Taylor Robt (c; Pearl M) lab h 122 (3) Spring la Bibb Co h 825 Orange Taylor Wynona tex wkr Bibb Mfg Co r 301 Center (EM) Taylor Zetra (c) r 201 Bowman Taylor Zuma (Mrs O L) tex wkr Bibb Mfg Co Taylor Robt (c; Fannie) opr Bibb Mfg Co 668 Hawthorne Taylor Robt G sta atndt Power Oil Co Inc r 11 Lake City (EM) Teague Wm (c; Alma) lab C of Ga Ry h 1315 Broadway 175 English Teal Dempie B (o) h 743 Ridge (I) Taylor Robt J (Katie) (o) investments 201 Ma Teal Francis E ofc emp Bibb Mfg Co r 743 con Sav Bk Bldg h 205 Vineville (V) Ridge (I) , Taylor Rosa prin Whittle Sch r 227 Bond Teasley Joel H student r 103 Hartley (CP) Taylor Rosa L (c) r 210 Woodliff Teasley Oscar A (Alimae) elk So Ry h 215 Taylor Rosa L (c) emp Snow's Ldry r 1343 Edna pi (LCHts) Broadway Tebeau John A (Claude) (Ard Cash Gro) h 153 Taylor Rosa L (c) maid r 107 (956) Ocmul- Boulevard (NH) gee la Teel Lewis sign pntr 30414 3d h do 1936 Macon City Directory 457 Telfair Edna (c) cook G E Snellgrove r 906 Pio Nono Telfair Peter (c; Edna) h 906 Pio Nono Temple Beth Israel I E Marcuson rabbi 870 Cherry Temple Chas (c) shoe shiner J W Peeks Temple Fannie (c) emp Mt de Sales Academy h 616 Washington Temple Gus (c; Lula) 1 lab h 956 (939) Mont- pelier Temple Helen (c) cook W R Bridges r 500 (501) Crisp Temple Henry r 111 Forest (B) Temple Herschel (c) lab r 403 (708) Hender- son (SM) Temple Jeff (c; Jean) 2 lab h 619 Hazel Temple Jesse (c; Helen) 2 emp Cherokee Brick Co h 500 (501) Crisp Temple Thamer E (Mable) 1 condr C of Ga Ry r 617 Pine Temple Walter P (Anna) bldr r 617 Pine Temple Walter P Jr (o) condr C of Ga Ry h 617 Pine Tennie Carl (c; Mae E) h 320 (318) Patterson Tennille Estelle tchr Gresham Sch h 576 Col- lege Tennyson Jeff (c; Corine) r 511 Hazel Terminal Hotel H G Callaway mgr 301 Cherry Terminal Station 5th at Cherry Terminal Station Baggage Room S D Stainton in chge Terminal Sta Terminal Ticket Office R N Bateman agt Ter- minal Sta Terrace Apartments 864 Mulberry Terrell Annie (c) Indrs h 101 (1) Opera Hse al Terrell Auto Electric Co (J H Terrell) 607 3d Terrell Jack (c; Hattie) 2 (o) emp C of Ga Ry h 806 (700) Crisp Terrell Jack H (Hath H) 2 (Terrell Auto Elec Co) h 138 Summit Terrill Arth L (Mollie S) 1 (O) trav slsmn h 175 North (NH) Terrill Levi M (c; Jewell) 3 pastor Tremont Temple Baptist Ch h 517 Calhoun Terrill Veda elk County Court of Ordinary r 175 North Terry Alice (c) 1 r 133 5th (V) Terry Allie B (wid HE) 2 tex wkr Bibb Mfg Co h 930 Walnut Terry Arth (c; Lillie) hlpr Chambers Lbr Co h 136 Pecan Terry Ella M (c) r 122 Edgewood Terry Frank (c) jan So Bell Tel Co r 1252 2d Terry Ida (wid W T) 3 h 253 Oakland Terry John stock kpr McCommon Bros r 930 Walnut Terry Mack I (Carrie F) 2 utilitymn City Bd of Water Comrs h 126 Cole Terry Margt slswn McCommon Bros r 930 Walnut Terry Marion P (Jessie) agt Life & Casualty Ins Co r 107 Crisp Terry Mary student r 930 Walnut Terry P Cameron (Virginia R) agt Met Life Ins Co r 141 Wesleyan dr RD 2 Terry Paul (c) h 801 Charles Terry Thos (c; Mary) lab h 1252 2d TEXAS CO THE, Jack Cutler agt, office and plant 770 Division--Tel 200 Texas Co The, serv stations 500 Forsyth, 280 Main (EM) and 770 2d Thackston James A (Myrtle B) (O) auto mech h 872 Hillyer Thackston Myrtle B (Mrs J A) sten Bibb Mfg Co r 872 Hillyer Thames Carolyn E sten Burden-Smith & Co r 401 Duncan Thames Earl (Esmeelee) 2 hlpr h 158 Crisp Thames Geo W elk Rogers Inc res Walden Ga Thames James E (West) mgr Lucky Strike Bowling Alleys r 423 Johnson Thames James M (Lois) br mgr Rogers Inc h 905% Orange Thames Joel E sta mgr Ingleside Oil Co r 1903 Vineville (V) Thames Jos C (Fronie B) bkpr Central Ga Bak- ing Co h 1903 Vineville (V) Thames Lelia M (wid R E) elk C-M-P Drug Co h 167 Magnolia Thames Louise J (Mrs W F Jr) ofc sec James & Kingman Lbr Co r 340 Vineville (V) Thames Mathew A (Mabel) supt h 612 Holt Thames Ruby (Mrs W M) slswn Darling Shops r 114 Madden Thames Ruth L sten Jones, Johnston, Russell & Sparks r 167 Magnolia Thames Thos J (Mary) carp h 313 Morgan Thames Walter F (Eliz) 1 bldg contr 401 Dun- can h do Thames Walter F Jr (Louise J) mgr James & Kingman Lbr Co r 340 Vineville Thames Wilbur M (Ruby) sten C of Ga Ry h 114 Madden Tharp Chas B (Mary E) 1 asst accnt Ga Power Co h 474 Orange apt 4 Tharp Evelyn student r 439 Duncan Tharpe Annie (c) cook J C Evans Tharpe Anthony (c; Eleanor) h 931 Fort Hill Tharpe Augustus (c) lab F S Royster Guano Co Tharpe Beatrice (c) emp Independent Ldry Co Tharpe Benj C (Louise V) 1 elk PO h 170 Laurel Tharpe Bessie (o) h 102 (3) Balkcom Tharpe Cicero (Odessa) 1 emp C of Ga Ry h 439 Duncan Tharpe Chas (c) r 414 (422) Elizabeth (SM) Tharpe Claire E student r 659 Ridge (I) Tharpe Cordelia (c) r 213 Green Tharpe E Jefferson (Ferris) (o) elk P O h 105 (4) Balkcom Tharpe Early (c) lab r 236 (221) Moore la Tharpe Edgar J Jr student r 105 (4) Balkcom Tharpe Felix E student r 308 Mikado THARPE GEO H (Lula M> (o) (Strong Shoe Co) h $01 Vista cir >--tel 1805 Tharpe Gordon recreational dir Macon Trans- ient Bur r 201 Vista cir (I) Tharpe Homer L elk Moore & Boone r 106 Montpelier Tharpe Horace (c) (Mamie) h 508 (605) Henrietta (SM) Tharpe James (c; Mattie M) jan Murphy Tay- lor & Ellis h 668 Douglas (V) Tharpe Jeanette (wid W D) r 215 Jeff Davis (SM) Tharpe Kate Mrs r 1010 Hazel Tharpe Lawrence A elk Melton Gro Co r 106 Montpelier Tharpe Lee H (Mae) 1 (o) signal formn C of Ga Ry h 308 Mikado Tharpe Lillie (c) r 242 Woodliff Tharpe Louise Mrs 1 h 970 Montpelier Tharpe Louise H (wid M C) (o) h 113 Ameri- can blvd Tharpe Luddie (c) chauf r 349 Middle (V) Tharpe Lynwood elk Moore & Broom r 106 Montpelier Tharpe Maggie (c) emp Snows Ldry r 414 (422) Elizabeth (SM) Tharpe Mary (c) r 124 (490) Virgin (V) Tharpe Mary (c) Indrs Macon Hosp r 971 Hazel Tharpe Mary (c) maid r 220 3d (V) Tharpe Mary student r 106 Montpelier Tharpe Mattie (c) cook V H Roberts Tharpe Pearl (c) h 140 Tharpe 458 Baldwin's and Telegraph's Tharpe R Kennedy sta atndt Gulf Refining Co r 659 Ridge (I) Tharpe Raymond L (Rosalyn) 1 fnshr Muecke ' & Sons Co Inc h 960 1st Tharpe Robt (c; Fannie) r 717 (611) Prince (SM) Tharpe Robt A (Emma) 1 (o) slsmn Murphy Taylor & Ellis h 659 Ridge (I) Tharpe Sampson (c; Mattie) 3 porter Cudahy Pkg Co h 414 (222) Elizabeth (SM) Tharpe Sarah (c) cook h 327 Robinson rd Tharpe Thos S Jr (Frances S) (o) slsmn Taylor Thomas Annie M cook r 122 Bartletts la Thomas Archie (c) cook G A Hanse r 1233 3d Thomas Archie (c) Indrs Crescent Ldry r 317 Hammond Thomas Arlene (c) cook R H Hillman Thomas Arth (c) lab Millirons Plmbg & Heat- ing Co r 227 Monroe Thomas Auburn R (Essie M) clo presser Happ Bros Co h 304 Mikado Thomas Austin (c; Elnora) 1 lab So Crate & Veneer Co h 118 Powell Thomas B F (c) delmn Fishers Drug Store r Iron Wks h 564 Boulevard (NH) Tharpe Tommie W (wid O R) r 712 Main (EM) Tharpe W Tully (Verna) 1 (o) h 102 Corbin (V) Tharpe Wm (c; Mary) 1 emp Dannenbergs r 220 3d (V) Tharpe Wm (c) ptnr h 582 Monroe (V) Tharpe Wm H (Daisy) emp Cotton States 315 Ernest Thomas Barney slsmn Dannenbergs r 410 Winship Thomas Barney M (Willie) 1 emp C of Ga Ry h 521 Main (EM) Thomas Barton (c; Mattie) 2 (o) h 9 Bertha- dale dr (V) Thomas Beatrice (c) 8 h 507 (474) Alabama Fertilizer Co h 106 Montpelier (SM) Tharpe Wyndal C student r 308 Mikado Thomas Beatrice (c) r 315 Ernest Theiss Conrad A (o) sec-treas Southland Thomas Beauty (c) cook J W Graham Coffee Co h 105 Ponce de Leon (SM) Thomas Benj (c; Dora B) 7 h 122 Bartletts la Theiss Marion pkr Southland Coffee Co r 105 Thomas Benj (c; Rosa) 3 h 161 (8) Phillips la Ponce de Leon Thomas Benj T (c; Gertrude) hlpr r 74 Ernest Therman Beulah (c) Indrs r 110 Roberts (U) Thomas Bernice slswn S H Kress Co r 326 Therman Thos (c; Susie M) 1 emp C of Ga Ry Linden h 111 Neel (U) Thomas Berry L (Josephine) 1 tex wkr South- Theus Chas (Tommie) 2 r 459 Elm land Knitting Mills h 410 Winship Theus Dollie M emp Bibb Mfg Co r 459 Elm Thomas Bertha (c) h 18 (431) Elbert la Theus Marvin (Willie C) 3 hlpr h 459 Elm Thomas Bobbie (c) student r 507 (474) Ala- Theus Woodrow r 459 Elm bama (SM) Thigpen Burch C (Marie) 1 bkpr Jacob Hirsch Thomas Bonnie L slsmn Dannenbergs r 410 r 716 Mulberry Winship Thigpen Corbett H student r 716 Mulberry Thomas Bosie (c; Rosa) 4 lab h 317 Dure (U) Thigpen Emmett B (Mary) 3 emp C of Ga Ry Thomas Carl E (c; Lillie) emp Willingham h 300 Villa (B) Mills h 128 (r) Green (V) Thigpen Guy A (Willie V) 3 waiter Spillers Thomas Carrie (c) 4 r 202 Coles al Pestr r 1777 3d Thomas Clarence A (Mvrtice) 1 tex wkr Payne Thigpen Lillian student r 300 Villa (B) Mill h 38 Brigham (PM) Thigpen Mary (Mrs E B) emp Happ Bros Co Thomas Claudia (c) h 102 (2) Bartlett r 300 Villa (B) Thigpen Nora L Mrs 3 r 242 Washington Thigpen Wm G (Alice) 1 elk Amerdson Sand- wich Shop r 656 New Third Street Properties Inc J C Murphey pres Eden Taylor Jr v-p P J Doster sec-treas 470 Thomas Cletia r 119 Daley Thomas Clifford (c) r 122 New Thomas Clifford (c) emp S Saloom & Sons r 1303 1st Thomas Clinton C (Eliz) 2 emp So Ry h 209 Jeff Davis Cherry Thistlewood Geo H msngr W U Teleg Co r 558 Arch Thistlewood Geo S (Rosa L) 2 slsmn J H Du- Bose & Son h 558 Arch Thomas Clyde A (Lucy A) carp h 164 Lamont (LCHtS) Thomas Chas (c; Leila) 7 r 109 Brooklyn (S) Thomas Chas (c) 2 hlpr h 300 (164) Roye Thomas Chas (c; Frances) 3 hlpr Bibb Mfg Thistlewood Marguerite student r 558 Arch Co h 509 e 1st (EM) Thomas A John (c; Eva) tr dr r 1642 1st Thomas Chas (c; Mary) 1 tr dr Toole Furn Co Thomas A Mansel tr dr Jarrett Paint & Glass r 126 (3) Cedar (U) Co r 209 Jeff Davis Thomas Chas G r 665 Ash Thomas Adam (c; Louise) 2 tr dr Jacob Hirsh Thomas Chas Jr (c) r 300 (164) Roye h 817 3d Thomas Danl (c) lab h 13 Gas House al Thomas Albert (c) ydmn R T Birdsey Thomas Della (c) cook Edna R Nelson r 226 Thomas Alex (c; Jessie) 3 tr dr h 120 (402) Calhoun Middle la Thomas Dollie M (c) case aide County Relief Thomas Alf (c; Ella) lab Atlantic Ice & Coal Co h 706 (618) Prince (SM) Thomas Allie (c) Indrs r 912 Washington Thomas Almeta (c) h 1022 Colemans la Thomas Alonzo (c; Beulah) lab h 1 Buckner al Thomas Andrew (c; Geneva) 1 lab So Crate & Veneer Co h 120 Cowan Thomas Anna (c) 7 h 112 Reid Admn r 505 Forsyth Thomas Donald F (c; Estella) 2 r 162 Lincoln (V) Thomas Doris (c) r 507 (474) Alabama (SM) Thomas Dorothy V student r 108 Courtland Thomas Early (c; Virginia) 2 emp Adams Mfg Co h 336 (556) 2d (U) Thomas Anne (c) h 100 (310) Craft (V) Thomas Easter (c) maid r 416 Glen Thomas Annie (c) maid C M White Thomas Eddie R (c) student r 507 (474) Ala- Thomas Annie (c) 1 r 110 Bay bama (SM) Thomas Annie (c) maid J H Pittman r 168 Telfair Thomas Edgar (c; Eldora) (o) agt Pilgrim Health Life Ins Co h 162 Lincoln (V) Thomas Annie (Mrs J D) marker Crescent Ldry r 80 Wilder (SM) Thomas Edgar (c) delmn Quality Food Store r 1 Spring 1935 Macon City Directory 459 Thomas Edmond (c) emp C of Ga Ry r 176 Thomas Gertrude (c) emp Bibb Mfg Co h 458 College Hawthorne Thomas Edw (c; Cordie) 3 h 5 Plant al Thomas Gilford (c; Julia) 1 (o) lab h 276 2d Thomas Edw (c) h 107 Woodliff (V) Thomas Edw (c) emp Bibb Mfg Co r 123 Thomas Glenn r Y M C A Washington Thomas Gus (Cozy Corner Cafe) r Hotel Macon Thomas Edw (c; Mary) 2 trkr C of Ga Ry h Thomas Gus (c; Celia) lab h 400 (8) Crisp 452 Bay Thomas H H r Y M C A Thomas Eliz r 326 Linden Thomas Hattie (c) cook W W Hartness Thomas Eliz supv intake FERA r 617 Orange Thomas Hattie (c) 2 h 15 Franklin St la Thomas Eliose (c) r 1 Spring Thomas Hazel waitress Plaza Cafe r 112 Thomas Ella (c) cook r 101 4th (B) Lamar Thomas Ellen (c) h 5 Rose la Thomas Helene Mrs r 912 Walnut Thomas Elma (c) student r 123 Washington Thomas Henrietta (c) r 604 4th (WH) Thomas Elmo (c) r 317 Dure (U) Thomas Henry (c; Annie) delmn Cherokee Thomas Eloise (c) r 507 (474) Alabama (SM) Pharm h 209 Cedar (U) Thomas Eloise (c) r 7 Rose la Thomas Henry (c; Irene) 1 lab So Crate & Thomas Elsie student r 326 Linden Veneer Co r 904 Hazel Thomas Emily (c) cook J M Byrd Thomas Henry (c; Mary) 2 lab h 7 Park Hotel Thomas Emily (c) 3 (o) maid R P Watson al h 17 Parker (V) Thomas Henry (c; Julia S) lab Willingham Thomas Emma (c) r 152 Bright al S&D Co h 1 Spring Thomas Emma (c) lndrs h 302 (202) 2d (U) Thomas Hester (c) 2 h 115 (300) Craft Thomas Essie (c) maid h 352 Madison (V) Thomas Hezekiah (c; Lucile) porter h 74 Thomas Estelle (c) sausage linker T & T Pkg Ernest Co Thomas Horace (c) r 142 (262) Forsyth la Thomas Estelle tchr Alex Sch No 2 r RD 3 Thomas Hosea (c) r 540 Flanders Thomas Ethel (c) maid Terminal Hotel h 1330 Thomas Hugh G (Ida) (o) mgr The Clinic 1st h 219 Vista cir (I) Thomas Ethel M (c) maid r 5 Rose la Thomas Ida B (Mrs H G) teller City Bk & Thomas Eva (c) 1 maid J P Boone r 104 Trust Co r 219 Vista cir (I) Woodliff Thomas Ida M (c) maid M L Stern Thomas Evelyn (Mrs Frank) opr Happ Bros Thomas Irene (c) h 714 Maynard Co r 276 Ell (SM) Thomas Isolene (c) cook W O McNair r Ayers Thomas Evelyn (c) maid Madison Stevens rd Thomas Evia (c) maid L P Burney r 5 Woodliff Thomas Ivory (c; Geneva) 2 h 112 (156) De Thomas Ezekiel S (Vallie) h 105 Dixie Borde (SM) Thomas Fannie (c) r 449 Coles al Thomas J Adrian (Susie A) 1 slsmn Goodrich Thomas Fannie (c) r 5 Murray al Silvertown Stores r 117 Culver (V) Thomas Fannie (c) h 10 (104) Steins al Thomas J C (Lillian) student r 511 Napier Thomas Fannie (c) cook R L Wilson h 302 Thomas J Leon mgr Piggly Wiggly r 112 (442) Industrial Home rd Pierce (V) Thomas Fannie (c) maid r 115 (151) Jones Thomas J Y (c) porter C H Douglas Jr r 105 St la Empire (V) Thomas Fannie (c) maid A E Greer r 261 Thomas Jack R (Hazel C) slsmn Dannenbergs Woodliff h 112 Lamar (V) Thomas Fannie H (wid J A) 1 (o) h 117 Culver Thomas James (c) r 108 (131) Elizabeth (SM) (V) Thomas James (c; Daisy) h 232 Norris Thomas Felix (c; Mary) 6 pastor St Marys Thomas James (c; Eliz) 3 lab C of Ga Ry h 305 Baptist Ch h 152 Lincoln (V) Gilmer Thomas Flossie M (c) emp Independent Ldry Thomas James (c; Lucinda) porter J H Sprat- Co r 164 5th ling h 10 Berthadale dr (V) Thomas Floyd (c; Pearl) 8 lab h 208 3d (U) Thomas James waiter Crawfords Barbecue Thomas Frances R 2 r 304 Ell (SM) Lunch r 326 Linden Thomas Frank (Evelyn) opr Happ Bros Co h Thomas James A (Mabel) Co) h 107 Vista cir 276 Ell (SM) (I) Thomas Fredk (c; Bertha) emp So Crate & Thomas James D (Annie) 4 h 80 Wilder (SM) Veneer Co h 704 Center (EM) Thomas James E (c; Dollie M) (o) carrier Thomas Funeral Home (c) (W P Thomas) 1000 P O h 505 Forsyth Pio Nono Thomas James M (c) chauf r 529 (521) e 2d Thomas Gartrel (c) r 18 (11) Malloys al (EM) Thomas Geo (c; Rilla) h 220 Gilmer Thomas James W (c; Lilian) brklyr h 501 Thomas Geo (c; Lizzie) 2 lab h 416 Glen Edison Thomas Geo (c; Eva) lab h 400 (511) Prince Thomas Jethro P h 665 Ash (SM) Thomas Jethro P Jr hlpr r 665 Ash Thomas Geo (Laura) 1 (o) mach C of Ga Ry Thomas John (c) r 441 Craft h 201 Bartlett Thomas John (c; Sallie) 1 h 111 Johnson (SM) Thomas Geo (c; Janie) 1 opr Bibb Mfg Co h 116 Thomas John (c) r 327 Monroe (V) e Ell Thomas John (c) r 121 (721) Railroad Thomas Geo pntr r 414 Pio Nono Thomas John (c) emp C of Ga Ry r 449 Coles Thomas Geo (c; Odessa) 1 tr dr Proctor & al Gamble Mfg Co h 919 Hazel Thomas Geo Jr r 414 Pio Nono THOMAS GEO N (Irene) 4 (o), pres T & T Packing Co Inc, h 108 Courtland--tel 675W Thomas Georgia dom R W Clark Thomas Georgia M (c) maid r 314 Monroe (V) Thomas Gertrude (c) cook r 74 Ernest Thomas John (c; Lizzie) 1 hlpr Maxwell Bros Fum Co h 106 (227) Hendrix al Thomas John (c; Lavinia) tr dr r 7 (308) Hanson (SM) Thomas John K printer Macon Teleg Pub Co r 224 Georgia 460 Baldwin's and Telegraph's Thomas John R (Effie) 4 (o) firemn CFD h 123 Thomas M Lucile student r 108 Courtland Piedmont (SM) Thomas Mabel (c) r 714 Maynard Thomas John W (o) gro 103 Whitehead h 2098 Thomas Mabel opr Happ Bros Co r 209 Jeff 3d Davis Thomas John W (Verna) 1 pipe fitter C of Ga Thomas Mae (c) r 317 Gilmer Ry r 410 Winship Thomas Mamie (c) h 8 (322) Steins al Thomas Johnnie L tex wkr Bibb Mfg Co r 110 Thomas Mamie (c) maid J M Green r 507 (474) (14) Balkcom Alabama Thomas Jonas L (c) tr dr r 709 (207) Charles Thomas Margt (Mrs F L) cash Smittys Barbe- Thomas Jos (c; Pauline) emp Maxwell Bros cue Lunch r 2218 Forsyth rd r 127 (27) Clara Thomas Margt E (wid W D) 2 h 119 Daley Thomas Jos (c; Hattie) farm hd Ga Industrial Thomas Marie (c) r 10 (104) Steins al Home h 108 Simmons Thomas Mary (c) (o) h 403 (819) Cedar (U) Thomas Jos (Winnie) (o) sch tchr Lanier High Thomas Mary (c) 1 r 222 Gilmer Sch for Boys h 18 The Prado Thomas Mary (c) h 403 (3) Grant Chapel al Thomas Jos E (Mary A) (o) 2 h 658 New Thomas Mary (c) dom T I Denmark Thomas Jos H Jr teller First Nat Bk & Trust Thomas Mary (c) emp So Crate & Veneer Co Co r 112 Pierce (V) h 110 Bay Thomas Jessie (c) 1 lndrs r 125 Roosevelt (V) Thomas Mary (c) lndrs r 11 (300) Hanson Thomas Jessie (c) maid J M Holloway r 122 (SM) New Thomas Mary (c) lndrs h 401 Smith (EM) Thomas Judge G (c; Lillie) h 529 (521) e 2d Thomas Mary (c) maid 197 Boulevard (EM) Thomas Mary F (c) r 411 (410) 3d (V) Thomas Julian B (c; Willie B) porter Ry Exp Thomas Mary L (c) (o) h 314 Industrial Home Agcy h 321 Douglas (V) rd Thomas Julius (c; Evie) hlpr Maxwell Bros r 5 Woodliff Thomas Mary L (c) maid Ethel B Davis Sch of Beauty Culture r 568 Monroe Thomas Katie (c) 2 r 327 Ballard (EM) Thomas Mary S (c) maid J B Kelley Thomas L A Drug Co (L A Thomas) 1001 Thomas Mary S (c) r 10 (104) Steins al Broadway Thomas Mathew (c) lab Caplan Junk Co r 710 Thomas Lalia (c) r 915 Ocmulgee Thomas Latha opr Happ Bros Co r 117 (15) Ash Thomas Mattie r 225 North (NH) Balkcom Thomas Mattie (c) maid Annie S Currington h Thomas Lee (c) gdnr r 437 Peters al (EM) Thomas Lee (c; Mittie) lunch rm 411 Crisp h 207 Charles 108 (770) Nussbaum Thomas Mattie S sten Willingham Loan & Trust Co r 502 American blvd Thomas Leo sausage mkr T & T Pkg Co res Sofkee Ga Thomas Leola (c) 1 maid h 410 Crisp Thomas Leon elk PPiPggly Wiggly r 135 Pierce (V) Thomas Leon J emp Riverside Ice & Coal Co r 164 Lamont (LCHts) Thomas Leroy (c; Florine) 2 (o) h 825 (227) Daisy (SM) Thomas Lester A (Clifford) (o) (L A Thomas Drug Co) v-p C-M-P Drug Co h 1320 Vineville Thomas Lester A Jr pharm L A Thomas Drug Co h 401 College apt 8E Thomas Lillie M (c) cook L D Porch Thomas Lillie M (c) cook C N Calloway r 313 Hawkins Thomas Lilly (c) r 110 4th (U) Thomas Lizzie (c) 1 lndrs h 212 Fretwell al Thomas Lizzie (c) lndrs r 212 (6) Virgin la Thomas Lizzie (c) maid W C Cherry h 110 Ward (V) Thomas Lonnie M (Della) emp Bibb Mfg Co r 503 Main (EM) Thomas Louise (c) 2 r 152 Bright al Thomas Louise tchr Bellevue Sch r 502 American blvd Thomas Lucinda (c) 1 h 110 (162) Virgin (V) Thomas Lucius (c; Lucy) emp Maxwell Bros h 214 Duval Thomas Lucretia (c) h 1303 1st Thomas Lucy (c) emp Maxwell Bros r 214 Duval Thomas Lucy (c) cook W W Meriwether h 313 Hawkins Thomas Lula (c) 3 r 152 Bright al Thomas Lula (c) r 1208 Broadway Thomas Lula (c) r 782 Reynolds al Thomas Maude (c) 1 h 404 Craft la Thomas Maurice C lawyer 421 First Nat Bk Bldg h 114 Corbin Thomas Mildred r 112 Pierce (V) Thomas Milton (c; Alena) porter Hotel Demp- sey r 505 (472) Alabama (SM) Thomas Milton (c; Corinne) lab Bibb Mfg Co h 424 Flanders Thomas Minnie G (wid J H) (o) h 112 Pierce (V) Thomas Minter (Pearl) 1 r 162 Magnolia Thomas Moses (c) h 423 Damour !a Thomas Myrtice (Mrs C A) tex wkr Payne Mill r 38 Brigham (PM) Thomas Myrtle C (Mrs M C) sec M C Thomas r 114 Corbin Thomas Nell (c) lndrs r 535 Calhoun Thomas Nellie (c) 1 h 133 Wilson Thomas Nellie (c) cook Mrs Irma M Clark r 435 Chestnut Thomas Nellie (c) lndrs r 420 Hawthorne Thomas Nelson (c; Maxie) lab S E Compress & Whse Co r 110 Hazel Thomas Noel (c) lab The Standard Tool & Handle Co r 303 Edgewood Thomas Norman (c; Ludie) 1 lab h 305 Hender- son la Thomas Ollie (c) r 410 (22) Mitchell al Thomas Ollie (c) 1 r 907 (937) Elbert Thomas Oscar (c; Jane) 1 lab C of Ga Ry h 1437 Broadway Thomas Oscar (c; Alice) lab Proctor & Gamble Mfg Co h 323 Gilmer Thomas Oscar (c; Mary) 3 lab Atlantic Ice & Coal Co h 403 (303) Waterville rd Thomas Otha (c; Susie) tr dr h 11 (300) Hanson (SM) Thomas Patsy (c) dom J O Holland ThblvdS LUla F (WW R 0) (0) h 502 American TIViSaS Lula w (c) instr Central City Col h Thomas Paul (c) r 416 Glen Thomas Paul (c; Mattie) emp So Ry h 222 Elliott Thomas Paul (c; Julius) lab r 630 4th (WH) 1935 Macon City Directory 461 Thomas Paul T (Evelyn) 1 laddermn CFD h 121 Winship Thomas Pauline (c) r 334 Boardman al Thomas Pauline E r 164 Lamont (LCHts) Thomas Pearl (c) r 201 Bartlett Thomas Pearl (c) 10 h 123 Edgewood Thomas Pearl (c) maid B S Walker r 220 3d Thomas Phyllis (c) 2 Indrs h 149 Lincoln (V) Thomas Porter D (Nina) 4 (o) credit mgr Huckabee Auto Co r New Clinton rd RD 5 Thomas Prince (c) emp Atlantic Ice & Coal Co r 817 Elbert Thomas Rockey M (c) 5 h 102 e Ell Thomas Robt (c; Viola) 1 emp So Crate & Veneer Co h 602 Center (EM) Thomas Robt (c; Annie L) hlpr Ga Auto Co h 1233 3d Thomas Robt (c; Alma) 1 lab r 1018 Ocmulgee Thomas Robt H (Lillian) wtchmn C of Ga Ry h 135 Pierce (V) THOMAS ROBT O (Margt D) 2 (o> (Calhoun & Thomas), r 502 American blvd--tel 645 Thomas Robt T (c; Bertha) (o) firemn C of Ga Ry h 234 2d (V) Thomas Robt T Jr (c; Mattie) 3 (o) carrier P O h 524 Monroe (V) Thomas Rosa (c) cook W E Davidson Thomas Rosa (c) maid W M Wiggins Thomas Rosa (c) waitress Len Berg Chili Par- lor r 120 Franklin Thomas Rosie (c) dom r 317 Dure (U) Thomas Roy (c; Osie B) lab C of Ga Ry r 713 (711) Elbert Thomas Ruby tchr Virgil Powers Sch r RD 3 Thomas Rufus (c; Lucinda) 6 h 101 (510) 3d (U) Thomas Sallie (c) maid Hotel Dempsey r 111 Johnson (SM) Thomas Sami (c; Carrie) lab So Cotton Oil Co h 305 (310) Campbell (SM) Thomas Sami Jr opr Happ Bros Co r 299 Chap- pell Thomas Sami R (c; Eliz A) dr Kinnett Odqpa Co h 110 Ward (V) Thomas Sanford (c) (o) brklyr h 915 Ocmul- gee Thomas Sara (e) 1 cook r 156 Phillips la Thomas Sarah M sten Bearing Sup Co r 658 New Thomas Scott (c; Louise) tr dr Sawyer Coal & Ice Co h 150 1st (V) Thomas Sebron (c; Pearl) hlpr W C Aber- crombie & Son h 220 3d (V) Thomas Sidney (c) emp Jeffreys-McElrath Mfg Co Thomas Susie (c) elev opr Hotel Lanier Thomas Susie (c) h 963 Ocmulgee Thomas Susie (c) r 103 (r) Roye Thomas Susie (c) Indrs h 102 (342) Grant (V) Thomas Sylvester (c; Jessie) 2 h 122 New Thomas Tabitha (c) 2 h 143 Auburn (S) Thomas Tallulah A (c) r 314 Forest (V) Thomas Tempie L (c) dom J F Moody h 154 Moore al Thomas Thos (c; Essie) porter h 618 Chap- man al Thomas Ulysses (c) r 709 (207) Charles Thomas Vallie (c) h 10 Bright al Thomas Vallie (Mrs E S) opr Happ Bros Co r 105 Dixie Thomas Virgin (c) restr 219 5th r 105 (175) De Borde Thomas W Henry (c) (o) phys 266% Main (EM) h 314 Forest (V) Thomas Walter (c) porter C W Johnson Thomas Walter (c; Addie) 1 (o) glazier Wil- lingham S&D Co h 210 Lincoln (V) Thomas Walter N (Maggie) 1 (Woods Mkt) h 117 (15) Balkcom Thomas Walter P (c; Mary) (Thomas Funeral Home) gro 229 Patterson h do Thomas Warren (c; Annie) 4 lab r 560 Smith row Thomas Wm (c; Fannie) h 115 (151) Jones St la Thomas Wm elk Piggly Wiggly r 135 Pierce (V) Thomas Wm (c; Mary) emp Frieds Garage h 213 Jones Thomas Wm (c; Arula) 1 hlpr Mansfield Dray Line Co r 228 Jones Thomas Wm (c; Julia) lab Ga Oil Corp h 540 Patterson Thomas Wm (c; Etta) porter Hotel Dempsey h 105 Spring Thomas Wm D (c; Laura) tr dr h 250 (174) Plant row Thomas Wm H (c) r 400 (8) Crisp Thomas Wm L (c) tr Chambers Lbr Co r 317 Dure (U) Thomas Wm P (c) tchr Pleasant Hill Sch r 321 Douglas Thomas Willie B (c) cook A T Sherwood r RD 1 Forsyth rd Thomas Willie M (c) cook C J Booker r RD 1 Thomas Willie W (c) student r 400 (8) Crisp Thomas Zeb (c; Annie B) 1 tr dr Snows Ldry h 168 Telfair Thomas Zeke (c; Eliz) 3 h 366 Bay Thomason DeWitt (Thelma) 2 electrn Con- tinental Paoking Co r 352 Clinton Thomason J Monroe (Mamie) carp h 102 (105) Applewood Thomason James U (Hattie P) 1 h 261 Maple Thomason John H student r 102 (105) Apple- wood Thomason Louise tex wkr Bibb Mfg Co r 102 (105) Applewood Thomason Louise waitress Betsey Ross Coffee Shop r 556 Pine Thomason Virginia M student r 261 Maple Thomaston Andrew J r 553 Elm Thomaston Eug r 553 Elm Thomaston John B hlpr h 553 Elm Thomaston Sarah L student r 553 Elm THOMBLEY BOB L (Martha J) 3, sec-treas Herbert Smart Clo Co Inc h 319 Corbin-- tel 1735-J Thompson A B r 453 Ash Thompson Agatha emp Snows Ldry r 763 Cherry Thompson Albert F (Mary) 1 bkpr First Nat Bk & Trust Co r 903 Cherry Thompson Almeda student r 156 New Thompson Anna (c) h 218 Duval Thompson Bernice r 2637 2d Thompson Bertha Mrs emp Middle Ga Tourist Camp r 3917 Houston Thompson Bessie M (c) maid Central Hotel h 113 Middle la Thompson Budrow (c) barb'er 246 Main (EM) h 226 (719) Pear Thompson C B emp Payne Mill r 408 Ross Thompson Carlton W (Eva) barber Southland Barber Shop r 774 (812) Pio Nono Thompson Carrie (c) dom h 105 Empire (V) Thompson Carrie (wid Joshua) 1 spooler Bibb Mfg Co h 408 Ross Thompson Cath S student r 421 Johnson Thompson Chas E (Jessie) slsmn Bibb Chevrolet Co h 300 Cherry Thompson Clarke A (Louise M) (o) bkpr Macon Cooperage Co h 703 Birch 463 Baldwin's and Telegraph's Thompson Claudia (c) r 1021 Edgewood Thompson Clayton (Frances) slsmn Bibb Chev- rolet Co r 100 Mercer ter Thompson Cleanions (Lemma) 2 h 220 Ayers (B) Thompson Danl M bs mgr Rogers Inc r 123 Thompson Norman R (Mary) meat ctr Piggly Wiggly r 421 Johnson Thompson O Richd (Hazel) 3 (o) phys 201 Doctors Bldg h 206 Belvedere dr (I) Thompson Odessa (c) r 404 Robinson rd Thompson Oscar (c) chauf Hubbard Funeral Magnolia Home r 450 City Hall la Thompson Dicie (c) maid r 101 Tindall Thompson Owen P (Rosa P) 2 (tf> cred mgr Thompson Dock B (Myrtle) pntr r 1026 2d Thompson Dola F (wid E A) h 421 Johnson A S Thorpe & Sons h 305 Fort Hill Thompson Paul (Dolly M) 1 tex wkr Willing- Thompson Dollie F supt Middle Ga Hosp r do ham Mills r 239 American blvd Thompson Dolly (Mrs Paul) tex wkr Southland Thompson Peter (c) lab Taylor Iron Wks Knitting Mills r 239 American blvd Thompson R D train dispr C of Ga Ry r 132 Thompson Donnie (c; Lera) emp C of Ga Ry High h 327 Ballard (EM) Thompson Edna student r 771 1st Thompson Ray L (Eleanor) printer Macon Teleg Pub Co r 144 Holt Thompson Eleanor (Mrs R L) slswn Wool- Thompson Richd (c; Dicie) carp h 101 Tindall worths r 144 Holt Thompson Robt E pntr r 1024 2d Thompson Emma (wid A G) r 212 Spring Thompson Robt F (Hattie) 1 h 868 Elm Thompson Emma Mrs nurse 110 Yates r do Thompson Robt H slsmn r 637 Vineville (V) Thompson Emmett delmn S W Abel r 408 Ross Thompson Roberta (c) maid r 615 Crisp Thompson Eula (wid R L) emp Hotel Lanier h Thompson Roland W r 103 Marshall (CP) 213 Bond apt A1 Thompson Ross (Daisy L) emp Ga Power Co h Thompson Eva H cash Mitchell & Williams Co 216 Hydrolia r 774 Pio Nono Thompson Thos W (Pearl) agt Ga & Fla Ry h Thompson Frank (c; Georgia) 2 emp So Ry 801 Pio Nono h 615 Crisp Thompson Viola (c) dom h 1008 Broad Thompson Fred (Mae) 2 barber r 556 Edge- Thompson W Emory (Nina) 1 asst mgr Com- wood munity Savings & Loan Co h 467 Napier Thompson Fredk W (Vivian) 1 patrolmn CPD Thompson Wade W (Clara A) carp Taylor Iron h 426 Cherry Wks h 620 1st Thompson Gene A mgr Wisteria Cafe r Tick- Thompson Walter R (c) student r 558 Ward ling Hotel (V) Thompson Geo (Charlsie) 3 speeder hd Bibb Thompson Wilbur L (Grace S) (o) engr So Ry Mfg Co h 610 Elm h 307 Forsyth Thompson Geo W (Leila) 1 (o) h 100 Villa (V) Thompson Willa r 300 Cherry Thompson Georgia T (Mrs W S) slswn Wal- Thompson Wm (c; Cath) (o) h 231 4th (B) green Co r 756 Mulberry Thompson Wm A (Maude) 2 (o) elk P O h 156 Thompson H Carlisle (Azalee) r 156 New New Thompson Harry (Ethel) 3 emp Leaptrots Dry Thompson Wm A Jr r 156 New Cleaning Co r 868 Elm Thompson Wm H slsmn Adams Buchanan Mtr Thompson Hazel L opr Avalon Beauty Shoppe Co r 821 Hemlock r 620 1st Thompson Wm K (Edna 1 r 274 Willingham Thompson Hubert (c; Lillie) 1 h 115 Hazel Thompson Zack (c; Hattie) 1 lab h 307 Hender- Thompson James (Loutrell) 1 emp So Ry r 862 son la Orange Thomson Eunice asst sec Wesleyan Col r 401 Thompson James M emp Ga Pow Co r RD 2 College Thompson James N r 868 Elm Thomson Polly sten J H Spratling r Wesleyan Thompson Jefferson (c) emp J W McCook Lbr dr RD 2 Co r 615 Crisp Thomson Vernon L (Emma F) 1 dispr Ga Thompson Jos A (Mallory) 2 condr So Ry h Power Co h 653 Forsyth 771 1st Thorner Estelle M tehr Joseph Clisby Sch r Thompson Julia (c) maid O L Brooks 204 Buford pl (V) Thompson Laura (wid J A) r 200 Antioch rd Thorner Gertrude sten Hall & Block r 204 (Lynmore Ests) Buford pl (V) Thompson Leonard (c) r 615 Crisp Thornton Addie M (c) r 300 Industrial Home rd Thompson Leroy R (Eda Belle) 2 (o) sec-treas Thornton Allen (c; Mattie) h 867 Edgewood Dessau Realty & Ins Co h 320 Buford pi (V) Thornton Bessie (Mrs R L) opr Happ Bros Co Thompson Leroy B Jr student r 320 Buford h 1985 2d pl (V) Thornton Billie elk The Film Shop r Y W C A Thompson Lizzie (c) r 232 Jones Thornton Eliz (c) 2 lndrs h 509 (519) Maynard Thompson Louise M (Mrs C A) sten City Bk Thornton Ethel (c) 1 (o) maid W M Jordan & Trust Co r 703 Birch h 315 (720) Short Thompson Mae (Mrs Fred) emp Adams Mfg Thornton Gussie (c; Susie M) cook Terminal Co r 556 Edgewood Hotel h 1104i (1010) Broad Thompson Margt E supt of nurses Oglethorpe Thornton Harry E mech R A McCord Mtr Co Private Infirmary r do Thornton Jesse T (c; Mary) h 1018 Broad Thompson Martin J (Minnie) (o) h 616 Arch Thornton Joseph G (Mamie) (o) firemn C of Ga Thompson Mattie (wid N B) r 239 American blvd Thompson Maude opr Happ Bros Co r 202 Newberg (SM) Ry h 724 Ash Thornton Lillie D (Mrs A E) (Hi Lo Gro) r RD 6 Milledgeville rd Thornton Lurline (c) (o) r 43j Chestnut Thornton Mary J (c) r 1018 Broad Thompson Meta F r 401 College apt 3B Thornton Nora (c) r 518 (105) Elliott Thompson Mildred (c) r 615 Crisp Thornton Smalley (c) huckster h 527 Hazel Thompson Moholia (c) r 105 (128) Kahns al Thornton Stanford elk Hi Lo Gro res RD 6 Thompson Newton J peddler r 801 Pio Nono Milledgeville rd 1935 Macon City Directory 463 'I'komton Thos R (Helen) slsmn r 99 Vineviile Threatt Mineola (c) emp Crescent Ldry r 812 apt A3 Elbert Thornton Wm (c; Sarah) 1 h 518 (105) Elliott Threatt Mozell (c) cook r 116 Gaillard (V) Thornton Wm D (Verna) U S N h 861 Mul- Threatt Ned T (c) carp h 113 Gaillard (V) berry apt 2D Threatt Oliver (c; Mineola) lab The Standard Thorp Chas S student r 1315 Vineviile (V) Tool & Handle Co r 812 Elbert Thorp Geo H (Frances M) 1 slsmn h 1315 Vine- Threatt Ruth (c) student r 306 Madison (V) ville Threatt Wm (c; Mattie) r 149 Pecan Thorpe Abr (c; Cornelia) 3 h 1065 Colemans la Threatt Wm (c) chauf r 215 Green Thorpe Ailene (c) lndrs r 1056 Colemans la Thurman Chas S (Emma E) dept mgr Frank Thorpe Augustus (c; Johnnie M) 1 h 257 Roberts h 461 Cherry Cowan Thurman Ella M (wid J P) r 209 Rogers (V) Thorpe Beatrice (c) student r 510 (650) Cowan Thurman Helen emp F W Woolworth r 6 Grand THORPE CECIL A, pres R S Thorpe & Sons (B) Inc, r 300 Georgia--tel 3287 Thurman John (c; Sophronia) 1 emp Clark Thorpe Chas (c; Malissa) 1 trkr C of Ga Ry Memorials Inc h 321 Ernest h 612 Ross Thurman Joseph (c; Mattie) 3 lab Cherokee Thorpe Ellen (c) dom O F Vance Brick Co h 101 (179) De Borde (SM) Thorpe Eura L (c) dom r 216 (240) Roye Thurman Lee (c; Lucy) 1 emp So Crate & Thorpe Frank (c; Ellen) 3 (o) emp F S Royster Veneer Co h 409 Charles Guano Co h 1056 Colemans la Thurman Leola (c) maid r 354 Maple Thorpe James (c; Mattie) 2 h 510 (650) Cowan Thurman Lois S r 461 Cherry Thorpe Josephine (c) 6 (o) lndrs r 15 Parker Thurman M Merritt (Mattie O'B) (o) sec-treas (V) Southland Knitting Mills h 209 Rogers (V) Thorpe Louise (c) cook r 123 Edgewood Thurman Mattie (c) maid Hotel Dempsey r 101 Thorpe Millie (c) 1 r 909 Ash (179) De Borde (SM) Thorpe Pearl (c) dom J J Phillips r 822 Edge- Thurman Warren (c; Willie) r 101 8th (B) wood Thurman Wm (c; Alberta) 7 lab h 822 Edge- THORPE R S & SONS INC, C A Thorpe pres, wood W H Thorpe sec-treas, mens clothing and Thurmond J Clifford (Ola E) 1 (o) slsmn Em- shoes, ladies beauty shop on 2d fir, 515-17 pire Furn Co h 210 Rutherford (SM) Cherry--tels 159-314-761 Thurmond Mildred L instr Macon Vocational Thorpe Robt E (c) r 15 Parker (V) Sch r 210 Rutherford (SM) Thorpe Virgil r 605 Orange apt 1 Thurmond Ola B opr So Bell Tel Co r 210 Thorpe Virginia (c) r 230 5th (V) Rutherford (SM) THORPE WARREN II (Margt S) 1 (o), sec- Thurston John A (Ethel E) 4 carrier P O h 203 treas R S Thorpe & Sons Inc, h 300 Georgia Montpelier --tel 3287 Thurston Linton R (Evelyn) mech R A McCord Thorpe Wm (c; Janie) 1 h 964 Elm Mtr Co h 460 Spring Thorpe Wm (c; Mary) porter Dannenbergs Thwaite Chas E (Annie Belle) (o) elk Ry M S Thrash Dixie T (wid W R) 1 sten County Tax h 110 Ingleside (I) Coir r 305 Forsyth Thwaite Chas E Jr elk First Nat Bk & Trust Thrash Jessie (wid Lawson) r 239 Stanislaus Co r 110 Ingleside (I) cir Thwaite Walter G student r 110 Ingleside (I) Thrash John (c; Claude) 1 (o) jan Mt De Sales Thweatt. Alex M (c) h 481 Douglas (V) Acad h 803 Daisy (SM) Thweatt Arth M (c; Phoebe) emp Atlantic Ice Thrash M Ann sten Power Oil Co r 305 Forsyth & Coal Co h 429 Douglas Thrash Margt (c) r 102 Mutual (V) Thweatt Ophelia (c) 1 smstrs r 481 Douglas Thrash Wm (c; Lillian) 3 (o) emp C of Ga Ry Thweatt Phoebe (c) cook R J Coates r 429 h 801 Daisy (SM) Douglas Thrasher John B agt Nat L & A Ins Co r 553 Thweatt Sarah (wid T H) sten FERA r 727 Orange apt 2 College Threat Dora (c) 1 lndrs h 229 Roosevelt (V) Ticknor Eug T (Katie M) (o) dept mgr Dan- Threat Fayette (c) r 146 (145) Sycamore (V) nenbergs h 743 Courtland Threat Moses (c; Luvenia) lab So Crate & Ticknor Holmes B pntr r 1132 Milledgeville rd Veneer Co h 307 Gilmer Ticknor J Henry pntr r 1132 Milledgeville rd Threatt Adele (c) maid Dr W R Golson Ticknor Mary J (wid G E) r 1132 Milledge- r 429 Ward (V) ville rd Threatt Annie (c) 1 emp Central City Bag Co Tidwell A Walton (Nannie C) (o) slsmn Macon h 306 Madison (V) Gas Co h 112 Stonewall pi (V) Threatt Beatrice (e) cook r 113 Gaillard (V) Tidwell Annie M (Mrs W C) opr Happ Bros Co Threatt Bessie (c) maid h 394 Telfair r 866 1st Threatt Clark (c; Eliza) (o) h 109 (128) Tidwell Annie T (wid G E) (o) h 1132 Milledge- Mutual (V) ville rd Threatt Eug (c) h 498 Gilmer Tidwell C Coleman (Anna M) 5 (o) engr Threatt Eva (c) 1 r 306 Madison (V) GS&FRR h 177 Laurel Threatt Florence (c) r 116 Gaillard (V) Threatt Henry (c; Leila) 1 (o) h 116 Gaillard (V) Threatt Irene maid J N Neel r 803 Daisy Tidwell C Coleman Jr r 177 Laurel Tidwell Chas C (Fannie) 2 flgmn GS&FRR h 553 Hemlock Threatt John (c) 1 emp Atlantic Ice & Coal Co h 803 Elbert Tidwell Danl L underwriter W D Griffith & Son r 177 Laurel Threatt Lena (c) dom h 105 (30) Dixie row Tidwell Earl mach Bibb Mfg Co r 663 Plum Threatt Lorenza (c) r 306 Madison (V) Tidwell Edw (Pearl) 2 tex wkr Payne Mill h Threatt Lucinda (c) r RD 1 Forsyth rd 141 Comer ter (PM) Threatt Mattie L (c) maid S V Campbell r Tidwell Elmer T 4 (o) carp h 608 Church (CH) 149 Pecan Tidwell Emma (wid G F) r 706 2d 464 Baldwin's and Telegraph's Tidwell Frank L emp Dannenbergs r 1132 Tillman John (c) lab r 101 Clara Milledgeville rd Tillman Joshua (c; Annie) 2 lab Macon Co- Tidwell Geo F coir Idle Hour Nurseries h 706 operage Co r 338 Hammond 2d Tillman Ophelia (c) maid R W Hawkins Tidwell Gertrude (Mrs Johnsie) opr Happ Bros Tilson Wm L asst meterorologist U S Weather Co r 1061 Ash Bur r 855 Mulberry apt 300 Tidwell Harold S (Ava L) emp Am Bakeries Tilton Cora Mrs hskpr Hotel Southland r do Co r 620 Plum apt 4 Timb'erlake Joel H (Mary) (o) h 710 Forsyth Tidwell Hattie Mrs r 559 Hemlock Timberlake Lillie M (c) h 443 (415) 4th (V) Tidwell Henry A (Susie) tex wkr Payne Mill Timmerman J Warren (Marie A) 2 dist mgr h 5 Bellevue rd Mut Life Ins Co of N Y h 657 College Tidwell Henry S (Ethel) laddermn CFD h 703 Timmons Nell Mrs slswn Dannenbergs Main (EM) Timothy John (c) gro 337 Madison (V) r 335 Tidwell Irma ldry wkr Crescent Ldry r 559 do Hemlock Tindall Zollie L (Lois) 3 emp Macon Hosp Tidwell Isabelle (wid GW) r 703 Main (EM) h 320 Giles Tidwell J T r 608 Church (CH) Tinker Francis E (Hattie M) 4 agt Met Life Tidwell Jas L ftr Macon Gas Co r RD 5 Ins Co h 119 Ninadell dr Tidwell Jas M (Jessie) 1 bus opr Ga Power Tinker Mary dental asst F W Farmer r 813 Co h 160 Williams (SM) (819) Pio Nona Tidwell Johnsie (Gertrude) 1 r 1061 Ash Tinley Clara (Mrs F L) slswn Lerner Shops Tidwell Lillie M Mrs opr Happ Bros Co r 559 r 163 2d Oglethorpe Tinley Foy L (Clara) 2 window dec Dannen- Tidwell Louise r 608 Church (CH) bergs r 163 2d Tidwell Luther J (Nell) tex wkr Payne Mill Tinley Joshua E embalmer Harts Mortuary r 5-6 Bellevue rd r RD 3 Tidwell Marian student r 112 Stonewall pi (V) Tinley Ollie B ofc mgr County Relief Admn Tidwell Martha emp S H Kress r 177 Laurel r 196 Laurel Tidwell Mattie (wid T E) (o) r 944 (510) Mont- Tinsley Archie (c) lab Macon Cooperage Co r pelier 1333 1st Tidwell Nadine r 703 Main (EM) Tinsley Cadmus L cash Procter & Gamble Tidwell Oscar r 1061 Ash Mfg Co Tidwell Oscar S (Annie) (o) engr C of Ga Ry Tinsley Clarence (c) delmn H P Vincent r 206 h 504 Beech Antioch rd Tidwell Pearl (Mrs Edw) tex wkr Payne Mill Tinsley Ernest (colored) r 305 Plant (SM) r 141 Comer ter (PM) Tinsley Fannie M Mrs 2 tex wkr Bibb Mfg Co Tidwell Robt D (Lizzie) (o) formn C of Ga Ry h 106 (265) Pearce h 1061 Ash Tinsley Fred (c) r 410 (557) Henrietta (SM) Tidwell Robt K r 1061 Ash Tinsley Fred (c) emp B F Merritt Coal & Wood Tidwell Robt V (Betty) 1 slsmn r 448 New Co r 1329 1st Tidwell Romer T (Lillie E) 1 (o) emp Am Tinsley Ida M (c) maid r 4 Violet Bakeries Co h 607 Montpelier Tinsley John D (c; Lucy) 1 h 411 (554) Hen- Tidwell Ruth r 803 Pine rietta (SM) Tidwell Sidney (Irene) slsmn Snows Ldry r 601 Tinsley John (c; Alice) 1 lab h 206 Antioch rd Napier Tinsley Kimball (c; Ella) 3 emp B F Merritt Tidwell Susie (Mrs H A) tex wkr Payne Mill Coal & Wood Co h 1333 1st r 5 Bellevue rd Tinsley Marion (c) sausage linker T & T Pkg Tidwell Thos J (Annie) gro 975 Pio Nono h do Co Tidwell W Cicero (Annie M) 2 pntr r 866 1st Tinsley Mary M (c) (0) h 418 Applewood Tidwell Walter W emp C of Ga Ry Tinsley Mattie (c) h 866 (65) Ballard (EM) Tignor Ada (c) dom Mrs Lilia Balkcom r 113 Tinsley Sami (c) r 307 (304) Tindall (SM) (152) Cedar (U) Tinsley Tamer (c) cook A P Amerson r 350 Tignor Minnie (c) Indrs r 825 Montpelier Harris al Tignor Oscar (c; Ada) delmn Cherokee Phar- Tinsley Theodosia tchr Pearl Stephens Sch r macy h 113 (152) Cedar (U) 534 College Tignor Robt (c) lab h 126 Cedar (U) Tignor Sarah (c) r 126 Cedar (U) Till Cecil r 123 Birch Till Frank K (Lula) slsmn Bibb Mattress Co h 123 Birch Till Henry A (Recy) h 118 Williams (SM) Tillery Frances (Mrs J P) elk Newberrys r 458 New Tillery Homer W (Nona) 1 carp C of Ga Ry h 458 New Tillery J Peter (Frances) elk College Hill Pharm r 458 New Tillery Thos W elk College Hill Pharm r 458 New Tillman Adel (c) r 114 Shoals la Tillman Annie (c) emp The Clinic r 133 McKays al Tillman Benj (c; Annie) 1 lab h 133 McKays tl Tinsley Walter (c; Anna) 3 h 350 Harris la Tinsley Wm (c; Ruby) emp B F Merritt Coal & Wood Co h 1329 1st Tinsley Wm (c; Marion) lab Maxwell Bros h 226 Turpin Tinsley Wm tex wkr Bibb Mfg Co r 2 Flanders Tinsley Wm (c) USN r 206 Antioch rd Tippins Amy (c) cook C G Jones r 104 (22) Davis al (EM) Tipton Edw W (Lillian) (o) lawyer 13 Harde- man Bldg h 896 Winton Tipton Wm L 5 lab h 1056 Oglethorpe Tissereau Louis h 310 (312) Giles Tisserau Daisy r 310 (312) Giles Titshaw Clifford F (Gertrude) 1 slsmn Collins Baking Co r 139 Rose pk Toaster Albert (c) plstr h 324 Boardman's al Todd' Annie (c) r 320 Hammond Todd Babe (c) 1 h 221 Woodliff Tillman Georgia (c) r 730 (8) Reynolds al Todd Cath nurse Middle Ga Hosp r do Tillman Jack (c) r 79 (9) De Borde (SM) Todd Eliz (c) r 104 (112) Plummer's al Tillman James R (c) lab h 908 Ocmulgee Todd Gussie Mrs r 299 Chappell (SM) 1935 Macon City Directory 465 Todd James L (Gussie Mae) 2 lab h 417 Edgewood Todd Julia student r 224 Georgia Todd Morgan delmn L W Gunnels r 802 Edge- wood Todd Rufus L (Annie) 3 emp Ga Power Co h 903 New Tolan Geo r 759 Hawthorne Tolan Oscar T (Dora) emp Bibb Mfg Co h 759 Hawthorne Toland Eug W (Lizzie) 3 tex wkr Bibb Mfg Co h 1010 Hazel Toland Lizzie (Mrs E W) spinner Bibb Mfg Co r 1010 Hazel Tolbert Chas (c; Mary) 2 hlpr C of Ga Ry h 503y2 e 1st (EM) Tolbert Fletcher (c; Georgia) h 403 Mitchell al Tolbert Henry (c; Willie) delmn Henderson- Turner Co h 312 (240) Roye Tolbert Thos emp C of Ga Ry r 619 1st Tolbert Wm (c; Ida M) 4 lab' h 205 Alabama (SM) Toler Dalton T (Lessie) 1 h 319 Montpelier Toler Lessie (Mrs D T) emp Willingham Mills r 319 Montpelier Toliver Caldonia (c) h 105 (101) Blount Toliver Edw (c) porter Trading Post r RD 1 Toliver James (c; Kate) 2 emp Cherokee Brick Co Toliver Louise (c) tchr Pleasant Hill Sch r 905 Ash Toliver Nancy (c) (o) h 905 Ash Toliver Ola M (c) tchr Pleasant Hill Sch r 905 Ash Tolliver Adel (c) r 216 Pond (V) Tolliver Benj (c; Ruby) h 426 Hammond Tolliver Chas (c; Frances) lab h 319 Hazel Tolliver Chas (c) soft drinks 237 Edgewood h do Tolliver Chas (c; Jessie) tr dr Freeman-Dent- Sullivan Co r 98 (106) Hazel Tolliver Ernest (c; Ida) 2 jan Lanier High Sch for Boys h 98 (106) Hazel Tolliver Eug (c; Bessie) 1 tr dr Freeman-Dent- Sullivan Co h 97 (18) Hazel Tolliver Georgia (c) cook G F Baker r 403 Mitchell al Tolliver Lucy (c) 1 dom r 306 (243) Roye Tolliver Maggie (c) 1 r 313 Forest (V) Tolliver May (c) cook F J Sutton Tolliver Monga (c; Eula M) 2 h 208 Fargason (V) Tolliver Viola (c) cook F D Lawfon r 130 Pecan Tolliver Wm J (c; Viola) porter Tatnal Square Serv Sta h 130 Pecan Tom's Place ( J T Wilburn) confr 703 (1795) Log Cabin blvd Tomblin Willie (c; Pinkie) 2 tex wkr Bibb Mfg Co h 108 Powell Tomlin Ernest A (Rena M) 3 elk C of Ga Ry h 452 College apt 2 Tomlin Geo electrn City r 615 Walnut apt 4 Tomlinson Frances ofc sec Tomlinson Paper Box Co r 20 Marion pi TOMLINSON PAPER BOX CO, W T Tomlin- son Pres-Mgr, W C Mayness Supt, 513 Oglethorpe--Tel 4936 (See page 49) TOMLINSON WM T (Blanche H) 1, Pres Mgr Tomlinson Paper Box Co, h 20 Marion pi--Tel 3081-R Tommie's Place (T E Epps) lunch rm 21 "Bellevue rd Tompkins Essie (c) h 853 Ash Tompkins Henry O (Annie) 4 carp h 303 Bailey Tompkins Hugh pntr r 580 Boulevard (N H) Tompkins Ida (c) maid h 802 Hazel Tompkins John (c) brklyr r 802 Hazel Tompkins Johnnie M (c) r 853 Ash Tompkins Melvin r 303 Bailey Toole Ambrose W (Julia S) elk Lester Grady Gro h 108 St James (SM) Toole Chas J (Pearl H) (o) coir Empire Furn Co Inc h 440 Beech Toole Chas J Jr (Louise) 3 (o) elk J S Wal- dorf & Son h 102 Ayers blvd (B) Toole Chas L (Eva) 2 (o) dentist 720 Bibb Bldg h 105 (202) Elizabeth pi (V) Toole Eula (wid F C) (o) h 609 Vineville Toole Florence (c) (o) dom h 115 Armond (U) Toole Frank L (Mary) 3 (o) mech D H Adams Mtr Co h 522 Log Cabin blvd Toole Furniture Co Inc T E Toole pres-mgr 367 2d and 316 3d Toole G Glen (Mary W) dist mgr HOLC h 473 College apt 4 Toole G Glen Jr (Emily E) elk Bibb Mfg Co h 327 Buford pi (V) Toole James W coir Toole Furn Co Inc r Lizella Ga Toole Jett J (Florence) (o) condr GS&FRR h 2520 2d Toole Kath (wid O A) (o) h 107 Oliver (LCHts) Toole Lila tchr Winship Sch r 107 Oliver (LCHtS) Toole Louis E (Annie) 2 (o) farmer h 603 Bur- ton Toole Lula (Mrs R M) opr Happ Bros Co r 814 New Toole Myrtice cash Personal Finance Co r 144 Hines ter (V) Toole R Otis emp Happ Bros Co r 814 New Toole Reba Mrs 1 elk Quality Food Store r 865 Mulberry Toole Robt J (Eliz) 1 formn Maxwell Bros Inc h 2520 2d Toole Robt M (Lula) opr Happ Bros Co h 814 New Toole Ruby E r 609 Vineville Toole Ruth tchr Winship Sch r 107 Oliver (LCHts) Toole Thos E (o) pres-mgr Toole Furn Co h 422 Vineville Toole Virgil r 440 Beech Tooley Oliver (c; Sallie) h 324 1st (V) Tooley Sallie (c) dom Clifford J Rolston r 324 (V) Toomer Ada (c) maid Kate C Malone r 139 (159) Nussbaum Toomer Beatrice (c) 2 maid r 228 Woodliff Toomer Chas (c; Eliz) porter Wood-Peavy Furn Co h 242 2d (V) Toomer Frank (c) r 119 New St la Toomer Harry (c; Susie) hlpr Bibb Mfg Co h 718 Hazel Toomer John (c; Ada) emp C of Ga Ry h 139 (159) Nussbaum Toomer Lizzie (c) maid Mt De Sales Acad r 167 (319) Nussbaum Toomer Mary (c) h 167 (319) Nussbaum Toomer Stonewall (c) h 216 Elliott Toomer Susie (c) 2 cook h 341 2d (V) Toomer Wm (c; Vessie) 1 lab h 119 New St la Toots Verlin (c) cook Mrs Eliz Stevens r 421 Damour la Torbert Virginia K (wid J K) r 108 1st (CP) Torch Aaron (Sarah) (o) (United Dry Gds Co) h 199 English Torch Harry student r 199 English TORCH ISADORE, Sec Riverside Ice & Coal Co, r 199 English--Tel 2873-M 466 Baldwin's and Telegraph's Tory Love (c; Annie) 2 h 248 (246) Church la (SM) Towler Arth G (Jewell T) (o) trav slsmn h 421 Forsyth Towler Silas C (Blanche G) (o) slsmn h 118 Corbin (V) Towles Geo W tex wkr r 518 Oglethorpe Townes Eug (c; Alice) h 112 (11) Frank al Traylor L Mason (c) case aide County Relief Admn r 520 Monroe (V) Treadwell Eva Mrs 2 (o) h 110 Buena Vista Treadwell Rosamond student nurse Oglethorpe Private Infirmary r do Treglown Nolan F (Pauline L) 2 swtchmn So Ry h 104 Ponce de Leon (SM) Tremble Calvin (c; Willie) (o) lab h 133 5th Townes Laurena waitress Ward's Bar-B-Q PI r 254 New Towns Richd (c; Mary) 2 lab Buckeye Cotton Oil Co h 445 Gilmer Townsend Bell (c) cook 307 Orange (V) Tremble Cleo (c) r 133 5th (V) Tremble Missouri (c) r 101 (534) Kahn's al Tremble Willie (c) maid M H Kessler r 133 5th (V) Townsend Dennis P opr Bibb Mfg Co r 100 Tremont Temple Baptist Church (c) L M Ter- Cabaniss (EM) Townsend Edw (c) cook Spiller's Restr r 220 rill pastor 534 Cotton Tremore Danl (c) emp C of Ga Ry Cresote Plant Townsend Geo C (Rosa L) 1 emp So Ry h 100 Cabaniss (EM) Trenary Wm F Jr slsmgr Carling Tile Co h 401 College apt 5 E Townsend Virginia asst librarian Wesleyan Col r RD 2 Tracy Mattie (wid J W) (o) ftr Burden-Smith & Co h 155 Mill Triangle Pharmacy (J H Settle Jr) 2640 2d Tribble Berner A (Jewel) tr dr Gamble Mtr Exp h 655 Hemlock Tribble Chas J (Estelle) 2 printer Macon Teleg Trading Post (R B Hicks) genl mdse 464 1st Pub Co h 102 Villa Crest Trapp Grace nurse 143 Rose pk r do Trapp Horace W (Annie B) 5 emp Bibb Mfg Co h 904 Boulevard (NH) Trary Robt (c; Mamie) r 554 Chappell (SM) Tribble John C (Cora) slsmn h 10 Marion (Lynmore Ests) TRICE REGINALD KFrankie), Agt Sinclair Refining Co, res Rivoli Ga--Tel 3242-J Transient Bureau Dining Hall 517% 3d Trice Zachary T ofc mgr Sinclair Refining Co Travers Thos (Grace A) (Busy Corner Lunch r 421 College Rm) h 809 Pine Trimble Alice W (c) nurse County Relief Trairs Adolphus (c; Cora) 2 (o) emp Cherokee Admn r 105 Amos Brick Co h 606 (328) Charles Trimble Clem (c; Leila) emp Collins Baking Travis John W (c) r 131 Middle (V) Co h 435 Madison (V) Travis Lillian (c) maid J M Hancock r 302 Crisp Trimble Edw (c; Alice) chauf B E Willingham h 105 Amos (V) Travis Margt Mrs r 655 Arch Trimble Elijah (c) 1 lab C of Ga Ry h 101 Trawick Alice (Mrs W L) emp Happ Bros Co (534) Kahn's al r 432 Ross Trimble J Thos (Bertie) 3 (o) inspr h 153 Trawick Barber Shop (W R Trawick) 17 Lamont (LCHts) Bellevue rd Trinity CME Church (c) Bradley Cleveland Trawick Benton J (Lottie) 2 (o) mgr Reming- pastor 446 Tindall (SM) ton-Rand Inc h 115 Hill Crest rd Tripp Effie (Mrs O C) opr Tapp Bros Co r 200 TRAWICK CLAUDE COAL CO INC, Claude Stratton M Trawick Pres-Treas, Red Cardinal and Tripp Josephine (c) cook r 708 Clinton Silver Star Coals and Coke 201 Edgewood-- Tripp Lucy (c) r 613 (614) 4th (V) Tel 59 (See top lines, page 84 and cards B D) Tripp Martha (c) 1 cook S A Cohn r 708 TRAWICK CLAUDE M (Lula Lee) 4 (o), Clinton Pres-Treas Claude Trawick Coal Co Inc, h Tripp Oscar C (Essie) barber 1504 Broadway Wesleyan Drive--Tel 2544-R h 200 Stratton Trawick Edw F (Helen) 2 elk J C Trawick r Tripp Wayman (Mary) slsmn r 143 Magnolia 1059 Elm Tripp Joshua (c) farmer h 441 Patterson Trawick Emory student r 432 Ross Trippe Susie (c) tchr Green St Sch r 441 Pat- Trawick Frankie L (c) tchr Pleasant Hill Sch terson r 210 (207) Grant (V) Trippe Walter R (Mary) slsmn Ga Power Co r Trawick Geo V emp Jackson-Wynn Co r Semi- 106 Buford pi (V) nole RD 2 Tripper Cooper (c) cook M S Coplan Trawick Hazel r 102 Grand (B) Trodder Lucius (c; Alene) 2 lab r 249 5th (V) Trawick Jas W r 206 Fort Hill Tronce Beauty Institute (Mrs Iva B Tironce) Trawick John C (Annabelle) meats 1007 2d h 652% Cherry 432 Ross TRONCE FRED W (Iva B) 1 (Metro Studio), Trawick Lena P (Mrs W A) opr Happ Bros Co h 137 North (NH)--Tel 2764-J r 206 Fort Hill Tronce Iva B (Mrs F W) (Cherry Beauty Trawick Lonnie H (c) agt Atlanta Life Ins Co Shop and Tronce Beauty Institute) r 137 r 210 (207) Grant (V) North (NH) Trawick Sally (wid C H) r 432 Ross Trotter J D emp Bibb Mfg Co r 653 2d Trawick Shoe Shop (W L Trawick) 610 Haw- Trotter James T barber R G Stripling r 653 2d thorne Troutman Annie P (c) cook J H Spratling Trawick Thos C delmn Trawick Shoe Shop r Troutman Emma (c) 1 h 17 (6) Paradise al 432 Ross Troutman Ida (c) 5 maid h 320 Cedar (U) Trawick W Aaron (Lena P) emp Bibb Mfg Co Troutman Irene (C) h 523 Coleman al r 206 Fort Hill Trouman John (c; Hattie) 1 lab Willingham Trawick Wm A (Jessie) 4 emp McAfee Candy S&D Co h 127 (221) Elliott Co h 206 Fort Hill Troutman Jos (c; Mary) 3 lab C of Ga Ry h Trawick Wm L (Alice) (Trawick Shoe Shop) 316 (65) Plummer's al h 432 Ross Troutman Lee (c) r 322 (312) Monroe (V) Trawick Wm R (Ellen) 1 (Trawick Barber Troutman Lena M (c) dom R B Dame Shop) r 15% Bellevue rd Troutman Mary (c) r 523 Coleman al 1935 Macon City Directory 467 Troutman Mattie (c) 1 cook r 207 Patterson Troutman Sarah (Mrs T J) marker Snow's Ldry r 613 Orange apt 2 Troutman Thos h 613 Orange J (Sarah) apt 2 2 emp C of Ga Rvy Truesdel B Rhett (Sarah) 2 (o) elk Municipal Court h 660 Napier Truesdel Lemuel D elk Volunteer Pharm r 660 Napier Truesdell Pearl M (o) smstrs h 1332 3d Truett Jos (c; Mattie) lata' C of Ga Ry h 275 4th (V) Truitt Andrew (c; Clyde) waiter Hotel Demp- sey r 820 Ocmulgee Truitt Fannie (c) cook G C Britt Truman Dorothy B (wid T B) 1 h 434 Ross Trust Co of Georgia N L Lewis mgr stocks & bonds 417 2d Tschudy Virginia (wid Mathias) r 910 Walnut Tubbs W S r 121 1st Tucker Albert (c; Lula) lab Taylor Iron Wks h 1132 Broadway Tucker Allen P (Louise) slsmn Dunlap-Peeler Hdwe Co r 717 Vineville Tucker Annie L cream tester Swift & Co r 139 Williams (SM) Tucker Areatha (c) 1 maid J M Macey h 113 Linden Tucker Benj M r 276 Ell (SM) Tucker C Eug Jr sta opr Shell Petroleum Corp r 121 Beech Tucker Caro tr dr City r 509 Arch Tucker Chas B (c) barber T J Hunt r 450 City Hall la Tucker Chas C elk Durr's Creamery r 421 (422 ( Lob Cabin dr Tucker Claude E (Ophelia) 2 toll test bd mn Tucker John (c) cook Dixie Cafe & Commis- sary Tucker John F (Julia) elk Terminal Hotel r do Tucker John W (Nettie) 1 mech h 423 (422) Log Cabin dr Tucker Joseph T (Cordelia) 1 (o) slsmn Union Dry Gds Co h 922 Walnut Tucker Julia P (wid J F) elk W U Teleg Co r Terminal Hotel Tucker Lillian emp Sunshine Creamery r 139 Williams (SM) Tucker Lillian Mrs 1 tex wkr Willingham Cot- ton Mill h 815 Montpelier Tucker Lizzie (c) cook h 211 Green Tucker Lucile Mrs 2 r 850 Walnut Tucker Lucile r 233 Washington Tucker Mary r 106 Ingleside (I) Tucker Mary opr Adams Mfg Co r 1670 3d Tucker Martha (wid J M) h 611 2d Tucker Maude Z student r 121 Beech Tucker Mildred emp Adams Mfg Co r 817 New Tucker Monroe emp Sunshine Creamery r 139 Williams Tucker N L (c) lab Central S&D Co Tucker Nettie (Mrs JW) smstrs Happ Bros Co r 423 (422) Lob' Cabin dr Tucker Paul regent Alpha Lambda Tau Fra- ternity rllO Montpelier Tucker Co r Prentice 1222 2d A (Pauline) bkpr T & T Pkg6 Tucker Ralph (c) asst Hutchings Funeral Home r 269 Madison (V) Tucker Richd W carp r 1019 Hazel Tucker Roy (c) hlpr So Crate & Veneer Co r 211 Green Tucker Roy A (Ruth) emp Am Tel Co h 717% So Bell Tel Co h 121 Beech Tucker Claudie Mrs 6 tex wkr h 1064 Ogle- thorpe Tucker Cody B (c) r 123 (157) DeBorde (SM) Tucker Coleman r 139 Williams (SM) Tucker Cordelia (Mrs J T) cash Collins Baking Co r 922 Walnut Tucker Cowart r 1670 3d Tucker Crowley (Katie) 4 serv mgr Central Tire Co h 150 Williams (SM) Tucker Delia (c) 1 emp Independent Ldry Co h 130 Green Tucker Dorothy L student r 121 Beech Tucker Edw (c; Vina) 1 h 101 8th (B) Tucker Eliz h 1019 Hazel Tucker Emma L (wid C O) tex wkr Adams Mfg Co r 922 Walnut Tucker Emmett W (Nina) 5 butcher T & T Pkg Co h 2138 2d Tucker Ernest (Sarah) 4 h 206 Simmons (SM) Tucker Essie Mrs 1 tex wkr Payne Mill h 123 Comer ter (PM) Tucker Felder E (Minnie) 3 hlpr h 655 Elm Tucker Frances student nurse Oglethorpe Pri- vate Infirmary r do Tucker Geneva student r 815 Montpelier Tucker Genevieve student r 815 Montpelier Tucker Gertrude r 1670 3d Tucker Gordon (c; Bessie) 1 hlpr Macon Stor- age Battery Co r 609 Hazel Tucker Harrold J r 1064 Oglethorpe Tucker Harry C (Grace L) city fireman Pump Co No 2 h 321 Montpelier Tucker Helen nurse Middle Ga Hosp r do Tucker Ruth B (Mrs R A) instr So Bell Tel Co r 7171/2 2d Tucker Willene nurse 321 Orange r do Tucker Wm (c; Flora) 1 h 815 Edgewood Tucker Wm hlpr T & T Pkg Co r 664 Elm TUCKER WM I (Carrie E) 1 (o>, Sec-Treas T & T Packing Co Inc, r Houston rd RD 3-- Tel 3458-W Tucker Wm L pntr h 244 Roff Home Tucker Winnie W (wid E S) 1 r 129 Pierce (V) Tuff Amanda (c) Indrs r 706 Clinton Tuff Eug (c; Doris) 2 delmn Wilson's Gro h 512 (112) e Academy Tuff Fannie M (c) Indrs r 706 Clinton Tuff Gladys (c) r 30 Macon (EM) Tuff Henry (c) lab r 1206 Broadway Tuff Isaac (c; Frances) gdnr h 327 Burnett Tuff Jackson (c; Amanda) (o) firemn C of Ga Ry h 706 Clinton Tuff Ned (c) r 354 Church al (SM) Tuff Roland (c; Theresa) tr dr Florida Fish Co h 105 Woodliff Tuff Ulysses (c) r 706 Clinton Tuff Wm (c; Bertha) 1 hlpr The Texas Co h 414 e 1st (EM) j-uii wm ic;, iNfcircissus) 3an Cia Casualty Bldg r 854 Ocmulgee Tuft Edw (c; Fannie) r 370 Flanders Tuft Major (c; Miriah) h 221 Fulton (SM) Tuft Nellie (c) 1 r 117 Wall's al Tuft Wm (c; Julia) (o) tr dr City Scavenger Dept h 242 Church la (SM) Tuggle Annie K (c) r 400 (291) Cowan Tuggle Chas (c; Mattie) 1 emp Birdsey Flour Tucker Howard R (Grace) 7 emp MD&SRR h Mills h 400 (291) Cowan 236 (r) Roff Home Tuggle Lenton (c) emp Birdsey Flour Mills r Tucker James H (Sue) elk Ry Exp Agcy h 536 400 (291) Cowan Boulevard (NH) Tuggle Lois (c) emp Hotel Dempsey r 400 Tucker James I (Annie) 1 mgr Sunshine (291) Cowan y Creamery h 139 Williams (SM) Tuggle Royce (c) r 854 Ash 468 Baldwin's and Telegraph's Tuggle Valla (c) r 854 Ash Tukes Geo (c) h 775 Edgewood Turk Dexter (c; Ethel) 5 lab C of Ga Ry h 457 Hazel Turk Ethel (c) emp Macon Linen Sup Co r 457 Hazel Turk Hazel (c) r 457 Hazel Turk John (c; Mattie) 6 hlpr Cherokee Brick Co h 120 Concord Turk John H (c) jan r 457 Hazel Turk Maria (c) h 143 Forsyth la Turlington Walter C (Carolyn) sheriff Muni- cipal Ct h 390 Suwanee Turlington Wm T (Mary) (o) mgr Crane Co h 105 Pio Nono Turner Allison F (Myrtle) 2 coir A G Rhodes & Son h 126 Edna pi (LCHts) Turner Andrew J (Gertrude) 3 mech h 112 Gant Turner Anne student r 300 Hardeman Turner Annie (c) 2 r 900 Ballard Turner Annie (c) r 109 Empire (V) Turner Annie r 410 Forsyth Turner Hoke S (Hattie) 2 waiter Sid's Place r 1411 3d Turner J H N (c; Naomi) 4 (o) h 219 Elliott Turner J W H (c) waiter Hotel Dempsey r 219 Elliott Turner James C (Katie J ) 2 (o) ambulance dr Macon Hosp h 3329 Houston Turner Jack .Gertrude) 1 h 165 Spring apt 7 Turner James (Willie J) elk C-M-P Drug Co h 865 Mulberry Turner James (c; Annie) 2 emp C of Ga Ry h 410 Peachtreet Turner Janie sten Odom Realty & Ins Co r 410 Forsyth Turner Jessie (c) 5 cook Q R Nolan h 435 Chestnut Turner John (c; Fannie) r 215 (393) Craft Turner John P archt r 757 Mulberry Turner John W (Ella) nurseryman 1108 Main (EM) h do Turner Johnnie (c) sch tchr r 219 Elliott Turner Jos (c; Mary) 1 dr Kinnett-Odom Co h 312 Calhoun Turner Annie M slswn Burden-Smith & Co r Turner Jos B (c;'Georgia) porter Carstarphen 3004 Houston (SM) Inc h 1000 Commodore Turner Arthelia r 435 Chestnut Turner Joseph B batterymn Goodrich Silver- Turner Augustus R brklyr r 3004 Houston town Stores r 3004 Houston (SM) Turner Jos S shpg elk Tapp Bros Co r 126 Turner Byron H (Neva) (o) condr C of Ga Ry Edna pi (LCHts) h 240 Boulevard (NH) Turner Julian H (Reba K) 2 sec-treas King- Turner Carrie E Mrs r 410 Forsyth man & Everett Inc h 847 Patterson Turner Cecil Mrs 2 r 568 Walnut Turner Julius (c; Carrie) tailor Union Dry Gds Turner Chas (c; Clara) tr dr Willingham S&D Co h 423 (474) 3d (V) Co r 123 Penn (U) Turner Laura (c) 2 (o) lndrs h 961 Pio Nono Turner Chas C (c) delmn Paris Gro Co r 560 Turner Lawrence (c; Anna) h 137 Bay Ward (V) Turner Lillie (c) 6 h 103 4th (B) Turner Clara (c) maid J A Fournoy Turner Louis B (Frankie) elk Lackey & Lack- Turner Clarence (Flossie) emp MD&SRR r 125 ay h 233 Chappell (SM) Rose pk Turner M Nell student r 321 Buford pi (V) Turner Clarence Jr (Miriam) 1 formn C of Ga Turner Mabel (c) cash Douglas Theatre r 68 Ry r 164 Spring Spring Turner Dorothy L student r 321 Buford pi Turner Mae (c) 1 dom h 52 Smith row (V) Turner Mamie (wid A R) h 3004 Houston Turner Dotie (c) (o) h 109 Empire (V) Turner Mamie L (wid J S) 2 (o) smstrs Bur- Turner Edith (c) (o) h 211 Grant (V) den-Smith & Co h 206 Log Cabin dr TURNER EDW H (Eva L>, Mgr Doctors Busi- Turner Mary (c) 1 h 258 (632) Elliott ness Bureau Colffection Service, h 321 Bu- Turner Mary (c) lndrs r 102 3d (U) ford pi (V)--Tel 2217-W Turner Martha (c) 1 cook Mary B Stewart r Turner Edw tex wkr Willingham Mills r 118 129 (205) Magnolia la (9) Holt Turner Mattie (wid C A) h 319 Vineville (V) Turner Ella (c) h 310 2d (V) Turner Mattie B (c) dom r 108 (102) Pringle Turner Elnora (c) 1 r 362 Robinson rd Turner Milton (c; Clara B) carp h 414 Ward Turner Elnora (c) r 1430 Broadway (V) Turner Emanuel (c) hlpr Middle Ga Lbr Co Turner Mittie A (wid J W) (o) h 619 Forsyth Turner Eoline Mrs h 226 Belmont Turner Myrtice (c) maid H A Wright r 414 Turner Ethel (c) cook J B Clarke r 560 Ward Ward (V) (V) Turner Myrtle (Mrs A F) slswn Moore Dry Turner Eug (Cleo) 3 tr dr City Scavenger Gds Co r 126 Edna pi (LCHts) Dept h 452 Edgewood Turner Nellie (c) cook r 435 Chestnut Turner Eve (c) h 800 (139) Maynard Turner Nellie sten Bankers H&L Ins Co r 239 Turner Fannie (c) cook W H M Weaver r 215 Edna pi (LCHts) (393) Craft Turner Ophelia (c) maid Hotel Southland Turner Frances sch tchr r 321 Buford pi (V) Turner Oscar C (Ida) 1 elk Miller Bros h 140 Turner Frank (c) lab r 127 (120) Phillips la Highland Turner Frankie (Mrs L B) opr Happ Bros Co Turner Pearl (c) r 310 2d (V) h 233 Chappell Turner Perry (c; Nellie) lab So Crate & Ve- Turner Fred C (Ruby) 2 r 520 Ash neer Co h 203 Campbell (SM) Turner Geraldine (c) maid A L Miller High Turner Philip (c; Lula) (o) emp Bibb Mfg Co Sch r 961 Pio Nono h 119 Powell Turner Hannah (c) r 203 Campbell (SM) Turner Ralph r 239 Edna pi (LCHts) Turner Harry E (Ida M) 1 (o) (Ivey-Turner Ice Cream Co) h 222 Belmont Turner Ray mech Bibb Chevrolet Co r RD 2 Turner Rebecca (c) 1 h 410 (213) Elizabeth Turner Hattie (wid S A) r 126 Edna pi (SM) (LCHts) Turner Henry (c) emp Dunlay Roofing Co h 560 Ward Turner Hense (c; Sallie) 3 emp Bibb Mfg Co h 690 Center (EM) Turner Robert (c) r 435 Chestnut Turner Roosevelt (c) r 690 Center (EM) Turner Roy H (Wilma) reprmn Union Furn Co r 215 Washington Turner Ruby (c) cook r 560 Ward (V) 1935 Macon City Directory 469 Turner Rufus (c; Ursula) 1 delmn Bell's Pharm r 117 (148) Cedar (U) Turner Russell (Hazel) 1 (o) (HendersonTurner Co) h 1000 Napier Turner Ruth (wid Albert) 1 slswn Burden Smith & Co r 120 3d Turner Sami (c; Ruby) 1 porter Dunlap-Peeler Hdwe Co h 105 Bonaire Turner Sami H slsmn Buck Ice & Coal Co r 239 Edna pi (LCHts) Turner Sarah E flrwn Newberry's r 226 Belmont Turner Stonewall J (c) r 414 Ward (V) Turner T Edwin (Irma) 2 (o) bkpr J H Dubose & Son h 115 Parkwood (B) Turner T Edwin Jr student r 115 Parkwood (B) TURNER T RAD (Helen B) 1 (o), pr,?s City Bank & Trust Co h 300 Hardeman--Tel 245 Turner Tabernacle AME Church Frank Moore pastor 3d cor Hawthorne Turner Thos (c) r 52 Smith row Turner Thos E (Hattie) h 239 Edna pi (LCHts) Turner Thos E Jr (Nelle J) 1 coir Hatcher & McCrary Inc h 125 Inverness Turner W Joseph (Ruby) r 130 Concord Turner W M mgr Sportsman's PI r Southland Hotel Turner Wallace (c; Mattie B) 1 h 108 (102) Pringle Turner Walter N bkpr Buster Btlg Co r Hotel Southland Turner Warren S (Ora) 1 bldg contr 867 Cherry h do Turner Wm (c; Willie M) 2 h 102 3d (U) Turner Wm (c; Mattie) (o) carp h 203 Lynwood (V) Turner Wm (c) 3 hlpr Wesleyan College r 868 Douglas (V) Turner Wm (c; Geneva) 5 lab h 211 (157) Center (EM) Turner Wm (c; Mabel) projectionist Douglas; Theatre h 68 Spring Turner Wm D (Turner's Bldg Sup Co) res At- lanta Ga Turner Wm H gdnr r 1108 Main (EM) Turner Wm M (c; Ella) 2 porter Macon Opti- cal Co h 907 Clinton rd (EM) Turner Willie R (c) sch tchr r 569 Ward (V) Turner's Building Supply Co (W D Turnc\) 345 Ocmulgee Turpin Wm C (Eliza) (o) h 376 Orange TURPIN WM C JR (Edith C) 2 (o) (Turpin & Lane) h 415 Hines ter (V)--Tel 4325 TURPIN & LANE h 905 American blvd Waldron Eliz elk FERA r RD 2 Bloomfield rd WALKER CLIFF CO (J Cliff Walker) Bicycles 515 Poplar--Tel 4679 Walker Clifford (c) emp Bibb Mfg Co r 842 Center (EM) Walker Collins F slsmn h 225 Adams Walker Cora ( Woman's Exch) r 76 Arlington pl Walker Cornelia (c) h 212 (216) Middle (V) Walker D Albert (Fannie H) 1 (o) agt N Y Life Ins Co h 673 Hillyer Walker Daisy G (c) 2 (o) maid R J Taylor h h i4TM^llIard F (Myrtice) 4 (o) emp So Ry Waldron Wm F (Mildred G) gro mgr Birdsey Flour Mills r RD 1 Waldrop Wm E (Hattie L) 2 cbnt mkr Will- ingham S&D Co h 231 Washington 235% Middle (V) Walker Danl (c; Josephine) 2 (o) chauf Mrs Julia T Riley h 320 Middle (V) Walker Dessau (c; Gladys) em C of Ga Ry h 388 (381) Melrose (EM) Walker Dinah (c) 1 h 1306 Broadway ^Cherry C H W Anderson mr drugs 518 Walker Adline (c) cook E G Jacobs r 208 Lincoln Walker Albert (c; Lucinda) lab h 618 4th (V) Walker Dixie (c) r 480 Chestnut Walker Dock (c; Sallie) emp Bibb Mfg Co h 503 Hazel Walker Dock Jr (c) lab So Crate & Veneer Co r 503 Hazel 1935 Macon City Directory 475 Walker Douglas (c; Emma) lab Riverside Lbr Walker James (c; Anna) pntr h 1016 Ocmul- Co h 255 Elliott gee Walker Duncan D (Helen) 2 phys 201 Doctors Walker James (c; Roberta) 1 porter Toole Bldg r 547 Georgia Furniture Co h 116 Long St La (SM) Walker Edna (c) maid Lincoln McConnell h Walker James E (c; Emma) 1 (o) carp h 115 842 Center (EM) Walker Edw (c; Ida) 3 r 455 Arch Jones Walker Jas L (c; Emma) jan Katherine Ct Walker Edw r 147 Glynn Apts h 306 4th (V) Walker Edw (c; Maggie) 2 porter Ry Exp Walker Jerry (Gladys) slubber hd Bibb Mfg Agcy h 109 (107) Orchard Co h 1039 1st Walker Eliz (c) 1 (o) h 456 (460) Clinton Walker Jesse (c; Pearl) lab Proctor & Gamble Walker Eliz student r 673 Hillyer Mfg Co h 346 Hammond Walker Ellis (c) lab r 354 Maple Walker Jessie L (C) cook D R Leverett r 128 Walker Emma (c) r 314 (326) Short (EM) Green Walker Emma (c) h 526 e 2d (EM) Walker John (c; Grace) emp Cherokee Brick Walker Emma (c) dom h 104 (120) Thomas Co h 936 Elbert (EM) Walker John (c) waiter Hotel Lanier r 115 Walker Emma M (c) maid H L Barfield r 115 Jones (401) Orchard Walker John B (Mary) 2 blrmkr C of Ga Ry Walker Emma S (c) maid J N Neel Co r 306 4th (V) Walker Enoch (c; Mary) (o) h 800 Daisy (SM) Walker Ethel (c) cook Wesley Hudson r 105 Rose Crest Walker Eudora (c) 1 h 480 Chestnut Walker Eug (c; Ora) 2 porter Jaques Bldg h 201 (362) Craft Walker Eula (c) maid Darling Shops r 128 Green Walker Eula M Mrs 2 tel opr So Bell Tel Co r 315 Columbus Walker Evelyn student r 55 Elm Walker Fannie (c) cook J D Alley Jr h 772 Moore al Walker Frances (c) student r 454 Hawthorne Walker Frank (c; Fannie H) (o) h 218 (161) Grant (V) Walker Frank (c; Lois) r 7 Woodliff Walker Frank (c; Ida) emp Standard Tool & Handle Co h 165 (317) Nussbaum Walker Frank (c; Pauline) 1 lab h 151 Moore al Walker Fred H student r 708 Napier Walker Fredk (c; Eliz) 2 lab h 205 3d (U) Walker Gaddie (c) maid Warren Roberts h 333 3d (V) Walker Geo (c) hlpr Middle Ga Tourist Camp Walker Grace (c) cook J E Poppell r 936 El- bert Walker Hal 4 (o), Pres Warren Frankie sten r 620 Hemlock Washburn Storage Co Inc, h 1107 Vineville-- Warren Fredk (c) chauf r 389 Madison (V) Tel 5677 Warren Georgia M (c) r 318 (319) Williams Washburn House (A C Washburn) furn rms 568 (EM) Walnut Warren Hubert E (Lillie) 1 (Warren's Mkt) Washburn Milton (c) asst M C Mitchell r 215 r 501 Georgia Jones Warren J Edw (c; Magnolia) porter Karsten WASHBURN STORAGE CO INC, C G Wash- & Densen Co h 103 (251) Henrietta (SM) burn Pres, L F McEachem Vp, H W McEach- Warren Janie (c) maid J H Spratling r 140 ern Sec-Treas, 201 Poplar--Tel 5376 (See Jones cards BD) Warren John W r 546 Log Cabin blvd Washington Addie (c) maid r 156 Bay Warren John W (c; Lula) farmer h 317 Wil- Washington Apartments 475 Orange liams (EM) Washington Avenue Presbyterian Church (c) Warren John W (Ruby) 1 speeder hd Bibb Mfg Lawrence McCorey pastor 221 Washington Co h 132 (419) Schell (EM) Washington Block (See Washington Bldg) Warren Jos H (c; Montry) lunch rm 217 5th Washington Booker (c; Gerdrude) r 243 2d (V) r 225 do Washington Building 566 Mulberry Warren Laura M (c) presser New York Clnrs Washington Carrie (c) h 234 Jefferson r 151 Hill Washington Carrie L opr Happ Bros Co r Warren Leconia (c) dom E A Sconyers r 508 RD 5 Lexington Washington Chas (c; Minnie) 2 lab h 409 (309) Warren Lorene (Mrs C O) waitress Warren's Waterville rd Quick Lunch r 403 Spring Washington Columbus J (c; Mary) barber h 111 Warren Lucile (c) 1 h 120 Johnson (SM) Linden Warren M A r YMCA Washington Council No 6 R&SM, C R McCord Warren, M E Church (c) 147 1st (V) recorder meets 4th Thurs 8pm 111 Cotton Warren Mae (c) 1 maid W J Jenkins r 120 Washington Curtis (c) solr Porter's Dry Clng Johnson (SM) Co r 135 (115) Wood al Warren Magnolia (c) maid G F Yetter r 305 Washington Edna (c) 2 r 122 (782) Nussbaum (310) Campbell (SM) Washington Ella M (c) maid r 811 Ocmulgee Warren Maudie M (c) waitress Pythian Lunch Washington Emma (c) h 163 (231) (r) Elbert Room r 458 Hawthorne Washington Ethel (c) h 3 Parker al Warren Otis (c; Laura M) 3 h 151 Hill Washington Eula B (C) elev opr r 811 Ocmul- Warren Regina (c) r 1008 Main (EM) gee Warren Reuben tex wkr r 207 Kemper Washington Eula M (c) dom 885 Hillyer Warren Rose (c) cook 728 Ridge (I) Washington Fannie (Mrs R E) slswn Burden Warren Ruby (Mrs John) spinner Bibb Mfg Smith & Co h 417 New Co r 132 (419) Schell (EM) Washington Fannie (c) student r 921 Ocmulgee Warren Rupert D (Beatrice) 4 mech Bibb Chev- Washington Geo (c; Annie) 1 lab Jeffreys-Mc- rolet Co h 9051/2 New Elrath Lbr Co h 101 3d (B) Warren Sara Mrs h 103 Stratton Washington Gertrude (c) r 111 (509) Strip- Warren Spencer (c; Evelyn) 1 h 117 Bostic la ling al Warren Texas (wid JY) h 207 Kemper Washington Gertrude (c) maid A P Kaplan r Warren Thos N (Mary) (o) elk PO h 546 Log 243 2d (V) Cabin blvd Washington James (e; Elconia) 6 h 108 John- Warren Thos N Jr r 546 Log Cabin blvd son (SM) Warren Wm (c; Anna) (o) emp C of Ga Ry Washington Jeanette (c) cook P N Coley r 126 h 366 2d (U) 4th (V) Warren Wm (c; Magnolia M) lab Karsten & Washington Jennie (c) h 216 Telfair Denson Co h 305 (310) Campbell (SM) Washington Jessie (c) 1 r 123 (17) Bay Warren Wm (c; Georgia) (o) wtchmn Demp- Washington Jessie (c) emp Dixie Cafe & Com- sey Hotel h 509 Fort Hill missary r 123 (17) Bay Warren Wm C (Martha) (o) h 436 Carling Washington John D (c; Gussie) trkr C of Ga Warren Wm L (Mollie) h 161 Broadway Ry h 418 (218) Elizabeth Warren's Market (H E Warren) meats 203% Washington Julia (c) case aide County Relief Hardeman Admn r 653 Spring Warren's Quick Lunch (C O Warren) 410 2d Washington Kaliff (c; Selma) 1 porter Ry Exp Warrenton Lee (c; Mattie) 1 tex wkr Bibb Mfg Agcy h 83 Wilder (SM) Co h 317 Norris Washington Kate (c) 1 h 902 Elbert Warthen Jennie M (c) maid W H Baskin r 209 Washington Louise (c) 2 h 123 (17) Bay 4th (V) Washington Louise (c) r 418 (218) Elizabeth Wasden Chas N (Eugenia C) 1 (o) phys 818 Ga (SM) Casualty bldg h 116 Buford pi (V) Washington Lula (c) maid W E Heath r 805 Wasdin Julia tchr Fort Hawkins Sch r 475 (804) Charles Orange Washington Margt (c) h 211 Linden 480 Baldwin's and Telegraph's Washington Mary (c) r 156 Bay Washington Mary (c) 1 lndrs h 811 Ocmulgee Watkins Annie Mae (c) maid Pitts Mortuary r 310 2d (V) Washington Mattie (c) dish washer W A Wal- WATKINS BENJ T (Ethel B> 1 (o) Chief of dorf r 921 Ocmulgee Washington Memorial Library (c) br 554 New Washington Memorial Library Sallie M Akin librarian 320 Washington Police City of Macon, h 215 Hendley--tel 5578 Watkins Benj T Jr student r 215 Hendley Watkins Carrie (c) hlpr Paul Duval & Son r 604 Broad Washington Noah M r 211 Linden Washington Park College at Magnolia Washington Viola (c) r 92 Bay Watkins Claxton waitress The New Yorker r 754 Cherry Watkins Clorinda (c) maid Board of Education Washington Walter (e) delmn Broadway Fish Co r 83 Wilder h 262 4th (V) Watkins Enice (c) h 418 Ward (V) Washington Wash (c; Lethan) farmer h 271 Watkins Eug (c; Ivory) 1 h 724 (634) Prince Willingham la (SM) Washington Wm (c; Annie) lab r 154 Bay Watkins G Robt mech Sparks Mtr Co r 760 Washington Woodrow (c) cook Macon Cafeteria r 811 Ocmulgee New Watkins Georgiana (wid T F) r 760 New Wasner Arabelle emp Dempsey Hotel r 718 Watkins Gordon L (Annie S) barber 611 3d h Mulberry 108 Ponce de Leon Wasner G Lumpkin r 555 2d Watkins Henry (c; Rebecca) h 520 Monroe (V) Wasner Geo L Jr student r 555 2d Watkins Isabelle B student r 215 Hendley Wasner Mattie M (wid S W) (o) h 209 Applewood Watch Shop The (G R Anderson) reprs 355 2d Waterhouse Edw W r 110 The Prado Watkins J C pantrymn Hotel Dempsey Watkins James (c; Mamie) h 112 Elm Watkins James (c; Lee B) 1 h 15 (8) Sparks al Watkins Jas (c; Mary) 6 lab h 35 (454) Ala- Waterman Frank B (May) sis mgr r 571 Ingleside (I) Waters Aldean (c; Lucy) 3 r 204 (278) Astor bama (SM) Watkins Jas (c; Jessie) lab C of Ga Ry h 103 (502) Campbell (SM) Waters Bertha (c) maid W P Herrin r 314 (342) Watkins Jas (c) student r 112 1st (U) Tindall (SM) Watkins Jeff (c; Ella) h 62 New Waters Cath (c) maid P A McArthur r 176 College Watkins John (c) h 726 Daisy (SM) Watkins John (c) h 609 (100) Elliott Waters Clayton C (Ruth) (o) condr C of Ga Watkins John (c; Hattie) 1 (o) lab GS&FRR Ry 615 Adams Waters Cyrus (c; Alice) h 303 Henderson la h 409 (727) Campbell (SM) Watkins John H (c) tr dr h 112 1st (U) Waters E Mercer student r 615 Adams Watkins Julia (c) r 471 (462) Alabama (SM) Waters Eliza (c) r 201 (213) Jones St la Waters Eliz (c) h 442 O'Hara la Watkins Lizzie (c) cook F R Happ r 227 Patterson Waters Eliz (c) student r 317 Burnett Watkins Lucy (c) maid Hotel Dempsey r Waters Emma (c) r 923 Hazel 1031 3d Waters Emma (C) cook r 147 Hill Waters H Marvin asst mgr Tatnall Square Serv Sta r 615 Adams Watkins Mattie opr Happ Bros Co h 1158 Edgewood Watkins Mattie J .763 Anderson (SM) Watson Leonard D (c) shoe repr 329 Monroe Watts Alma (Mrs W C) slswn Darling Shops r 321 Forsyth (V) r 9 5th (V) Watson Lila student r 100 Richmond Watts Annie (c) maid R A Tharpe Watts Arth B (Sallie E) (o) formn So Ry h Watson Lillian r 763 Anderson (SM) 131 (224) w Grenada ter Watson Lizzie (c) dom h 234 (238) Farga- Watts Beatrice r 1805 Vineville son (V) Watts Cecil M (Mabel) 1 (o) printer Macon Watson Lonnie L (Lou Ada) 5 hlpr h 246 Willingham Watson Lonnie R (Vivian) 1 slsmn Central Ga Baking Co r 304 Morgan Watson Lucy F (c) lndrs h 430 Womack Teleg Pub Co h 553 Boulevard Watts Clifford B r 107 Broadway Watts Dewitt elk r 1805 Vineville Watts Geo (c) lab Buckeye Cotton Oil Co r 455 Coles al Watson Lu Reese student r 3022 Houston Watson Marie (c) dom R S Watson r 201 Oc- mulgee Watson Martha (Mrs R A) sten Penn Mut Life Ins Co r 202 Coleman Watts Hampton (Hattie) 1 doffer Bibb Mfg Co r 815 2d Watts Hugh R (Eliz) 1 engr So Ry h 816 Cherry WATTS J MOTE (Annie M) Mgr Central Hotel Watson Martha E student r 202 Coleman r do Watson Mary Mrs r 319 Johnson Watts Jas (Lizzie) r 108 (171) Forest (B) Watson Mary student r 227 Riverdale dr (I) Watson Mattie (wid T E) h 866 Mulberry Watts Jas H r 107 Broadway Watts John (Minnie) 5 tex wkr Atlantic Cot- ton Mill h 9 Atlantic Village 482 Baldwin's and Telegraph's Watts John A (Rachel) 3 emp City Scavenger Weaver Willie T (Evie) 1 tex wkr Bibb Mfg Dept h 107 Broadway Co h 52 Hydrolia Watts Kate Mrs r 320 College Webb Ada (c) maid Mrs Eldna Butts h 354 Watts Minnie (Mrs John) tex wkr Atlantic 5th (V) Cotton Mills r 9 Atlantic Village Webb Ada L (c) (o) h 937 Montpelier Watts Nannie (wid W T) 1 h 302 Ell (SM) Webb Alf (c) elk Van Gibson r 316 Patterson Watts Rachel (Mrs J A) spooler Bibb Mfg Co WEBB BERNARD A (Kathleen) 1, Mgr Webb r 107 Broadway Coal Co, h 403 Hill Crest--tel 1257-J Watts Radie (Mrs W T) r 130 Main (EM) Webb Bernard A Jr student r 403 Hill Crest Watts Thos (c) 1 h 113 (232) Kahns al Webb Bertha (c) 1 r 1003 Pio Nono Watts Thos emp City Scavenger Dept r 107 Webb Blanton tr dr Independent Ldry r 619 Broadway Oglethorpe Watis W Thos (Radie) leather wkr G Bernd Webb Calvin (c; Hattie) 1 h 316 Patterson Co h 130 Main (EM) W'ebb Cath (c) emp So Bell T&T Co r 316 Watts Wallace C (Alma) slsmn r 321 Forsyth Patterson Watts Wallace C Jr student r 321 Forsyth WEBB COAL CO, B A Webb Mgr, Roff Home Watts Wm L (Ida B) farmer h 1805 Vineville rd--tel 2187-2188 W aw fork Laura (c) lndrs h 940 (502) Mont- Webb Curtis r 619 Oglethorpe pelier Webb Dora (c) cook r 103 Rose Crest Waxeibaum Aimee P (wid G J) h 401 College Webb Edgar L (c; Isabella) r 965 Oglethorpe apt 2D Webb Edw (c; Rosa) 1 h 2 Cheatham al Waxeibaum Jos (Maude) vp Dannenberg & Webb Emily (c) (O) h 519 Monroe (V) Waxeibaum Co h 401 College apt 3D Webb Fredk L (o) phys h 168 Cherokee Waxeibaum Lewis 1 (Marian) 1 h 554 College Webb Hattie (c) cook r 316 Patterson Waxeibaum Lewis I Jr slsmn Dannenberg & Webb Herman (c; Carrie) 4 h 101 Empire (V) Waxeibaum Co r 554 College Webb Hoyt E (Webb's Place) Waxeibaum Marian student r 554 College Webb Ida (wid J H) r 459 Carling Way Aadie (c) cook r 416 Bay WEBB J T JR (Mary S) 2 (o), Circulation Wayman Rotat L (Alice) h 119 3d Mgr The Macon Teleg and Macon Evening Wayne Betty Q Mrs r 104 Lamar (V) News, h Shirley Hills, RD 5--tel 2827 Wayne Hugh elk Crescent Ldry r 104 Lamar Webb James R (Lillian) 2 pastor Cherokee (V) Methodist Ch h 648 Pio Nono Weaks Hugh S (Mildred) 1 mach C of Ga Ry Webb James R Jr student r 648 Pio Nono h 666 Hemlock Webb James T III elk Macon Telegraph r Shir- Weatherford Myrtle tel opr Bibb Mfg Co r 313 ley Hills RD 5 Forsyth Webb Jesse T (Dura) 3 electrn Macon Electric Weatherford Sami A (Theresa E) agt Bankers Co h 869% Mulberry H&L Ins Co r 870 1st Webb John (C) porter Ry Exp Agcy r 316 Weathers Beulah (c) cook r 1216 3d Patterson Weathers Fred (c; Bertha) 5 (o) tex wkr h Webb John H slsmn r 905 Cherry 623 Middle (EM) Webb John P (Lena) wtchmn Central S&D Co Weathersby Bertha (c) cook Macon Cafeteria r 440 Edgewood r 866 Willow Webb Julius (c; Henry D) 3 lab h 106 May WEAVER ALEX H S (Janie F) (Harris, Rus- Webb Kate (c) h 133 Bay sell, Popper & Weaver), r 107 Cleveland (V) Webb Louise (wid E R) r 1060 Walnut --tel 1234 Webb McCullen (c; Mabel) 5 (o) barber J A Weaver Anna prin Lanier High Sch for Girls Braswell h 965 Pio Nono r 107 Cleveland (V) Webb Myrtle r 619 Oglethorpe Weaver Clyde W (Hattie) 1 (o) mach C of Ga Webb Pamelia (c) (o) h 1003 Pio Nono Ry h 103 Beuna Vista dr Webb Pearl (c) emp Snow's Ldry r 303 (417) Weaver David slsmn r 619 Oglethorpe Elizabeth Weaver E Louise opr So Bell Tel Co r 212 High Webb Peter J (c) hlpr Ingleside Oil Co Weaver Howard A (Rebecca) 5 mail elk Macon Webb Raymond (c; Gussie M) (o) auto mech Teleg Pub Co h 1424 3d h 8 (311) Hanson (SM) Weaver Hudnall G (Margt S) 2 (o) phys 230 Webb Thos J (c) delmn r 501 (468) Alabama Doctors bldg h 120 Callaway (V) (SM) Weaver John N (Neltie N) h 212 High Webb Wm (c; Annie) 2 jan Wesleyan Con- Weaver Julia K student r 702 Ridge (I) servatory h 924 Pio Nono Weaver Leroy (c; Hattie) lab Bibb Mfg Co h Webb Wm (c; Pearl) tr dr Willingham S&D Co 220 Summit Hill (S) h 243 3d (V) Weaver Mary home economist Ga Power Co r Webb Wm B (Rebecca) (o) carp h 358 Fair- 212 High view Weaver Mattie P postmistress Merver Univer r 409 Adams Webb Wm B Jr student r 358 Fairview Webb Wilson (c; Pearl) h 303 (417) Elizabeth Weaver Maude Mrs opr Marinello Beauty Webb's Place (H E Webb) confr 670 Cherry Shoppe r 817 New Weaver N Terrell (Lucile H) 2 (o) vp Bankers H&L Ins Co h 184 North (NH) Weaver Olin H (Georgia) (o) phys 230 Doctors Bldg h 702 Ridge (I) Weaver Philip (c; Effie) h 123 (207) Elliott Weaver W Frances tex wkr r 52 Hydrolia Weaver W Hudnall M (o) v-chmn County Bd of Comrs h 107 Cleveland (V) Weaver Watson C (Rebecca) 3 r 1053 Walnut Weaver Watson C Jr student r 1053 Walnut Weaver Wm M Jr (Edith) 2 (o) pur agt Bibb Mfg Co h 204 Albemarle pi (I) Webster Cora L (c) 1 maid Fickling Hotel h 106 (141) Clemons la Webster Danl (c; Lessie) lab Macon Cooperage Co h 628 (1) Gilmer Webster Earl D (c; Susie) r 202 Woodliff Webster Frances student r 137 North (NH) Webster Mary (c) 1 (o) h 308 (601) Prince (SM) Webster Mattie (c) 3 r 109 5th (B) Webster Myrtis (Mrs R L) opr Happ Bros Co r 417 Edgewood Webster Oscar (c) dr Colored Cab Co r 962 Ocmulgee 1935 Macon City Directory 483 Webster Perry G (Nellie I) steel wkr Taylor Welch Geo D (Amanda) meat ctr Huey's Mkt Iron Wks r RD 2 Bloomfield rd r 554 Ash Webster Robt (c; Fannie) 1 r 311 Green Welch James T (Mattie) (o) pntr h 170 Macon Webster Robt L (Myrtis) lab r 417 Edgewood Welch Lillian nurse Macon Hosp r do Webster Sarah L (wid J F) h 910 Oglethorpe Welch Lois (c) (o) h 603 3d (V) Weeks John S atndt Weeks Serv Sta r RD 3 Welch M Eliz student r 217 Villa Esta Weeks Newton S (Weeks Serv Sta) r RD 3 Welch Margt (c) cook B E Willingham r 603 Weeks Service Station (N S Weeks) 3212 3d (V) Houston Welch Mark I mech Chapman's Garage res Weeks W J elk Ry MS r 764 Cherry Dunbar Ga Weems A Eug (Ellen) 1 mgr Capitol Hotel r do Welch Mattie (wid A F) (o) h 2210 2d Weems Geo W (c; Nellie) embalmer Central Welch Pearl (c) dish washer Macon Cafeteria City Funeral Home r 530 Cotton r 361 Edison Weems Jas C (Sally) gro 237 Winship h do Welcher Thos (c; Annie) h 131 (209) Elliott Weems Mary (c) cook Warren Grice Welcome Baptist Church (c) 8 (127) Para- Weems Peter (c; Sophronia) emp Cherokee dise al Brick Co r 700 (519) Colquitt Welfare Worker's Cottage The 69 Davis (PM) Weems Susie (wid L W) 1 r 908 Walnut Weller Linda r 101 Highland Wehrcamp Edw student r 561 Boulevard (NH) Wellons Augustus R (Sarah) 1 gro 280 Co- Wehrcamp Paul (Marguerite) tr dr City St lumbus h 339 Columbus Dept r 561 Boulevard (NH) Wellons Colin E (Cora) 1 ins rep So Bell Tel Weilbaker Vernon slsmn Southland Barber & Teleg Co h 820 1st Shop Wellons Ida elk A R Wellons r 339 Columbus Weinberg Louis (Jennie) gro 517 (499) Hall Wellons John L elk Bibb News Co r 328 (EM) h 515 (497) Hall (EM) Columbus Weinberg Mary (wid J L) 1 (Pleasant Hill Gro,; Wellons Jos B (Meura) (o) condr So Ry h h 103 Capital 657 Pine Weinstein Beatrice student r 135 Rose pk Wellons Kenneth B (Blannie) 5 barber 1917 Weinstein Max (Reba) 1 (o) (The Globe Dress Vineville (V) h 105 (204) Grand (B) Shop) h 135 Rose pk Wellons Shirley E (Louise) 2 barber Hotel Weinstein Sami S (Gus) dept mgr Dannenberg's Dempsey Barber Shop h 328 Columbus h 864 Mulberry apt 3F Wellons Shirley E Jr elk Macon Evening News Weinstein Sidney bkpr J Backer Furn Co r 135 r 328 Columbus Rose pk Wells Alice (wid E W) 1 (Edwells Trick & Weir Chapter Order of De Molay Ira Kaplan Novelty Co) h 818 Walnut sec meets Wednesdays 8pm 710 Mulberry Wells Betty S (wid W M) slswn r 337 Calhoun Weir Cynthia A (wid M A) prin John W Wells Cora (c) 1 h 106 (505) Campbell (SM) Burke Sch h 318 Spring Wells Daniel (Marie) emp Atlantic Ice & Coal Weir Cynthia Playground 2d bet Edgewood & Co r 260 Jeff Davis (SM) Bright Wells Dora L (c) maid W F Bryant r 103 Rose Weir David student r 105 Park pi apt 3 Crest Weir Jack (Donnie L) 1 mech Bibb Chevrolet Wells Friendly (c) delmn S M Wright r 125 Co h 115 Lamar (V) Lynwood (V) Weir Marshall A Council Knights of Kadosh H Wells Genie matron Ga Industrial Home r do G Hollingsworth sec meets Fridays 8pm Wells H S pntr Huckabee Auto Co r 114 Chap- 710 Mulberry pell Weir Marshall A Lodge No. 448 F & A M H G Wells Harriett ofc dep U S Int Rev Coir h Hollingsworth sec meets 1st & 3d Thursdays 232 Georgia 8pm 710 Mulberry Wells J W (c) bus boy The Cricket Weir Thea teller So Bell Tel Co h 105 Park pi Wells Jacob elev repr r 607 Plum apt 3 Wells John B (c; Susie) r 751 Ash Weisiger Wm P (Connie D) mech h 305 For- Wells Josephine (c) maid S L Farrar r 140 syth Pecan Weiss Frank E (Lois) 1 emp Cherokee Brick Wells Lottie (c) maid Wesleyan College h 125 Co h 101 (370) 3d (SM) Lynwood (V) Weiss Lathan O (Ruby) mech Acme Welding Wells Mary L (c) r 322 Hammond Co h 1078 Walnut Wells Marie M (c) (o) h 5 Mitchell (EM) Weisz Frances sten Leon S Dure Co r 800 Wells Ossie (c; Phennie) 3 (o) emp h 505 Orange Fort Hill Weisz Genevieve tchr Gresham Sch r 800 Wells Ralph elk Karsten & Denson Co r RD 5 Orange Wells Robt C (Edimae) wtchmn r 607 Plum Weisz James G organist h 800 Orange Weisz Mamie bkpr Macon Shoe Co r 800 Wells Sarah E Mrs r 108 (726) Cabaniss (EM) Wells Selestin (c) (o) h 207 2d (U) Orange Wells Thos (c) 3 peddler r 207 2d (U) Welch A W (Vera M) 1 tex wkr Payne Mill h Wells Thos P slsmn Carstarphen Inc r Hotel 76 Short (PM) Macon Welch Abbie (Mrs D W) beautician Dannen- Wells Wm (c) bellmn r 527 Academy al (EM) . berg's r 767 Poplar Wells Wm D (Veola V) (o) dentist 301 Macon Welch Agnes M (wid C A) (o) h 2627 Broad- Savings Bk bldg h 106 2d way Werba Edw O (Doris) 1 dept mgr Macon Gas Welch Amanda (Mrs G D) opr Happ Bros Co r 554 Ash Welch Clarence student r 134 -134 Comer ter (PM) Welch Danl W (Abbie) mach C of Ga Ry r 767 Poplar Co h 401 College apt 5D Werden W R Co C E Whalen mgr whol gro 248A 5th Wesley Addie (c) r 324 5th (V) Wesley Annie (c) maid Herbert Smart r 132 (245) Railroad Wesley Arth (Sabina) 4 barber 808 Hazel h Welch David-- (c; --Pearl) 5 lab h 361 Ediso,ni 806 do 484 Baldwin's and Telegraph's Wesley Jas r 806 Hazel West Jean C (Mrs T B) (o) h 106 Cleveland Wesley Jas (c) lab Idle Hour Club r 109 (121) (V) 3d (B) West John E (Mervin) slsmn Birdsey Flour Wesley John (c; Lillie M) butler r 100 May (U) Mills h 110 Holt (V) Wesley Jordan (c; Mattie) 1 (o) lab C of Ga West John H (Marion H) 1 (o) as3t mgr Life Ry h 102 Johnson (SM) Ins Co of Va h 1212 Ridge (I) Wesley Josie (c) 2 h 109 (121) 3d (B) West John T (Mary) h 533 Orange apt 9 Wesley Mayme L (c) r 821 3d (V) West John T Jr elk So Tex Co r 533 Orange Wesley Mildred r 806 Hazel apt 9A Wesley Mildred Mrs 1 emp So Bell Tel Co h West Jos W lawyer 353 Vz 3d r 504 Washington 217 Hardeman West Kath emp Happ Bros Co r YWCA Wesley Pascal r 806 Hazel Wesley Pearl (c) cook r 5 West Boundary Wesley Robt (c) lab r 109 (121) 3d (B) West Lovie (Mrs W M) checker Snow's Ldry r Miller Field rd West M Deweese r 103 Mill Wesley Robt M (Eva) (o) h 201 Burton West Mary (c) maid C N Wasden r 242 2d (V) Wesley Romeo (c; Mabel) 3 delmn Volunteer West Mary .(c) nurse 117 Opera House al h do Pharm h 127 Woodliff Wesley Thos (c; Julia) h 7 West Boundary West Mary (Mrs J T) slswn J N Neel Co h 553 Orange apt 9 Wesley Walter (c) lab Bibb Mfg Co r 109 (121) West Myrtle mach opr Happ Bros Co r 718 3d (B) Hemlock Wesley Wm (c; Annie) lab Willingham Mills h West Norman V (Lillian) (o) buyer Atlantic 132 (245) Railroad Cotton Mills h 760 Hillyer Wesley Willie M (c) 5 h 307 Short (EM) West Preston (c; Louise) (o) emp So Ry h WESLEYAN COLLEGE, D R Anderson pres, 281 1st (V) Leon P Smith dean, J B Hill bursar, Forsyth West Ralph W lawyer r 103 Mill rd--tel 6371 West Reno (c; Eva) hlpr Atlantic Refining Co WESLEYAN CONSERVATORY OF MUSIC h 191 Lincoln (V) AND FINE ARTS, D R Anderson pres, Jos West Robt P (Della) slsmn h 854 Cherry Maerz director, Maiy Lou Barton, bursar, West Sami L r 718 Hemlock College West Stella (c) r 110 Hurley la Wesleyan Pharmacy (H L Chichester, Wm West Thos (c) lab C of Ga Ry r 418 Hazel Faircloth) RD 1 Forsyth rd West Utah E (wid J P) h 519 Pine Wesson Frank r 41 Atlantic West Valda B (Mrs G E) nurse Macon Tran- Wesson James W (Lillie) 1 emp Atlantic Mills sient Bur r 103 Mill h 41 Atlantic Village West Vivian (o) tchr John W Burke Sch h Wesson Marie emp Atlantic Mills h 41 Atlantic 553 Orange Village West Walter M (Evelyn) 1 mech Ga Power Co Wesson Wm emp Atlantic Mills r 41 Atlantic h 207 Appleton Village West Wm M (Lovie) lawyer 8 Washington bldg West Alice student r 106 Cleveland (V) r Miller Field rd West Allen (c) trkr C of Ga Ry r 1171 Ogle- West Woodfin G mach C of Ga Ry thorpe West Zon (c) firemn C of Ga Ry r 1321 West Anna M sten Harris, Russell, Popper & Broadway Weaver r 504 Washington Westbrook Arth V (Gladys) 1 steel wkr Taylor West Anna B (wid Thos) 2 (o) h 446 Wash- Iron Wks h 107 Ponce de Leon ington Westbrook Gladys (Mrs A V) opr Happ Bros West Annie B (c) maid Mrs Fannie Taylor r Co r 107 Ponce de Leon 116 (6) Spring la Westbrook J Robt (Lessie L) (o) blrmkr So Ry West Carrie (c) lndrs h 111 (509) Stripling al h 3030 Houston West Clarence (c; Annie B) lab h 116 (6) Westbrook Jas (c; Matilda) 1 lab Procter & Spring la Gamble Mfg Co h 306 (441) Alabama (SM) West Cottrell (c) tr dr PO h 265 Walnut Westbrook Viola M (wid T W) (o) h 3041 West Della (Mrs R P) furn rms 854 Cherry r do Houston West Edw W (Eliz) 2 emp C of Ga Ry h 113 Westbrook Wm L div supt Ga Power Co r Willingham 2314 Forsyth rd West Elain L (c; Mary) carp McCook Lbr Co Westcott Ludie (o) h 341 Calhoun r 242 2d (V) Wester Emma (wid J H) opr Happ Bros Co West Ella (c) maid Wesleyan Col h 5 5th (V) r 722 Pine West Ellis (c) jan YWCA Wester N Roscoe 3 emp Washburn Storage Co West Essie (c) 4 r 926 Pio Nono h 722 Pine West Frank B (Ruth T) (o) appraiser HOLC h Wester Wm student r 722 Pine 504 Washington Western Railway of Alabama R F Wynne Jr West Frank B Jr civ engr City Engng Dept div frt agt 605 Bibb bldg r 504 Washington WESTERN UNION TELEGRAPH CO, L R West Fredk (c; Rose) h 200 Coles al Dublin Mgr, 455 Cherry--Tell, Call Western West Geo E (Valda B) 2 stage scenery 105 Union, br ofc 244 Main (EM) Wood h 103 Mill Weston Theodis (c) tchr Ga Acad for the West Geo W hlpr r 219 (120) Cutters la (EM) Blind r do West Gertrude (c) h 211 Hazel Wethers Grant (c) lab Carling Tile Co West Gussie (c) 2 r 619 Division Whalen Chas E (Lillian) mgr W R Werden Co West Jackson L (Annie) 1 (o) slsmn Ga Roofing & Sup Co h 380 Jasamine r 866 Cherry Whalen Lillian (Mrs C E) opr So Bell Tel Co West Jas E (Mary) (o) formn C of Ga Ry h 112 Dixie West Jas F r 144 Williams (SM) West Jas L (Lula) 1 engr C of Ga Ry r 301 Cutters Green (EM) West Jas P (c; Rosa) r 267 Woodliff r 866 Cherry Whalen Sallie E (wid J D) (o) h 342 Hydrolia Whalen Thos W city firemn r 342 Hydrolia Whaley Claude L (o) pres Ouzts Mitchell & Whaley Inc h 370 College Whaley John (Martha) 3 h 146 Concord 1935 Macon City Directory 485 Whaley Juanita waitress Union News Co r 131 Cole Whaley Kath r 370 College Whaley Odessa r 146 Concord Whaley Oscar (c; Lilia) emp C of Ga Ry h 509 e Academy Whatley B Jewett (Nell) overseer Bibb Mfg Co h 716 Oglethorpe Whatley Margt nurse Macon Hosp r do Whatley Nell (Mrs B J) binder Am Printing Co r 716 Oglethorpe Wheatley Lee r 353 Walnut Wheatley School (c) Maude Pye prin 200 An- thony rd Wheaton Bertha (wid S A) h 135 Academy Wheaton Chas R (Virgie) 1 formn So Crate & Veneer Co h 309 Center (EM) Wheaton Clemmie O slswn S H Kress Co r 135 Academy Wheaton D Wilmot (Tupsie) 1 elk h 125 Academy Wheeler Albert (Jessie) 1 tr dr City r 250 Washington Wheeler Alice Mrs 3 h 2018 Broadway Wheeler Alice (wid J W) 3 h 144 Ell (SM) Wheeler Aurelious (c) lab Maxwell Bros r 114 (532) Campbell (SM) Wheeler Benj P asst paymaster Bibb Mfg Co r 301 Hines ter (V) Wheeler Cath (wid J W) h 101 (98) Oakland Wheeler Chas A (Norma) cash Swift & Co h 761 Pine Wheeler Chester A (c; Lillie) 1 emp R C Crop- per h 220 Grant (V) Wheeler Clyde M (Ruth G) trav slsmn h 644 Forsyth Wheeler Doris (c) r 114 (532) Campbell (SM) Wheeler Egbert S (Uba) 3 (o) firemn GS&FRR h 113 Heard (SM) Wheeler Eliz Mrs r 711 Orange Wheeler Ernest (c) hlpr Atlantic Ice & Coal Co r 121 (120) Orchard Wheeler Francis W D student r 301 Hines ter (V) Wheeler Geo A tchr Lanier High Sch for Boys r 106 Napier Wheeler Geraldine D (wid C A) (o) cake baker 301 Hines ter (V) h do Wheeler Gladys (c) cook H F Northington r 102 (2) Bartlett la Wheeler James (Ethel) slsmn L B Price Mer Co r 717 Cherry Wheeler Jas (c) lab Ga Oil Co Wheeler Jas (c) shoe shiner Philadelphia Hat Cleaning Co r 121 (120) Orchard Wheeler Jas T r 40 Brigham (PM) Wheeler Jas W Jr (Anna) (o) car repr So Ry h 103 (100) Oakland Wheeler Jesse (c) hlpr Atlantic Ice & Coal Co r 121 (120) Orchard Wheeler John R (Lottie) 3 mech Independent Ldry h 101 Mill Wheeler Jos (c; Emma) 1 r 403 (731) Camp- bell (SM) Wheeler Julia nurse Middle Ga Hosp r 711 Orange Wheeler Katie (c) 1 r 156 5th Wheeler Louise opr So Bell Tel Co r YWCA Wheeler Luther W (c) emp C of Ga Ry r 412 Hawthorne Wheeler Mary (c) r 88 Bay Wheeler Otha M (c) maid 203 Albemarle pi (I) Wheeler R Prentiss student r 301 Hines ter (V) Wheeler Rilla (c) cook Julia Parkham Jones Benevolent Home h 121 (120) Orchard Wheeler Roberta (c) student r 220 Grant (V) Wheeler Sarah (c) 1 cook W L Marshall r 414 Lawton Wheeler Sidney J (Ruth) emp Art Fum Mfg Co h 122 Grady Wheeler Van B (c) student r 114 (532) Campbell (SM) Wheeler Walter D (Lois) (o) emp H C Fowler Lbr Co h 212 Albemarle pi (I) Wheeler Wm (c; Annie) 3 lab So Ry h 114 (532) Campbell (SM) Whetcbell Edna Mrs 1 r 355 New Whibly Janie (c) Indrs r 211 Yates Whiddon Mary A (wid J 1) (o) h 824 Curd (SM) Whigham Julius (c; Lillie) gdnr h 214 North (V) Whigham Lillie (c) cook Lulu Hardeman r 214 North (V) Whigham Louise (c) student r 119 (123) Syca- more (V) Whigham Luther (c; Pearl A) (o) hlpr Dixie Dairies h 119 (123) Sycamore (V) Whigham Pearl (c) Indrs Ga Acad for the Blind r 119 (123) Sycamore Whigham Robt (Thelma) emp Atlantic Cotton Mills r 234 Oak Haven Whigham Thelma (Mrs Robt) opr Happ Bros Co r 234 Oak Haven Whigham Wm (c; Janie L) emp C of Ga Ry h 201 (204) Alabama (SM) Whipper Chas (c; Jessie) 4 lab h 601 Charles Whipple Carrie (c) 1 r 404 e 1st (EM) Whipple Chas (c; Maud) 2 lab h 204 Kitchens Whipple Harvey (c) elk John Timothy r 341 Madison (V) Whipple Jas (c; Dena) porter R S Thorpe & Sons h 257 Middle (V) Whipple Leila (c) (o) Indrs h 205 Kitchens Whippier Ada (c) cook 117 Park pi Whisbee Edison (Vertie L) 2 h 313 Vine Whisby Willie B (c; Margt) 4 lab Willingham S&D Co h 453 Shoals al Whitaker Annie (c) Indrs h 862 Coles al Whitaker Bennett H (Martha) 1 formn Inde- pendent Ldry h 873 Orange Whitaker Cecil F (Mary W) agt N Y Life Ins Co h 131 Rogers (V) Whitaker Cornelia (c> dom Wm Parker r 168 Astor Whitaker Dollie B (wid G W) (o) h 1777 3d Whitaker Donnie (c) r 847 Norris Whitaker Ella (wid J B) r 25 Melrose (B) Whitaker Felton A (Marietta) (o) h 1310 Vineville Whitaker Geo H traffic mgr MD&SRR r 520 Washington Whitaker John (c) r 441 Peter's al (EM) Whitaker Pearl 1, gro 617 Linden White Daisy (c) maid G F White White David (c; Emma) peddler h 209 Holmes White E Lula (wid E L) r 120 Florence --tel 1146, h 438 Duncan White James M r 292 Cedar (SM) White John (Mae) 1 r 553 Walnut White Easter (c) h 263 4th (V) White John (c) delmn r 441 (469) Tindall (SM) White Eastwell (c; Willie M) hlpr MD&SRR h 517 e 2d (EM) White John (c; Maggie) 3 emp Standard Tool & Handle Co h 363 Maple White Edw (c; Mary) tex wkr Bibb Mfg Co White John B (Eliz W) (o) agt Life Ins Co of h 236 1st (V) Va h 116 Log Cabin dr White Edw D (c; Katie) pastor Beulah White John M (Ruby) emp Happ Bros Co h 112 Baptist Ch r 863 Ocmulgee Whitehead White Eliza (c) r 263 4th (V) White John T (c) (o) jan Y M C A h 176 White Eliza (c) cook A R Kelly r 209 Madison College White Eliz (Mrs J B) smstrs Happ Bros Co White Jos (c; Mary) 1 (o) firemn C of Ga Ry r 116 Log Cabin dr h 221 Morgan White Emma (c) cook r 209 Holmes White Joseph (c) lab F S Royster Guano Co White Erasmus (c) jan Ga Acad for the Blind White Jos M (Lucille) barber Dannenbergs h h 211 Northwest Boundary 911 Orange White Ernest (c; Julia) lab The Standard Tool White Jos N (Mary) tex wkr Bibb Mfg Co & Handle Co h 623 (6) Gilmore h 103 Coleman White Ernest A (demon) 2 mech Huckabee White Julia (c) hlpr Bibb Mfg Co r 455 Hazel Auto Co h 616 Broad White Julia (c) maid F E Irby r 218 Jordans White Eug r 155 2d al White Eva (Mrs L A) emp Meaders Mattress White Kate (wid W R) h 568 1st Co r 425 Arch White Kath (c) 1 h 750 Edgewood White Eva L (wid J T) 1 mach opr Happ Bros White Kelley (c) r 138 (135) Phillips la Co h 623 Oglethorpe White Laverne r 103 Piedmont (SM) White Fannie (c) 3 r 332 3d (V) White Fannie Mrs 1 tucker Tomlinson Paper Bo Co r 306 Flanders White Florrie C Mrs infirmary supt Wesleyan Col White Leila (c) cook r 1014 Ocmulgee White Lester (c) r 118 (552) Magnolia la White Lester A (Eva) carp C of Ga Ry Creo- sote Plant h 425 Arch White Letha (c) cook h 138 (135) Phillips la White Lewis (c) jan P O h 303 Patterson White Frances inspr Happ Bros Co r 623 Ogle- White Lillian (c) maid Kenmore Burns Inc r thorpe 152 Walkers la 1935 Macon City Directory 487 White Lillie (c) 1 emp Snows Ldry r 220 (227) White Wm J instr Macon Vocational Sch Moughon (V) r 103 Coleman White Louise (c) maid r 200 Northwest White Willie M (Mrs C B) opr Adams Mfg Co Boundary- r 720 Plum White Lucius (c; Sara) 4 h 307 (304) Tindall Whited Agnes L elk Liggetts Drug Store r (SM) 706 1st White Lucius (c; Hallie) h 602 3d (V) apt 2 Whited Julian waiter Smittys Barbecue Lunch White Lydia Mrs opr Ethel B Davis Beaitty r 706 1st Shop r 155 2d Whited Sallie (wid C W) h 706 1st White M Frances elk Newberrys r 137 Park pi Whitehead Annie (c) h 923 Hazel White Mabel L (c) r 138 (135) Phillips la Whitehead Annie L (c) tchr Hudson High & In- White Mabel Memorial Baptist Church W W dustrial Sch r 256 Middle (V) Williams pastor 2634 2d Whitehead Anthony (c; Essie) 4 trkr C of Ga White Maggie (c) lndrs r 224 Ward (V) Ry h 1208 (404) Woolfolk White Mamie (c) cook E L Moore r 115 (19) Whitehead Chas F (Mildred) tex wkr Willing- Wise (V) ham Mills h 7 Randolph pi White Margt r 103 Coleman Whitehead Edw S (Sara W) 1 (Whitehead Serv White Marvin msngr W U Teleg Co r 1923 2d Sta) h 309 Buford pi (V) White Mary A elk Hatcher & McCrary Inc r Whitehead Eleanor case wkr FERA r 104 103 Coleman Corbin (V) White Mary E (c) 1 h 153 Middle (V) Whitehead Eug (c; Irene) 1 r 130 Pecan White Matilda (c) 2 r 209 (366) Railroad Whitehead Eunice T r 906 Orange White Mercer opr Happ Bros Co r 865 1st Whitehead Eva (c) lndrs r 606 New White Miller G (Allie J) 3 chf radio opr CPD Whitehead Geo (c) r 210 Lee (EM) h 100 Courtland Whitehead Georgette (c) tailor Edw Bashuk White Minnie (c) r 602 3d (V) apt 2 r 131 (123) Phillips la (EM) White Minnie (c) cook J A Etheridge r 404 Whitehead Henry (o) h 906 Orange (507) Prince Whitehead Henry L (Sue M) 2 (O) trav slsmn White Monroe (c) tr dr Sawyer Coal & Ice Co h 200 (132) Buford pi (V) White Nathl (c) cook Busy Bee Lunch Whitehead Ivory (Mrs Roy) tex wkr Payne White Nettie r 623 Main (EM) Mill r 155 Comer ter (PM) White Nita slswn S H Kress Co r 911 Orange Whitehead J Berrien (Stella T) (o) slsmn Yates White Ohgerreter (c) (o) h 226 Telfair & Tabor Co Inc h 104 Corbin (V) White Oliver (c) lab Birdsey Flour Mills r 312 Whitehead James (c; Elsie) farmer Effie B Monroe (V) Burke h 3202 (r) Forsyth rd White Ollie (c) emp C of Ga Ry r 750 Edge- Whitehead James C r 143 (r) Carling wood Whitehead John B Jr teller First IN at Bk & White Oscar G (c; Idell) tr dr r 555 Monroe Trust Co r 104 Corbin (V) (V) Whitehead John H (Nellie M) 1 (o) condr C of White Paul C (Martha R) 2 agt Bankers H & Ga Ry h 101 Grenada ter L Ins Co h 225 North (NH) Whitehead Juanita (c) dishwasher B F Lyles White Pauline (wid J A) r 860 Mulberry r 223 Elliott White Pauline Mrs emp Happ Bros h 137 Whitehead L Parker (Minnie L) 1 tex wkr Park pi Willingham Mills r 218 (20) Holt White Pearl (c> h 119 (2) Fulton la Whitehead LeVita H r 101 Grenada ter White Philip slsmn H L Green & Co r RD 1 Whitehead Mamie J mgr Charis Corp h 253 White Richd student r 137 Park pi New White Robt (c; Mary) 2 h 1 Woodliff Whitehead Oscar (Myrtle) 1 tex wkr Willing- White Robt student r 155 2d ham Mills; r 13 (69) Mill White Robt L (Minnie) (o) h 328 American Whitehead Robt F (Mary Ella) 5 hlpr h 424 blvd American blvd White Roland E (Mamie V) 4 (o) asst mgr Life Whitehead Roy C (Ivory) 2 tex wkr Payne Ins Co of Va h 103 Piedmont (SM) Mill h 155 Comer ter (PM) White Roswell R (Mattie Lou) h 115 Rose pk Whitehead Sadie (c) maid A T Kendall h 124 White Roswell T agt Carolina Life Ins Co (238) Stewarts al r 115 Rose pk Whitehead Service Station (E S Whitehead) White Rufus (c; Evelyn) (o) lab So Crate & 600 New Veneer Co h 921 Pio Nono Whitehead Valena (c) emp So Crate & Veneer White Ruth h 292 Cedar (SM) Co r 320 e 2d (EM) White Sallie (c) emp Snows Ldry r 227 Whitehead W Jackson (Emma L) 2 h 129 (36) Moughon (V) Holt White Shelton (c; Mazie) lab h 107 Davis Whitehead Wm (c; Ruby) 1 lab So Crate & (NH) Veneer Co h 323 (245) Division White Simon (c) watch repr 249 5th h do Whitehead Wm J tex wkr Willingham Mills r White Thos (c; Lula B) (o) h 1050 (920) 143 (r) Carling Pio Nono Whitehead Wm T 1 h 143 (r) Carling White Tinsley R (Audrey) 1 tr dr The Texas' Whitehurst Agnes emp Southland Knitting Mill WThCiotehV1io1l2a (136) (c) h Charles 8 Harris al r 102 Richmond Whitehurst Bertha r 1525 Broadway White Walter (c; Annie) emp Yates Mtr Co Whitehurst Burdick (Berta) 6 miner h 806 White Walter (c; Olivia J) jan Biltmore Apts Broad r 504 (603) Henrietta (SM) White Walter (c) porter Terminal Hotel r 111 Shoals la Whitehurst Cornelius A (Annie) h 102 Richmond Whitehurst Eugenia J (wid J E) (o) furn rms 258 1st h do White Wm (c; Mattie) 2 h 307 (515) Plum- Whitehurst Evelyn E slswn Penneys r 102 mers al Richmond White Wm (c) h 551 4th (V) Whitehurst Julius T delmn r 112 Grady 488 Baldwin's and Telegraph's Whitehurst Thos H elk r 112 Grady Whittington Jessie (Mrs J R) opr Happ Bros Whitehurst Walter J (Rilla) 4 miller h 112 Grady Whitehurst Wm student r 224 Georgia Whitehurst Wm M (Sarah) (o) asst engr C of Ga Ry h 313 Buford pi (V) Whitener Ellen sten Ford Ware r 261 Georgia apt C2 Whitener Hazel ofc sec Dr C A Yarbrough r 261 Georgia apt C2 Whiteside Arth L announcer WMAZ r Central Hotel Whitfield Benj (c) jan So Bell Tel Co r 217 Calhoun Whitfield Clara (c) dom r 127 Bartletts la Whitfield Mack (c; Rosa L) 1 hlpr Boston Leather Co h 204 (1) Tatnall la Whitfield Mitchell (c; Minnie) (o) h 256 2d (V) Whitfield Mitchell Jr (c) hlpr Philadelphia Hat Cleaning Co r 256 2d (V) Whitfield Richd (c; Amy) 8 (o) h 122 (22) Wise (V) Whitfield Sallie (c) r 132 Pecan Whitfield W Herschel (Ann) 1 sta atndt Gulf Refining Co h 452 College apt 4 Whiting Geo (Jonnie) M) 2 lab h 205 Log Cabin dr Whiting Jerry (c; Addie) 2 (o) carder Bibb Mfg Co h 357 (211) 3d (U) Whiting Wallace L supt Union Bus Terminal r Gordon Hotel Whitlock A Fredk (Letha) tex wkr Payne Mill h 60 Davis (PM) Whitlock Arth D tex wkr Payne Mill r 60 Davis (PM) Whitlock Howard H (Thelma) tex wkr Payne Mill h 48 Davis (PM) Whitlock Mary (Mrs T C) tex wkr Payne Mill r 101 Green (PM) Whitlock Thos C (Mary) tex wkr Payne Mill h 75 Short (PM) Whitlock Thos C Jr (Mary L) 2 tex wkr Payne Mill h 101 Green.(PM) Co r 620 Anderson (SM) Whittington John R (Jessie) (o) h 620 Ander- son (SM) Whittington Katie Mrs 1 tex wkr r 8 Roff Home pi Whittington Mabel sec Methodist Orphans Home r do Whittington Mildred 1 r 102 Whitehead Whittington Sami msngr W U Tel Co r 620 WAhinttdleersJonCu(rStiMs )(Helen) 1 mgr A & P Tea Co h 911 Orange Whittle School Rosa Taylor prin 1 Hill Park Wiggins Chas (c) r 311 (114) Smith (EM) Wiggins Chas L (Lorine) gro 478 Clinton h do Wiggins Clifford W electrn Morris Putzel Inc r 930 Walnut Wiggins Gertrude ,(c) 1 cook Lucy Hubbard h 317 (313) Womack Wiggins Grest (c) maid r 770 Ocmulgee Wiggins John (c; Mary) h 256 3d (V) Wiggins John (c) lab h 540 (248) Smith (EM) Wiggins Julia nurse Macon Hosp r do Wiggins L Sterling (Emma) slsmn r 1162 Edge- wood Wiggins Mary (c) r 317 (313) Womack Wiggins Minerva (c) 1 tex wkr Bibb Mfg Co h 311 (114) Smith (EM) Wiggins Minnie (c) cook C B Andrews r 113 (11) Wise (V) Wiggins Ned (c; Exie) 1 (o) h 408 (510) May- nard Wiggins Richd W (c; Bessie) 2 (o) h 534 Clinton Wiggins Robt L tchr Wesleyan Conservatory r do Wiggins Rosa opr Happ Bros Co r 132 Gordon Wiggins Roy A (Agnes P) 1 trav slsmn h 202 Boulevard Wiggins Sami (c; Ella B) 1 (o) carp h 72 (143) Forest (V) Wiggins Stanford (Lena) emp McAfee Candy Whitman Iris L prof Wesleyan Col r do Whitmans Pharmacy (J G & J A Fausett) 179 Spring Whitmore Eliz matron Julia Parkham Jones Benevolent Home r do Whitmore Ophelia (c) 1 lndrs r 109 (205) Elliott Whitney Alice Mrs r 866 3d Whitney C Leonard asst mgr Newberry3 r 232 Co r 930 Walnut Wiggins Stella (wid W W) r 454 Clinton Wiggins Thos C (c) porter Glass Pharm r 534 Clinton Wiggins Vivian Mrs 1 tex wkr Adams Mfg Co r 2301 2d Wiggins W Carl (Adele) 5 emp Sunshine Creamery h 143 Tenney (SM) Wiggins Wade (c; Minnie) porter Glass Pharm Georgia Whitney Laura (c) 1 dom h 110 Powell Whitt Fred W (Kathleen H) mech Willingham h 113 (11) Wise (V) Wiggins Wm M (Bennie J) 3 (o) ins agt h 468 Duncan S&D Co h 101 Highland (NH) Wight Thos M emp C of Ga Ry r 318 New Whittaker Arth D student r 201 Pierce (V) Whittaker Claud J (c) r 168 Astor Wilbanks Hazel r 127 Violet Wilburn Azar (c) tr dr Buck Ice & Coal Co Whittaker Fred N (Marie D) supt Methodist Orphans Home r do Whittaker Fred N Jr student r 201 Pierce (V) Whittaker Geneva (c) dom h 168 Astor r 357 Madison (V) Wilburn Chanie (c) h 559 Smith row Wilburn Geo (c) emp Independent Ldry Co r 357 Madison (V) Whitten Harold A (Carolyn) 1 baker Central Wilburn Irene (c) r 411 Applewood Ga Bakery r 708 Hemlock Wilburn Iris r 104 Capital (Mikado pi) Whitten James A emp So Ry h 125 Charles Wilburn J Frank (Lois) 2 (o) sub sta mgr At- Whitten John H (Bessie) 4 tex wkr h 9 Roff lantic Ice & Coal Co h 219 Knott (SM) Home pi Wilburn J Thos (Frances) (Toms Place) flgmn Whitten Mae opr Happ Bros Co r 125 Charles C of Ga Ry h 150 Glynn Whitten Mattie r 125 Charles Wilburn Joseph L (Alleyne) 4 mech Riverside Whitten Ralph (Anna) elk Burney Bros Co Ice & Coal Co h 242 Jeff Davis (SM) r 489 Orange Wilburn Lester elk J C Moore r 219 Knott Whitten Theo J (Rosa) 3 r 825 Orange (SM) Whitten Wm P (Edna) 2 shpg elk Burney Bros Wilburn Lewis B (c) r Clinton rd extd (EM) Co h 361 Fairview Wilburn Lizzie (wid J T) r 150 Glynn Whittington Anna (c) 1 lndrs h 309 (602) Wilburn Louise (c) 1 lndrs r Clinton rd extd Colquitt (EM) Whittington Chas H (Corona) 6 h 394 Belmont Wilburn Mamie (C) maid r 411 Applewood Whittington Estelle Mrs 1 r 1069 Hazel Wilburn Mary (c) h 357 Madison (V) 1935 Macon City Directory 489 Wilburn Minnie 1 (c) (o) h 411 Applewood Wilburn Sidney (c; Ada) (o) trkr So Ry h 394 (376) Melrose Wilburn Sol (c) emp Macon Hosp r 357 Madi- son (V) Wilburn Wm (c) r 314 Norris Wilcher Carlos (c) r 214 Fargason (V) Wilcher Ida (c) 1 lndrs h 214 Fargason (V) Wilcher Orlando B (c) delmn O R Sowells Gro r 214 Fargason (V) Wilcher Sami (c; Eva) 1 lab City h 863 Ocmulgee Wilcox Addison (c; Priscilla) tr dr Worsham & Sherrill h 302 Ward (V) Wilcox Annie (c) h 141 Hazel Wilcox Arth (c; Beulah) lab Buckeye Cotton Oil Co h 339 Elbert Wilcox Beulah (c) tex wkr Atlantic Cotton Mills r 339 Elbert Wilcox Calvin I (c; Annie) 2 (o) swtchmn MD&SRR h 377 Madison (V) Wilcox Chas (c; Marie) 2 (o) h 119 (118) Orchard Wilcox David (c; Martha) 2 emp Terminal Hotel r 141 Hazel Wilcox Geo (c; Leola) h 101 (263) Bookers al Wilcox Geo M (Marian C) 2 pastor Vineville Presbyterian Ch h 102 Culver Wilcox Geo M Jr emp Bibb Mfg Co r 102 Culver (V) Wilcox Gerald E (Louise C W) dist engr FERA h 162 Georgia apt 4A Wilcox Henry (c) r 144 Bright al Wilcox Homer H (Gertrude) h 1240 College dr Wilcox Maria (c) r 119 (118) Orchard Wilcox Marian C student r 102 Culver (V) Wilcox Marie (c) dom R J Carmichael r 119 (118) Orchard Wilcox Pennie (c) cook Stansell Potato Chip & Sandwich Co Inc r 157 Bright al Wilcox Sara E tchr Gresham Sch r 102 Culver (V) Wilcoxon Hubert Ur mgr So Oil Stores Inc res RD 3 Wilcoxon John R (Mattie) car repr C of Ga Ry h 1992 3d Wilcoxon Robt E r 1992 3d Wilder Abr (c; Henrietta) 2 emp Bibb Mfg Co h 219 (820) Moore la Wilder Albert (c; Annie M) 2 (o) h 121 Key (U) Wilder Amos (c) r 160 Birch (U) Wilder Annie L student r 422 Duncan Wilder Annie M (c) dom H E Shoenfelt r 112 Johnson Wilder Buster W (Jennie) 2 peddler r 1016 Oglethorpe Wilder C Eug (Lucille) (o) gro 155 5th h 613 Holt Wilder Chas B sta opr Standard Oil Co r 122 Rembert Wilder Chas J (Hattie) (o) farmer h 122 Rembert Wilder Christine r 121 Stonewall pi (V) Wilder Claude E (Kath) agt Jefferson Standard Life Ins r 2111 2d Wilder Cleo (c) emp Maxwell Bros h 174 Astor Wilder Cornelia (c) cook r 407 (439) Forest (V) Wilder D Walker (c) (o) carp G G Hardeman Co h 1214 (1132) Woolfolk Wilder David (c) lab Buckeye Cotton Oil Co Wilder Delia (C) maid Lanier High Sch for Boys r 109 Short Wilder Edw (c; Lila) r Clinton rd extd (EM) Wilder Eldred (Lillie) 1 (o) (Wilders Gro) h 25 Melrose (B) Wilder Elmer (c) orderly Macon Hosp r 215 Plant (SM) Wilder Ernest (Aline) 2 r 352 Columbus Wilder Ethel Mae (c) r 609 Flanders Wilder Etta (c) clnr Payne Mill r 325 (298) Hawkins Wilder Frances (c) cook R E Sheridan r 232 Plant (SM) Wilder Geo C (Agnes) 2 emp C of Ga Ry h 109 Harrold Wilder Georgia r 121 Stonewall pi (V) Wilder Green (c; Carrie) firemn Proctor & Gamble Co h 115 (165) De Borde (SM) Wilder Hattie (c) 4 lndrs r 174 Astor Wilder Hattie E nurse 121 Stonewall pi (V) h do Wilder Henry lab r 1016 Oglethorpe Wilder Howard (c; Celia) emp Smiths Dairy h 1026 College dr Wilder J Harold (Lucia) 1 carrier P O h 453 New Wilder Jack A student r 422 Duncan Wilder James (c; Annie) 3 firemn Proctor & Gamble Mfg Co h 1635 Broadway Wilder James (c) lab Bldrs Lb's Co r RD 5 Wilder Jane (c) dom J T Shrophire h 175 Wood al Wilder Jennie (c) (o) h 609 Flanders Wilder John B baker C Ga Baking Co h 121 Stonewall pi (V) Wilder John H (Minnie L) firemn CFD h 422 Duncan Wilder John T (c; Louise) 2 porter R A Mc- Cord Mtr Co h 111 Wyche Wilder Laura r 2111 2d Wilder Lizzie (c) dom h 160 Birch (TJ) Wilder Louise (c) r 1635 Broadway Wilder Lucia M (Mrs J H) opr So'Bell Tel Co r 453 New Wilder Lula (c) emp The Clinic h 1057 Ogle- thorpe Wilder Mamie (c) maid h 117 Wyche Wilder Mamie B (c) h 407 (439) Forest (V) Wilder Marion H r 422 Duncan Wilder Mary F (wid W E) (o) h 606 Mont- pelier Wilder Matilda (c) r 830 Edgewood Wilder Monroe (c) r 117 Wyche Wilder Nathl (c; Elmira) 2 (o) hlpr h 402 Roye Wilder Nell r 2111 2d Wilder Oscar O (Laura) 8 (o) firemn CFD h 2111 2d Wilder Ruth M (c) (o) agt Thomas Funeral Home h 604 Straight (U) Wilder Wm L (Mary Ella) 1 mach Willingham S&D Co r 465 Duncan Wilder Willie (c) r 325 (298) Hawkins Wilder Wilson r 704 Holt Wilders Grocery (Eldred C Wilder) Bellevue rd cor Melrose Wilensky Jake H Leather Co J L Carolan mgr 514 Poplar Wiley Ada (c) maid Annie Willingham h 152 College Wiley Asa (c; Magnolia) 1 h 102 Antioch rd Wiley Clyde student r 862 3d Wiley Frank (c; Zoe) r 113 (542) Tinsley la Wiley Henry (c; Eliz) 1 exp 252 Broad r do Wiley Judith (Mrs S R) elk County Court of Ordinary r 323 Georgia Wiley L Clyde r 1250 2d Wiley Sara (c) maid r 152 College Wiley Sudie (wid J J) h 862 3d Wiley Wm (c; Adelie) 3 h 9 Franklin St la Wilford Oscar (c; Sara) 1 lab Atlantic Ice & Coal Co h 468 Bay Wilkerson Lula (c) cook 202 Pierce (V) 490 Baldwin's and Telegraph's Wilkerson Mary (c) 2 h 107 (171) Long la Wilkes Anne spinner Payne Mill r 18 Brigham (PM) Wilkes Drucilla (Mrs Harley) tex wkr Payne Mill r 103 Green (PM) Wilkes Eva (Mrs W A) spinner Bibb Mfg Co r 5 Bibb Wilkes Harley (Drucilla) 1 tex wkr Payne Mill h 103 Green (PM) Wilkes Homer G (Verna M) 2 slsmn Cudahy Pkg Co h 1021 Clinton rd (EM) Wilkes Jesse tex wkr Payne Mill r 128 Brookdale (B) Wilkes Leone r 716 2d Wilkes Lester W (Sallie) 1 tex wkr Payne Mill h 18 Brigham (PM) Wilkes Marvin tex wkr Payne Mill r 128 Brook- dale (B) Wilkes Oliver (Beulah) 1 tex wkr Payne Mil) r 18 Grand (B) Wilkes Owen student r 224 Georgia Wilkes Vera (c) 1 r 104 (4) Wise (V) Wilkes Wm A (Eva) 3 carder Bibb Mfg Co h 5 Bibb Wilkes Wm F (Mollie) 1 (o) h 128 Brookdale (B) Wilkins Claude W (Myrtie) 4 (o) trav slsmn h 104 Thomas (LCHts) Williams Amos D (Ima) (o) 1 blksmth h 10314 Rocky Creek rd Williams Andrew (c) lab F S Royster Guano Co Williams Andrew M (o) pres-genl mgr S Jones Co h 211 Corbin (V) Williams Anna (c) maid A J Long r 215 Plant (SM) Williams Annie r 107 Brookdale (B) Williams Annie (c) 1 cook G F Willis r 360 Campbell Williams Annie (c) tailor Edw Bashuk r 137 Roosevelt Williams Annie B (c) tchr Griffin Ga r 609 Center (EM) Williams Annie G (wid F L) (o) h 109 Napier Williams Annie L (c) r 436 Chestnut Williams Annie L (c) h 216 Walker la Williams Annie L (c) dom A G Reddy Williams Annie M (c) Indrs r 410 (22) Mit- chell al Williams Annie M opr Happ Bros Co r 128 Highland Williams Annie S (c) 1 waitress Anns Restr r 309 Elbert Williams Ardecia (c) Indrs h 105 (48) Traceys la Williams Ardell (c) r 1604 1st Wilkins James W (Minnie) hlpr r 555 Ogle- Williams Aretha (c) box mkr r 220 Pear thorpe Williams Arth (c; Essie) carp h 536 Flanders Wilkins Joseph E (Pearl) 1 h 103 Dixie Williams Arth (c; Mary) lab r 185 (562) Wilkins Lillian r 103 Dixie North (NH) Wilkins Pearl opr Happ Bros Co r 198 High- Williams Arth E (Beaufort) teller Luther Wil- tower (SM) liams & Son r 453 Boulevard (NH) Wilkins Sami L drftsmn Ellamae League r 720 Williams Arth L (c; Callie M) 2 lab r 857 3d Orange Williams Augustus (c) butler J W Hawkins Wilkinson Chas W (Della C) emp So Ry h 143 r 124 Plant row Laurel Williams Augustus (c) delmn Colemans Pharm Wilkinson Frank L 2 pres So Stages Inc h 855 r 469 Alabama Mulberry apt 303 Williams Beatrice (c) r 609 Center (EM) Wilkinson Josie L elk Newberrvs r 207 Forsyth Williams Benj (c; Annis) lab h 156 Edwards Wilkinson Sol (c) jan Y M C A h 23 Buckner (U) al Williams Benj (c; Lucille) 1 waiter Hotel Will Dollie (c) cook M M Sistare r 13 (651) Dempsey h 594 Fort Hill Witkowskis la Willett Dora opr Happ Bros Co h 865 1st apt 2 Willett Hettie (c) Indrs r 935 Montpelier Williams, see also Willums Williams A Julian (c; Annie) (o) carp h 239 1st (V) Williams AW (c; Sweetie) (o) lab Buckeye Cotton Oil Co h 100 Johnson (SM) Williams A Wallace student r 405 Ridge (I) Williams Aaron (c; Patsy) emp Bibb Mfg Co r 965 Hazel Williams Ada (c) r 100 (5) Franklin St la Williams Albert (c; Annie) 2 h 5 White al Williams Albert S (c; Julia) 3 carrier P O h 115 Douglas (V) Williams Alberta D (Mrs J H) sten Willingham & Payne Inc r 226 High Williams Alf (c; Lula M) hse clnr r 83 (114) Roosevelt (V) Willjams Alice (Mrs Noah) h 13 (69) Mill williams Alice (c) 1 r 122 (260) Singletons la W imams Alice (c) maid Middle Ga Hosp r 315 Madison (V) Williams Alice A (Mrs E E) waiter Williams Williams Benj (c; Charlotte) 2 wtchmn T & T Packing Co h 400 Tindall (SM) Williams Bernard dancing tchr r 109 Napier Williams Bertha (c) h 126 Bright al Williams Bertha (c) r 527 Gilmer Williams Bertha (c) cook Florence Wilson Williams Bessie Mae (c) r 239 Morgan Williams Beulah (c) 2 clnr Bibb Mfg Co h 103 Sapp (U) Williams Britt (c) r 317 Hammond Williams Broadus tex wkr Willingham Mills r 69 Mill Williams Buford (c) 1 r 552 Hammond Williams Bush (c; Mary) 4 lab Cherokee Brick Co r 504 (505) Crisp Williams Carl stock rm Happ Bros Co r 109 Napier Williams Carl (c) tr dr Kinnett-Odom Co r 157 (313) Nussbaum Williams Carmea nurse Macon Hosp r do Williams Carrie (c) r 423 Elbert Williams Carrie (c) cook D I Lee r 142 2d (V) Williams Carrie (c) dom r 103 Sapp (U) Williams Cath r 226 High Place r 2635 Broadway Williams Cecelia (c) 1 cook G R Harvey h 327 Williams Allen (c; Mary A) lab r 518 Calhoun williams Allen (c; Martha) lab Cherokee Brick Co h 504 (505) Crisp Cedar (U) Williams Ceipher R (c; Alice) 4 sausage mkr Swift & Co h 244 Plant (SM) Allie V (Mrs H WMAZ r 131 Hines ter G) (V) program dir Williams Celesta (c) cook Bessie Merritt r 254 Madison (V) Williams Amanda Pres Willingham S&D Co, h 139 Jefferson-- Tel 3912 Willingham Ouida M student r 102 Mill Willingham Pauline elk FERA r 930 College apt 3 Willingham Ralph W tr dr Sawyer Coal & Ice Co r 102 Mill Willingham Sarah (wid P D) (O) h 545 College WILLINGHAM SASH & DOOR CO, O P Willingham Jr Pres, C Y Alexander Vp, B L Johnstone Sec-Treas, Sashes, Doors & Building Materials, Retail Store 457 3d--tel 278; Factory 7th cor Cherry--tel 156 (See left side lines) Willingham Thos M (Frances) (o) pres Central --Sash & Door Co h 525 College apt 1 Willingham Virginia waitress Mitchell & Williams Inc r 115 School Willingham W Bibb (Lynda) slsmgr Central S&D Co h 525 College apt 4 Willingham Wm A (Lora G) carp h 653 New Willingham & Payne Inc W S Payne Jr pres A R Willingham vp J H Williams sec Calder Payne treas ins 350 2d Willis A Ollie (Lucile) h 163 Spring apt 1 Willis Addie (wid W E) h 418 Plum Willis Alberta (c) student r 405 (332) Elizabeth (SM) Willis Annie r 526 Log Cabin blvd Willis Annie H (c) clnr Bibb Mfg Co r 1123 Napier Willis Benj F elk Great A&P Tea Co r Gordon Hotel Willis Bessie opr Happ Bros Co r 1318 3d Willis C Wm (Annie M) hlpr h 164 1st Willis Celias (c) sta firemn r 227 (722) Pear Willis Chas student r 224 Georgia Willis Chas B 2 mldr r 102 Wood Willis Clarence (c) sta atndt J Brad Wall r 226 Madison Willis Corlie (c) porter Ry Exp Agcy r 325 Green Willis Doris opr So Bell Tel Co r 722 College Willis Earl r 524 Log Cabin blvd Willis Edmund (c; Annie B) 1 porter h 1123 Napier Willis Edw (Edith) 2 slsmn r 251 New Willis Edw A baker Am Bakeries Co r 320 College Willis Eliz (c) dom B C Jones r 68 Schofield 1935 Macon City Directory 497 Willis Ella (c) maid J W Stephens r 205 Patterson Willis Emma (c) cook D M Poland r 343 Ernest Willis Emma (c) 1 maid I O Allen h 405 (332) Elizabeth (SM) Willis Eula (c) cook r 1123 Napier Willis Frank (c) r 405 (332) Elizabeth (SM) Willis Fred (c; Ella) 2 h 205 Patterson Willis Geo A (Mattie L) 1 agt Southeastern Exp Co h 107 Lamar (V) Willis Geo A Jr (Frances) 2 elk Southeastern Exp Co r 203 Ridge (I) Willis Geo C (Ola N) 1 druggist Mitchell & Williams Co r 710 Anderson (SM) Willis Geo G elk r 102 Wood Willis Geo W (Lutie) emp GS&FRR h 514 Giles Willis Gladys (wid Jos) r 1827 Broadway Willis Gordon F (Nettie) (o) formn C of Ga Ry h 127 Knott Willis Harold E emp Leaptrot's Dry Cleaning Co r 107 Lamar (V) Willis Harry (Eddie L) 1 slsmn Macon Sup Co h 524 Log Cabin blvd Willis Harry Jr r 524 Log Cabin blvd Willis Henry A (Addie) 2 emp C of Ga Ry h 301 Blackburn Willis Jacob T (Mary V) (o) h 884 Hillyer Willis James r 524 Log Cabin blvd Willis Jas (c) r 1303 (514) Woolfoik Willis Janie (Mrs Monroe) spooler Bibb Mfg Co r 513 Arch Willis Jennie M (c) cook Elijah Adkins r 110 (10) Tracy's la Willis Jesse (c; Eliz) (o) h 68 Schofield Willis John student r 854 Cherry Willis John (c; Lizzie) 1 trkr C of Ga Ry h 860 Hurley la Willis John W h 526 Log Cabin b'lvd Willis John W (Willie W) elk C-M-P Drug Co h 606 Montpelier Willis Jos (c; Alice) lab Birdsey Flour Mill h 443 Tindall (SM) Willis Josephine (c) asst D T Walton r 462 Broad Willis Josephine (wid C B) 2 smstrs 1242 Col- lege dr h do Willis Laura (c) 1 r 205 3d (B) Willis Lillian (c) 3 h 620 (619) 4th (V) Willis Lillie T (wid S W) (o) h 307 Ross Willis Lizzie (c) 1 lndrs h 110 (10) Tracey's la Willis Lutie G (Mrs G W) sten So Bell Tel Co r 514 Giles Willis Maggie (wid E B) (o) soft drinks 1703 Broadway h 102 Wood Willis Marjorie r 1242 College dr Willis Milledge C (Hallie) 4 br mgr Birdsey Flour Mills h 122 Garden Willis Monroe (Janie) 3 r 513 Arch Willis Morton (c) elk County Relief Admn r 462 Broad Willis Myra r 555 Broadway Willis Nora nurse Middle Ga Hosp r do Willis Onnie H formn Central Cotton Oil Co res Franklington Ga Willis R Alvin slsmn Standard Paper Co r 884 Hillyer Willis Ray R (Ruby) (o) mech City Storage Garage h 331 American blvd Willis Robt L (Mary L) 1 (o) blksmth Taylor Iron Wks h 422 Ross Willis Sherrod (c; Dolly) lab Bibb Mfg Co h 371 Flanders Willis Thos (c; Emma) (o) hlpr h 343 Ernest Willis Thos (e; Cora) 4 lab r 308 Edgewood Willis W C emp P L Hay h 533 Orange apt 12B Willis W Fay (Florrie) 1 routemn Crescent Ldry h 722 College Willis Wm (c; Adele) lab h 1321 Broadway Willis Wm B Jr (Irene) 1 printer Macon Teleg Pub Co h 320 Bond Willis Wm J (Ruby) r 1248 2d Willis Zell waitress Wisteria Cafe r 112 Lamar Wills Helen (c) r 618 4th (WH) Wills Jos E (Ida) r 26 Melrose (B) Willums W Lee ice sta mgr Atlantic Ice & Coal Co r 908 Ridge (I) Willums Jas W (Fanyb'el) 1 (o) engr C of Ga Ry h 908 Ridge (I) Wilmore Annie B (c) maid r 207 Orange Wilmore Annie M (c) 2 dom C L Coney h 177 Lincoln (V) Wilmer Maurice stockmn Edw Bashuk r 412 Vineville Wilson Alf (Belle) 2 tex wkr Atlantic Mill h 100 Pinkerton Wilson Alice (c) r 49 (54) Green's al Wilson Annie (c) 1 r 811 Center ( EM) Wilson Annie (Mrs F W) tex wkr Bibb Mfg Co r 212 Hydrolia Wilson Arth (c) jan r 113 (118) Adams Wilson Beatrice Mrs r 116 Roye Wilson Belle (c) 2 h 117 Jones Wilson Bessie (c) drsmkr 207 4th (V) h do Wilson Carl J (Helen) 1 elk Wilson's r 99 Coleman Wilson Carl T (M Ruth) 1 asst mgr Macon Linen Sup Co h 407 Duncan Wilson Carrie (Mrs H M) opr Happ Bros Co r Trammell (Lynmore Estates) Wilson Chas (c; Mamie) 2 bellmn Fickling Ho- tel h 242 Woodliff Wilson Chas (c; Laura) 2 emp Procter & Gam- ble Mfg Co h 806 (807) Charles Wilson Chas B (Dollie) 3 mech Adams-Buch- anan Mtr Co h 110 Whitehead Wilson Chas G (c; Maude) 1 lab Maxwell Bros h 201 Hazel Wilson Chester (c; Cleo) 1 h 112 e Ell Wilson Clay (Mattie) farmer h 1017 (2011) Log Cabin blvd Wilson Cornelia (c) cook C E Newton r 231 3d (V) Wilson Cornelius (c; Martha) 2 lab G Bernd Co h 422 Elliott Wilson D Leon (Louisa F) 1 (o) associate genl agt Penn Mut Life Ins Co h 400 Hill Crest Wilson D Leon Jr elk Worsham & Sherrill r 400 Hill Crest Wilson Danl (c; Millie) h 416 Ward (V) Wilson Dollie F (wid J F) opr Adams Mfg Co r 215 (161) Center Wilson Dora (Mrs E A) opr So Bell Tel Co r 657 Pine Wilson Dorothy L slswn Kaybee Clo Store r 147 High Wilson E Mae (c) h 327 Monroe (V) Wilson Edgar (c) clo presser r 508 Clinton Wilson Edgar S slsmn r 341 Hardeman Wilson Ellen (c) h 58 Spring Wilson Ellen (c) student r 922 Montpelier Wilson Elmer A (Dora) test deskmn So Bell Tel Co r 657 Pine Wilson Erie chf opr So Bell Tel Co r 108 Buford pi Wilson Ernest W (Ruby) 1 linemn So Bell Tel Co r 653 Pine Wilson Estelle R (wid A H) h 147 High Wilson Ethel sten Central S&D Co r 800 Ridge Wilson Eva (c) r 125 Roosevelt (V) Wilson Evelyn (c) sch tchr r 227 Orange Wilson Fannie E (wid J W) r 141 Pierce (V) Wilson Fletcher C (Florence) electrn J W Wil- son Elec Repr Shop r 212 New Wilson Florence (wid F C) bdg 554 1st h do Wilson Frank (c; Effie) h 215 Ward (V) 498 Baldwin's and Telegraph's Wilson Frank (c) emp Buckeye Cotton Oil Co Wilson Mary ofc wkr FERA r 1152 Milledge- 243 Tindall (SM) ville rd Wilson Frank C bus opr Ga Power Co res Way- Wilson Mary M h 341 Hardeman side Ga Wilson Mary S (wid J L) r 1664 2d Wilson Frank G (Wilson & Vandiver) r 663 Wilson Matthew (c; Lula) h 513 Elliott Spring Wilson Matthylde chf probation ofcr County Wilson Frank W (Annie) r 212 Hydrolia Wilson Geo (Opal) 3 h 1057 Elm Juvenile Court r 800 Ridge (I) Wilson Mattie (c) cook Agnes Hands r 611 Wilson Georgia Mrs 1 slswn Sears Roebuck r Hazel 754 Plum Wilson Mildred Mrs winder Bibb Mfg Co r 421 Wilson Gussie R Mrs (o) emp Bibb' Mfg Co h Oak 102 3d (SM) Wilson Mittie (c) maid Kenmore Burns r 416 Wilson Harry (c) r 320 Cheatham al Ward (V) Wilson Hattie L (Mrs J W) opr So Bell Tel Wilson Moses P (Mae) 2 (o) dairymn h 1194 Co r 1805 2d Milledgeville rd Wilson Henry (c; Jessie) 1 lab h 203 Hazel Wilson Myrtle C slswn H L Green & Co r 3500 Wilson Henry M (Carrie) (o) sta engr h Tram- Houston mell (Lynmore Estates) Wilson Nancy (c) dom A S Hatcher r 126 1st Wilson Hollie (c; Lillie) 6 h 149 (214) Nussbaum (WH) Wilson Inez (c) h 416 (426) North Wilson Nannie (wid U C) r 947 Montpelier Wilson Iva N (wid S P) r 583 Boulevard (NH) Wilson Naomi cash R A McCord Mtr Co r Wilson J Bernard (Pearl) Idry solr r 715 Pine 215 New Wilson J Edw (Louise V) (o) dept mgr Burden Wilson Ned (c; Dolly) 2 porter Heard Bros h Smith & Co h 2725 Forsyth rd 135 Ritchey WILSON J W ELECTRICAL REPAIR SHOP Wilson Norwood (c; Cornelia) (o) jan First Nat (John W Wilson) General Electrical Repair- Bk bldg h 231 3d (V) ing, 23 Wall--tel 373 Wilson Odelia (c) 5 r 112 (12) Alabama (SM) Wilson J Woodrow (Mabel) doffer Bibb Mfg Wilson Oscar (c; Roberta) h 114 Gaillard (V) Co r 123 (8) Myrtle (EM) Wilson Otis (c; Mattie) 1 (o) carp h 112 Wilson Jack baker Sunlite Electrik Bake Shop Mitchell Inc res Bolingbroke Ga Wilson Paul mech R A McCord Mtr Co h 126 Wilson Jas (c) h 208 (4) Tatnall la Steele Wilson Jas (c; Evelyn) 2 presser r 227 Orange Wilson Pearl (Mrs J B) inspr New York Clnrs Wilson Jas M (Julia) 3 emp C of Ga Ry h r 715 Pine 712 1st Wilson Pearl (c) maid W B Sparks Wilson Janie emp Nat Pecan Mktg Assn r 353 Wilson Phoebe (c) h 203 Mutual (V) Fairview Wilson Richd (c) delmn College St Gro r 120 Wilson John (c) emp So Crate & Veneer Co r Tatnall la 755 Fort Hill Wilson Robt E (Myrtle) 1 (Wilson's) r 663 Wilson John D (c; Georgia) 3 lab h 313 Hazel Spring Wilson John E (Margt C) (o) (John E Wilson Wilson Robt L (c; Mary) 1 lab r 421 e 2d (EM) & Son) h 618 Forsyth Wilson Robt L (Sarah) (o) pres GAB Sch of Wilson John E (Lizzie) hlpr h 353 Fairview Commerce h 800 Ridge Wilson John E Jr (John E Wilson & Son) r Wilson Rosa (c) h 8 Murray al 618 Forsyth Wilson Ruby (Mrs E W) opr So Bell Tel Co r Wilson John E & Son (J E & J E Jr) ins 702 653 Pine Bibb bldg Wilson Rufus (c; Mary) emp So Crate & Ve- Wilson John L (Virginia) 1 lab r 962 Ogle- nere Co h 755 Fort Hill thorpe Wilson Sally B (wid S B) h 518 Log Cabin Wilson John M (Mattie) emp C of Ga Ry r blvd 712 1st Wilson Sami mech Harper's Garage r 3500 WILSON JOHN W (Hattie L) 2 (J W Wilson Houston Elec Repr Shop) h 1805 2d--tel 2879-J Wilson Sarah (c) r 215 (434) Thompson's al Wilson Jos W (Mary) trav frt agt L&NRR h Wilson Thos (c; Annie) 1 (o) carp h 485 305 College apt 3 Short al (V) Wilson Lillian (c) student r 120 Tatnall la Wilson Thos (c) lab r 313 Hazel Wilson Lizzie (c) h 240 Middle (V) Wilson Thos L (c) lab Maxwell Bros r 201 Wilson Lonnie (c; Cora) 1 h 2 (350) Hanson Hazel (SM) Wilson Vera (c) maid L W McManus r 129 Wilson Louis B (Loretta) (o) (Wilson's) h 123 Adams Highland Wilson W Alex hlpr Odom Candy Mfg Co r Wilson Louise (o) h 518 Log Cabin blvd 653 Pine Wilson Louise h 816 3d Wilson W Harry (Margt) 2 agt Am Nat Ins Wilson Lucile (c) h 1 Moore al Co r 109 3d Wilson Lula (c) r 115 Elm Wilson Walker clnr Snow's Ldry RD 2 Wilson Madison (c; Julia) 4 lab Murphey Tay- Wilson Warren G (o) elk Macon Transient Bur lor & Ellis h 109 Rose Crest h 165 Cherokee Wilson Mamie (c) h 103 e Ell Wilson Whitfield (Nellie) emp C of Ga Ry r Wilson Margt r 618 Forsyth 150 Holt Wilson Margt Mrs r 126 Steele Wilson Wm (c; Eliose) 1 hlpr Maxwell Bros h Wilson Margt (Mrs W H) slswn Mary Eliza- 755 Edgewood beth Shop r 109 3d Wilson Wm (c; Evelyn) 1 lab So Crate & Ve- Wilson Marvin P (Mildred) 2 winder Bibb Mfg neer Co r 316 (65) Plummer's al Co h 1015 (2009) Log Cabin blvd Wilson Wm (c) porter Hotel Dempsey r 108 Wilson Mary r 663 Spring Wilson Mary (c) lndrs Ga Acad for the Blind Spring Wilson Wm B (c) r 240 Middle (V) Wilson Wm P (Myrtle) 2 (o) servmn So Bell h 111 Rose Crest Tel Co h 684 Hillyer 1935 Macon City Directory 499 T Wilson Wm T (Ada) h 118 (9) Holt Wilson Willie student r 866 Mulberry Wilson Willie L (c) 3 h 3 Mitchell (EM) Wilson Zana (wid J E) (o) h 663 Spring Wilson & Vandiver (F G Wilson W H Vandi- ver) lawyers 305 Macon Sav Bk bldg Wilson's (J W, L B' & R E Wilson) gros 203 Hardeman, 772 Hazel & 324 Main (EM) Wimberly Alex carder Bibb Mfg Co r 362 Robinson rd Winchester Robt P (c; Sadie) 2 carder Bibb Mfg Co h 362 Robinson rd Winchester Sadie (c) carder Bibb Mfg Co *r 362 Robinson rd Winchester Thos H (Laura D) 3 (o) civ engr h 119 Vista cir (I) Winders J Fredk (Lillian) 2 slsmn Burden, Smith & Co h 556 Edgewood Windham Gladys nurse Macon Hosp r do Windman Mamie (wid W W) h 715 Pine Windom Hewlitte Mrs 2 r 103 Grand (B) Windom Jack W (Velma) 2 h 125 Clisby pi Winfield Jesse T (Alma) (o) emp MD&SRR h 720 Orange Wing Augustus M (Laura) (O) pres Bearings Supply Co h 1106 Ridge (I) Wing Clifton r Fickling Hotel Wing Harry r Fickling Hotel Wingate John O (Etna) 2 tex wkr Payne Mill h 105 Brookdale (B) Wingate Noah (Addie M) 4 tex wkr Atlantic Cotton Mills h 20 Atlantic Wingate Roger W tex wkr Bibb Mfg Co r 105 Brookdale (B) Wingate Ruth (Mrs R W) r 1421 3d Wingers John emp Art Furn Mfg Co r J21 Grady Wingfield Frank (c) firemn Procter Sz Gamble Mfg Co r 415 Mitchell al Wingfield Henry (c; Fannie) lab Standard Tool & Handle Co r 905 Elbert Wingfield Sami B (Annie) pastor Second Bap- tist Ch h 1703 2d Winn Cozzy (c) student r 625 3d (V) Winn Ella (c) 1 h 625 3d (V) Winn Eliz registrar Wesleyan Col Winn Geo B )Righton M) slsmn Bibb Chevrolet Co r 535 Vineville (V) Winn Goode (c; Ella) 1 h 518 Calhoun Winn Ida (c; lndrs h 6 (313) Hanson (SM) Winn Lila (c) cook r 625 3d (V) Winn Liza (c) cook J H Turner 509 Baldwin's and Telegraph's Winn Righton M (Mrs G B) elk Vineville Drug Womack Jas J (Mary E) 1 emp So Ry h 871 2d Co r 535 Vineville (V) Womack Lucille Mrs 2 h 513 Telfair (SM) Winn Wm (c) r 625 3d (V) Womack Lura (wid T E) 1 r 514 Jackson Winn Wm M (Martha L) 3 agt Bankers H&L Womack Mildred r 514 Jackson Co h 538 Log Cabin blvd Woman's Benefit Association mets 2d & 4th Winship Florence (wid Herring) 1 (o) tchr Tuesday 515 2d Miller High Sch h 203 Cherokee Woman's Exchange (Mattie Nutting Cora Wal- Winship Herring student r 203 Cherokee ker) novelties 209 Cotton Winship Mary L student r 203 Cherokee Wommack A Jack r 1435 2d Winship School Jessie Rice prin Beech cor Pio Wommack J Frank teg wkr r 100 (206) Nono Green (V) Winslett Usher T (Clara H) 1 (o) County Tax Wommack Jamie R (Anne) tex wkr Bibb Mfg Coir h 116 Cleveland (V) Co h 720-22 Oglethorpe Winletter Margt E opr rm supv Oglethorpe Wommack Wm A Jr (Florence) 1 tchr Lanier Private Infirmary r 1309 Oglethorpe High Sch for Boys h 930 College apt 1 Winston Jas (c; Mabel) 2 h 402 (509) Prince Wood Abner W (c) h 416 Phillips la (SM) Wood Beulah (wid G H) (o) h 1901 2d Winter Jas C student r 395 Hill Crest Wood Chas (Mattie) 4 hlpr h 134 Schell (EM) Whiter Ruth C student r 395 Hill Crest Wood Chas G (Mary O) 1 elk Dunlap-Peeler Winters Bertha (c) maid L M Loh r 327 Mon- Hdwe Co r 137 Boulevard roe (V) Wood Danl doffer Bibb Mfg Co Winters Ida Mrs hskpr 966 Oglethorpe r do Wood Dolly (c) r 1238 1st Winters Thos (c; Bertha) h 337 Monroe (V) Wood Edith student r 201 Pierce (V) Winton Chas (c) h 1 Parker al Wood Elmo (Mary) 5 dolpher Bibb Mfg Co h Winton's Pharmacy (L A & W E Bloodworth) 1000 2d 248y2 Main (EM) Wood Ernest W (Annie L) 1 br mgr East Ma- WIPPLER WM F (o) Sta Mstr Terminal Sta-- con Ice & Coal Co r RD 2 Tel 4993 h 748 College--Tel 4728 Wood Etta (wid C I) h 904 Cherry Wisdom Milton (c; Pauline) h 108 May (U) Wood Florence E tchr Virgil Powers Sch r 800 Wisdom Oscar (c; Roberta) h 15 Parker (V) Napier Wisdom Rufus (c; Addie M) 1 h 317 Patterson Wood Fredk H (Martha) 1 solr Swift & Co r Wise Alyne C (Mrs T A) ofc sec Macon Teleg 116 (130) Charles Pub Co r 537 Boulevard (NH) Wood Geo D (Annie) slsmn Bailey Auto Parts Wise Anna (c) r 538 (539) 3d Co h 870 2d Wise Jas (c; Alice) h 538 (539) 3d V) ( Wood Geo W mach Taylor Iron Wks r 870 2d Wise John W (Lila M) flgmn C of Ga Ry h Wood Henry (c; Lula) lab Cherokee Brick Co 756 y2 New h 1106 Elbert Wise Mary E (c) maid M O Smith r 125 Roose- Wood Henry B (Martha) mach Bibb Mfg Co r velt (V) 622 Main (EM) Wise Richd (c; Ruby) lab T&T Pkg Co h 607 Wood Hollis J (Allie) trav slsmn h 613 1st (22) Gilmer Wood Ida L (Mrs J T) spinner Bibb Mfg Co r Wise Sami (c; Arrie) (o) ydmn S R Jaques h 29 Bibb 103 Walls al Wood India (c) h 392 Telfair Wise Trammell A (Allene C) trav slsmn r 537 Wood J Arth shpg elk McAfee Candy Co r 239 Boulevard (NH) Carling Wise Walter (c) lab C of Ga Ry Wood Jackson (c; Emma) h 229 (217) North Wisteria Cafe (J A Smith Jr) 420 Cherry Wood Jas (c; Dolly) lab Standard Tool & Han- Witcher Julius G (Myrtice) 1 ry condr h 746 dle Co r 1238 1st Patterson Wood Jas E speeder hd Bibb Mfg Co r 1029 Witcher Martha student r 746 Patterson Wood Jas N Jr (Viola) 1 mgr City Storage Witcher Melvina (c) r 204 (100) Virgin la (V) Garage h 613 Arch Witherington Virginia nurse Macon Hosp r do Wood Jas N ni emp City Storage Garage r Withers Grant (c; Jennie) 1 emp Carling 'file 613 Arch Co h 305 (418) Elizabeth (SM) Wood Jas T (Ida L) 1 twister Bibb Mfg Co h Witman Jack M (Theresa) slsmn r 800 Cherry 29 Bibb Witman Louise r 800 Cherry Wood Jos (c) chauf A R Willingham r 389 Woco Pep Filling Station L B Parker mgr 2101 Madison (V) Vineville (V) Wood Josephine (c) r 104 (2) Franklin St la Wofford Oil Co C T Bowden dist mgr F W Walthall local mgr, plant 101 Walnut, serv stas Wood Julian H mtrcycle ofer CPD r 1901 2d Wood Kemp G (Slona) 2 emp Atlantic Mills h 672 Spring & 1600 2d Wolf Abr (Roe) 1 (Sportman's PI) shoe repr 416 Poplar h 168 (138) Oakland Wolf Delinski r 243 Ross Wolf Jane E prof Wesleyan Col r 320 Orange Wolf Moses (Ida) h 243 Ross Wolf Zelik (Sylvia) 1 (New Serv Shoe Store) h 109 Brentwood Wolfe Arth C baker Sunlite Electrik Bake Shop Inc r 821 Mulberry Wolff Carolyn Mrs r 305 College apt 5 Wolff Martin (Elberta) (o) h 112 Forest (B) Wolff Wm Cemetery ft Madison (V) Wolithin Lodge No. 390 F&AJM R W Wyche sec meets 1st & 3d Tuesdays 8pm 710 Mulberry Womack Chas Jr (c; Mabel) r 6 Berthadale dr . (V) 13 Atlantic Village Wood Leila B (c) dom C F McCook r 718 Daisy Wood Lizzie Mrs tex wkr Bibb Mfg Co r 254 Hydrolia Wood Louise (c) maid J F Heyser r 545 (203) Mitchell Wood Maggie (wid H C) 1 h 1343 (1311) Edgwood (SM) Wood Marie K sten r 904 Cherry Wood Martha K student r 239 Carling Wood Mary (wid A S) 1 r 914 New Wood Mary Mrs r 191 Oakland Wood Mary (Mrs Elmo) spinner Bibb Mfg Co r 248y2 Main (EM) Wood Mary W Mr3 h 239 Carling Wood Michl D (Lena) (o) carp h 122 Daley Wood Mildred L elk Newberrys r 123 (8) Myrtle (EM) 1935 Macon City Directory 601 Wood Minnie H (wid W H) 2 tex wkr Willingham Mills h 154 Carling Wood Minnie W Mrs 2 h 301 Beech Wood Obie L (Lucy) 1 elk W M McConnell h 123 (8) Myrtle (EM) Wood Ophelia P Mrs h 200 Plumtree (EM) Wood-Peavy Furniture Co E B Durham pres I D Greene sec K P Allen treas 357-65 2d Wood Quentin r 123 (8) Myrtle (EM) Wood Rabun M (Laura) 4 (o) supv C of Ga Ry h 101 West End Wood Raymond I farm hd r 301 Beech Wood Robt B solr Tatnall Sq Dry Cleaning Co r 191 Oakland Wood Robt L (Mamie L) 6 lab h 224 Main (EM) Wood Sidney E (Louise) mech Bibb Chevrolet Co h 109 Cabaniss (EM) Wood Stella tex wkr Atlantic Cotton Mills r 13 Atlantic Village Wood T Miller (Luna B) 3 slsmn Builders Lbr Co h 411 Beech Wood Thos J (Lucy) 1 (Bibb Poultry Co) h 756 Mulberry Wood Thos L (Florence) (o) plmbg Contr 512 1st h 800 Napier Wood Thos L Jr student r 800 Napier Wood Viola (Mrs J N Jr) elk Independent Ldry Co r 613 Arch Wood W Lee (Lois M) organist First Baptist Ch h 217 Bond Wood Wm (c) h 211 Lynwood (V) Wood Wm A (C'oml Barber Shop) r 109 Lee (Lynmore) Wood Wm A student r 239 Carling Wood Wm J r 200 Plumtree (EM) Wood Wm T (Marie S) (o) slsmn Robertson- Walker h 460 Overlook (I) Woodall A B (Nettie) 2 electm h 411 Main (EM) Woodall Ada L (c) 3 cook r 105 (24) Clara Woodall Alberta (c) cook Annie Hamilton r 101 Clara Woodall Annie (c) 4 lndrs h 507 (509) May- nard Woodall Arth (c) lab F S Royster Guano Co Woodall Ashby T (Eliz) park tndr Tatnall Sq h 105 Maynard Woodall Carolyn r 411 Main (EM) Woodall Chas J (Minnie) (o) carp h 718 (208) San Juan Woodall Doyle elk Piggly Wiggly r 569 Boule- vard Woodall Eliz (c) tchr East Macon Sch r 540 e 2d (EM) Woodall Elsie slswn S H Kress Co r 156 Crisp Woodall Gadson H (Leila) 1 h 1204 Edgewood Yoodall Hattie (c) lndrs h 133 Army Lot Woodall Henry F (Lucile) 2 (o) (Couch & Woodall) h 724 Main (EM) Woodall Jas (c; Lilia) lab r 103 (3) Alabama (SM Woodall Jas H student r 156 Crisp Woodall Jas R (Emmie) emp MD&SRR h 156 Crisp Woodall Jas W (Nora L) 3 (o) carp h 714 San Juan Woodall Lilia (c) maid r 103 (3) Alabama (SM) Woodall Spencer (c; Lillie) lab Riverside Lbr Co r 320 Hammond Woodall W Arth (Ilah L) 1 meats Clintern rd extd (EM) h 569 Boulevard Woodall Wade H (c; Lila) emp Central Tire Co h 449 e Academy (EM) Woodall Wm (c; Mamie) 2 emp Birdsey's Flour Mills r 1039 3d Woodard Boris (c; Eva) (o) emp C of Ga Ry h 304 Cedar (U) Woodard Cecil (c; Mildred) porter Hotel Lanier h 310 Madison (V) Woodard Dock W (Anne) 1 emp Clark Memorials Inc h 851 Hemlock Woodard Edmond (c; Dora) lab C of Ga Ry r 659 Spring Woodard Elaine r 851 Hemlock Woodard Elias (c; Mary) h 266 4th (V) Woodard Ella (c) tex wkr Bibb Mfg Co r 108 Concord Woodadr Ida (c) h 122 (488) Virgin (V) Woodard J Edw student r 2006 2d Woodard Jas (c; Zella) porter H L Green & Co r 108 Concord Woodard John H (c) porter Union Bus Ter- minal r 110 (340) Rock Woodard Knox (c) lab h 136 Phillips la Woodard Louise (c) hlpr Bibb Mfg Co r 962 Ocmulgee Woodard Marie student r 2006 2d Woodard Marion (c) r 9 (5) Sparks al Woodard Mary (c) r 219 Pear Woodard Mary (c) cook H A Key r 266 4th (V) Woodard Mattie L (c) maid r 6 (755) Sparks al Woodard Mildred (c) elev opr Hotel Lanier r 310 Madison (V) Woodard Montez sten Happ Bros Co r 851 Hemlock Woodard Myron B emp Macon Cafeteria r 851 Hemlock Woodard Oliver (c) h 9 Graham's lot Woodard Otis A (Eliz) agt Bankers Health & Life Ins Co h 2006 2d Woodard Salina (c) r 517 Coleman al Woodard Senetta (c) r 114 Hurley la Woodard Thos (c; Mary) h 9 (5) Sparks al Woodard U R elk FERA r Macon Hotel Woodard Valerie student r 851 Hemlock Woodell Ella elk Ivey-Turner Ice Cream Co r 551 Arch Woodell Luther F (Minnie) 2 elk PO h 561 Arch Woodell Melyear L tillerman CFD r 285 Wash- ington Wooden Eliza (c) ldry h 609 Ross Wooden Lee (c; Rosa L) 3 lab h 5 Ross St pi Woodfin Jessie slswn The Hat Box r 106 Os- borne pi (I) Woodford Benj (c) emp Jeffreys-McElrath Mfg Co Woodford Dorsey (c; Mamie) 4 ydmn Macon Hosp h 591 (557) Siam Woodford Dote (c; Ida) emp Jeffreys-McElrath Mfg Co h 221 Hawkins Woodford Lula Mill Wright Annie (c) maid Vivian West r 307 Clarkes (V) Wright Annie G (c) maid Wesleyan College h 71 Schofield Wright Athos W (Louise) 2 serv sta 2723 Houston (SM) h do Wright Augustus (c; Willie) 1 emp Carling Tile Co h 324 Smith (EM) Wright Barney (c; Frankie) pntr r 108 (512) Campbell (SM) Wright Benj (c; Fannie) emp Coca Cola Btlg Co h 450 Clinton Wright Betty Mrs r 866 3d Wright Beulah Mrs speeder hd Payne Mill r 104 (201) Grand Wright Brady r 324 Dannenberg Wright Carlton (Mary) spinner Bibb Mfg Co r 1414 Edgewood Wright Carrie (c) r 6 (157) Duffey's al Wright Carrie (c) r 720 (630) Prince (SM) Wright Carrie (c) lndrs h 218 Mitchell la (V) Wright Carrie L (c) tchr Hudson High & In- dustrial Sch r 217 Green Wright Cecil nb r 718 Main (EM) Wright Charity (c) r 452 Bay Wright Chas (Beulah) 2 r 104 (201) Grand Wright Chas r 446 Vine Wright Chas tex wkr Willingham Mills r 217 Duncan Wright Chas E emp R A McCord Mtr Co r YMCA Wright Clara (c) r 2 Barnhart's Bottom Wright Clara M (c) maid r 916 Ocmulgee Wright Clarence (c; Mattie) 1 delmn A Melton Gro r 423 (474) 3d (V) Wright Clifford L Mrs tchr Lanier High Sch for Girls r 324 College Wright Dollie (c) 1 lndrs h 112 (18) Spring )a Wright Dora (c) cook h 916 Ocmulgee Wright Dovie L student r 34 Schell (EM) Wright Edw (c; Rosa) h 322 Hammond Wright Edw (c; Hattie) (o) h 518 3d (V) Wright Edw (c; Eliz) lab C of Ga Ry h 208 Wright Effie (wid J L) 1 h 759 Poplar Wright Eliz emp Willingham Mills r 209 (28) Holt Wright Ella (c) r 424 Long St la (SM) Wright Ella L (c) dom r 105 Berthadale (V) Wright Ema emp Bibb Mfg Co r 34 Schell (EM) Wright Emma (c) cook r 720 (630) Prince (SM) Wright Emma B (c) clnr Bibb Mfg Co Wright Estelle (wid) educnl dir Masonic Home of Ga r do Wright Eva (c) maid W W Chrisman r 518 3d Wright Evelyn (c) maid H M Woodruff r 206 (120) Virgin la Wright Fannie (c) cook Emma Smith Wright Fannie (c) cook Len Berg Chili Parlor r 450 Clinton Wright Fannie (c) 1 dom r 328 McClain la Wright Felix (c) r 518 3d (V) Wright Florine (c) maid J P Haffey r 537 Grant Chapel rd Wright Francis H r 354 Spring Wright Frank (c; Gertrude) 4 lab h 547 (144) Mitchell ' Wright Frankie (c) maid Macon Dental Depot r 108 (512) Campbell Wright Geo B (Florence) 1 bkpr Cudahy Pkg Co r 147 Rose pk Wright Geo S (N Retha) (o) h 901 (907) Lost Cabin blvd 6 Wright Geo W tex wkr Willingham Mills r 217 Duncan Wright Georgia A ,G.c). 1 maid V H McMichael r 85 (130) Forest (V) Wright Georgia M (c) r 450 Clinton Wright Geraldine L Mrs h 254 College Wright Gertrude C (wid W A) (o) h 354 Spring Wright Grover C waiter J H Knight r 990 Montpelier Wright Gus (c; Addie) lab Buckeye Oil Mill h 119 (219) Dannenberg Wright Gussie (c) maid Alex Blair r 302 Plant (SM) Wright Gussie (c) maid Alex Blair r 302 Plant (SM) Wright Harry (Hattie B) (o) seeds 306 3d h 644 Forsyth Wright Hattie (wid W O) r 116 Beech Wright Henry (c; Gussie) 3 lab Maxwell Bros r 302 Plant (SM) Wright Herbert F (Lorene) acting prof Mercer Univ h 507 Adams Wright Hillery R (Wright's Gro) r 34 Schell (EM) Wright Horace A (Monica) 2 (o) h 587 College Wright Hugh W (Anne) emp So Ry r 671 2d Wright J Milton (Estella) (o) mach So Ry h 32 Marion pi Wright Jas (c) r 100 (406) Randall la Wright Jas (Grace) emp Willingham Mills r 332 American blvd Wright Jas (c; Alice) 3 clo presser 246 (r) Main (EM) h 134 Pecan Wright Jas (M Eliz) mgr Wright's Gro h 34 Schell Wright Jas E (c) barber Palmetto Barber Shop Wright Jas F (c; Mary) h 209 Lincoln (V) Wright Jas H (Eliz) 4 emp Sunshine Creamery h 548 De Borde (SM) Wright Jas I sta opr The Texas Co r 32 Marion pi Wright Jas T (c) (o) h 217 Green Wright James T Jr (c; Mary) hlpr r 217 (235) Williams la Wright Jas W (c) 3 r 518 3d (V) Wright Jesse E (Alline) 1 (o) sec-treas Nye Odorless Incinerator Co h 324 College Wright Jessie E Jr r 324 College Wright John (c) lab Riverside Lbr Co r 101 (263) Bookers al Wright John (c; Ida) 1 lab h 112 (101) Plum- mer's al Wright John (c) student r 720 (630) Prince (SM) Wright John A (c) lab Birdsey Flour Mills r 2 Barnhart's Bottom Wright John W (Josephine) 2 emp Willingham Mills h 209 (28) Holt Wright L Kath r 440 Duncan Wright Lena B slswn S H Kress Co r 440 Duncan Wright Lewis H (Ruth) 3 pastor Tatnall Sq Baptist Ch h 111 Coleman Wright Lillian L r 644 Forsyth Wright Lorena slswn Dannenberg's r 400 Vineville Wright Lorene ofc sec Mercer Univ r 507 Adams 604 Baldwin's and Telegraph's Wright M Louvenia slswn Dannenberg's r 440 Duncan Wright Maggie (c) r 301 Green Wright Mamie C (wid W H) h 130 High Wright Margt (wid S M) (o) h 867 Mulberry Wright Marie (c) 2 lndrs h 6 (555) Witkow- ski's 13/ Wright Mary (c) r 203 (365) Craft Wright Mary (c) r 1154 Edgewood Wright Mary (c) 7 h 720 (630) Prince (SM) Wright Mary (c) h 158 2d (V) Wright Mary K (wid C E) elk Wilson's r 663 Spring Wright Mattie (c) 1 h 752 Elm al Wright Mattie (c) r 302 Gordon (CH) Wright Mattie L (c) tchr e Macon Sch r 328 Hill Crest Wright Melvin E (Ruth G) 1 (o) h 901 Napier Wright Minnie (wid R T) h 901 Cherry Wright Nelson (c; Ruby) 1 (o) lab C of Ga Ry h 600 Center (EM) Wright Nettie (c) (o) h 608 Flanders Wright Nina Mrs 2 opr Happ Bros Co h 1664 2d Wright Nora (wid Andrew) opr Happ Bros Co h 718 Main (EM) Wright Ocie (wid T L) r 923 Log Cabin blvd Wright Olin emp C of Ga Ry Wright Otis W (Mary W) 1 r 765 Poplar Wright Pink (c; Bessie) emp Buckeye Cotton Oil Co h 209 (248) Thompson's al Wright R L (Alice) 4 tex wkr r 7 Roff Home pi Wright Robt (c) repr Paul Duval & Son Wright Robt T Jr electm Ga Power Co r 901 Cherry Wright Rosa B (c) maid H C Warlick r Dish- roones la Wright Ruby (c) 1 cook Mattie G Hill h 438 4th (V) Wright Ruby (c) maid G E Pruett r 130 Army Lot Wright Ruth (c) 3 h 6 (157) Duffey's al Wright Ruth (c) maid D D Dunwody r 218 Mitchel la (V) Wright Sallie Mrs 1 r 324 Dannenberg Wright Sara (c) h 142 4th (V) Wright Scrap r 140 Magnolia Wright Stella (C) h 416 (220) Elizabeth (SM) Wright Steve M Pharmacy Geo Watson mgr 503 Broadway Wright Susan F Mrs emp Met Life Ins Co r 533 Orange apt 3 Wright Susie (c) maid M L Connolly h 122 Cowan Wright T Gordon (Anna L) (o) slsmn Ga Roof- ing Co h 440 Duncan Wright T Gordon Jr r 440 Duncan Wright T Jos student r 202 Appleton Wright Tennyson G (Wright's Gro) r 34 Schell Wright Thos (c) cook W A Keel r 716 Haw- thorne Wright Thos P (Ethel) 1 shpg elk A B Lee Plmbg & Htg Co h 202 Appleton Wright Ulysses (c) delmn A Melton Gro r 206 (120) Virgil la Wright Victoria (c) r 112 6th (B) Wright Viola (c) emp Snow's Ldry r 916 Ocmulgee Wright Virgil (c) r 6 (157) Duffey's al Wright W Leo (Nellie) 3 asst mgr Met Life Ins Co h 116 Beech Wright Walter (c) 1 (o) h 303 Edgewood Wright Warren (c) h 484 Short al (V) Wright Warren (c; Hattie) 2 hlpr C of Ga Ry h 206 (120) Virgin la (V) Wright Warren Jr (c) emp A Melton Gro r 206 (120) Virgil la Wright Wm (c) plmbr r 1171 Oglethorpe Wright Wm C (c; Lola W) 2 (o) jan Municipal Auditorium h 113 Neals (V) Wright Wm C slsmn Goodyear Serv Inc r 354 Spring Wright Wm F (c) r 518 3d (V) Wright Wm R (c; Lucille H) 1 jan Mortimer Glover h 551 Ward (V) Wright Willie (c) h 119 (219) Dannenberg Wright Willie R (c) cook C A Rainey Jr r East Macon Wright Willie T (c) r 303 Edgewood Wright Woodrow W student r 440 Dujican Wright's Grocery. (H R & T G Wright) 266 Main (EM) Wrigley Frank J (Lucille) tex wkr Bibb Mfg Co r 138 Ell (SM) Wrigley Henry J student r 202 College pi Wrigley Henry P (Margt) (o) condr GS&FRR h 202 College pi Wrigley Lucille (Mrs F J) tex wkr Bibb Mfg Co r 138 Ell (SM) Wroton Lee C Mrs inspr Happ Bros Co r 809(4 Cherry Wrye Ada Lee (Annie) 4 hlpr h 855 2d Wrye Emmett H (Eliz) elk Mitchell & Wil- liams Co h 1103 Walnut Wrye Frank emp Am Dist Teleg r 855 2d Wrye Fred waiter Mitchell & Williams Co r 855 2d Wrye Gladys r 855 2d Wrye Jas W emp C of Ga Ry Wrye Mary Jo food checker Hotel Dempsey Wrye Minnie L (wid J W) h 108 (12) Balkcom Wrye Ruby elk Sid's Place r 108 (12) Balkcom Wurtzel John L (Small Animal Clinic) r Camp Wheeler rd RD 4 Wyatt Dora L (wid J W) 1 h 126 Beech Wyatt Inez Mrs waiter Oozy Corner Cafe Wyatt Maudie L Mrs spinner Bibb Mfg Co r 1514 2d Wyche Annie B (c) cook L D Brown r 404 (309) Bartlett Wyche Benj F (Carrie) emp Carling Tile Co h 713 Woolfolk Wyche Bernard M r 415 Virginia Wyche Davis (c) lab C of Ga Ry r 770 Ocmulgee Wyche Doris (c) dom J R Lamb r 404 (403) Mitchell (EM) Wyche Gertrude (Mrs J A) slswn Charis Corp r 126 Washington Wyche Guy C elk So Ry r 111 Pio Nono Wyche Helen waitress The Polar Bear r 713 Woolfolk (EM) Wyche Henry (c; Lillie) (o) picker Bibb Mfg Co h 102 Carter (B) Wyche J Alden (Gertrude) slsmn Steve M Sol- omon h 126 Washington Wyche Jas (c; Annie) lab C of Ga Ry Creo- sote Plant h 404 (309) Bartlett Wyche John (c; Ida) 6 lab h 226 Cedar (U) Wyche John C (Eunice A) (o) frt agt C of Ga Ry h 111 Pio Nono Wyche Leila (c) hse maid Ga Acad for the Blind r 1014 Ocmulgee Wyche Lillie (c) carder Bibb Mfg Co r 102 Center (B) Wyche Roy W (Annie C) 1 chf elk C of Ga Ry Creosote Plant h 302 Cherokee Wyche Sallie opr Happ Bros Co r RD 2 Wyche Wm E (c; Addie) 1 (o) lab C of Ga Ry h 200 3d (U) Wyley Wm (c) r 4 (456) Steins al Wylie Charlie (c; Estella) emp Heard Bros r 455 e Academy (EM) Wylie Estella (c) emp Hotel Dempsey r 455 e Academy (EM) Wynes Henry (c; Rosa) 2 r 309 2d (U) 1935 Macon City Directory 505 Wynes Marie (c) h 38 Gas House al Wynes Rosa (c) maid A J Swann r 309 2d (U) Wynes Wm (c; Rosa) 2 r 309 2d (U) Wynn Anna L (c) r 439 (443) Chestnut Wynn Buster slubber hd Bibb Mfg Co r 2108 Vineville Wynn Cecil C emp Bibb Mfg Co r 2108 Vine- ville Wynn Eug (c; Irene B) 2 h 207 Roosevelt (V) Wynn Fannie (wid J J) r 623 Walnut Wynn Geo O (Claudia) (o) pres Jackson-Wynn Co h 107 Rio Nono Wynn Georgia (c) 3 cook h 439 (443) Chestnut Wynn Harry emp Jackson-Wynn Co res Lizella Ga Wynn Henry (c; Bessie) (o) dist mgr Pilgrim Health Life Ins Co h 215 1st (V) Wynn Herbert (c) r 207 Roosevelt (V) Wynn J H emp C of Ga Ry r 865 Orange Wynn Jas (c; Nancy) h 425 Elliott Wynn James E (Annie E) 1 meats 954 (937) Montpelier res RD 2 Columbus rd Wynn Joseph (c) r 7 Berthadale dr (V) Wynn Joseph W (Roba J) 1 sec-treas Schofield Ins Agcy Inc h 103 Hill Crest rd Wynn Lafayette (c) r 134 Brooklyn (S) Wynn Lillian (Mrs W W) emp Central Pecan Mfg Co r 119 Lee (EM) Wynn Louis (c) r 134 Brooklyn (S) Wynn M Byron (Sarah E) 2 formn Ga Power Co h 103 Callaway (V) Wynn Manning speeder hd Payne Mill r 2108 Vineville Wynn Martha (c) maid S C Davis Jr r 207 Roosevelt (V) Wynn Marvin (Hath) bkpr Wofford Oil Co r 224 Georgia Wynn Minnie L (wid S J) r 305 Adams Wynn Nora (o) h 100 Troup Wynn Odessa (c) cook J W Willums r 134 Brooklyn (S) Wynn Odia r 63 Davis (PM) Wynn Orie (c) lndrs h 4 Wall St la Wynn Osborne (Grace) elk P O h 707 Vine- ville Wynn Pearl Mrs r 607 2d Wynn Ruth tchr Alex Sch No 4 res Lizella Ga Wynn S T (c; Nettie) chauf r 439 (443) Chestnut Wynn Simon (c; Sarah) 2 lab City St Dept h 7 Berthadale dr (V) Wynn Thos N (Donie E) h 2108 Vineville Wynn Wm W (Lillian) 2 tex wkr r 119 Lee (EM) Wynn Willie (c) lndrs Macon Hosp r 529 Cot- ton Wynn Yancey L (Mildred) 1 h 116 Roye Wynne Celia (c) r 118 (18) Wise (V) Wynne Chas (c; Mary) porter Standard Brick & Tile Co h 102 Tindall (SM) Wynne Henry M (Julia S) (o) bldr h 107 Heard (SM) Wynne John (c) emp So Ry h 903 (303) Elbert Wynne Julia (c) h 100 (5) Henry (SM) Wynne Lita (c) cook r 100 (5) Henry (SM) Wynne Lillie (c) maid Macon Hosp r 100 (5) Henry (SM) Wynne Ollie (c) r (10) Elbert la Wynne Robt (c; Annie) 1 dr Taylor Trans Co h 455 Arch Wynne Rob't F Jr (Cecelia) 2 div frt agt At- lantic & West Point RR Co h 724 Ridge (I) Wynne Rufus (c) jan h 8 (757) Sparks al Wynne Ruth D (wid W M) 1 dep elk U S Dist Ct r 404 Ingleside (I) X V Clothes Shop J V Sheridan mgr 454 Cherry Yancey Chas B (Nora) 3 emp C of Ga Ry h 324 Napier Yancey Evelyn cash Liberty Nat Life Ins Co r 105 Piedmont Yancey Raymond A (Mattie) 4 steel wkr h 101 Log Cabin way Yancey Sidney br mgr Am Oil Co r 263 College Yancey Thos B (Mary L) 1 (o) condr C of Ga Ry h 2420 2d Yancey Tossie (wid C B) 1 h 105 Piedmont (SM) Yancy Belle (wid Abr) r 234 Roff Home Yancy Gus L tex wkr Atlantic Cotton Mills r 234 Roff Home Yapp Ruby r 111 2d Yarborough James S (Clyde) barber Vineville Barber Shop r 303 Hines ter (V) Yarborough Louis (c) lab h 623 (206) Colquitt Yarborough Wm J (Kate S) (o) formn Proctor- Gamble Co h 2804 Houston (SM) Yarbrough Alvin r 154 Broadway Yarbrough C Augustus (S Viola) 1 (o) dentist 713 Bibb Bldg h 438 Vineville (V) Yarbrough Edna student r 764 Hemlock Yarbrough Ernest E (Ethel) slsmn Kingman- Burnett Stables res Lizella Ga Yarbrough Eug (c) r 123 Army lot Yarbrough Gertrude (wid H C) r 154 Broadway Yarbrough Gustie sch tchr r 438 Vineville Yarbrough Harriett Mrs r 764 Hemlock Yarbrough Jeanette (wid S J) 2 (o) tex wkr Bibb Mfg Co h 138 Ell (SM) Yarbrough John W USN r 438 Vineville Yarbrough Lewis student r 764 Hemlock Yarbrough Marie (c) maid r 424 (539) Hen- rietta (SM) Yarbrough Ouida student r 438 Vineville Yarbrough R Walker r 154 Broadway Yates A Jos ship elk Yates & Tabor Co Inc r RD Wesleyan dr Yates Carolyn student r 319 Forest Hill YATES CHAS H (Sarah N) 1 (o), Pres-Treas Yates Mtr Co Inc, h 109 Plaza (Stanislaus) --Tel 3188 Yates Christine (Mrs R L) slswn Carstarphen Inc r 1413 Edgewood Yates Dalice L (Ethel) supt Ga Roofing & Sup Co res RD 2 YATES DTJRWOOD (Arlena C) (o). v-p Yates Mtr Co Inc, h 374 Orange--Tel 2380 Yates Eliz ofc asst Arcadia Hotel r do Yates Elmer E (Lula W) 1 (o) shpg elk Kingman & Everett Inc h 780 Montpelier Yates Elmer E Jr r 780 Montpelier Yates Evelyn S sten Idle Hour Nurseries r Arcadia Hotel Yates Flavrie C (Mrs T E) elk Idle Hour Nurseries r 91 Lawton Yates Fred H (Lillian) dept mgr Bibb Chevrolet Co r 534 Log Cabin blvd Yates G Morgan (Margt) (o) sis mgr DunlapPeeler Hdwe Co h 404 Forsyth Yates H Roscoe (Louise) shpg elk Am Bakeries Co r 3024 Houston (SM) Yates J Emory (Gladys) 2 (o) slsmn h 319 Forest Hill Yates J Joseph (Carolyn) slsmn h 319 Vineville Yates James E (Rebecca) 1 (o) pres Yates & Tabor Co Inc h 29 Arlington pi YATES JAMES M (Nettie B) (Hickey's Coffee Shop) r Central Hotel Yates James W (Sallie) 1 elk Great A & P Tea Co r RD 2 Yates Luther E (Frances)i 4 tr dr r 811 Clinton Yates Melvin elk Dunlap-Peeler Hdwe Co r 374 Orange _____ 506 Baldwin's and Telegraph's YATES MOTOR CO INC, C H Yates pres treas, Durwood Yates v-p, A M Harrison sec, Plymouth, DeSoto and Packard motor cars, 707 3d--Tel 1445-1446 Yates Robt L (Christine) 2 slsmn Ga Roofing & Sup Co h 1413 Edgewood Yates Thos E (Flavrie) atndt Goodrich Silvertown Stores r 91 Lawton Yates Wm E baker Am Bakeries Co r 809 Montpelier Yates Zonnie D (Sarah E) (o) overseer Bibb County Convict Camp h 809 Montpelier Yates & Tabor Co Inc J E Yates pres O H Hogan sec-treas whol gros 274 5th Yaughn Amy opr Happ Bros Co r 335 Calhoun Yaughn Corinne r 335 Calhoun Yaughn Floyd C elk r 1083 Pio Nono Yaughn Katie (wid Vester) 3 h 656 Pebble Yaughn Lula (wid C M) opr Happ Bros Co h 335 Calhoun Yaughn Mabel Mrs 3 h 155 Williams (SM) Yaughn Rubye B nurse Macon Hosp r do Yaughn W Frank (Pearl) 1 h 1537 1st Yeargan Thos L carp Adam-Swirles Mill r 103 Ridge (I) Yeager Frank O (Myrtice A) mach So Ry h 2457 Forsyth rd Yeager Louise K sten Fenner & Beane r 2457 Forsyth rd Yearty Emmett F (Minnie) 3 elk Willingham Mills h 41 Marion pi Yearty J Thos (Nellie M) (o) trav slsmn Hamil- ton Brown Co h 226 North (NH) Yelin Benj (Dora) (o) delicatessen 458 Cotton h 419 Forsyth Yellow Cab Transportation & Baggage Co E H Young Arnette carrier Macon News r 324 Cherry Young Arth C (Eliz) 2 (o) emp C of Ga Ry h 2453 2d Young Arth C Jr emp Bibb Mfg Co r 2453 2d Young Beth M student r 324 Cherry Young Bob Used Car Exchange (R S Young) 451 1st * Young Carrie (e) 3 tex wkr Bibb Mfg Co h 812 Elbert Young Chas T (c; Annie) 1 emp So Ry h 701 (700) Colquitt Young Clara (c) maid r 107 (5) Frank al Young Clarence (c; Louise) 2 h 104 3d (U) Young Clarence T (Evelyn) 4 (o) gro 944 (510) Montpelier h 324 Cherry Young Clifford (c) res RD 2 Montpelier Young Docla (c) h 353 (14) 7th Young Doris student r 205 Oakland Young Douglas (c; Lillian) meat ctr Cliff Rushins Mkt h 76 (137) Forest (V) Young Edw (c) gdnr 120 3d Y oung Everett r 125 Steele Young Floyd (Pauline) swtchmn So Ry r 816 Cherry Young Geo elk C T Young r 324 Cherry Young Inez (c) cook A B Birdsey r 124 Sycamore (V) Young Irma (c) 1 r 308 Burnett Young Israel (c; Rena) lab C of Ga Ry Shop h 1324 1st Young J Wm (Ga Mkt Hse) res Lizella Ga Young James (c) lab Buckeye Cotton Oil Co Young James (c) r 315 Gilmer Young James r 29% Hydrolia Young James (c; Emma) 1 emp So Cotton Oil StakGr Pr6S F F Baker Jr sec-treas Terminal Yeilow Jacket The (L P Chapman) eonfr 559 Broadway Yeoman Arth (Addie E) 3 h 1702 3d Yeoman Arth Jr r 1702 3d Yeoman Mary E student r 1702 3d Yeomans Allen C (Nettie J) agt Bankers H & L, Ins Co r RD 1 Yepmans Ethel (Mrs W A) tel opr So Bell Tel Co r 2528 2d Yeomans Frances r 616 1st Yeomans Helen F sten H C Atkinson r 2458 Forsyth rd Yeomans Harrold W (Ruby Kate) agt Progres- sive Life Ins Co r RD 2 Forsyth rd extd \ eomans Hershell V (Mary L) slsmn Progres- sive Life Ins Co h 616 1st S Sami R (Lula) Co) (Vineville Fish Co) h 2458 Forsyth rd ' Yeomans Wallace A (Ethel F) (0) supt Progressive Life Ins Co h 2528 2d h 406 MikadoB (Sybil) (> emP C of G. a Rvyj Yetter Geo D r 1415 2d Co h 105 Telfair Young James S (Ellen) (o) emp MD&SRR h 205 Oakland Young James W (Lucie) (Riverside Lbr Co) r RD 3 ' Young Jennie (wid J A) h 1674 2d Young John A Jr policemn CPD r 724 Mont- pelier Young John H (c; Melinda S) (o) 200 (305) Neal (V) Young John T elk Ga Mkt Hse res Lizella Ga Young Lillian slswn H L Green & Co r 903 2d Young Lizzie (c) (o) h 350 (1) Neal (V) Young Louie lab So Crate & Veneer Co Young Lucy (c) Indrs Crescent Ldry Young Lymon (c; Mary Eliza) (o) lab h 1215 (1123) Woolfolk Young Mamie (c) 1 cook A M Wing r 207 (205) Industrial Home rd Young Mary (c) (o) cook H J Lamar h 124 Sycamore (V) Young Mary (c) maid D C Harris h 509 Pio Nono la Young Matilda (wid F D) r 549 Telfair (SM) Young Maude opr Happ Bros Co r 854 Elm YIncrhG14lF2dDellie D> (0) preS Ge F Yetter YETTER GE F INC, Geo F Yetter pres, y plmbrs 1451. etter Minnie Cotton--Tel 331 (See card I tchr Bruce Sch r 1415 B 2d D) YomanDance Studio (Mrs Marie G Yoman) 652 Mulberry Yoman Marie G Mrs (Yoman Dance Studio) r Valdosta Ga Yopp Ruby waitress DeLuxe Cafe r 111 2d Young Mens Christian Assn P A McArthur genl sec 371-79 1st Young Missouri (c) 3 res RD 2 Montpelier Young Nellie 125 Steele (Mrs P E) emp Bibb Mfsa Co r Young Percy E (Nellie) h 125 Steele Young Pierce A (Ruth) emp C of Ga Ry h 903 2d Young R Alex dr Dixie Dairies Young Raymond J r 220 Ayers rd (B) r RD 21 reP Mac0n Better Hsg Program Youghn Crissie (wid H) emp County Relief Admn r 1019 Ash ^ Youmans Frank M (Dorothy T) mgr Firestone Auto Young Sup & Addie Serv (c) r Stores h 99 220 Powell Vineville ap1 t D3 Y--West from 300 252 Hatcher Martha L (o)-- to Edgewood av, 1st e of blk Corbin av, 1st n of Carlton 2956-R Broadway Dunlap Kinloch F--5357-N 254 Garrett Robt L--2809-J 1402 Smith Mary (c) ANTHONY RD--A continuation of Jeff Davis, west from 6th av 100 Braswell Ida V Mrs (o) 142 Davis Lonnie (c) 5th av intersects 200 Wheatley Sch (c) 205 Brown Augustus (c) (o) 3d av intersects 300 Burnett Wm R 330 Vacant 333 Vacant 337 Fields Marcellus C (c) (o) 339) Marshall Jesse B ANTIOCH RD--South from 120 Enterprise, 1st e of Houston av 100 Smith Lula (c) 102 Wiley Asa (c) 104 Taylor Jas (c) 106 Grier John (c) 108 Hawkins Jesse (c) 110 Simmons Floyd (c) 200 Mt Calvary Bapt Ch (c) 201 Mallory Bettie (c) 202 Henderson Leo (c) (o) 203 Dinkins Joe (c) 256 Hays Oscar W (o)--5127-R 260 Britt G Curtis (o)--3940-J APPLEWOOD (EM)--East from Jones av, 3d s of Main 102 (105) Thomason J Monroe 107 McKay Wm L (o)--6356 Balkcom intersects 209 Wasner Mattie M Mrs (o)-- 5513 Cain Robt R 211 Balkcom Robt P (o)--544-J 213 McDaniel Mackie L (o) 214 Vacant 215 Rogers Robt 216 Braswell E Waswick 217 Vacant 219 Vacant 223 Hammock Marion J (o) 224 Vacant 225 Brooks Wm D 226 Sanders Wm P Fairview intersects 301 Mann Horace J 303 Amerson Andrew 308 King Jas 1403 Sanders Caleb (c) 1404 Goolsby Ola (c) 1405 Copeland Robt (c) 1406 Pitts Nancy 1425 Vacant 1426 Preston Leola (c) 1429 Mitchell Anderson (c) ARLINGTON PL -- Southwest from 504 Washington av to Forsyth 16 Vacant 17 Poe Lena V Mrs 19 Mitchell Frank B phys (o)-- 2360-R 20 Smith John R L (o)--5229 21 Clary Geo E--2087 28 Everett Malcolm E (o)--4064 29 Yates Jas E (o)--2539-J 33 Snellgrove G Emmett--275 34 Newman Florida nurse (o)-- 2360-W 35 Hall Jas M--5727-W 36 Rogers A Thos--2640 37 Walters Jos W--2850-R 42 Greene H Susan Mrs (o)-- 204 Brown Anna (c) Stripling la intersects 2556-J 205 Evans Eva (c) 403 Bonner Louis W (c) (o) Tinsley's la intersects 206 Tinsley John (c) 404 Goode Florence (c) 51 Leonard Floy E Mrs--2129-J 231 Moore Lizzie (c) (o) 406 Peek John (c) 53 Talbird Mamie M Mrs--. 257 Giddens Wm (c) (o) 409 Butler Chas S (c) 5284-J 259 Green Thos L (c) 411 Wilburn Minnie (c) (o) 54 Avrunin Louis (o)--5284-W 260 Green Hezekiah M (c) 418 Tinsley Mary M (c) (o) 58 Jones Malcolm D (o)--2983 261 Bentley Borie B (c) (o)-- 419 Vacant 61 Cusson Larkin G--2854-W 5467-J 421 Shiloh Baptist Church (c) 62 Harris Lula L Mrs (o)-- 300 Greenwood Nelson S (c) (o) 439 Vacant 2854-J --4572 65 Vacant 301 Clark Perry (c) ARCH--Northwest from 440 Ogle- 66 Vacant 302 Galry Alonzo J (c) (o) thorpe, to New 70 Tuten Minnie Mrs (o)-- Carter Adolphus (c) (o) 411 Fraley Minnie (c) 5727-J 315 (267) Howard Mary (c) 417 Hamlin Hubert H 71 Boswell Eug--748-J 324 Vacant 425 White Lester A 76 Clark Lalla A (o)--2033-J ANTIOCH RD (Lynmore Estates) A continuation of Antioch rd hey Fulton 425 (r) Meaders Mattress Co-- 5136 453 Barfield tVm (c) 453 (r) Shinholster Ellen (c) 77 Moore John T (o)--1214 79 Kilpatrick Wm C (o)-- 2854-M 82 Chaplin Rosa--4824-R 1935 Macon City Directory 511 Arlington PI Kindergarten 701 Gantt Lee (c) 1165 Vacant 83 Haffney James P--1003 702 Bullard Minnie (c) 1171 Perkins Arth D--6349-J 87 Ryther Fenley--1372-J 710 Cross Annie (c) 1173 Shi Susie Mrs 88 Bozeman Wm E (o)--1057 711 Killbrew Jas (c) College intersects 93 Riley Edith C Mrs (o)--1898 713 Williams Thos (c) 1206 Findlay Prentiss E--154 715 Graham Jack (c) 1218 Bartlett Chas L (o)--347 ARRINGTON PR N--South from 718 Evans Wm (c) College intersects Jefferson ter to Georgia av, 724 Thornton Jos G (o)--5968 Mercer University--5916 continuation of Madison 726 Finnie Isaac (c) Tatnall Square Baptist Ch-- 1 McNair Nellie Mrs (o)--2105 728 Baldwin Mary (c) 6313 7 Coffee Andrew J--2107-R 749 Vacant Coffee A J & Son window 751 Rawls Alice (c) ASTOR (EM)--East from Melrose displays 753 Bish Jos B (c) to Center, 1st n of Broad 755 Dandie F John (c) 145 Shaw Maud (c) ARMOND AV (U)--North from 757 Vacant 146 Miller Holmes (c) Anthony rd, 1st e of Davis 759 Spann Mattie (c) Clinton intersects 105 Howard Benj (c) (o) 760 Walker Benj 167 Lockett Clifford (c) 115 Toole Florence (c) (o) 761 Mitchell Andrew (c) 168 Whittaker Geneva (c) 763 Vacant 169 Ross Jos L (c) ARMY ROT--South from 822 Ash, 764 Reddick Homer (c) (o) 170 Vacant 1st w of Telfair 765 Taylor Frank) (c) 172 Hunt Addie (C) 121 Taylor Aurelia (c) 767 Jackson Eug (c) 174 Wilder Cleo 123 Matherson Edw (c) 769 Hudson Dock (c) 174% Vacant 126 Vacant 770 Anderson Wm (c) 176 Smith Mattie (c) (o) 127 (526) 771 Nelson Mary (c) Lexington intersects 128 Bell Henrietta (c) Telfair intersects 200 Merriweather Arth T (c) 129 Vacant 803 Williams Hattie (c) (o) 202 (229) Stallworth Lillie (c) 130 Chapman Carlton (c) 807 Herrington Clarence (c) 204 (278) Reynolds Annie B (c) 131 (523) Roberts Ella (c) 809 Felder Allen (c) 206 (276) Newman Quintus (c) 132 Walker Lonnie (c) 810 Reeves Grady C (c) (o) (o) 133 Woodall Hattie (c) 814 Jackson John (c) 260 Vacant 134 Gardner Leroy (c) 816 Howell Melvin Jr (c) 269 Vacant 146 (459) Crawford Henry (c) 819 Vacant 270 Pittman Mary Mrs 822 Sword Acquilla (c) ASH--West from Division to Lin- 823 Ch of God in Christ (c) ASTOR PLACE (EM) -- North den, 1st s of Hazel 851 Milner Henry (c) from Astor to 607 Woolfolk. 1st 110 Vacant 852 Craft Wm C (c) (o) n of Center 112 Brown Reese (c) 123 Patterson Nora (c) Gilmer intersects * Hammond in tersects 5th intersects 311 Carter Louis (c) 317 Elzie Allen (c) 321 Corbin Florence (c) 354 Byron Wm (c) 358 Calhoun Clifford (c)--4289-J 360 Smith Mattie (c) McCook J W Lbr Co--4177 Broadway intersects 400 Vacant 404 Vacant 408 Vacant 410 Little Beeman (c) 416 Sanctified Ch (c) 420 Green Fletcher (c) 421 Kendrick Andrew (c) 453 Smith Mary Mrs 476 Fountain Rosie Mrs 3d intersects 514 Vacant 523 Abercrombie Robt M 553 Smith Cora Mrs 554 Raney Mollie E Mrs (o)-- 4789-J 556 Amerson Chas B 559 Brice Jos F (o)--3334-J 2d intersects 645 Waits Arth C--1413-W 647 Pryther Wm H 649 Sauls Clark H 651 Vacant 853 Thompkins Essie (c) 854 Brooks Claude (c) (o) 855 Vacant 4 Hackett Wm M 5 Jones Jas A 857 Jones Chas W (c) Jackson intersects 901 Underwood Robt W (c) (o) 905 Toliver Nancy (c) (o) 907 Zeigler Mary (c) ATLANTIC AV (B)--West from 121 American blvd 300 Hendley Wm T (o) 306 Hammett Jas T (o) 909 Ridley Mary (c) 911 Buckner Jefferson (c) 912 Vacant 915 Ne Smith Wm T 915 McCrary Josephine (c) 917 Evans Irene (c) 919 Kendall Anna B (c) 921 Vacant 925 Curry Thos (c) Calhoun intersects 1014 Abercrombie Jas E ATLANTIC VILLAGE--At end of Oak Haven av, bet English av and C of Ga Ry 1 Gunnells Sami 2 Atlantic Mills Community Hse 3 Long Jack N 4 Allen Willie M Mrs 5 Glass T Edw 6 Entrekin Howard H 1016 Smith Jessie Mrs (o) 7 Evans Jordan J 1018 Vacant 8 Cline J Veran 1019 Singleton Fredk L 9 Watts John 1020 Edwards Linda Mrs 1023 Etheridge Dock--5675-W 10 Cline Dolly Mrs 11 Monfee David 1024 Sanders Robt L 12 Vacant 1054 Vacant 13 Wood Kemp G 1055 Moore Thos A (o) 1061 Tidwell Robt D (o)--5675-R 1068 Hunnicutt Mollie Mrs--5675-J 14 Clark Cleveland M 15 Mailey Sami F 16 Vacant Ross intersects 1111 Gardner Walter B 1115 Fordham Annie Mrs 1116 Haynes Arnold H 1117 Hartzou Richd H 1118 Vacant 1119 Childs John D gro 1120 Allen Thos D 17 Hobbs Freeman B 18 Ferguson James O 19 Brooks John W . 20 Wingate Noah 21 Motes Robt A 22 Burnett Albert Mrs 23 Ray Howard L 24 Vacant 25 Smith Vernon 665 Thomas Jethro P Shamrock intersects 26 McAbee C Noyes 670 Childs Ellen Mrs gro--1413-M Langford Geo H 1153 Sumlin Frank E 1155 Maya John C (c)--4195-M 27 Horne Gus E 28 Holder John P----1 1st"inters' ec'ts Mays Rachel mus tchr 29 Mullis W Alvin m Baldwin's and Telegraph's 30 Harper Mollie Mrs 31 Jackson John 32 Coker Neal 33 Barber David M 34 Horne Chas L 35 Graham Dennis 36 Horne James 37 Vacant 38 Sanderson Jas 39 Vacant 40 Vacant 41 Wesson James W AUBURN AV (S)--Bast from Tyrone blvd at Auburn 139 Howard Edw (c) 141 Johnson Chas (c) 152 Rice John 4 Sanders Blanche (c) 153 Rice Kannon K (o) plmbr-- 6 Youngblood Lula (c) 2806 151 Crowell John M--1231 330 Howard Adam (c) 331 Jackson Lucy (c) 300 Broxton Herschel R (o) 329 Vacant 303 Tompkins Henry O 304 Reakes Wm (o) 399 Steed Wm T (o) 401 Vacant 403 Vacant BARNHART'S BOTTOM -- West from nr 606 Forsyth to C of Ga Ry, 1st w of West Boundry 1 Howard Geo (c) 405 Oliver P Clarence 2 Ward Lizzie (c) Branch intersects 3 Miller Laura (c) 501 Noonan Minor B (o)--5057-W 505 Hamlin Susan Mrs (o)-- 5 Lawrence Jas (c) 6 Hightower Jas (c) 5057-M 7 Higgens Maudie M (c) 507 Rice Wade W (o) 8 Smith Minnie L (e) 143 Thomas Tabitha (c) AVON RD (B)--West from Euclid av to Resthaven av, 1 g of Forsyth rd 100 (12) Elliott Boce M (o) 101 (25) Fay Geo J (o)--4403-M 108 Cunningham Stewart O-- 1705 109 Powell F Rogers (o)--6165-J 110 (100) Sikes Amos M (o)-- 6538 112 Vacant 113 Rosengreen Vivian--4403-W BALKCOM AV (EM)--South from 701 Main, 2d e of Hydrolia 101 (1) Cardell Wm C 102 (3) Tharpe Bessie (o) 103 (2) Bray J Alfonsa (o) 104 (105) Brown U Iverson 105 (4) Tharpe E Jefferson (o)-- 3891-W Myrtle begins 106 (111) James Wm A 108 (12) Wrye Minnie L Mrs 109 (10) Jones Chester P 110 (14) Collins Clifton 113 (13) Meaders Wm T (o)--993 BARTLETT--North from Napier av, 1st w of Inverness av 100 Rachels Alva C furn repr 102 (2) Thomas Claudia (c) 148 Vacant 164 Watson Alberta (c) 172 Davis Bright (c) (o) Gordon intersects 201 Thomas Geo (c) (o) 203 Battle Monroe (c) (o)--4427 205 Bronson Henry (c) 218 Perkins John (c) Hill Crest av intersects AYERS BDVD (B)--West from Ayers rd, 1st n of American blvd 102 Toole Chas J Jr (o) 104 Waldorf J Sturger (o)-- 823-W 109 Shierling Thos W--3798-W 117 (15) Thomas Walter N Peachtree intersects 202 (102) Walden Roger L 203 (103) Brown H Lamar (o)-- 3865-W 207 (107) Ratliff Wm A (o)-- 3891-J 211 (109) Mingledorff Robt S Roye intersects 402 Vacant 404 (309) Wyche Jas (c) 406 (150) Mathews Clara B (c) 412 (125) Holmes Sami (c) (o) 418 (202) Radford Mamie (c) (o) 460 (204) Lockett Sallie (c) AYERS RD (B)--East and west from American blvd, 1st n of Grand av 104 Staley Jas H (o)--3798-R 108 Merritt Nannie M Mrs (o) Dover intersects 110 Wade Harry W (o) 119 Curtis Wm N (o)--1056-J 123 Patterson Annie Mrs (o)-- 3314-XM 220 Thompson Cleaners 222 Hurlbert Harry M 223 Vacant 224 Hurst Walter E 229 (233) McMichael Wm J 441 Alexander Della F Mrs (o) BACON (SM)--South from 356 Hanson, 1st e of Houston av 120 Holt Miles F Jr 140 Holt Miles F --East from Main, 2d n of Osborne pi 6 Davis Annie (c) 73 Maddox Dolie (c) 102 Lawson Gertrude (c) 103 Mays John (c) )106 Nichols Arie (c) (o) 109 Adams Lillie (c) 113 Vacant 118 Clark Rose (c) (o) 120 (310) Kitchen Jas (c) (o) (Edgewood av intersects) 2309 Worsham Marvin L 123 Lucky Aretha (c) 1601 Vacant 2321 Brice Jas W (o) 1602 Vacant Ell intersects 1613 Beulah Baptist Ch (c) 2402 Penny Profit Store gros-- 1621 Vacant 2982-J 1624 Dean Walter G gro (o)--9125 Avera Milton J (o) 134 Reed Mollie (c) 135 Howard T'hos (c) (o) 138 Cromwell Robt (c) (o) 142 (5) Holt Ida (o) 164 Johnson Grant (c) 1633 Green Eug (c) (Douglas Intersects) 1635 Wilder James (c) 2437 Sellers Claude F 1650 Poppell Beulah Mrs gro-- 2440 Avera John B 9504 2444 Greer Robt L (o)--2982-W BUCKINGHAM PL (V)--South from nr 800 Vineville av 1st of Oak Haven av (Church B*egins) 2447 Charlie's Place serv sta-- 2850-W 107 Hollingsworth Henry G (o)-- 4045 (Chappell Begins) 1701 Pryor John (c) 1703 Willis Maggie Mrs soft drnks 1710 Vacant 1741 Roberson Clarence W 1743 Fennell Addie Mrs 1745 Huff Frank 1747 Bennett Chas 1749 Farmer Annie Mrs soft drnks 1751 Vacant Smith Chas A 2480 Johnston Newton B (o)-- 1423-J (Oliver avIntersects) (Daly begins) 2503 Jordon Chas J (o)--494 2520 Stephens Lee M (o)--3089-M 2525 Vacant 2526 Nix Edgar C 2529 Vacant (Wood Begins) 2552 Slaughter Chas H 108 Coates Richd J (o)--4770-W 109 Domingos Karl K (o)--2678-J 110 (190) Fick Peter N (o)--2469 111 Saye Ernest B--2350 112 (192) Matthews Robt H (o)- 1605 114 (194) Clark Ida S Mrs-- 2678-W 115 Doster Paul J (o)--4583 116 (196) McCommon Geo W (o) -4683 117 Hattrich Fred H (o)--4213 1801 Butler Wm H auto repr 2554 Williamson Clifford T (o) -- 118 (198) Blum Leo J (o)--3809-W 1807 Harris Chas O 2325-W 119 Rickenbaker Leila S Mrs-- 1811 Vacant 2555 Jenkins Jos H (o)2859-J 2032-J 1818 Utility Club Clinic--5386 (Central av intersects) 120 Bootle Wm A (o)3809-J Pilot Club Dental Clinic 2603 House Dempsey R 1820 Snow Sally Mrs 2604 Millirons John W (o)--2325-J BUCKNER AL--West from 55S 1821 Scoven Sami G (o) 2606 Beasley Emmett T--2859-R 2d, bet Plum & Poplar 1823 Barnes Elias L 2606 Jones Joseph J 1 Thomas Alonzo (c) 1824 Farmer Geo A 2609 Roberts Wadis A--1355 2 Stalk Eug (c) 1825 Hutto J Monroe 2615 Holloway Patk G--3318-W 3 Davis Wm (c) 1827 Davis Wm J 2620 South Macon Primitive BapJ 4 Zellars Geo (c) (Giles begins) Ch Williams Chas (c) 520 Baldwin's and Telegraph' 5 Brown Laura (c) 6 Ellis Chas (c) 8 Lester Ida (c) 10 Knight Daisy (c) 12 Heard Gussie (c) 13 Vacant 14 Vacant 15 Sheffield Cynthia (c) 17 Daniels Rosa (c) 19 Lewis Nancy (c) 21 Taylor Fannie (c) 23 Wilkinson Sol (c) BUENA VISTA AV--West from 4003 Houston av (at 3 mile line) 100 Johnston Francis M (o) 104 McDaniel Henry V 209 Sanford Sterling E 210 Fink Boyd W (o)--4238 211 Hart J Freeman Jr--921 212 Ross Malcolm R (o)--1360-M 213 Stern Morris L--1284 214 Smith Chauncey J (o)--2069 215 Cleveland Wm A (o)--2217-R 216 Angier Edith M Mrs (o)--5507 217 Newton Ralph G (o)--3622 219 Zellner Loraine--2439 221 Nolan Quincy R (o)--2648-W 223 King Jas L (o)--3039 225 McLean Hugh (o)--2648-J (McDonald av intersects) 301 Allen Wm Hi (o)--5606 302 Cannon Chas L (o)--4212-W 303 Merritt Benj F--4212-J (Branch intersects) 401 Hollingsworth Francis M (o) 405 Glisson Mary Mrs (o) 409 Hollingsworth Marshall H (o) 423 Ricks Geo E (o)--6263-W 425 McConnell Reynolds (o) 460 New Wm L--6263-M 603 Toole Louis E (o)--6263-R 603 (r) Vacant 605 Cook Sallie Mrs (o) (Ridgeland av intersects) 701 Argo Thos V (o)--4088-M 709 Joiner Richd (o)--3581 (Seminole av intersects) 800 Stubbs W Eug (o)--3581-R 829 Hall Thos H (o) 110 Treadwell Eva Mrs (o) 115 Griggs Emmett A--3752-M 117 Malone Grover S--3752-J 200 Russell Garry H (o) 215 Middlebrooks Robt L 220 Lamb Jas C 224 Jones Wm J (o) BUENA VISTA DR--North from end of Montpelier av, 1st w of Brentwood av 103 Weaver Clyde W (o)--2182-J 104 Brown Harry B (o)--2182-M 108 Genone J Ernest (o) 107 Copeland Alonzo T--2182-R BUFORD PL (V)--North from 609 Vineville av 101 Redding Jas T (o)--5740 104 Haley Mamie H Mrs (o)--685 105 Hatcher Sidney W (o)-- 4323-J 106 Perdue Chas H (o)--1393 107 Krenson Fredk--2960-R 108 Ganand John T (o)--1509-W 109 Branan Wm--2960-W 110 Guttenberger Mark K Mrs-- 2665-W 111 Willingham Anne Mrs (o)-- 508 112 Harris Albert G--2025 113 Popper Jos W (o)--174 114 Fowler Harry C (O)--2896 115 Jacobs Thos A (o)--663-W 116 Harris Albert G--2025 117 Barnes A Emmett Jr (o)-- 2213 118 Plaskitt Jas M--2852 119 Jones Malcolm D Jr--1049-J 120 Bashinski Ben j J Dr (o)-- 1603 121 Farmer Chas H--1412 122 Persons Henry P (o)--2665-J 123 Lumpkin Geo (o)--663-J 124 Hill Hugh H--2656-J 125 Stewart Jesse 0--1341 126 Jacobs Thos A Jr (o)--3170-J 127 Cater Louise W Mrs (o)-- 3306 128 McCrum Robt W--1049-M 129 Vacant (Clayton intersects) 200 (132) Whitehead Henry L (o) --5159-J 201 McElroy Chas B (o)--4542-J 202 Adams Irby H (o)--1076 204 Marcuson Isaac E--3062 205 McLean Winship--4542-W 206 Flanders Edw T (o)--4505 207 Wale Phelps (o)--2538 208 Harden Timothy (o)--2217-J 304 Doyle Edw B--1786-W 305 Grinalds Archie S--4891 306 Doyle Clifford E (o)--2446 307 Mitchell Donald G Jr (o)-- 5588-J 308 Little Walter A Arnold Fredk A (o)--2355 309 Whitehead Edw S--5588-W 310 Dudley Nathl M--3546 311 Vacant 312 Bryan Jas B (o)--3768 313 Whitehurst Wm M (o)-- 1786-J 314 Gill John J--2508-R 315 Mathews Thornton L (o)-- 4424 317 Walker W Brown (o)--5553 318 Moss Wm T--2217-M 319 Boles Sami P (o)--3024-J 320 Thompson Leroy B (o)-- 567-J 321 Turner Edw H--2217-W 322 Hardy Fredk C (o)--1360-J 323 Evans Robt E 324 Cromwell Jas O (o)--3024-W 325 Hay Robt L (o)--712-W 327 Toole G Glenn Jr--712-M 328 Mathews Jas W C (o)--4075-J 329 McDuffie Wilbur E (0)--712-J 331 Roberson Clifford M (o)-- 3640 BURNETT (EM)--South from 437 Flanders to Elliott 302 Collins Robt (c) 303 Brown Chas (c) 308 Lindsey Charity (c) 311 (315) Little Collins (c) 312 Brown Elmer (c) 313 Veal Raymond (c) 315 James Laura (c) 316 Stewart Eula (c) 317 Waters Lee (c) 319 (310) Vacant 324 Stubbs Prince (c) * 326 (322) Vacant 327 Tuff Isaac (c) BURTON AV--South from 423 Log Cabin blvd, 1st w of Macon av 108 Glisson Felton 200 Jackson Ada W Mrs (o) Reagan Sarah E Mrs--3730-J 201 Wesley Robt M Rev (o)-- 3730-W 203 Alley Jeff D Jr (o) 204 Jackson W Gladstone (o)-- 3594-R 212 Conger Job C (o)--3514-R 301 Fields Elbert L (o)--3594-W 311 Johnson Sarah Mrs (o) CABANISS AV--West from 105 Womack to Center, 1st n of Broad 100 Townsend Geo C--2205 101 Hudson Benj F Stevenson Theo 103 Adams Chas D 104 Stevenson Turen B 105 Cook Albert P (o)--2791-J 105% Carmichael Leonard N 106 Finney Grady P (o)--3504-W 107 Castellaw Louie A 108 (726) Lord Eliz Mrs 109 Hall Maggie Mrs Wood Sidney E--1594-M 110 Vacant 111 Vacant CALHOUN--Southwest from 210 Maple, 1st w of Jackson 101 Colbert Jos E (c) 110 Hinson Mary R Mrs 111 Vacant 115 McCowen Jas C (o)--3608-J (Oglethorpe intersects) 209 Franklin John L (c)--5518-J 212 Lavender James A 216 Roach Eliz B Mrs--5309-M 217 Brown Monroe (c) (o) 220 Holland Walker 221 Walker Chas (c) 222 Sanders Earl (c) 225 Floyd Wm (c) 226 Hunter Susie (c) 230 Smith Jas (c) 232 Lockett Belle (c) 234 Jones Geo (c) 238 Hanks Lizzie (c) 239 Irvin Wallace (c) (o)--5104-R (Hazel intersects) 312 Turner Jos (c) 314 Harvey Mary (c) 316 Jackson Gussie (c) 318 Chaney Jas (c) 323 Singleton Sylvester (c) 325 Vacant 326 Henry Julia (c) 327 Rowell Jas W 330 Smallwood Oscar B 331 Hudgins Chas (o) 334 Rowell Jas W 335 Yaughn Lula Mrs 337 Wimberly Jas L 338 Dunn Elvy L 341 Westcott Ludie (c) 412 Herrjpgton Alice (o)--3725-J (Ash Intersects) 415 Ashley M Ladel (o)--1588- R 416 Williams Wm H 418 Parker Edw T--3129-W 420 Dumas W Carl--3027-W 1935 Macon City Directory 521 421 Brady Thos E 424 Du Bose E Austin--3552-J 426 Vacant 427 Cook John J 431 McLean Wm O (o)--3822-W 439 O'Neil Chas O 440 Vacant (Elm intersects) 507 Allen Jas W (o) Allen Walter O 511 Nixpn Boisy (c) 512 Gallimore Floyd (c) 517 Terrill Levi M Rev (c)-- 5984 518 Winn Goode (c) 519 Hight Jesse (c) 520 Quinn Katie (c) 522 Jackson Schuyler L (c) 524 Bryant Eva (c) 526 Sutton Anne (c) 527 Bell Julius (c) 528 Vacant 531 Vacant 535 Johnson Sarah (c) 539 Gurr Lizzie (c) 543 Clayton Harold (c) 308 Johnson Lillie (c) 309 (310) Fluellen Lester (c) 310 (309) Cater Thos (c) 311 (312) Vacant 313 (314) Shelly Sampson 315 (316) Williams Loyd (c) 360 Finney Fannie (c) (Henrietta intersects) CARLING AV--East and West from Dannenberg av, 1 n of t Linden av 141 Darley Sidney Mrs 141 (r) Johnson Lonnie H 142 Taylor John (c) 143 La Grone C Jack 143 (r) Whitehead Wm T 401 (729) The Sugar Bowl (c)-- soft drinks Rowland Robt (c) (o) 144 Howard John (c) 146 Mills Ernest (c) 150 Shelton Harry J 402 (724) Gordon Ada (c) 403 (731) Bailey Sarah (c) (o) 404 (726) Newman Buster (c) 154 Wood Minnie H (Dannenber*g *av* intersects) 406 Nix Clara (c) soft drinks (Remhert av intersects) 407 (725) Richardson Floyd J (c) 201 Beecham Chas A 403 (720) Nix Clara (c) (o) 205 Fogarty Thos Z--563-W 409 (727) Watkins John (c) (o) 209 Vacant 410 (718) Cooper Mattie (c) ' 213 Nail Margt E Mrs 412 (716) Edwards Isaac (c) (o) (Curd intersects) 215 Brown Clarence B 217 Bragg Wesley D 500 (714) Adams Frank (c) 219 Vacant 502 (712) Gullatt Wm (c) (o) 237 Donaldson Eulia B 503 (715) Jordan Claude (c) 239 Wood Mary W Mrs 504 (710) Hicks Richd (c) (Lawton ay intersects) 506 (708) Nelson Ira (c) 301 Vacant 508 (706) Evans Jas (c) (o) 302 Jones Sallie W Mrs CALLAWAY (V)--North from 800 Vineville av, 1st w of Corbin 102 Burson Homer E--4874 103 Wynn M Byron--2060-J 509 (709) Flowers Sol (c) (o)-- 1320-J 511 (705) Braswell Reuben (c) 513 Bell Alf (c) 104 Burdett A Roscoe--5457-J 106 O'Shaughnessy Wm J--3018-J 107 Watson J Durward--14 111 Cook J Thos--4863-M CAMPUS AV (WH)--Southwest from Edgewood av, 1st s of Morgan 113 Burns Sidney L--1239 276 Price Julia F (o) 115 Fincher Benj H--2050 116 Snow B Cubbedge (o)-- CAPITAL AV--South from 521 4863-W Oglethorpe to Hawthorne 117 Mallary Nelson D (o)--1580-J 118 Flatau Isaac (o)--3592 120 Weaver Hudnall G (o)--7 100 Barker Clifford C Jordan Gillis 101 Harris Thos J CAMPBELL AV (SM) -- South 102 Sauls Dewey, D from 900 blk Edgewood av, 1st e of Tindall 103 Garvin John Weinberg Mary Mrs 100 (500) Bivins Monroe (c) 102 (501) Harris Geo (c) 103 (502) Watkins Jas (c) 104 (503) Hicks James (c) 105 (504) Akridge Nunar (c) 106 (505) Wells Cora (c) 107 (506) Vacant 108 (512) Woolfork Eva (c) 111 (557) Pollock Cath (c) (o) 104 McKenna Wm A (o)--535-W 105 Rodgers Chas A 106 Spivey Walter C 107 Rewis Henry K 108 Walker John B 109 Simpson Clarence I 111 Jones Thos J 112 Gann Lizzie Mrs 115 Blankenship T Wesley Jones Mattie (o)--3180 303 Melton John M (o) 304 Billingsley Ethel Mrs 310 Lazenby J Frank (o)--3699-J 312 May Geo A--1535-M 315 Hatcher Grace R Mrs--1785 324 Burrus F Edwin--6470 331 Hale Jas S--1094-M 333 King H Clayton--1535-R 336 Mercer D Howard (o)-- 1094-W 337 Jackson John S--2829-J 339 Younginer B Floyd--2147-J 341 Ray Luther B (o)--1411-J 343 Snellgrovei Walter L (Coleman av intersects) 401 Prentiss Otis G--3279 405 Felder Sami L (o) 407 Carter Earl F (o)--2106-J 423 Gormly Aurora M Mrs (o)-- 5448-J 424 Atwater Jas A (o) 426 Landrum C Logan Rev--2496 428 Knight Wm C (o) 431 Martin Eula Mrs (o)--4017 432 Harrington John T--2323-V 433 Howell Albert M (o)--5706-W 436 Warren Wm C (o)--5448-M Mathews Emma nurse 112 (533) Anderson Edw (c) (o) 113 (529) Birdsong Malinda (c) 114 (532) Wheeler Wm (c) 115 (531) Bell Ella (c) (o) (Prince intersects) 201 Parker Eula (c) 203 Turner Perry (c) 204 (405) Glover Henry (c) 206 (407) Howard Edw (c) 207 (205) Johnson Thos (c) 208 (409) Owens John (c) 209 (305) Coley Ella (c) (o) 210 (270) Reeves Frank (c) 211 (307) Cody Amelia (c) 213 (353) Lucas Chas (c) (o)-- 3235-J (Elizabeth intersects) 301 (302) Morris Drug Store- 9270 * 303 (304) Alford's Gro--9173 Alford Wm A 305 (310) Thomas Sami (c) (o) 307 (308) Taylor Edw (c) CAPITAL AV (Mikado pi)--South from 101 Davis, 1st e of Houston av 100 Higgins John W--39-R 103 DuPree Ernest L 104 Ilill Chas N 105 Pippin Thos M (o) 10T Smith Benj T--3843-J 109 Anderson Sami P--39-M 115 Arnold A Felton 119 Arnold Wm E 231 Hewell Arth M (o) 233 Arnold A Terrell (o)--3365-W 236 (136) Humphries Annie Mrs () (Chatham intersects) 300 Killebrew Edgar L (o) 400 Davis Robt E 407 Graham John 411 Jones Harold B (o) (Thomas intersects) 503 Sauls Griffin (o) 522 437 Ray, Andrew D (o)--5706-J 438 Burgdorff Geo P--1059 Sealy Lovie Mrs (o) 453 Darden Robt J--5448-W 455 Rankin Alberta Mrs (o)-- 288-J 456 Johnson Thos R 457 Vickery Luther W--2699-W Ferguson Lamar 459 Lary Nancy B Mrs (o)-- 2699-R 460 Watson Eliz Mrs--5660-W (Montpelier av intersects) 501 Davis Maude S Mrs (o) 503 Mosely T Hubert--2384-W 505 Laney John F 506 Lawson Warren P (o)--4312-J 508 Jones Wm N--4312-W 591 Ashmore Wm T 593 Domingos Walter D (o) 595 Rogers Susie Mrs (o)--2384-J (West End av intersects) Baldwin's and Telegraph's 602 Gilreath Zebulon H (o)-- 289 Culpepper Chas 403 (819) Thomas Mary (c) (o) 5360-W 292 White Ruth 425 Boston Louis (c) 605 McConnell Odessa S Mrs (o) 293 Demarest Mary Mrs 430 Hester Mary (c) (o) 606 Davis A Jos (o)--5360-J cor Calvary Free Will Bapt Ch 435 Stanford Louis (c) (o) 616 Strozier Robt C (o)--4132-R Wyche intersects 617 Coleman Berry W--352-XJ 310 Sullivan John A 437 Stanford Richd (c) 620 Cassini Louis (o)--1141-J 621 Hilley Dozier A--352-M 622 Hall Silas S--352rW 623 Swanson Agnes E Mrs 625 Hughes John D--352-R Whitehead intersects Jones Chapel Cem 402 Martin John 404 McGee Sami 405 Hodges E C CEDAR LA (SM)--West from Cedar, 1st n of Ellis 403 Smith Wilbur 405 Hill James 406 Britt James W 407 Felder Wm M CARLISLE AV--South from 548 Log Cabin blvd, 1st w of Burton av 105 Harris H Earl (o)--6021-J 107 Amerson Grover C (o) bldg contr--6397 125 Dozier Wm H CEQAR (U)--South from Montpelier av, 2d w of Pio Nono av 101 Callaway Barber Shop (c) Callaway John H (c) 102 Vacant 104 (2) Hogan Wm (c) CEMETERY LA--East from beginning of Madison to College' 100 (1) Booker Belle (c) 102 (12) Carter Annette (c) 104 Vacant 106 Vacant CARMAN PLACE (Lynmore Estates)--West from Antioch rd to C of Ga Ry 1st s of Marion av 601 Carr Milton A 658 Venable J Otis CARTER (B)--West from 211 Tharpe, 1st n of Robinson rd 101 (200) Bowman Monroe (c) 102 Wyche Henry (c) (o) 103 (156) Howard Ananias (c) (o) CARTER'S AL--South from 620 Elm to Edgewood 221 Vacant 222 Vickers Beulah (c) 224 Veal Marcus (o) 225 Vacant 227 Stephens Freeman (c) CEDAR --West from Wood, 2d n of Broadway 51 Vacant 52 Dykes Andrew J 56 Evans Beulah Mrs 63 Marsh Jos E 68 Durden Wm O 76 Lackey Edw D 85 Lindsey Dixie L Giles intersects 102 Mullis Hollis L 109 Shirah Alice Mrs--1958-R 110 Lackay Jas (o) 115 Hill Jas H (o)--1958-J 118 Stewart James T 119 Irby Wm W 122 Freeman Hattie Mrs 173 Combs Leonard C 174 Campbell Chas R (o) 178 Campbell Lloyd L 180 Vacant 181 Maxwell Marvin W (o)-- 548-W 183 Ford James I 185 Campbell Senate L Crenshaw Edw W Jenkins intersects 213 ender Marvin S (o) 218 Tankersley Danl O 220 Sullivan Robt 224 Shelley Annie Mrs 227 Barnes Jas O (o) 229 Gassett Geo F 231 Golden Arth 232 Sikes Thos H 233 Hudgins Thos W DeBorde intersects 288 Elliott John J 105 Bowden Jas H (c) (o) 106 (3) Johnson Lillie M (c) 109 Vacant 110 (4) Howard John (c) 111 Harvey Geo (c) 113 (152) Tignor Oscar (c) 115 Vacant 117 (148) Brantley Tilman (c) (o) 122 Brooks Lizzie (c) 123 (156) Fambro Leoard (c) (o) 124 Smith Thos (c) 126 Tigner Robt (c) 128 Mitchell Della (c) (o) 157 King Angie (c) 158 Rose Emma (c) 159 Fambro Jas (c) 202 Vacant 203 Vacant 204 Solomon Jos (c) 205 Whitley Matilda (c) (o) 206 Jones Mattie (c) 207 Ingram Fronie (c) 208 Bivins Emmett O Rev (c) (o)--4026-J 209 Thomas Henry (c) 211 (214) Ryan Robt L (c) 214 Butler Herbert (c) 215 (216) Fletcher Wesley F (c) (o) 217 (218) Smith Lula (c) (o) 221 Foster Herbert (c) 222 Vacant 223 Smith Alonzo (c) 224 Carswell Danl W (c) (o) 225 (226) I?owden Clifford (c) (o) 226 Wyche John (c) 227 Mitchell Rufus (c) 228 Raines Margt (c) 230 Vacant 233 Leslie Edw D (c) (o) 235 Pitts Felton (c) 236 Jackson Robt (c) 241 Vacant Dempsey av intersects 301 Woodward Boris (c) (o) 304 Johnson Lelia (c) (o) 306 Jones John H (c) 308 Barnes John (c) (o) Straight intersects 312 White Arth (c) 314 Shelly Jas (c) 315 Davis Sami (c) 320 Troutman Ida (c) 321 Hester Hillyer (c) 326 (303) Floyd Joshua (c) 327 Williams Celia (c). 328 Adams Chas (c) 329 Cornelius Laura (c) CENTER (EM)--North from Yates av, 2d w of Main 3 Hunter Hattie (c) (o) Clinton intersects 102 Rozier Stanley W 104 Kitchens Jas E (o) gro Garden intersects 202 Joiner Wm E 204 Mathews Lemuel F 205 Stripling Lawrence T (o) 206 Beckett Geo W Phillips la intersects 208 (154) Raymond's Drink Stand 209 (155) Bryant Anna (c) 211 (157) Turner Wm (c) 213 (159) Quinlan Lula Mrs (o) 214 (156) Schaefer Sallie T Mrs 215 (161) Barlow Morgan T-- 2609-W 260 Roberts Chas M (o)--2609-J 268 Roberts Geo W (o) Lee intersects 300 McCullough Howard 301 Taylor Mary L Mrs 304 Finkle Willie B Mrs 305 Mullis Carlton M 306 Fountain Arch S Steadman Wm A 307 Cheves John L (o)--2458-W 309 Wheaton Chas 310 Brown Henry 353 Brooks Wm B 354 Cripe Fred H 360 Dalton Annie Mrs 364 Borum John R * Broad intersects 450 Balkcom Bryant J (o)-- 3698-W 451 Zorzi John M--2825 454 Guest Lewis H--3504-R 456 Maund Sarah F Mrs Woolfoik intersects 501 Lewis Harvey Rev (c) 503 Binns Peter (c) 595 Orr Obie (c) 597 Coach John (c) 599 Kurtz John H (c) Cowan intersects 600 Wright Nelson (c) (o) 602 Thomas Robt (c) 603 Billingslea Randolph (c) 604 Manson J Wiley (c) 605 Hightower Emory (c) 606 Brown Claude (c) 607 Graves Benj J (c) (o) 609 Williams Richd H Rev (c) (o) 610 Pitts Jacob (c) 610% Smith Jesse (c) 1935 Macon City Directory 523 611 Parker John H (c) 417 Jarrell Albert A--2229-M 309 Moseley Arth (c) 612 Goolsby Wm M Rev (c)-- 421 Branan Albert B 310 Antioch Sch (c) 4208-M 425 Coleman Chas H Mason intersects 690 Turner Hense (c) Henry intersects 401 Fordham Doc (c) Hall intersects 500 Goodson Wm M gro 401 (301) Hammond Florence (c) 700 Pennamon Robt (c) DeBorde Intersects 402 (305) Gordon Henry (c) 702 Vacant 517 Rivers Walter H (c) 403 Smith Wesley (c) 704 Thomas Fredk (c) 519 Simmons Jas (c) 404 (307) Murpsy Chas (c) 706 Sawyer Wm M (c) 521 Boone Chas (c) 405 Mason Geo B (c) 750 Vinson Sara L (c) 552 Hudson Jas H (c) 406 (410) Bonner Robt (c) 752 Walton Jos (c) Johnson intersects 407 Owens Mack (c) 753 Carson Eva (c) 554 Killen Jane (c) (o) 408 (311) Talton Minnie (c) 754 Driskill Bernice (C) 755 Mayo Mary - 4657-W 363 Carroll S Penny (o) 372 Fox Sallie Mrs (o)--3023-J 373 Hamlin W Edw--4657-J 374 Maddox Edgar M 377 East Macon Presby Ch 386 Lundy Carl A Hydrolia intersects * Center intersects 390 Byrd Michl (o)--2468-J 414 Culpepper J W Edw (o)-- 562-W Powell intersects 448 Vacant 450 Wright Benj (c) 452 Sanders Tommie C (c) 453 Vacant 454 Hendley Wm H gro 455 Vacant 456 (460) Walker Eliz (c) (o) 458 (456) Horton Laura (c) 459 McCarthy Henry (c) soft drinks 459% Parks Nelson (c) 462 (486) Faulk Mahala (c) (o) 467 (455) Clinton Cash Mkt-- 6123 474 McCarthy Henry (c) 476 Franks Warren (c) 478 Wiggins Chas L gro Garden Intersects 2d intersects Siam intersects 506 Dempsey Clifford R (c) (o) lunch rm--1613-R 507 Herb Sarah Mrs 508 Stephens Geo H (c) (o) 511 Richardson Minnie A (c) (o) 512 Green Thos (c) 518 Adams Warren E (c) 520 Price Lottie M (c) (o) 529 Hall Wm M Rev (c) (o) 6180 530 Gibson Daisy L (c) 534 Wiggins Richd W Rev (c) (o> Broad intersects 600 Jones Lamar gro--9358 606 Jones Garfield (c) (o) 610 Griffin Henrietta (c) (o) 655 Murray Edw (c) 700 BranAtlsetyorCilnartears(ecc)ts(o) 701 Hoskins Danl H (c) 702 Hicklin Geo W (c) 703 Brown John (c) 706 Tuff Jackson (c) (o)--6230-W 708 Logan Clarence S (c) (o) 755 Edwards Wm E--2319-J Woolfoik intersects 801 Sargent Raymond 809 Davis Jas M Fulton intersects 811 Yates Luther E Cowan intersects 901 Shelton Otto H 903 Christian Henry J 905 Sawyer Wiley Reynolds Robt D 907 Lassetter Robt L gro--9356 909 Reynolds Robt D restr CLINTON RD (EM)--Continuation of Clinton north from intersection with Hall 907 Turner Wm M (c) 909 Shaw Enoch (c) (o) 909 (r) Ellis Ross (c) 910 Vacant 912 Elizabeth Primitive Bapt Ch (c) 917 Kimbrough Evans (c) 919 Patrick Chas (c) 921 Vacant 923 Kinslow Silas (c) 927 McCary W Porter (c) 965 (723) Ross Jos (c) 970 (720) Ross Chas (c) 1008 Moore Clarence W (c) (o)4570-R 1010 Jackson Mitchell J (c) (o) 1011 Rogers Mary A Mrs (o) 1012 (1135) Glover Alfred (c) (o) 1013 Owen W Roland--1696-J 1014 Humphries Charles L--5166-R 1015 Pickett Ida T Mrs (o)-- 5166-W 1016 Burney Martha C Mrs (o) 1017 Clay Lamar Jr 1018 Vacant 1019 Smith John I (o) 1020 Elder Erwin W (o) 1021 Wilkes Homer G--3639-J 1022 Elder Erwin W gro 1023 Tyler A Cullen--4463-W 1024 Sconyers Edw A--4463-J 1025 Barfield W Edgar (o)-- 4463-R 1026 Ouzts M Emmett (Corinne)-- 1028 Penn Hulon E (o) 1029 Appling P Geo (c)--5736-J 1030 Graham Ralph J 1035 Central City College (c)-- 5143 Addleton John F Allen Owen (c) Ellis Ida (c) gro Hudson Chas D gro Hudson Chas N--5435-J Jack's Place restr Lowe Leila (o) Outing Hattie (c) Pickett Eug W (o)--1696-W Powers Aris (c) Ridley Robt Roy's Serv Sta & Gro Smith Felix (c) Smith Susie (c) cafe Smith Wm G gro Snyers Cora L Mrs gro Williams Rogers (c) Williamson Minnie M Mrs (o) Woodall Wm A meats CLISBY PL (V)--South from 406 VineviUe av to Boff Home av 103 Denton Mary R Mrs (o)-- 2934 106 Hardeman Gordon I (o) 5874 108 Struby Chester A (o)--1829 110 Simmons Lance B (o)--3090 116 Hawthorne Hubert H (o)-- 3599-W 117 Hogan Jasper T--5240 120 Rogers Thos E Dr, (o)--2557 121 Bethune Benj T (o)--4020-W 123 Hood Marshall H--5764 124 Rousseau Jas C (o)--3672 125 Windom Jack W--2898-J 127 Vacant 129 Chandler Henry H--514-W 131 Ehney Margt L Mrs--2514-J Bansome intersects 200 Talley Benj H--2898-R, 201 Ryals T Edw (o)--6440 202 Rabun Sallie Mrs--4973-M 203 Long Margt M Mrs (o)-- 2604-W 204 Chapman Holt (o)--4195 205 Bernd Henrietta Mrs (o)-- 1259 207 Platt Mary S Mrs (o)-- 2898-W 208 Brown J Holland--1591 209 Rogers Philip W--2040 210 Peacock E Julian (o) 212 Park Chas L (o)--3615 213 Morrison Otis A--4973-R 214 Martin John W Dr (o)--164 215 Sandefur Ewell L--2514-R Lifsey Hewlitte nurse 216 Myers Wm F--235-J COLE--West from 852 Orange, 1st s of Holt 114 Apartments: 1 Keene Mollie Mrs 2 Gunnels Howell P 3 Long Bessie Mrs 4 Vacant Street continued 115 Myers Wm Y (o)--1170-J 122 McGee Ennie C (o)--4014-J 124 BrownJesse G--4014-W 124% Vacant 125 Jones Wm C (o)--5449-J 126 Terry Mack I 128 Bedgood Hansell M 131 Woods Lummie Mrs--1170-W 132 Bazemore Crowell O--2819-J 136 Martin John S (o)--758 137 Simpson Etta Mrs 143 Lawless Wm H 145 Camp G Mack--5449-R 148 Hatcher Florence E 150 Bowman Alice Mrs 151 Hattaway Wm C 153 Long Albert C (Maple intersects) 200 Fountain 202 Dent Oscar R 204 Frazier Luther F COLEMAN AL--East from 652 New to 1st & south from 754 Plum to Pine 1 Barron Clara 2 Jackson J P (c) 3 Hogan Helen (c) 4 Irwin Riley (c) 75 Pullins Preston (c) 124 Nealy Henry (c) 126 Vacant 132 Lawrence Millie (c) 507 Smith Josie M (c) 509 Rice Mae (c) 511 Jackson Rachel (c) 513 Vincent Mary (c) 514 Leonard Geo (c) 516 Randall Frank (c) 205 Slaughter Louis (c) 258 Lipstead Grace Mrs--6107-J 517 Barnes Susie (c) 206 Johnson Elbert (c) 263 Napier E Tris (o)--5944 523 Troutman Irene (c) 207 Jackson Andrew (c) 271 Bracken Jas W--6107-W 652 McNair Ella (c) 208 Butler Harden (c) 272 Humphries Mattie Mrs (o)-- 209 Tarver Robt (c) 4125 COLEMAN AV (CH)--West from 210 Felling Chas (c) 277 Cunningham Colbert A--1983 506 Adams, 1st s of Lawton 212 Ridley Hattie (c) 278 McLendon Annie V Mrs (o)-- 91 Atlantic Serv Sta--9586 (Ash intersects) 3109-J 93 Jolly Wm A--582-W 302 Vacant 279 Lifsey Chas L--1138 95 Smith Henry P--2137-J 307 Vacant 280 Anderson Carl L (o)--1186 97 Dillard Lillian--3905-J 308 Campbell Wm (c) Redding Mattie M nurse 99 Adams Edith--908-J 309 Vacant 284 Brown Homer F--1120 (Linder av intersects) 310 Price Anna J (c) Brown Walter V 101 Mozo H Bailey 311 Vacant 287 Wortham Nettie D Mrs (o)-- Martin Wm B--551-W 315 Hunter Reuben (c) 3179 102 Cason Edw J (o)--829 317 Bateman Wm (c) Woodliff intersects 103 White Jos N--1808-J 319 Barnes Carrie (c) 290 King Campbell T (o)--2071 111 Wright Lewis H Rev--708 (Eim intersects) 296 Sloan Apartments 114 Edwards Penelope J Mrs (o) 432 Williams Rufus (c) Apartments: --2853-W 448 Vacant 1 Stubbs Lillian 119 Glover Clifford Mrs--2840-W 449 Pearson Leon (c) 2 Vacant 120 Watson Eliz Mrs (o)--2323-J 450 Vacant 3 Smith Robt L 121 Ott T Cane--5448-R 451 Lawson Herman (c) 4 Vacant 126 Long Kate Mrs--2106-W 452 Jones Fredk (c) Street continued 127 Peeler Eliz J Mrs (o)-- 453 Wimberly Gertrude (c) 300 Armstrong Octavius--1453 1698-J 454 Vacant 305 Lafayette Terrace 130 Spangler Geo C (o)--5620-J 455 Barnes Geo (c) Apartments: (Johnson av intersects) 464 Vacant 1 Sutton Jas B--135-J 201 Sammons Jas P (o)--3492-J 466 Vacant 2 League Ellamae A Mrs-- 202 Watson Roger A (o)--6355 1956 210 Cater Thos J--3492-W COLLEGE--South from Rose Hill 3 Wilson Jos W--1844-R 218 Shealy Philip C Cemetery to Highland av, 1st e 4 Warlick Freeman H 219 Pi Kappa Phi Fraternity of Madison 5 Wachstein Lenora Mrs 221 Mattrews Margt (o)--2725 222 Kinman Russell B (o)-- 5620-R 223 Cropper Raymond C (o)-- 2147-W (Carling av intersects) 315 Phi Delta Theta Frt 320 Jones Thos J--4018-J 321 Vacant 322 Stewart Fred D--4018-M Rose Hill Cemetery 125 Vacant 141 Abrams Georgia (c) 145 Layfield Ella (c) 152 Wiley Ada (c) 153 Dennis Fetth (c) 156 Parham Wm (c) 160 Johnson Effie (c) 161 Garcia Pedro (c) Jones St la intersects 6 De Vaughn Wm M--136-W 7 Cargill Edw K--1810 8 Vacant Street continued * * Bond intersects 310 Apartments 1 Branan Harold H--1807-W 2 Henderson Howell H--5370-J 3 Rogers Lester--5948-R COLEMAN'S LA (EM) -- East from Fort Hill, 1st n of Williams 1017 Eppigs Minnie (c) (o) 1020 Sons & Daughters of Jerusa- lem Hall (c) 1022 Thomas Almeta (c) 1056 Thorpe Frank (c) 1065 Thorpe Abr (c) 1071 Brown Mingle B (c) 162 Mason Geo (c) 170 Gilliard Joseph (c) 174 Clemons Mary J (c) 176 White John T (c) (o) (Jones intersects 200 Hutchings Wm P (c) (o)-- 3728 205 Danforth Remus (c) (o)-- 2392--R 208 Dogwood Mary (C) (o)--2543 209 Hall Warren ( ') 4 Dodgen Hugh S--3858 Street continued 314 McCormack John E--3895-J 317 Coleman Sami T (o)--782 320 Carswell Hattie T Mrs--2737 322 Gwaltney Eug C--599 324 Wright Jesse E (o)--959 329 Bloodworth Geo T--3421 335 Chatfield Belle Mrs--3704-J 341 Brown R Lawson (6)--489 354 Richards Thos J--3045-W COLES AL--West from nr 918 Oglethorpe 152 Vacant 154 Vacant 155 Gallimore Georgiana (c) 156 Vacant 157 Williams Mary (c) 158 Vacant 159 Chapman Claude (c) 160 Anderson Willie M (c) 161 Wade Jesse (c) 162 Jackson Geo (c) 163 Cooper Emma (c) 164 O'Neil Wm (c) 165 Rutherford Bug (c) 166 Jones Lilly (c) 168 Williams Chas (c) 210 Vacant 355 Butler Earl W (o)--607 211 Hill Cleveland (c) 360 Apartments: 212 Lee Walter C (c) (o)--756-J 1 Collings Thos L--724-J 215 Moody W Thos--3285 2 Ward Clifton P--258 216 McBrearty Chas--130-J 3 Crews Jas S--1319 217 Mann Robt E--1552-J 4 Harris T Isaac--1047-J 221 Satterfield Dell B Mrs (o)-- Street continued 1475 362 Crook Chas E--5838 224 Newman Lula B Mrs (o)-- Boone Walter S--1806-W 4943 363 Apartments: 224 (r) Vinson Belle (c) 1 Ross Jas T (o)--800 226 Solomon Wm W 2 Vacant 237 Kirven; Liston C (o) 3 Adams Carl M--996 239 Massee Annie C--2090 4 Bragg C Clark--2239-M 240 Balkom Thos N Street continued 246 Vacant 367 Stevens Lillian D (o)--466 250 Apartments: 368 Cunningham Clement S-- 1 Jones Martin L--6260-W 1391-J (Hazel intersects) 2 Flahive Joseph J--4125-J 370 Whaley Claude L (o)--6514-J 200 West Fredk (c) 201 Reese Carrie (c) 202 Sutton Alberta (c) 203 Vacant 204 Graybill John (c) 3 Cameron Ernestine 4 Vacant Street continued 254 Wright Geraldine L Mrs-- 658 375 Bennett W Walter--3970-W 376 Felton Augustus C (o)--453 401 Massee Apartments Apartments: 1A Mobley Walter E--6330 530 Baldwin's and Telegraph's IB Costa Joseph--3778 1C Williams Frank M--1895-M ID Rushin Chas--3207-R 2A-B Dannenberg Walter F-- 2248 Jefferson ter intersects 452 Apartments: 1 Harris Emmett B--967-M 2 Tomlin Ernest A--967-W 597 Battle Annie L Mrs (o)-- 6298-W Cor St Paul's Episcopal Ch Forsyth intersects * * 2C Renfroe Annie B Mrs--2451 3 Stamps Dolores Mrs 2D Waxelbaum Aimee P-- 4 Whitfield W> Herschel--967-R 1895-R Street continued Cotton av intersects 610 Roberts Chas E (o)--715 624 Neel Jos N (o)--1206 . 2E Dossey Nettie Mrs hostess--310 2F-G-H Vacant 3A Frey Fred D 3B Bobo Walton E--979 3C Stelljes Geo--3225 3D Waxelbaum Josceph--3361 3E Bishop Joseph E--3409-J 3F Frye Fredk 3G Hayes Y Eug--1430 3H Jenkins Wm A--794 31 Slade Truman J--285 4A Smith Marshall B--4680 4B Vacant 4C Christie J E 4D Peddy Julian E Jr--3110 4E Hertz Hermia--3484-M 4F 6'Daniel Pearl N Mrs-- 3484-J 4G Berckmans Robt C--799 4H Allen Emily--2307-J 41 Carr H Eleanor Mrs--4897-J 5A Kingman Robt D--999 5B Adams Dana H--2710 5C Hay Park L Jr--2240 5D Werba Edw O--2649 5E Trenary Wm F Jr--1894 5F Cameron J Kenneth 5G Newton Chas E--1061 5H McRae Ruth 51 Jones Lily M--2942 6A Harrold Eliz--1905 6B Davenport Wm H Jr-- 1498-J 6C Anderson Halstead T--5150 6D Coleman Ida M Mrs--1282 6E Pruett Joel F--1459-M 6F Myrick Carrie L--1459-R 6G Ainsworth Wm N Rev--824 6H Akin Sallie M 61 Sikes Hattie--796 7A Hathaway Danl J--6129 7B Hackett Frank L 7C Mitts Keyes--2973 7D Goldstein Ellis--2963-J 7E Vacant 7F Loyall Jennie--3824 7G Lamar Julia--722 7H Walker Kitty S--4724 71 Levie Otis H--134 8A Vacant 8B Meath Martin J--183 8C Geoghegan Brooks--5974 8D Kerr James F--3265-J 8E Thomas Lester A Jr--3053 8G Hinton Chas C--1153 Street continued 404 Grace Walter J (o)--611 409 Sheridan Jos A 410 Willingham Alf R (o)--2237 411 Williford W Thos (o)--3343 414 Estes Nannie J Mrs (o)-- 2239-J 415 Willingham Eunice Mrs (o)-- 3237 418 Hart Freeman (o)--90 425 Piper Bernard H--4781-J 427 Moorman Arth L--967-J 445 Davis Danl--4552-M Georgia av intersects 456 Adams Danl D (o)--4552-J 468 Sparks Willis B (o)--6042-J 470 Ellis Theo W--4455 476 College Hill Apts Apartments: 1 Smith John C--5415-J 2 Hawkins Willis A 3 Warren Dayde Mrs--246-R 4 Hobbs Rupert--2477-W 5 Haley Franklin 6 Vacant 7 Heyward Emory S--3488-J 8 Vacant 9 Rogers Mary B--2962-J 10 Massey Jos B--246-J 12 Edwards Jackson L--2082 14 Cook Marjorie--246-W 15 Bennett J Gordon Street continued 478 Ellisonian Apts Apartments: 1 Nye Elbert C--227-R 2 Vacant 3 Zimmerman Herman 6042-W 4 Toole G Glenn--555-R 5 -Wallis J Cosper--850-J 6 Durham Clifford--1561-M Magnolia intersects Washington Pk Washington av Intersects 500 Wesleyan Conservatory College Beauty Salon--4816 501 Chiropractic Health Home- 431 507 Nash Chas E 515 Hill Maude S (o)--2457-J 520 McCook Jas W (o)--1609 521 McGee Marie Mrs--1843-J Canuett Mary nurse 525 Apartments 1 Payne Wm S Willingham Thos M (o)--2871 2 Zeigler John R--4142-W 3 Kemme Eugenia Mrs--384 4 Willingham W Bibb--1126 Street continued 530 Vacant 531 Boone Tolar H (o)--2464-J 532 Porter Jas H (o)--1091 534 Ross Murrell G (o)--632 545 Willingham Sarah Mrs (o)-- 615 550 Barfield H Lee (o)--2464-M 554 Waxelbaum Lewis I (o)-- 282-M 555 Kendall Anthony T (o)--3950 Tinsley la begins 556 Park Orville A (o)--113 558 560 Massee Harris Wm J Walter A(0)(--o)8--081034 563 McKenna S Edw McKenna Ruth M nurse 565 Flournoy Jos A (o)--6069 567 Harrold Thos Jr (o)--6022 569 Canipelli Vincent (o)--4142-J 570 Smith Benj C (o)--509 571 Chambers Avner (o)--4953 576 Tennille Estelle (o)--2748-J 587 Wright Horace A (o)--836 632 Roberts Warren (o)--942 635 Vacant 656 Riley Julia T Mrs (o>--3034 657 Adams Eva C Mrs (o) timmerman J Warren--1678 659 Hart Jesse B (o)--760 662 Allen K Poe (o)--2127-J 664 Derry Henry P--628 666 Andrews Wm 670 Barfield Bennett W--3802-J 679 Erwin Helen P Mrs (o)-- 5127-W Appleton intersects 680 Craig Eliz Mrs (o) 681 Humphreys Chas H Peacock Chas H--610 683 Vacant 686 Smith J Lundie--5028 687 Jemison Lannie H Mrs (o)-- 4782-W 689 Bell Albert P--2330-J 689% Vacant 690 Howard John R (o)--6595 692 Milady Cleaners--817 694 Vacant C of Ga Ry intersects * * * Chestnut intersects 709 Taylor Frank (o)--6329 711 Clarke Robt L--2765-J 715 Slocum; Martha Mrs--4635-R 719 Schell Elmer D--3582-J 720 Chasteen Burt M--389-J 722 Willis W Fay--8582-XY 723 McMurray Edith Mrs (o)-- 3582-W 724 Cary Robt F 726 Williams James It--389-W 727 Carstarphen Taylor T (o)-- 4635-W 728 Dopson Jas M 735 Hart Mamie S Mrs (o)--9082 736 Ward Mary K Mrs (o)--582-J Ward Helen G nurse 737 College St Gro--1287 739 Fulford's Pharm--1631 742 Smith Chas B--3582-M Miller Mildred Mrs 745 Bradley W Jos (o)--4638 747 Huthnance Alice M Mrs (o)-- 4420-J 748 Wippler Wm F (o)--4993 751 Drew Thos C (o)--1638 752 Tatnall Sg Presbyn Ch Oglethorpe intersects 800 Gulf Refining Co serv sta-- 9309 810 Apartments: 1 Favors J Wm--2236-J 2 Smith Wm A--112-W 3 Kirkland Ernest T--1121-R 4 Murray J Aex--112-J Street continued 836 Alexander Sch No 2 838 Long Augustine J--3938 840 Redmond Annie Mrs--2383-J 846 Hertwig Maria P Mrs--1270-W Tatnall Sq Pk Hazel intersects 906 Perkins Thos--1270-M 1935 Macon City Directory 631 910 Medlock Milo B (o)--1930 Elm intersects 912 Holder Isabel Mrs (o)-- 1120 Vacant 99 (141) Etheredge Emmett B-- 100 (144) Estes Geo P (o)--1660-M 3836-R 1121 Johnson Chester J 101 (139) Vacant 920 Albion Apts 1123 Gaddy Hubert 102 (142) Edmonson Claudia Mrs Apartments: 1 McLendon Thos O 1126 Gates Rost L (o)--6413 Co) 1127 Forrester Clifton A--1583-J 103 (137) Baldwin Fredk O 2 Lockhart Richd B--5170-J 1128 Stewart Theo R 104 (138) Dean Sami A (o) 3 Cauthen John C--1174 1130 Vacant 105 (135) Pressley Harry M-- 4 Alley Gewinner--5285 1131 Taylor S Henry 1563-J Street continued 1132 Gilmore Starling 106 (136) Davison Chas (o) 4 Findlay Richd E--1470 1133 Shupe Leroy R 107 (133) Burden Jas W--2939 930 Tatnall Apartments 1134 Kent Sami E (o)--5290-W 108 (134) Hollingsworth Thos Apartments: Edgewood av intersects F (o) 1 Wommack Wm A Tr--6249-W 1234 Riley Frank H (o) 113 (125) Morgan Oliver F 2 Spiers Chas K--9068 1236 Riley Sami H--4159-R 115 (123) Hatcher Arth E (o)-- 3 Willingham Benj B--6249-J 1237 Israel Geo M (o)--810 4550 4 Lewis Arth--3850-J 1238 Richards Henry L 117 (121) Kitchens Martha O Street continued 1240 Wilcox Homer H 118 (124) Cook Clarence 936 Alpha Tau, Omega Frater- 1241 Lyles Ella Mrs (o) 119 Bailey Henry I nity--1053 1242 Willis Josephine Mrs 120 Ryle Vernon B 940 Centenary M E Ch Prince intersects 121 (115) McDaniel Lonnie Ash intersects 1400 Vacant 124 (116) Hightower Labon L 1130 Vacant 1132 Vacant COLLEGE PL--West from 243J 126 (112) Field Edw G 130 (110) Myers Lonnie W 1134 Vacant Ross to College, 1st s of Hazel 136 (102) Driggars Seymour B 1136 Vacant 1138 Vacant 1224 (1234) Clements Chas E Elm intersects 1226 Huff Wm P--1543-J 1231 Harrell J Henry--1543-XR 1235 Hays Jos S--6475-R 1238 Bacon Philip C 1240 McClung Plinnie J 1242 Smith John T dairymn--5040 1244 Baskette Braddock M Prince intersects 1340 Molton Frank A 1343 Grubbs Jas B 1344 Rhodenhiser Roy B--1782-J 1346 Vacant 1350 Long Bonnie L (o)--1557-J Mary intersects 108 Avent John T (o)--4085-J 109 Andrews Felton E 110 Martin Chas I vending machs --1679 111 Samples Daisy Mrs (o)-- 958-W Shamrock intersects 200 Harris John J Wooten Frankie F--6214-J 201 Vacant 202 Wrigley Henry P (o)--684-W 203 Tarver Lettie Mrs (o)--6084-R 204 Knight B Dallas (o)--6249-M 205 McDaniel Julius A (o)--6084-J 206 Parker Geo H 207 Pinkston J David--6084-M 209 Sherrer Wm H (o)--2383-W. Antioch rd intersects 200 (201) Ross Lee (c) (o) Peacock intersects 301 (204) Chapman Edw C (c) 303 (608) Berryhill Hannah (c) 305 (606) Bonner Robt (c) 307 (604) Goodwin Susie L (c) 309 (602) Whittington Anna (c) Mason intersects 400 (401) Moore Levorse (c) 403 Waters John (c) 405 King Edw (c) 407 Stephens Isaac (c) 455 Miller James (c) 457 Brooks Jessie (c) Henderson Intersects 500 (409) Roberts Wm (c) 506 (104) Dillard Geo (c) 1436 Fuss John P--1557^W 1440 Sherwood Thos B Jr--2921-J 1444 Lewis Claude M 1446 Bragg Edgar R--6475-M 1450 Grant Maynard E--1543-XM 1452 Gratigny Jerome A--6475-J 1454 Vacant Plant intersects 1537 Campbell Chas B (o) 1539 McLendon Augustus C (o)-- 6256-M 1541 Eddings Herman L 1543 Sherwood Thos B (o)--S402-J 1544 Asbell Geo E 1545 Meeks Joseph B 1546 Vacant 1547 Scott Minnie G Mrs gro--9478 1548 Chailan Chas P (o)--6253-J 1st intersects 1601 Vacant 1603 Norman Grady COLLINS PL--South from Stewarts al to Jefferson bet Monroe & Madison 202 McKinley Lizzie (c) 204 Griffen Peter (c) 206 Pitts Lee (c) 207 Davis Ulysses (c) 208 Redding Janie (c) 210 Mills Leila (c) 212 Rouse Ella (c) 214 Dorsey Mollie (c) 215 Jamerson Lillian (c) 216 Jones John (c) 218 James Julius (c) 220 Anderson Lillie (c) 221 Reeves John (c) 222 Hudson Lula (c) 224 Pleasant Robt (c) 226 Anderson Jennie (c) 227 Adams Lizzie (c) 228 Jackson Albert (c) Stevens intersects 600 (113) Davis John (c) 602 (112) Razor Danl (c) 604 (111) Smith Alonzo (c) 606 (109) Haugabook Danl (c) 608 (107) Johnson Chas (c) 617 (208) Bryant Viola (c) 621 (207) Vacant 623 (206) Yarborough Louis (c) Toombs intersects 700 (519) Gale Lucille (c) 701 (700) Young Chas (c) 702 (320) Jackson John L (c) 703 (207) Jenkins Jacob (c) 704 (208) Vacant 705 (203) Edge Tony (c) 706 (205) Boose Wm (c) 707 (202) Harvey Chas (c) Texas intersects 800 (115) Story Chas (c) 801 (181) Porter Lucile (c) COLLEGE DRIVE--South from 1200 blk Ash, 1st e of College 230 Reeves Mollie (c) 232 Ford Mattie (c) 233 Burke John (c) COLUMBUS--West from Orange (at Pk. pi) to Shamrock 1004 Jackson Mattie (c) 234 Mullins Johnnie (c) 260 Dewberry Annie F Mrs (o)-- 1008 Cochran Ida M (c) 235 Richardson Jas (c) 1390 1016 Albea Robt (c) 236 Mitchell Wm (c) 252 Colbert Henry D--4858-J 1020 Akin Rosa (c) 238 Akin Lula (c) 258 Bailey Fleming W--5391-M 1025 James Ralph (c) 239 Vacant 261 Lamis Jas (o)--6243 1026 Wilder Howard (c) Green's la intersects 262 Pritchett Alonzo P--1592-J 1027 Palmer Clara (c) 408-58 Vacant 264 Clark Seth E--1073-W 1028 Bloom Joseph B (c) 265 Etheridge Robt N--5391-J 1042 Vacant COLQUITT (EM)--East from 2632 266 Patterson Edw W--5882-W 1045 Mundy E R Thos Broadway 270 Wall Jos A--5882-R Mundy Jas T (o)--1350 97 (143) Chambers Howell C 272 Campbell Richd W--5882-J 532 Baldwin's and Telegraph's 274 Taylor Nancy E Mrs 280 Wellons Augustus R gro-- 3816 282 Vacant Appleton Intersects 315 Johnson Ida B Mrs--3370-M 319 Schmidt Arth W (o)--2195-W 327 Allen Anna Mrs (o)--3370-K 328 Wellons Shelley E 330 Pittman Herman A 334 Means Sarah E Mrs (o) 339 Wellons Augustus R 340 Smith Stella Mrs (o)-- 4858-R 341 Brown Carlton H 343 Dushane B Alf 345 Vacant 348 Lines Rayfield--3370-J 350 Langston Wm W 352 Mote Andrew J 106% Union Bros & Sisters of Zion Hall (c) 108 Richardson James (c) 110 Brice Reuben (c) 112 Morgan Ryle (c) 116 Peek Virginia (c) 120 Turk John (c) 124 Price Thos (c) 128 Curtis Nettie (c) 130 Kitchen Abbie Mrs 138 Kitchens Wm 146 Whaley John CORBIN AV (V)--North from 525 Vinevilie, 1st w of Rogers av 100 Skinner Walter A (o)-- 1757-W 102 Tharpe W Tully (o)--2035-R 104 Whitehead J Berrien (o)-- 2534-J 105 Hardeman Building Rooms: 1-2 Feagin & Feagin lawyers --193 Perry Torn M lawyer--193 3 Palm Pur Co--6 4 Bloodworth & Bloodworth lawyers--5 5-6 Ga Retail Lbr & Bldg Sup Assn--244 8-9 Vacant 12 Vacant 13-14 Tipton Edw W lawyer-- 711 Urquhart Julian F lawyer- 711 15 Clements F Larcus lawyer-- 711 Campbell R D C lawyer--- 711 COMER TER (PM)--West from Rose av, 1st s of Green 105 Griffith Arth (o)--5540 106 Childs Wyatt B (o)--4690 107 Menard Albert R (o)--5178 Johnson Arth M real est-- 711 3d fl Lamis Wm 112-13 Morrow Fredk A--6558-W 108 Matthews John T (o) 114 Jordan Woodrow 1465-W Bankston R E Jr Sanders Julius 115 Blair J Floyd 110 Mitchell Horrance N (o)-- Street continued 116 Rice C H 117 Mullis Frank 3269 107 Royal Typewriter Agcy-- 112 Chrisman Wm W (o)--2185 3411 119 Vacant 120 Sapp Geo W 121 Adams Merritt A 113 Orr Clifton B--2785 114 Burgess Malcolm S Thomas Maurice C Millirons Pimbg & Heating Co--3176 109 Idle Hour Nurseries--223 122 Land Fredk 115 Sanford Paul H (o)--1980 111 Masonic Hall 123 Tucker Essie Mrs 116 Norris Wm M (o)--3455-W 113 Mozo Furn Co--1311 124 Rainey Jas B 125 Vacant 126 Barton Vernon 117 Jones Mamie W (o)--4034 118 Towler Silas C (o)--4565-W 119 Stewart Louise J Mrs-- Evans Rufus'; R radio repr-- 1311 115 Elec Dry Clng Co--3500 127 Johnson Leroy 128 Tyson Laudice L 129 Vacant 2720-J 117 Warlick Hillver C photogr-- Stewart Minnie Mrs--2720-W 767 121 McWilliams Manley (o)-- 119 Schelling Geo R shoe repr'-- 130 Benton Benj H 131 Foster Troy 132 Kitchens Arnold E 133 Vacant 134 -35 Cobb Ernest F 136 Vacant 137 Dunn Chas 2471-W Clayton intersects 203 Oliver Jas W--1834-W 204 Maddox Edw L--5979 205 Hearin Ellis R--9088 206 Atkinson Harold C (o)--2813 207 Bullington Roy V 9277 Silk Stocking Hosp 123 Film Shop The photogrs-- 123% Mitchell Mae 125 Vacant 127 Elks Club--9229 131 Lowe Elec Co--6300 138 Layfield Floyd 139 Chambley Jesse A 140 Vacant 141 Tidwell Edw 142 Freeman Cleveland J 143 Molton John W 144 Farr Noel 145 Vacant 148 Riley Chester E 147 Dukes Jas P 148 Vacant 149 Edwards Austin W 150 Sapp Wm 151 Barron Clarence J 152 Smith Chas E 153 Gordon John, R 154 Duke Fredk C 155 Whitehead Roy C 156 Jones Irvin J 157 Brewer Nathan 158-59 Brown Harry T--3808-R COMMODORE--West from 119 Bartlett's la to Ernest, 1st s of Napier av 1000 Turner Jos B (c) 1002 Dean Wm L (o) 208 Beach Donald D--5544-R 209 Redding Edw B (o)--5026-M 210 Stewart Benj C (o)--1834-J 211 Williams Andrew M (o)-- 5168 212 Jones Grover C (o)--2894 213 Riley Jos T Jr (o)--2019-J 214 Dunwody Danl D (o)--5983 215 Watson Richd P (o)--5310 216 Amspoker Guy E--2019-M 217 Blum Arie I (o)--2574 McDonald Intersects 301 Fitzpatrick Benj S (o)-- 5544-W 302 Johnson Geo M--5645 303 Wallace Milton K (o)-- 1054-W 304 Chichester Helon L (o)-- 1054-J 315 Myers Ocie Q Mrs-568 315 Davis Wallace McC--4049-J 317 Manget Victor (o)--4049-W 319 Thombley Robt L--1735-J 321 Brantley Alf (c) 325 Jackson Alonzo (e) 327 Ward Walter (c) 329 Banks Wm (c) Wall intersects 150 Macon Savings Bk Bldg Macon Saving Bk--336 Rooms: 201 Taylor Robt J investments --417 202 Vacant 203-05 Phoenix Mut Life Ins Co--315 206 Nottingham Warren G ofc --5236 301-02 Wells Wm D dentist--656 303-04 Perdue Chas, H dentist --2349 305 Wilson & Vandiver lawyers--2826 806 Willingham Benj B ins2826 307 Grayson Dolly Cosmetic Co--2877 308 Vacant 401-07 Davis Edwin S ins-- 1142 Jaekson J Guy ins 403-06 Maynard Elijah W lawyer City Atty--727 CONCORD (SM)--West from 701 COTTON AV--West from 600 Elbert to Broadway 105 Vacant 106 Vacant Mulberry to Spring 103 Shelverton-Bayne Drug Co-- 3405 1985 Macon City Directory 533 Taylor Edw F lawyer--506 Jones S Gustavius lawyer-- 727 408 Anderson Wm G dental laboratory--441 501-07 Carlisle & Bootle lawyers--664 504-06 Geoghegan & Norris accts--6266 508 Vacant Street continued 151 Artistic Beauty Shop--2361 153 Macon Memorial Pk ofc-- 2666 154 Vincent F T Realty Co--Inc --860 155 Nat Cash Register Co--4112 156 Stokes Thos W real est-- 2883 157 Burns Kenmore Inc real est --878 158 Merriman School of Business The--6367 159 Taylor Furn Co--2051 160 Wood-Peavy Furn Exch (rear) 161 Allen's Studio photogrs-- 3271 Gregorie Chas H dentist-- 1405 163 Mayham Chas S 168 Taylor Furn Co (rear) 169 Hall Thos H III real est-- 6387 171 Nutting Floral Co--1776 173 Rialto Theatre--30 179 Georgia Power Co--4100 Cherry intersects 201 Ellis Building 201 Community Sav & Loan Co-- 6131 201% Earle Nancy Cosmetic Co --2715 Rogers Jos W phys--956 203. Stanton Sound Serv radio reprs--1178 205 Collins Baking Co--4900 206 Stephens Bob Barber Shop 207 Great A & P Tea Co gros-- 726 208 Canter's Delicatessen--3841 209 Woman's Exch novelties-- 2557 210 Rogers Stores gros--9706 210% Atwood's Pleating Plant- 1524 Atwood E Jay 211 Bankers Ins Building Bankers Health & Life Ins Co home & dist ofc--2440 WMAZ Radio Sta--3131 Southeastern Broadcasting Co--3131 359 Lucky Strike Bowling Alleys --9521 361 Barnes & Barnes Inc ins--25 Roberson Realty Co--321 361% Vacant 363 Jung Frank ldry 365 Bibb Printing Co--1671 369 Vacant 407 Vacant 407% Vacant 409-11 Vacant 411% Masonic Hall (c) Smith Robt L (c) lawyer-- 756-W 413 Hunt Thos J (c) barber 415 Underwood Pearl (c) restr 417 Tavern The (c) restr 421 Bibb Poultry Co--1636 421% Sanford Clyde R (c) tailor 423 Jenkins Elijah (c) shoe shiner 425 Johnson Walter (c) tailor Jackson Walter (c) sign pntt 429 Ingram Sami (c) restr 429% Stocks Wm S (c) tailor 451 Yetter Geo F Inc--331 451% Macon Lodge No 555 IBP O E (c) 452 Hurley Elec Co--2936 453 Vacant 454 Bradley Oscar gro--1166 455 Pythian Lunch Room (c) 456 Union Shoe Shop reprs--4371 456% Vacant 457 Independent Funeral Home (c)--4827 458 Yelin Benj delicatessen--4551 460 Duval Paul & Son (c) furn reprs--2688 461 Vacant 462 Michael Jos sec hd clo 463 Vacant 463% Key Mattie Mrs 465 Clemons Sol C (c) real est-- 465 466-68 Hubbard Funeral Home (c)--997 466% Jones Fannie (c) 467 Moran Dora Mrs 469 Vacant 471 Six Point Weiner Stand- 9119 474 Vacant 76 Vacant 478 Dean M Otis Mrs gro--2338 Dean W Bonnie New Intersects 527% Pilgrim Health & Life Ins Co (c)--3951 528 Harris Vinie (c) 528% Johnson Buster (c) 529 Bentley Wm J (c) 530 Central City Funeral Home (c)--57 531 Powell Wallace (c) 534 Tremont Temple Bapt Ch (c) 538 Leggett Chas A bldg contr 561 Leak Daisy (c) 565 Stewart Chapel AME Ch (c) 574 Vacant 576 Mercer Clarence M gr--9632 576% Mercer J Ernest COURTLAND AV--South from nr 120 Hillcrest av to Montpelier av, 1st w of Pio Mono av 100 White Miller G--5943 101 St James' Episcopal Ch 102 Roller H Freeman--294-J 103 Murrah Bascom W (o)-- 3967-W 104 Piland Chas A--2055-J 105 Hicks Jas R Jr (o)--2679 106 Hill Winnie M kindergarten Hill David W (o)--429 107 Brooks Frank B--2790-J 108 Thomas Geo N (o)--675-W 109 Corn Ernest) (o)--480 110 Stephenson Jas L--3967-J 111 Rankin Goodwin S (o)--6072 112 Slocum Karl R--3643 113 Davis Chas H--5762 114 Mahone Roland T (o)--4590 Cherokee Intersects 404 Carter Jas S--3289-W Napier intersects 667 Lowrance Jas L (o)--5446 669 Fowler Thos E--2628 670 Barfield John R Jr--3202-W 678 Stallworth Paul--3202-J 679 Price Sami J T*--6098-R 680 Marshall A Roy--3202-M 695 Emerson J Fred--3479 696 Leverette Oscar E--2972 Beech av intersects 708 McCowen Geo S (o)--1655-J 709 Maddux Josiah A (o)--1279 717 Lester Effie T Mrs (o)-- 4627- W 730 Millican Wm T (o)--3059-J 731 Sheehan L Clyde (o)--2944-W 742 Petzinger Chas F (o) 743 Ticknor Eug T (o)--3918-M 750 Alexander Geo W (o)--3219-J 761 Smith Allen J (o)--4024 212-14 Middle Ga Lbr Co--4338 Plum Intersects Kerry May nurse 212% Atwood's Photo Studio 500 Shell Petroleum Corp serv 777 Harp Melvin (o)--1125-J 213 So Bell T'el & Teleg Co- sta 782 Hudson Harry H--3732 9000 501 Standard Oil Co serv sta-- 793 Hayes Chas G--355-J 216 Central Georgia Baking Co-- 3281 794 Golsan Wm R (o)--3183 4000 509 Criswell H W & A F Co Date av intersects 218 Nu Way Weiner Stand restr plmbrs--4686 806 Jones John A--3059-M --9255 Andrews Tin Shop 808 Gallemore James P (o)-- 220 Cherrio The beer--9239 511 Vacant 3927-W 222 Miller Bros plmbrs--474 511% Wallace W Edwin--2020 815 Jones Louis P (o)--4051-W 222% Ga. Nat Guard 121 Infty 513 Vacant 840 Marshall Onan W (o)--2906 Med Detachment 224 Moore's Dinty Lunch Rm 226 White House Weiner Stand --9203 226% Bell Junius J (c) dentist- 3093 228 Combrevi Lula N Mrs gro 228% Combrevi Lula N Mrs 1st intersects 513% Vacant 515 Nesbit Maggie (c) confr 517 Shropshire John T plmbr-- 1265 523 Vacant 523% Vacant 525 Vacant 527 Kyles Drug Store (c)--9304 841 Griggs J Hillyer--4051-R 842 Gilman Jesse P--2423-J 845 Greene Benj W Dr (o)--1305 850 Jackson Lewis (o)--703 852 Suarez Raymond Dr--587 Sykes Elmer E--5142-J 854 Smith Philip J--5142-M 534 Baldwin's and Telegraph's COWAN (EM)--East from 900 blk 803 (816) Garmon Carrie (c) (o) 200 Stephens Hugh L--2809-M Clinton, 1st n of Woolfolk 806 (820) Perry Patsy (c) (o) 202 Hitchcock Roland M (o)--< 104 Clowers Charlotte (c) Banks Richd (c) clock repr 2622-J 106 Robinson Emma (c) 809 (852) Andrews John (c) 204 Greene J Millard (o)--1260-J 108 Mercer Thos (c) 811 (854) Johnson David (c) 206 Fisher Albert 110 Forest Atheline (c) 812 (809) Sinclair Jos (c) (o) 208 Miller John M (o)--5145 112 Middlebrooks Edw (c) 813 (856) Snipes Wayne (c) 210 Rockwell Beverley H--2267 114 Gooden Albert (c) Short intersects 116 Brantley Marshall (c) 900 (8) Marshall Moses (c) CRISP (SM)--East from 2650 118 Pounds Sina (c) 901 (917) Hilliard Frank (c) Houston av 120 Thomas Andrew (c) 902 (991) Nelson, Wm (c) (o) 96 Lindsey Wm F 122 Wright Susie (c) 903 (916) Green Chas (c) 100 Causey Arth L--2419-W Northern av intersects Society intersects 101 Lyles Benj F--2693-J 123 (121) Rolland Jas (c) 904 (992) Williams Chas (c) 105 Cleveland Grover--488-J 124 Hunt Elmer (c) 909 (993) Peeples Aaron (c) 107 Baisden Robt E (o)--6184 226 (126) Oliver Sami (c) 109 Burke LeRoy 228 Ward Jos (c) (o) CRAFT (V)--North from 271 Har- 110 Matthews Mary Mrs (o) 230 (130) Raines Irene (c) deman av, 2d w of Middle 111 Clifford Geo R--2419-R 232 (136) Brown Wm E (c) (o) 100 (310) Thomas Anne (c) 112 Boland Jos L 234 (138) McCrey Albert (c) (o) 101 (312) Riggins Danl (c) 113 Ong Benj F--2189-R --2422 102 (85) McCrary Alex (c) 114 Taylor Jesse J 236 (140) Hunt Fannie (c) 104 (303) Taylor Bishop (c) 115 Russell Nonnie M 245 Gordon John (c) 106 Moss Ludelle (c) 116 Bius Earl M 247 (246) Ross Carrie (c) 108 Gilbert Irene (c) 117 Clance Carroll James Noble (c) 249 (248) Mercer Lizzie (c) 251 Billingshea Otis (c) 110 (297) Bryant Sandy (c) 111 (302) Franks Jos (c) 1st av intersects 118 Ivey W Cleo (o)--488-W 120 Clarke A Turner 156 Woodall Jas R--2419-M 253 Canty Jas (c) 255 Ford Julia (c) 257 Thorpe Augustus (c) 259 Healy Herman (c) 261 Miller Mattie (c) 112 (575) Moughon Jennie (c) 114 (523) Vacant 115 (300) Thomas Hester (c) 116 (366) Parker Robt (c) (o) 117 (298) Jackson Sol (c) 158 Thames Earl Blount intersects 202 Dyes S Lee gro Antiock rd* intersects 265 Lester Rose (c) Comer Mattie (c) gro 118 (37) Phelps Wm (c) 120 (448) Simmons Eliza (c) Peacock intersects 300 Johnson Lee (c) Lexington intersects 301 Greeley Madison (c) 303 (203) Goddard Calvin (c) Craft la begins 201 (362) Walker Eug (c) 203 (365) Hill Alice (c) 301 Jones Miller (c) 302 Chappell Henry (c) 303 Campbell Ophelia (c) Short intersects 205 (358) Walters Mattie J (c) 305 (205) Bowman Delia (c) (o) 207 (73) Durden Tillman (c) Center intersects 209 (75) Carter Mary L (c) 400 (291) Tuggle Chas (c) 211 (79) Edmondson Frank (c) 401 (298) Bronson Wm Jr (c) (o) 213 (369) Hughes'Ellen (c) --5788-W 215 (393) Howard Thos (c) (o) 402 (297) Stallworth Mack (c) 441 Gray John T (c) furn repr (o) Ritchey al intersects CRAFT LA--South from 116 (366) 403 (300) Ritchey C Moses (c) (o) 404 (303) Reeves Wm (c) 405 (305) Quick Judson (c) 408 (345) Carswell Jesse (c) (o) Womack intersects 500 Card Sallie (c) 502 (129) Byrd Geo (c) 508 (430) Marks Emma (c) Craft 402 Simmons Chas (c) 403 Grier Lizzie (c) 404 Thomas Maude (c) 406 Bonner Pearl (c) 407 (167) Johnson Sallie (c) 408 Vacant 304 Holloway Oscar (c) 305 Oliver Jas B (c) 306 Manson John (c) 307 Ringwood Abram (c) 309 Dean Elijah (c) Mason intersects 400 (8) Thomas Gus (c) 401 Hawkins Annie K (c) 402 (9) Jones Fannie (c) 404 Finney Henry (c) 406 Johnson Henry (c) 408 Holloway Ruby (c) 409 (501) Smith Arch (c) 410 Thomas Leola (c) 411 Thomas Lee (c) lunch rm Henderson intersects Clark intersects 510 (650) Thorpe Jas (c) 520 East Side Funeral Home (c) --3382 Fort Hill Intersects 602 (516) Moore Walter (c) 604 (222) Lewis Eulis (c) Smith intersects 606 (593) Glover Wiley (c) (o) CRAIG'S LA--South from Ell to Long, 1st w of 2d 50 (51) Vacant 52 Vacant 53 Fountain Benj (c) 54 Vacant 56 Talton Geo (c) 61 Maddox Lizzie (c) 500 (501) Temple Jesse (c) 501 (471) Humphries Silas (c) 502 (503) Jackson Jesse (c) 503 Saints of Christ Holiness Ch (c) 504 (505) Williams Allen (c) 505 (400) Vincent Hughie P (o) gro 506 (507) Johnson Geo (c) 608 (595) Reese Clarence (c) (o) 612 (698) Jones Tabernacle AME Ch (c) Maynard intersects 700 (620) Bryant Arth (c) (o) 701 (117) Gross Danl (c) (o)-- 4370-M Ballard Intersects 702 (122) Lowe Mattie (c) (o) 703 Clark John H (c) 704 (118) Bryant Andrew (c) (o) 709 Harris Lucius (c) Norris intersects 800 Sinclair Eug (c) 801 (814) Harkless Ida (c) CRESCENT AV (CH) -- South from 401 Suwanee av to Napier av 117 Tarver Danl A (o)--2622-W 119 Nutting Geo G (o)--1662 121 Nutting John B (o)--3341 123 McAfee Chas O (o)--4946-W 127 Berry Russell R (o)--4946-J 153 Jarvis Elmer L (o)--2814-M 157 Bledsoe Walter C (o)--2814-W 194 (108) Balkcom Lilia Mrs (o) 196 (120) Lawson Andrew S (o) --2814-J 198 Hunt Eunice J Mrs--2809-R Whitehall intersects 507 (415) Gilman Lizzie Mrs gro --9318 509 Moore Lewis (c) 511 James Thos (c) 513 Davis John T (c) Stevens intersects 600 (601) Wash Carl (c) 601 (275) Vacant 603 (274) Paul Eunice (c) 605 (406) Reeves Augustus (c) 606 Howard Perry (c) (o) 608 (56) Jackson Frank (c) 612 (54) Jackson Wiley (c) 614 (706) Wash Mary (c) 615 Thompson Frank (c) Toombs intersects 1935 Macon City Directory 535 701 (608) Barnes Wm (c) 103 (127) Asbey Mary (c) 805 Evans Victoria (c) 703 (610) Beal Claude (c) (o)-- 105 (126) Layton Rebecca (c) 809 Jones Leola (c) 3955-J 107 (365) Banks Thos (c) 811 Cotton Osie (c) 705 (612) Dill John (c) 109 Phelps Wm (c) 813 Woolfoik Chas (c) 707 (614) Johnson Floyd (c) 111 Johnson Lillie (c) 815 Vacant Texas intersects 113 (9) Vacant 817 Bouyer Carlos (c) 801 (701) Greer Cecil (c) 825 (227) Thomas Leroy (c) (o) 803 (789) Lamar Millie (c) CURRY DR (NH)--North from 805 (788) Ellis Linwood (c) Nottingham dr to Boulevard DAISY PARK--Extension of Pine 806 (799) Terrell Jack (c) (o)-- 130 Rankin Geo P (o)--3483 n from Spring to Orange 3955-W 132 Herron Hugh J (o)--3154-J 100 Smith Mary L Mrs 807 (108) Green Foushions S (c) 138 Sanchez Harry P--2144 135 Giles Wm M (o) 140 Morgan Henrietta Mr3 (o)-- 137 Hilliard Harold 810 (110) Calhoun Edw (c) 3043 139 Chambers Woodfin C-- 4119-M CRUMPS PARK--North from 405 CURRY PL--East from North av 147 Cheatham Grace TJMrs Ridge, 2 w of Ingeside av (at Summit) to Clinton rd 149 Fann Brooks 105 Haralson Perry F 108 McCord Cajah R (o) 115 Clifton Walton H 108 Dunn Roy L (o)--2988 125 Joanis Wm C 127 Dove Wm B (o)--1615 129 Humphries Homer W 161 Chiles Mack S--421-J Jones Paul D DALEY (SM)--West from Broad- CULPEPPER'S LA (V) -- West from 141 Pierce, 1st n of Vine- 131 Bragg Earle S--6235-J 132 Bergman Carl A--6235-R viile av 307 Vacant 310 (98) Lucas Eug (c) 321 Lucas Albert (c) CUTRO AL--South from 107 Roff Home av 101 Frazier Lonie J 103 Vacant way to 2d, 1st of Ell 117 Amerson Frank C 119 Thomas Margt E Mrs 122 Wood Michl D (o) 125 Brown Geo T 130 Jessup C Hickman 131 Andrews J Edw CULVER (V)--North from, 509 Vineville av, 1st w of Lamar 102 Wilcox Geo M Rev--6132 104 Baynard Geo A (o)--1598-W 105 Pittman Marvin C (o)--6127 106 Akerman Chas A (o)--1516-W 107 Reagan Frank--842-W 109 Holt Frances M Sheehan John C (o)--1438 111 Smart Herbert I (o)--2979-W 113 Taylor D Hughes--596-J Cozine John E--1598-J Bacon Herbert F--9033 115 Jones Thos M (o)--2979-R CUTTER'S GREEN (EM)--The block bounded by Main, Garden, Church and Hydrolla 301 Morrison Wm T (o)--4062 303 Hatcher Z Crawford 306 Colbert W Howard--1357-M 308 Heath Linda E Mrs (o) Sudduth Ernest D 310 Smyly Jas T (o) 311 Booth M Edgar--4082-J 314 Smith Jas A 315 Vacant 318 Smith Benj F 139 Moss Allen M--3498-J I DAMOUR LA--West from 121 Broadway to 3d 419 Waldon Maria (c) 421 Jackson Eli (c) 423 Thomas Moses (c) DANNENBERG AL--East from Holt av, 1st n of Lawton av 61 (12) Narrell Cecil J 90 (325) Defore Benj F 94 (328) Stroud Curfey Mrs 99 (11) Newberry Essie Mrs 117 Thomas Fannie H Mrs (o)-- 1252 ,419 Miller Boyce E (o)--1299-J 121 McKay Chas P--1408-W 123 Cherry Henry T--1408-J 125 Barfield Tiros W (o)--3998-W 127 Deaust Annie S Mrs (o)-- 3998-J 129 Frierson Mary N Mrs--2932-J 131 Hollman Roy B (o)--3998-W 133 Janney Geo W--1593-W 135 Cheves Jesse R 137 Drinnon Wm M 139 Randall Viola (c) CUTTER'S LA (EM)--North from 602 Main to Church 200 Vacant 202 Brannon Jas H 203 Brockman Fredk 204 Everidge Dozier 213 (112) Vacant 219 (120) Dudley Averilla Mrs (o) 220 (121) House Mitchell P (o) 223 (122) Land Viola Mrs (o) DAISY--South from Prince, 2d s of College dr DANNENBERG AV--West from 301 Linden av 119 (219) Wright Gus (c) 121 (217) Murray Danl (c) 122 (222) Williams Geo (c) 123 (215) Vacant 124 (224)Andrews Viola (c) Carling av intersects 203 (3) Bloodworth Curtis M 205 (2) Ball Chas J 207 (1) Jordan Film P Duncan av intersects 313 Hicks Cleveland C 315 (112) Clanton Ozell H CURD (SM)--West from 633 Tel- 701 Williams Jas S (c) Randolph pi intersects fair, 1st n of Plant 702 Schrem Jack--3402-W 317 Scoggins Clyde 312 Howard Artis (c) 703 Anderson Robt (c) 319 Williams Raymond A Tindall av intersects 710 Clayton Cleveland (c) 320 Hogue Sami gro--9156 414 Hampton Henry (c) 711 Fudge John E (c) (o) 321 Vacant 446 Brewer John H (c) 712 Stephens Earl (c) 323 Newberry Newman 448 Smith Edw S (c) 713 Oliphant Lee (c) (o) 324 Barnes Jos Campbell a*v intersects 714 Williams Isaiah (c) 715 Solomon Chas (c) 325 (323) King Annie J Mrs 3C7 (328) Gibson Geo W gro (o) Nussbanm intersects 717 Hazzard Wm (c) --9682 800 Vacant 718 Solomon James (c) 330 Bagley Tillman B 801 Hight Hattie (c) 719 Brown Annie (c) 803 Hall Mary L (c) 721 Ross Major (c) DATE AV--West from 801 Pl 815 Ross Wm G (c) 722 Griswold Pearl (c) Nono av, 1st n of Cherry av 821 Frazier Wm P 723 Clayton Jos (c) 209 Vacant 823 Kimble Wm W (o)--5521-R 724 Jenkins Minnie (c) (o) 704 Adams Vivian J (o)--854-J 824 Whiddon Mary A Mrs (o)-- 725 Russell Rosa (c) 705 Roberts Jos A (o)--4920-J 2344-W 726 Watkins John (c) 717 McCrary Nolan (o)--1175 Jones Ewell C 800 Walker Enoch (c) (o) 719 Flood Harry T (o)--2855 CURD'S AL--North from 5 Wood- 801 Thrash Wm (c) (o)--2405 721 Ard John D (o)--3888-J liff 803 Thrash John (c) (o) 726 McElroy Jack Rev 536 Baldwin's and Telegraph'* 728 Sawyer John C--3888-R 733Bar>field John H 112 (6) Pound Frank (c) 277 Hollis Chas F (c) ;(o)-- 2959-J 738 Finison Ernest H--1138 DAVIS LA--North from 4th av 4th av intersects 750 Edwards Bennett H (o)-- (V), 1st e of Linwood av 300 Vacant 2190-J 101 (57) Marlowe Lizzie (c) 323 Scott Ada (c) (o) 760 Bradford Floyd V--6382-R 102 (54) Glover Mun (c) 324 Barker Essie (c) 774 Peddicord Geo W--6382-J 104 (111) Vacant 328 Gray Cora A (c) 105 (157) Lowry Jos (c) 330 Odoms Pummie L (c) DAVIS (NH)--West from Clinton 106 (113) Sims Jas (c) rd, 1st n of Boulevard 108 (115) Jordon Louise (c) 102 Bunkley Mary (c) 110 (117) Roberson Robt J (c) 104 Davis Wm (c) 332 Hunter James (c) 334 Childs Georgia (c) 338(77) King Wm (c) 340 (79) Smith Elijah (c) 105 Lizaboro Baptist Church (c) DEBORDE--East from 2140 2d 107 White Shelton (c) 7 (10) Williams Wm L (c) 121 Groce Albert H (c) (o) 9 Bedney Minnie (c> house mover 10 (78) Fedd Wm (c) Pio Nono av intersects 807 Banks John (c) 808 Kellum Troy L (c) 809 Vacant DAVIS (PM)--West from Bose av, 1st s of Brigham 48 Whitlock Howard H 49 Cook Arth C 50 Jackson Otis 51 Herring Wm 52 Cochran John H 53 Ward Mae C Mrs 54 Collins Jones 55 DuBose I Flemon 56-57 Perkins Rufus 58-59 Giddens Danl B Newman Clayton 60 Whitlock A Fredk 61-62 Jordan Jesse J 63 Persons Hudson 64 Doke Jos R 65-66 James Geo 67-68 Payne City Auditorium 69 Welfare Wkrs Cottage The Herndon Mary Hays Clara M 70-71 Bibb Mfg Co (Payne City Clinic) 72-73 Cobb Thos J Chappell Intersects Middle intersects 100 (172) Stephens Robt (c) (o) 811 Burkett Mattie W (c) 101 (179) Thurman Joseph (c) 813 (724) Davis Thos (c) 102 (170) Pharmes Jesse (c) (o) --3262 Cedar* inte*rsects 103 (177) Burns Murray (c) 5th av Intersects 104 (164) Goodrum Geo (c) 903 (107) Stewart Wm (c) 105 (175) Ross Jas (c) 905 (105) Banks Harry (c) 106 (162) Snowden Andrew (c) 909 (222) Colbert Louis (c) 107 (173) Burg Cornelius (c) 4th av intersects 108 (160) Taylor Frank (c) 1005 (224) Jones Roger (c) (o) 109 (171) Collins Lee (c) 3d av intersects 110 (158) Mathis Wm M (c) 1103 Manard Chas H (c) (o) 111 (169) Hudson Wm (c) 112 (156) Thomas Ivory (c) 2d av intersects * * 113 (167) Harrell Wm L (c) 1st av intersects 114 (154) Crowder Jesse (c) (o) 1233 Smith Nancy (c) (o) 115 (165) Wilder Green (c) 1235 Jones Wm M (c) 116 (152 Guy Jos A (c) (o) 1236 Moseley Sank) (c) 117 (163) Jackson Everett (c) 1237 Ellison Wm (c) (o) 118 (150) Bolden David (c) (o) 1239 Perkins Annie (c) (o) --2532 1240 (225) Woolfolk Albert (c) 119 (16?) Benjamin Wm (c)-- 1245 Perkins Wallace (c) (o) 1504-M 1301 Causey Grifin (c) 12i (159) Murphy Robt (c) 1302 (1411) Bivens Owen (c) 123 (157) Holmes John H (c) 1302 (1411) (r) Vacant DAVIS (SM)--East from 3006 Houston av to C of Ga By Tracks 100 Adams Herman T--39-W Capitol av begins 101 Smith Jerry T (o) 102 Emerson Susie Mrs (o) 109 Byrd Geo H 110 Bishop James R Mikado av intersects 202 Simpson Otis 207 Mosely Von V 210 Ford T Virgil 212 Campbell Isaac J contr-- 27J95XR 125 (155) Knight Ezekiel (c) 127 (153) Hill Edna M (c) 129 (151) Ransom Wm (c) Broadway intersects 542 Vacant 548 Wright James H 565 Wall Henry C 574 Heath Ella O Mrs DEL PARK--West from 1991 Log Cabin bivd, 1st n of Industrial Home rd 101 Carlisle Lewis W (o)-- 4108-J 106 Allison Don D--4152-R 1304 (384) Burns Jesse (c) Key av intersects 1708 (168) Calloway Handy (c) 1714 (1516) Brunson Wm (c) 1716 Johnson Sami (c) 1717 McBride Wm R (c) 1718 Vacant Johnson intersects 1802 Cliett Lonnie (c) 1805 Calhoun Lavonia (c) (o) DE SOTA PL--North from 1320 Vlneville av, 1st w of Holmes av 102 Anderson S Venable--1098 103 Lott Clarence L--9086 AVIS (P)--South from Mosley, 6th e of Key 112 Smith Lem (c) 114 Anderson Josephine (c) 122 Curry Cassie (c) 137 Jones Frank (c) DELAWARE AV (V)--East from 119 Cleveland av to Buckingham pi, 1st s of 900 blk Vlneville av 104 Smith Carl B--1365-W 106 Spruce Thurman P--1365-J 108 Comer Chester J--3770 110 Rainey S Clifford Jr (o)-- 104 Bradbury J Louis--4324 105 Mahone Robt C--4499-J 106 McKinney Otis L--3013-W 108 Vacant 109 Cameron Robt R 111 Roberts Calvin W (o)--435-R 112 Ware Ford Dr--2086 DAVIS AI--East from Ocmulgee to river, bet 5th and 6th 189 Crowder Jas (c) 432 Jones Sol (c) 2221-J Oak Haven av intersects 206 Newton ' John W--2650-J 208 Sammons J Ellis Rev--6105 210 Kimball Clyde W--1365-M 114 Baldwin Chas W (o)--4499-W 115 Land Wm O (o)--6283 116 Hadaway Jos L (o)--2412-R 118 Kinnett Jas T--3920-J 119 Hovey Edwin R--734 DAVIS AL (EM)--North from 275 Garden, bet Thomas & Siam 102 (274) Vacant 104 (22) Brown Rosetta (c) 106 (3) Hill Sallie (c) 108 (4) King Mamie (c) 110 (5) Morris Julia (c) DEMPSEY AV--West from intersection of College and Plant along city limit line 238 Vacant 240 Ross Jas M (c) 246 Leslie Eva (c) 247 Vacant 120 May Nathan D Jr (o)-- 2412-W 121 Atkinson Mallory C--1435-M 122 McMichael V Hugh--3138 DESSAU PL--North from 245 Hardeman av, 1st w of Middle 3 Jones Allen A 1935 Macon City Directory 537 5 Pritchard Helen Mrs (o)-- 4163 DIVISION ST LA--West from 419 Green L Wiley (c) Division, 1st s of Turpin 421 Jones David (c) 7 Barge John A--3070-J 9 DeLamar Curtis--2318-J 11 Lamb Paul R--2427-J DEWITT--South from 30 Hydro- 102 Kaigler John (c) 103 Nelson Douglas (c) 122 Sanford Ida (c) 197 Stafford Floyd (c) 221 Lundy Laura (c) 429 Thweatt Arth M (c) 435 Howard Wm (c) 441 Vacant 444 Murphy Augustus (c) 445 Jackson Willis (c) lia, 3d e of Main 104 Register Lucile Mrs 105 Jones Carl C 106 Vacant 107 Estes Trudy Mrs 109 Hammock Olin 111 Phillips Jas 114 Vacant 222 Colbert Adolph (c) 225 Rivers Lucretia (c) 244 Samuels Jos (c) 248 Hunter Annie (c) 264 Byrd Josephine (c) 268 Hunter Bertha (c) 316 McCrary Ella, (c) 448 Howard Lizzie (c) 453 Lundy John W (c) 457 Edwards Wm (c) 461 Chambliss Robt (c) 465 Banks Fannie (c) 469 Walker Mattie (c) 473 Holmes Garrett (c) (o) 475 Gordon Cash Gro DISROON AT--West from nr 163 Spring, 1st n of Walnut 217 (117) Bryant Tabernacle Bapt Ch (c) 220 (156) Johnson Nettie (c) 221 (6) Colbert Mamie (c) 223 (564) Montgomery Thos (c) 227 (561) Jackson Wm (c) 229 (112) Stevens John (c) 236 (161) Smith Wm (c) DIXIE AV (SM)--West from 2721 Houston av 103 Wilkins Joseph E 105 Thomas Ezekiel S 110 Palmer Clarence W 111 Parnell Lorena--6309-W 112 West Jas E (o)--2615-W 113 Mannheim Jos (o) 115 Shine Lillie M Mrs 116 Culpepper Wm J--1912-J 117 Knowles Mattie Mrs 125 Hysler Wm H (o) 481 Thweatt Alex M (c) 668 Tharpe Jas (c) 674 (507) Shorter Butler E (c) 868 Williams Zachariah (c) (o) DOVER (B)--South from Ayers rd to Villia av, 1st w of Grand av 100 Bales Bernard (o) 102 Grimes Morris C 304 (2) Varner Harvey V (c) 308 Corbin Reno (c) DIVISION--Continuation of 7th, 1st e of Gilmer 207 Vickers Arnetta (c) lunch rm 209 Jordan Wm (c) 210 Searcy Titus (c) 211 Adams Hosea (c) 214 Hicks Henry (c) 216 Chandler Phyllis (c) 218 Burney Mamie (c) 220 Corker Gordon (c) 135 McDonnell Wm S 150 Carmichael H Grady (o)-- 6309-M DIXIE ROW--South from nr 756 Ocmulgee, bet New & 1st 101 (76) Vacant 103 (33) Lee Cinderella (c) 105 (30) Threatt Lena (c) 107 (29) Dennis Frank (c) 109 (37) Vacant DREW'S QUARTERS -- South from Winship, 2d w of Pio Nono av 101 Jordan Steph (c) 103 Scott Grady (c) 105 Ballard Boskie (c) 107 Robinson Chas (c) 109 Robinson John L (c) 111 Blue Edw (c) 113 Shelley Danl 221 Roberts Felton 222 Powers Rosa (c) 223 Becker Annie (c) Bay Intersects 311 Vacant 315 Gordon Emanuel M (c) 316 Cowan Henrietta (c) 317 Cleveland Chas C (c) 319 Parker Ernest (c) 321 (241) Cummings Arth (c) 323 (245) Whitehead Wm (c) 323% (243) Jackson Mathew (c) 325 (233) Searcy Sol (c) DOROTHY AV (Lynmore Estates} --South from Marion av to Car- DRURY AV (I)--North from Ridge av, 1st w of Merritt av man pi (at 3 mi line) 1 Clark J Holmes (o)--1558-R 104 Dinkins Henry E (o) 216 Freeny Henry W 221 Hayes Sami L 225 Loden Carl L 3 Tabor Hugh L--1558-W 4 Lee Arth H--4252-R 6 Deadwyler Ida A Mrs (o)-- 1558-M 14 Corley Thos A--252-R DOUGLAS (SM)--East from Broadway, 1st s of Ell 121 Stanley Hayes (c) 200 Atkins Eliz (c) nurse 18 Hollingsworth C Jefferson 5555 22 Davis Jas W--4373-J 26 ^Brown Wright--2059 326 (140) Goolsby Mattie (c) 327 (235) McNeal Nina (c) 329 (237 Brown Henry (c) 400 (212) Williams Julia (c) ) 402 (244) Cooper Geo (c) ) 404 New Bethel Bapt Ch (c) Elm intersects 608 Jackson Benj J (c) 609 Vacant 614 Macon Cooperage Co--358 615 Collins Richd (c) 619 Ponder Oliver (c) 621 Ashley John (c) 623 Walker Clem (c) 627 Kent Sami (c) 628 Goolsby John L (c) 633 Green Florine (c) 635 Lewis Wm (c) Edgewood Intersects Standard Tool & Handle Co plant 750 T & T Packing Co meats-- 1875 770 Texas Co The plant--200 790 Moyar Lbr Co--1840 Atlantic Ref Co plant Buckeye Cotton Oil Co--6168 DOUGLAS AV (V)--West from 129 Grant av. 1st n of 4th 103 McGaugh West (c) 107 Fish Spencer (c) 115 Williams Albert S (c) Ward intersects 117 Stewart Richd C (c) barber Lincoln av intersects 202 Gooche Roxie (c) 203 Ross Chas H (c) (o)--4603 204 Benn Chas M (c) 206 Jenkins John (c) 208 Lavender Ernest (c) 259 Vacant Forest av intersects 306 Tanner Frank (.c) 308 Clyde Jas (c) 321 Thomas Julian (c) 339 Vacant Ruby intersects 342 Brookins Helen (c) 343 Jackson Andrew (c) 351 Vacant Penn av intersects 405 Stephens Arth (c) 411 Smith Thos (C) DUFFEY'S AL--Southwest from 852 Elm to Edgewood av 2 (3553) Jones Anderson (c) 3 (3566) Hart Rich (c) 5 (567) Moore Jesse (c) 6 (157) Wright Ruth (c) 7 (3564) Childs Sallie (c) 9 (3559) Daniels Mary (c) DUNCAN AV--South from C of Ga Ry to 400 Montpeier av, 1st w of Carling av 102 Stewart Henry S 104 Hutto Thad H 108 Foster R Clyde 110 Vacant 112 Phillips J Robt 114 Newberry John Dannenherg av intersects 201 Moore Wm H Ward Wm E 202 Carpenter Arth B 203 Vacant 206 Dupree Jas T 210 Addams Pearl Mrs 217 Mason Cliff 538 Baldwin's and Telegraph's 219 Vacant 221 Morgan Grover C 224 Fowler Chas J 226 Batson Walter G 230 Vacant 233 Gregory Jas T 240 Gregory T Felton 243 Huhn Sadie M Mrs (o)-- 695-J Lawton av Intersects 301 Pilcher Frances Mrs gro-- 2364-W 302 Dixon Tobias A (o)--2364-J 307 Pilcher Mary F Mrs (o) 310 Feagin Lillie Mrs (o)-- 2364-R 311 Fielding S Blake--5152-J 312 Fetner Leo A (oj--3214-W 315 Sires Melvin J (o)--1978-W 319 Watson Annie L Mrs (o)-- 5748-W 325 Ballard John W Utev--620-J 340 Callianos Peter A--5565-J 342 Goins Robt W Braddy Clifton T Napie*r a*v *begins Coleman av intersects 401 Thames Walter F contr-- 613 Vacant 615 Abel Lucy (o)--263-J 618 Powell Fred C (o) 620 Long Row W 621 Flynn Ida B Mrs 622 Bell Reason H--3854-J 623 Millirons Wm T 624 Johnson Robt H--3359-M DUNLAP (EM)--South from 1100 Main at limits 440 Sharp Albert (c) 450 Pitts John (c) DUNLAP AL--West from 619 Spring to Orange 226 Jackson Minnie (c) 227 Jackson Martha (c) 325 Evans Chas (c) 562 Lamar Annie (c) 653 Lewis Henry (c) 675 Dennard Henry (c) 678 Dix Jack (c) DURE (U)--North from Dempsey av, 1st w of Pio Nono av 101 Phinazee Henry (c) 102 Bivins Thos (c) 302 Cash Geo W (c) (o) Harris Greely (c) 303 Wright Walter (c) (o) 304 New Zion Baptist Ch (c) 307 (207) Samuel Sara (c) 308 Mack Tommie (c) 309 Mack Essie M (c) 311 Adams Hugh (c) 318 McCluster Shot (c) 324 Colbert Essie (c) Broadway intersects 417 Tbdd James L 419 Harris Janie L Mrs 421 Stripling Randolph B 440 Dunn Jesse W--2714-R 448 Simpson John L--863 452 Turner Eug 453 Ryles Chas B 454 Smith Oscar B 456 Britt Lonnie T (o) 457 Moore Singleton 458 Groce Spartan T (o)--4792-R 500 Munn David M (o)--5323-R 506 Spikes Wm I (o)--6035-M, 509 Rhodes Johnson J (o)--3572 520 Beall Rosa D Mrs (o)--3519-J 525 Sutton Sidney W 526 Brown Julia K Mrs (o) 553 Watson Clinton D 556 Winders J Fredk 6029 403 Bryan Carl A 405 Freeman Ida O Mrs--3212-W 407 Wilson Carl T Hart Ella Mrs (o)--3764-R 409 Middlebrooks Wm H (o)-- 945-J 411 Ruff D Preston (o)--4934 413 Blair Dorothy Mrs--2110-W 414 Holland Bessie Mrs--523-J 418 Hartley Forrest A 419 Radney Wiley R 420 Parrish G Henry--513 421 Gladin Ivy D--2110-R 422 Wilder John H--4018-W 429 Helmly Bea R 429 Gregory Glenn--4018-R 435 Stanford Aug L--4764-M 438 White Jas B 439 Andrews Sallie Mrs 440 Wright T Gordon (o)-- 945-W 442 Alexander C Lee--3486-J 445 Foster Emmett L--3486-W 451 Tarver Augustus A--302-J 456 Paul Tims B--3764-J 457 Royal Beth L Mrs--4433-W 460 Copeland Alpr F--3212-J 465 Kent Ida B Mrs (o)--3764-W 466 Arnold C Monroe--3486-R 467 Duckworth Jesse M--4433-J 468 Wiggins Wm M (o)--3432 469 Donnan Homer E (o)--2619 473 Asbell Jas B (o)--6442-R 475 Cox Jas M (o)--4433-M 477 Holloway Mary T (o) Montpelier av Intersects 501 Hersey Warren C 502 Anderson John H (o)--2426-J 503 Andrews Elmer R 504 Branan Alvah L--263-R 505 Bragg J Robt (o>--3359-W 507 Lester Rufus E 592 Howard N Ralph (o)--1378 594 Dudley Lenora Mrs (o)-- 3848-R 602 Rodgers Geo T (o)--3359-R 610 Rackley Benton T--263-XM 611 Bargeron Jos G--3848-M 305 Byas Eug (c) 307 (220) Perkins Lee (c) 311 Harden Margt (c) 315 Harden Geo (c) 317 Thomas Bosie (c) 319 Head Wm (c) 321 Harden Henry (c) DUVAL (EM)--Sooth from 152 Broad, 1st e of Wilson 214 Thomas Lucius (c) 215 Benford Geo W (c) (o)-- 5319-W 217 Henry Mamie (c) (o) 218 Thompson Anna (c) 220 (122) Burns Raymond (c) ECHO PL--See Dover (B) EDGEWOOD AV--West from s end Division to Linden av, 1st s of Elm 105 Bryant James (c) 109 Palmer John (c) 110 Smith Will (c) 111 Branham Columbus (c) 112 Harden Gilbert (c) 113 Smith John (c) 119 Butler Marie (c) 120 Cobb Chas W gro 121 Sutton Richd (c) 122 Sealey Mattie (c) 123 Thomas Pearl (c) 124 Williams Sami (c) 125 Vacant 126 Williams Clem (c) Hammond intersects 201 Trawick Claude Coal Co Inc --59 210 Gulf Refining Co--5076 230 Butts Nathan (c) 232 Collins Annie (c) 234 Allen Evie (c) 236 Bell Leonard (c) 237 Tolliver Chas (c) soft drinks Elbert intersects * 5th intersects 301 Jordan Thos (c) restr 557 Gray Wm H 558 Watson Wm D 559 Hawkins Lucius R gro 560 Simmons Addis F--5244XR 2d intersects 667 Beck Alf F 671 Stripling John D 673 Boutwell J Julian 675 Buckner W Freeland 677 Bailey Sami E--6432 1st intersects 722 Jordan Robt (c) 724 Chester Idus (c) 730 Miles Jerome (c) 731 Dyer Alex (c) 738 Vacant 740 Vacant 741 Smith Carrie (c) 742 Greeley Alex (c) 748 Myers Mollie (c) 750 White Kath (c) 751 Varnedore Perry (c) 752 Andrews Timothy (c) 753 Shurney Nina (c) 754 Vacant 755 Wilson Wm (c) 756 Preston Fred (c) 757 Waller Reuben (c) 767 Taylor A J (c) 771 Lightfoot David (c) 773 Williams Thos L (c) 775 Tukes Geo (c) 776 Wimberly Dublin (C) 780 Vacant 802 Gunnels Louis W gro--1407 804 Brown Chas (c) 805 Johnson Willie (c) 806 Potter Chas (c) 807 Prater Myrtle (c) 808 Vacant 809 McCloud Blanche (c) 810 Johnson Minnie (e) 812 Hall Clifford (c) 814 Vinson Lewis (c)--5851-J 815 Tucker Wm (c) 816 Vacant 818 Vacant 820 Lockett Thos (c) 822 Thurman Wm (c) 1935 Macon City Directory 39 824 Barnes Laura (c) 826 Vacant 828 Green Job (c) 830 Brantley Emory L (c) 853 Duncan Bessie (c) 855 Jackson Claudia (c) 857 Brown Wm (c) 859 Hart Geo (c) 861 Pennyman Anna (c) 865 Franklin James (c) 867 Thornton Allen (c) Jackson intersects 901 Cook Henry (c) 905 Hughes Moses (c) Campbell av intersects 909 Mitchell Wm (c) 913 Jones John H (c) Calhoun intersects 917 Rembert Wm (c) 919 Green Dave (c)--3499-J Tindale av intersects 1011 O'Neal John (c) 1015 Harvey Webster (c) 1017 Johnson Benj (c) 1019 Bass Minnie (c) 1021 Johnson Fate (c) 1023 Bennett Louise (e) 1025 Jackson Mary (c) Alabam* a intersects Ross Intersects 1154 Pitts Bettie A (c) 1155 Cook John (c) 1156 Meadows John C gro--9569 1158 Watkins Mattie 1162 Sturkie Annie B Mrs (o)-- 5365-W College dr Intersects 1202 Vacant 1204 Woodall Gadson H 1240 Davis Wm H--5290-J Etheride Lewis C College Dr intersects 1335 Kirkland Lucy Mrs 1337 Kemper Mauds G Mrs 1343 (1311) Wood Maggie Mrs1835 R 1343 (r) Hilley Dean A 1345 Vacant 1351 Cockrell Ellen Mrs 1353 Ragsdale Bartow D--1553 1354 Anthony Robt E--1298-J 1355 Brown Wm O--1835-W 1356 Vacant Adams ends 1406 Sutton Benj F (o)--1787-M 1408 Richardson Courtney Mrs (o) 1409 Scott R Benj 1411 Apartments 1 Hudson Chas F 2 Jackson Joshua R 3 Hambrick Ludie Mrs 4 Spinks Lonnie R--1835-J Street continued 1412 Kennedy Adele Mrs 1413 Yates Robt L 1414 Folk Wm E (c)--1787-R 1415 Moore Goldie M Mrs (o)-- 1298-M EDISON (EM)--North from Oc- muigee river, 2d e of Main 345 Gordon Vinie (c) 356 Searcy S Jackson (c) 358 Vacant 360 Bass Marcus (c) 361 Welch Dave (c) 363 Vacant Elliott intersects 407 (127) Pless John (c) 409 Vacant 411 (309) Flanders Ethel M (c) 417 St James Baptist Ch (c) 418 (118) Spikes Ernest (c) 424 (124) Walton Benj (c) 426 (126) Johnson Minnie (c) 469 McClain Fate (c) (o) Flanders int*ersects Middle intersects 500 Bonner Ida (c) 501 Thomas Jas W (c) 502 Sexton Boston (c) 503 Vacant 504 Forrest Florence (c) (o) 505 Holt Chas (c) 507 Cummings Dorsey (c) 509 Vacant 511 Jackson Geo W (c) (o) Martha intersects 606 (206) Blount Geo (c) 611 (211) Wimberly Chas (c) 612 (212) Gillard Clifford (c) 613 (207) Blount Geo Jr (c) 615 (214) Lovett Clarence (c) EDNA PL--South from Log Cabin blvd, 1st s of Thomas (L C Hts) 101 Hardeman Geo W--3054-M 103 Carr John L--5509-M 105 Bollinger John W 117 Shipman Oliver S 121 Poole Harold B--1292-J 123 Davis Walter G 126 Turner Allison F 129 Pettey S Augustus (o)-- 3560-J 133 Laney Chas H (o) 136 Spiller Jas A (o) 196 Kent Eric A (o) 197 Tanner Ira T--4292-R 1st intersects 203 Donnan Abner B--3054-R Robertson Margt Mrs nurse 215 Teasley Oscar A--3560-W 226 Johnson R Clyde 239 Turner Thos E 244 Hawkins Robt D 251 Tyson Wm E 350 Hall E Clyde (o) 355 Stillwell F Earl (o) 355 (r) Jordan Chas (c) EDWARDS (O--South from 160 Mosley, 1st e of Birch 156 Williams Benj (c) 158 Anderson Jas (c) 160 Walker Robt (c) ELBERT--South from Hammond, 1st e of Broadway 161 Jackson Fannie (c) 163 (231) Johnson Mattie (c) 163 (231) (r) Washington Emma (c) 165 (237) Sims Carrie (c) 301 Smith Mary L (o) 303 Boone Buster (c) 305 Bryant Isaiah H (c) 307 Comer Johon (c) 309 Williams Sara (c) 333 Lawton Wm (c) 335 Russell Mattie (c) 337 Perkins Wm (c) 339) Wilcox Arth (c) ' Ash inte1rsescts 1 11 540 423 Sanford Emma (c) 431 Robinson Tommie (c) 435 Balkcom Bosie (c) 441 Harris Wm (c) Elm in*ters*ects C of Ga* R*y C* rosses Edgewood av intersects 501 (502) Morris Jos (c) 503 (504) Page Tressie (c) 505 (506) Heard Wm (c) 507 (508) Prather Bonnie (c) 509 (510) Davis Wm (c) 511 (512) Jones Annie P (c) Watervllle rd begins * * Church intersects 601 (1270) McGee Kath (c) 603 (1280) Fountain Geo o(c) 605 (1281) Small Mabel (c) 607 (683) ifriver Chas . (c) 609 (685) Collier! Robot (c) 701 Williams Willis (c) restr 703 (702) Williams Willis (c) 705 (706) Taylor Ollie L (c) 707 (713) Cobb Buford (c) 708 (705) Blackshear Edw (c) 709 (708) Nelson Danl (c) 710 Hill Arth (c) 712 Anderson Eug (c) 713 (711) Cleveland Thos (c) 715 (703) Anderson Joshua (c) 717 (704) Ballard Jones (c) 719 (709) Moore Robt (c) Steel intersects 800 Edwards James E gr 803 Threatt John (c) 805 Dillard Willie M (c) 807 Mitchell Susie (c) 809 Sappington Edw (c) 811 Nelson Carlton (o) 812 Young Carrie (c) 813 Harris Walter (c) 815 Duncan Wm (c) 817 Brown Lillie (c) 818 Deas J C (c) 820 Mathis Claude (c) 822 Howell Hezekiah (c) 824 Hutchins James (c) Stratton intersects 902 Washington Kate (c) 903 (303) Love Edw (c) 904 Williams Chas (c) 905 Reese Fannie (c) 907 (937) Mims Chas (c) 909 Epps Glenn A gro--9690 909 (r) Hartis Sami B 910 Waters Harrison 932 Howard Martha (c) 934 Smith Benj (c) 936 Walker John (c) 938 Grant Arth 942 (940) Duff Cash Gro Dover A Bailey Reid intersects 1011 Calhoun Ellen (c) 1012 Brown Thos (c) 1013 Britton Enoch (c) 1014 Easley Harry (c) Elbert la intersects 1015 Price Hattie (c) 1017 Davis Sylvia (c) 1019 Gordon Louise (c) Henry i*ntersects De Borde intersects 1106 Wood Henry (c) Baldwin's and Telegraph's 1108 Dean Lee (c) 117 Johnson J Eug 128 Anderson Frank (c) Stuckey Homer W 129 Lockett Edgar (c) ELBERT LA--East from 1014 El- 119 Souther Jos J--4383-M 130 Griffen David (c) bert to Hall 10 James Walter (c) 121 Bateman Codono V Mrs (o) 131 Vacant 128 Handley Geo D 132 Mills Riley (c) 17 Vacant 18 (431) Thomas Bertha (c) 19 Vacant 21 Vacant Ellis Horace M 130 Euthon Ruby E Mrs 132 Brown, Bernard H 135 Kitchens Lee D 133 Jones T J (c) 134 McCoy Frank (c) 135 Harris Willie (c) 136 Franklin Easter (c) ELIZABETH (SM) -- Southeast from 439 Alabama 100 (144) McCormick Sami (c) 101 (22) Woods Riley (c) (o) 102 (146) Vacant 104 (148) Lamar Clara (c) 106 Burden Maggie (c) 107 (155) Brown Cajor (c) 108 Sanders Eug (c) 111 (157) Smith Sarah (c) 113 (159) Rumph Edw (c) 202 (310) Jones Wm (c) restr 204 (167) Jackson Edw (c) 206 Vacant 208 (306) Hampton Eug (c) 210 (307) Atlantic Ice & Coal Co (br) 212 (307) Henderson Louise (c) restr Mitchell Melvin (c) phys 216 (353) Lucas Chas (c) gro-- 3235-J Campbell intersects 301 (421) Johnson Albert (c) 303 (417) Webb Wilson (c) 304 (450) Bowden Elbert (c) 305 (418) Withers Grant (c) 307 (419) Smith Bessie (c) 309 (422) Irvin Susie (c) Nussbaum intersects 401 (300) Battle Virlene (c) 402 (565) Jones James (c) 403 (304) Dean Rebecca (c) 404 (543) Hill Jerry (c) 405 (332) Willis Emma (c) 407 (330) Collins Floyd (c) 408 (541) Larry Carrie (c) 409 (328) Evans Alien (c) 410 (213) Turner Rebecca (c) 136 Lavender Wm H (o)--4383-R 138 Yarbrough Jeanette Mrs (o) 140 Snow Jas H 142 Nelms Claude L 144 Wheeler Alice Mrs 146 Waldron Millard F (o) 147 McPherson Eug 151 Schrimshire Hubert E 165 Gholson Richd L (o)--5964 167 Hooker Ernest O (o) 172 Shy Robt I 2n intersects 137 Chamblee Ula (c) 138 Joseph Vester (c) 139 Outlay Willie M (c) 140 (123) Bennett Danl (c) 141 McGhee Hattie (c) 142 Hill Henrietta (c) 144 (136) James Rome (c) 146 (206) Harrell Jas (c) 148 Griffin Wm (c) 150 Rogers Alice (c) Chappell Intersects 204 Hagans Kate (c) 219 McKinney Jos A 208 Outler Chuck (c) 221 Banks Arth A 210 Vacant 229 Stone B Ramon--3586-J 231 Bean Edw C--4135-M ELLA (SM) -- East from 3024 237 Mitchell Henry R-A135-W Houston av, 1st n of Franklin 239 Mitchell Forney D (o)--- 100 Stewart Leo H--466 4135-J 102 Brown A Sidney (o) 240 Jones David J (o) --2274-J 104 Rankin Robt L--2244-R . 246 Jenkins Wm J (o)--6237 250 Gilleland Addie (o) ELLIOTT (EM)--North from 248 253 Holloway Chas R (o)--324 Main 260 Kelly Clifton D 262 Selman Lucius D 269 Irby Frank E (o)--2587-J 273 Jenkins Pink L (o)--2587-M 274 DuPree Jesse F 275 Powell Lanty j (o)--2079-J 276 Thomas Frank 277 Tamplin Maggie Mrs (o)-- 2915-J 278 Raines Lillie W Mrs (o) 279 Odom Clifford L (o) White intersects 301 Hagan Henry M 302 Watts Nannie Mrs (o) 304 Middlebrooks Mary Mrs 308 Wagner Oscar B 102 (202) Smith John (c) 103 (203) Hooks Isadore (c) 103% Culp Jos (c) (o) 104 (235) Carswell Sallie (c) 106 (211) Solomon Levi (c) 109 (205) Epps Mary (c) 110 (201) Houser Nathan (c) 115 (227) Humphries Sami T (c) 117 (227) Cornelius Tullie (c) 119 (225) Rogers Art (c) 121 (212) Morris Benj (c) * 123 (207) Weaver Philip (c) 127 (221) Troutman John (c) 130 (208) Rogers Roosevelt (c) 131 (209) Weicher Thos (c) 196 Lester Estella (c) 411 (326) Hill Wm (c) 412 (331) Cook A Chas (c) ELL--East from 2402 Broadway 197 Grier Clarence (c) 199 Rouse Della (c) 413 (324) Hunter Wm (c) 100 McGee Geo (c) Pear intersects 414 (222) Tharpe Sampson (c) 101 Bryant Geo (c) 204 Bristol Lindsay (c) 415 (330) Vacant 102 Thomas Rockey M (c) 206 Harris Bertha (c) 416 (220) Wright Stella (c) 103 Wilson Mamie (c) 213 Burrs Wm (c) 417 (328) Calhoun Chas (c) 104 Jones Elijah (c) 213% Foler Nancy (c) 418 (218) Washington John D (c) 105 Bowen Lillie (c) 214 Nash Wm M (c) (o) 421 (520) Pierce Essie (c) 106 Brice Crawford (cj 215 Jones Vina (c) 423 (518) Little Hattie (c) (o) 107 Reed Lucy (c) 216 Toomer Stonewall (c) 108 Collins Eva M (c) 217 Vacant ELIZABETH PL (V)-East from Pierce, 1st n of Vineville av 109 Davis Beatrice (c) 110 Law Wm (c) 218 Smith Geo (c) 220 Barnes Albert (c) 105 (202) Toole Chas L (o)-- 6157-W 107 McFerrin Jas M (o)--5455 108 Vacant 109 Crowley Thos J (o)--5469 110 Newsome Clifford C--5452-J 111 (193) McMillan John M 6380 113 (195) Smith Morris O (o) 115 (197) Bernd Lawrence J (o) --1110 111 Vinson Lillie B (c) 112 Wilson Chester' (c) 113 Smith Maude (c) 114 Anderson Henry (o) 115 Cornelius Sandy (c) 116 Thomas Geo (c) 117 Goodrum Jesse (c) 118 White Jackson (c) 119 White Arth (c) 120 Parker Wm (c) 121 Rumph Andrew (c) 122 Jackson Ardelia (c) 219 Turner J H N (c) (o) 221 Purnell Homer (c) 222 Thomas Paul (c) .223 Jones Robt (c) 226 Hall Marie (c) 227 (217) Finney Lucy (c) 233 (124) Kinslow Georgia (c) (o) 255 Walker Douglas (c) 256 Jones Florence (c) (o) 258 (632) Turner Mary (c) 418 Phelps Lee O (c) 420 Butts Columbus (c) ELL (SM)--West from Broadway, 1st s of School 1st s of School 114 Hubbard Emma Mrs 1935 Macon City Directory 2321 123 Collins Chas (c) 124 Sales Will (c) 125 Starks Bennie (c) 126 Burns J D (c) 1 127 Grier Celia ii... (c) 541 1111 * 422 Wilson Cornelius ,(c) 423 Barnes Mary (c) 424 (451) Balkcom Charlotte (c) 425 Wynn Jas (c) 426 (236) Canady Hamp (c) 427 Roberts Mattie (c) (o) 500 (115) Easley Effie (c) 506 (119) Dunn Emma (c) 510 (110) Bell Floyd (c) 511 Myrick Henry (c) 512 (112) Merriweather Millie (c) 513 Wilson Matthew (c) 514 McBride Archie (c) 517 (117) Vacant 518 (105) Thornton Wm (c) 521 (122) Appling Irving (c) gro 601 (122) Searcy Wm (c) 603 (120) Patterson Wm (c) 605 (108) Powell Ola M (c) 607 (100) Walker Luther (c) 609 (100) Watkins John (c) 610 (105) Jones Hannah (c) ELM--Northwest from end of Division, 1st e of Edgewood Standard Tool & Handle Co 1340 6 Spencer Clifford (c) 10 Ward N Ardell gro 14 Tyler Wm (c) 16 (100) Maddox Eva (c) 18 (104) Tarver Wm (c) Gilmer intersects 102 Smith Harvey M gro--9207 105 Isabel James (c) 106 Rice Thos (c) 107 Bonner Geo (c) 108 McKay Sami (c) 109 Bryant Mann (c) 111 Bailey Arcelius (c) 112 Watkins Jas (c) 115 Robinson Edw (c) 119 Ford Alice (c)' 120 Vacant 124 Holt Jerry (c) 152 Stephens Wm (c) 153 Pardue Winnie (c) 157 Phelps Jos (c) 160 Marshall Ira (c) 162 Mitchell Robt (c) Hammond intersects 205 Stowe Herbert (c) 207 Rawlins Frank (c) 209 Ross Frank (c) 211 Horn Luther 215 Lowe Etta (c) Elbert intersects * C of Ga Ry crosses 314 Williams Jos (c) 320 Blackshear Thos 355 Jolly John H (c) 357 Williams Dollie (c) 359 Williams Elijah (c) 360 Hill Maude (c) 361 Fair Geo (c) 364 Johnson Hannah (c) Broadway intersects 409 Hanson Robt 411 Vacant 415 Morgan Henry G 416 Bassett Geo 419 Bostwick Marion 420 Vacant 452 Lowe John ` 454 Vacant 457 Akers Harvey 459 Theus Marvin 467 Raleigh Leola 469 Flynt Jas F--2462-R 3d intersects 516 Brady Tilton M 520 Bolton Geo S (o)--3536-W 521 Vacant 523 Balkcom Ralph E 553 Thomaston John B 554 Dodd Claudia Mrs 555 Cooper Thurston W 558 Pentecost Chas 560 Word Evan F 2d intersects 610 Thompson Geo 612 Holloway Birl H 615 Beasley Julian Beasley Wm C 618 Dixon Victoria Mrs 619 O'Connor Dollie Mrs 621 Farley John ,M 651-53 Purser Robt S gro--3866 654 Crump Chas 655 Tucker Felder E 657 Vacant 659 Rodgers Minnie Mrs 660 Simmons Thos S bldg contr- 2920-J 661 Josey Clifford M 664 Arnold Arth 665 Crawford John T 667 Vacant 1st intersects 702 Reddick Maria (c) 706 Walden Eug (c) 708 McGee Mozelle (c) 710 Stokes John H (c)--5389-J 712 Phillips Eug G (c) (o)-- 5189-J 718 Edwards Mary (c) 752-54 Sharp Chas (c) barber . clo clnr 753 Chambliss John (c) 755 Lang Sami (c) 757 Ebenezer Bapt Ch (c) Telfair intersects 802 Hudson Danl E gro--9468 804 McCrary Eliz Mrs 807 White Jas (c) 809 Rumph Robt L (c) 810 Barrom Edw (c) 811 Baker Wright (o) 814 Bouyer Clifford (c) 816 Carswell West (c) 818 Walden West (c) Duffey's la Intersects 852 Hand Jefferson 854 Simpson Jas W 858 Akeridge Alice Mrs 859 Harris Benj 863 Bass M W 864 Clark Merle J 865 Lee Robt E 866 Carroll Benj 868 Thompson Robt F 869 Kolodner Morris Morris Gro Store--3785 Jackson intersects 908 Stallings Henry P--3319-R 911 Strong Wm F 914 Bost Fannie Mrs (o) 915 Lewis John E 917 Vacant 920 Schermerhorn Mary (o) 949 Bartlett Walter E (o) Coles ai intersects 952 Herin Walter S (o)--3238 953 Ramey Reese L (o)--2989-J 955 Brantley Sylvia Mrs 956 Edwards Lewis C 957 Walls Leatha 964 Thorpe Wm (c) 966 Bell Maggie (c) 968 Flanders Sami (c) 542 Calhoun intersects 1617 McGill Wm C 1018 Jones Sula V Mrs (o) 1020 Behr Eliz Mrs (o) 1021 Vacant 1057 Wilson Geo 1059 Hunt Earl 1063 Stewart Ibbie Mrs 1064 Ashkenzie Heime 1066 Wallace Karl gro--9133 Ross intersects 1103 Bailey Chas E (o)--2154-J 1112 Gossett Albert G 1116 Demouy Tarleton L 1120 Chancellor Jewett A 1157 Hudson Nicholas C 1158 Cobb Chas W 1159 Godfrey Henrietta V Mrs-- 2922-J 1160 Paul R Carl--2922-W 1161 Grace Jesse 1164 Nabor C Arth--5510-W 1178 Vacant College *dr* in*tersects College intersects ELM AL--South from Elm St la to Elm, bet 1st and 2d 752 Wright Mattie (c) 756 Johnson Lucille (c) 760 Walker Rosa (c) ELM ST LA--East from Eim along C of Ga Ry, s of 1st 635 Walker Chas 635 Henderson Claybon 639 Walker Cleveland 645 Houser Lonnie (c) 649 Simmons Mamie (c) 651 Williams Amos (c) 653 Johnson Alice (c) 655 Simmons John (c) EMERALD (EM) -- North from Flanders, 1st w of Main 104 Johns Bartow 106 Maxwell Chas 108 Peacock Benj W 110 Gilder Jordan T EMILY PL--North from 209 Ingleside av to Vista cir 143 Buck Selby H--3693-J 150 McKay John J Jr (o)--1920-W 155 Anderson Robt L (o)--3534 EMORY AV--West from 228 Jeff Davis to 6th av, 1st a of Plant 101 Pope Bruce G (o) 103 Price Mamie Mrs 104 Meaders Jas W (o) Batchelor Artis R 105 Clements Ollie L 106 Meaders Gro Co 108 Meaders Jas O 109 Cadle Geo 110 McCrimmon Lester M 112 Vacant 118 Rutherford Lena M Mrs 119 Ash Lewis M 121 Churchwell W Henry (o) 122 Roberts H Arth 125 Reed Thos O 160 Vacant 162 Skipper Benj F (o) EMPIRE AV (V)--South from 223 3d av Baldwin's and Telegraph's 100 Alexander Carolyn (c) (o) -- 343 Willias Thos (c) 222 Griffin Walton (c) 445-W 224 (219) Gonder Robt (c) 101 Webb Herman (c) ERNEST LA--East from 20 Er- 225 (190) Simmons Jas (c) 102 McLean Eliz (c) nest, 1st n of Gordon 226 (232) Vaughn Robt (c) 103 Harrison Addie (c) (o) 154 Howard Dollie (c) 227 (334) Harris Fannie (c) 104 Allen Jas (c) (o)--5408-W 156 Vacant 229 (235) Abram Sami (c) 105 Thompson Carrie (c) 158 Vacant Lamar intersects 106 Tasker Lena (c) 230 (234) Lundy Miles L (c) (o) 107 Cross Rosa (c) 108 Smith Ada (c) (o) EUCLID AV --West from 207 108 Evans Rufus R (o)--1917-J Oak Haven av to Pio Nino 110 McMillan Walter C (o)-- 102 Ward Wm 6165-M 104 Vickers A James 106 Hilsman Myrick--1630-W EVERGREEN LA--West from 235 (237) Pennington Willis (c) (o) 236 (244) Vacant 237 (243) Jackson Maggie (c) (0) 238 (240) Govner Adam (c) 239 (241) Avant Thos (c) 108 Barker G M--5512-J 155 Fetner B Lee (o)--5099-R 160 Clark Eug O--1483-R 165 Burgess John--343 175 Taylor Hugh N (o)--6310 180 Hargrove Wm M--1630-R 182 Sanders Albert L--5099-J 184 Hardin Ernest H--1483-W 185 Dunwody Howard R--189-M 186 Smith Emma Mrs (o)--2374-J 188 Smith Maude W--313-W 190 McDonald, Donald 192 Moore Lloyd D (o)980 194 Williams Gay E (o)--2873-R Cleveland intersects 195 Midyett Jas C--189-J 196 Volk Theo J (o)--2374-W 199 Torch Aaron (o)--5099-M ENTERPRISE (SM>--East from 2556 Broadway, 2d n of Charles 100 Helton Wm L 104 Ezell Geo E 105 Clark Arth S 106 Woodson L Leon (o)--2859-W 106 (2) Cofer Chas T 107 Ellis Ivy E 108 Vacant 109 Vacant 110 Brown Ernest W 111 Myers Elton H 112 Sumlin Geo 113 Vacant 115 Coulter Rosa L Mrs 116 Sumlin Warren J 120 Mack's Place gro--3223-J 2921 Houston av 143 Frazier Joshua W (c) 145 Mack Geo (c) EVERYBODY'S CROSSING -- East from 164 Bartlett, 1st n of Napier av 584 Battle Henry (c) 586 Lightfoot Jas (c) 590 Steven Geo (c) 592 Collier Lawrence (c) EXPRESS--West from 5th to Broadway, bet Poplar & Plum 7 Adams Mfg Co clothing mfrs --393 FAIRMONT AV --North from 315 Vineville av, 1st w of Ward 50 Ballard Normal Sch (c) 52 Von Tobel Raymond G-- 4452-J 61 (66) Mounts Lewis H 63 (102) Campbell Edw (c) (o) 315 McBride Howard G (c)3256-R 347 (443) Byrd Amos (c) 348 (445) Spears Indiana (c) 396 Vacant 398 Hobbs Thos J (o) 400 Bronson Horace W--3673-R 402 Rainey Enoch J--814-W 1823-J 1485 402% Carson Carvel H--9062 64 (133) Hughes Lovie (c) (o) 403 (441) Butts Lonnie (c) FLETCHER (EM)--West from 450 Dunlap, 4th s of Main 65 (305) Harrell Henry (c) 66 (135) Williams Nettie M (c) 404 Gibson Hattie W Mrs--943-J 406 (408) Ponder Allen T--5271-W 704 Savage John T (c) Oscar (o)-- Monroe Intersects 653 Thomson Vernon L 2672 500 Texas Co The serv sta--9162 Holleman Cornelius B (o)-- 503 Savage Edw W (c) (o)-- --3837-W iFOREST HILL AV--North from 1814-M 654 Elfe Matilda L Mrs (o)-- 3012 Forsyth rd 505 Thomas Jas E (c) (o)--4488-J 3837-J 120 Johnson Frank H--2072 507 Andrews Mary (c) 655 Lumpkin Geo B--3510-J Ridge av intersects 509 Vacant 658 Riley Jas T (o)--4985 200 Wadley Richd B (o)--2358-M 510 Sunshine Creamery--1181 660 James Benj W--3510-W 202 Nisbet McDougald--5320-J Kahns al Intersects Cates John G The Prado intersects 511 Ned Deal Gro Virgin la intersects 211 Jones Stanley A (o)--1406 Lavender Beulah Mrs 701 Banks Mattie L nurse Overlook av intersects 513 Jones Eva (c) Banks Lula A Mrs (o)-- 311 Davidson Wm E (o) 515 Sanders Annie L (c) 2884-W 319 Yates J Emory (o)---3314-W 521 Moore Isaac (c) 702 Ferrill Margt S Mrs (o)-- 321-31 Appleton Church Home-- 523 Dennard Nicie (c) 2157-J 1864 525 Hawkins Emma (c) 709 Orr Oliver (o) lawyer--6107 330 Miffin Henry (c) 527 Higgins Norris (c) 710 Timberlake Joel H (o)--5054 400 Campbell Albert V (o)-- 528 Harper Abr (c) 711 Vacant 3719-W 529 Sherman Marie (c) 712 Kassner Irving E (o)-- 407 Chandler Alva R (o)--1185 531 Vacant 3415-W 411 Grovenstein Bertha A Mrs 432 Rushing Roxie (c) 714 Rolston Clifford J Mrs (o)-- (o)--3804-W 533 Roberson Louis B gro 4875-J 533% Lundy John W (c) phys 715 Davis J LaFayette Jr-- FORSYTH--Continuation of Cot- 540 Vacant 4875-W ton av w of intersection of Pine 544 Laing Fredk C--2143-R 716 Chappell Clarence J (o)-- and Spring Frank's al intersects 1454 102 Gresham School * 720 Lott Gus 0--3420 114 Woodruff Louise Mrs--109-M West Boundary intersects 722 Redding Wm C (o)--2157-W 126 Lanier High Sch for Girls 603 Adams Chas L--4294-"R 726 Clisby Jos W (o)--3200 Orange intersects 604 Murphy Wm F--2143-W 200 Willingham Gro Co--206 604% Sherling Randolph R FORSYTH LANE--North from 202 Powell E Eug meats--647 605 Avent W Lloyd 411 Forsyth % I" 204 Atkins Andrew H baker 206 Norton Wm A--5742-W 606 Pace Wm N 606% Johnston Jos T--2784-J 140 (264) Flewellen Louis (c) 141 Gibson Fannie (c) 2071 Smith Wm G 607 Sherrill E Gordon (o)--3782 142 (262) Hill Ida M (c) 210 Smith Northrup (o)--633-W 608 Paullin MargtS Mrs (o)-- 218 Solomon Lillie Mrs (o)--2971 6270-W 143 Turk Maria (c) 144 (246) Lester Jennie E (c) Solomon Linton M--3800 221 Raley Romas H--6298-J 610 Spruce R Danl--5144-M 611 Latham Robt S--1742 223 Power Oil Co serv sta--2216 Virgin intersects 145 Mitchell John T (c) 147 Atkins Sami T (c) 149 (153) Jackson Richd (c) College Intersects 305 Weisiger Wm P 307 Thompson Wilbur L (o) 612 Newsom Bradford (o)-- 2784-W 615 Leggett Chas A--5144-R 151 (426) Taylor Leah (c) 152 (245) Vacant 154 (243) Bussey Annie L (c) Crutchfield Jack E 310 Cone Barney B--2595-W 311 Causey Wm H--2485-W 313 Criswell A Frank--2394 314 Sharp Zimie D (o)--578 317 Murphey Alice H Mrs (o)-- 2485-J 318 Sheridan Chris F (o)--2531-J 321 Miles W Freeman--2407-R 322 Odom Robt L--2454-W 324 Henderson Hollie B--5754-W 325 Jones David S--1372-J Arlington pi intersects 616 Ridley Hamilton B--783-W 618 Wilson John E (o)--1629 619 Alexander Eulalie T Mrs-- 1220-W Turner Mittie A Mrs 620 Stahle De Motte (o) 622 Lee Fitzhugh 623 Warlick Josie V Mrs (o)--1607-J Woods Auburn 625 Vacant 626 Jones Bruce C (o)--2558 629 Davis Jesse W--3278 156 (241) Jinks Willie A (c) FORSYTH RD--Continuation of Vineville av beyond Riley av 2116 Sawdust Trail Barbecue-- 9296 2116 (2) Person Eug G (0)--- 1904-W 2120 Gordon Robt R gro 2121 Vacant 2122 Gordon Robt R 2123 Vacant 2125 Vacant St Paul intersects 630 Lawson O T*hos--783-J 2129 Causey John C--1904-J 631 Grace Ruby J Mrs (o)--4923 2130 Ingleside Oil Co fill sta-- 400 Newton Victoria Mrs--5754- 632 Apts: 9264 404 Yates G Morgan (o)--2926 1 Coleman Young R--1607-W 2137 Dixon T Talmage 406 Barnett Morris (o)--2454-J 2 Coleman Thos V 2200 Clark Memorials Inc monu- 407 Beall Jas (o)--2243-W 3 Wallace T Raymond--1607-R ments--3616 i- 410 Sandefur Annie L Mrs-- Street continued 2211 Gooding Jas K--365 iff 2407-J 636 Woodruff Geo S--1220-M 2214 Irvine Wm S Jr Forsyth la Intersects Progress intersects : 411 Davis R Marion--4645 637 Vacant 2216 Mason John W--1608-W 639 Pellew Sarah C Mrs (o)--906 643 Roberts Frank (o)--6085 2218 Smith Jas A restr 2220 Vacant 2226 Liberty Service Sta--9620 415 Willingham Chas L--6114-J 644 Wright Harry (o)--1804-J Higgison Leila Mrs restr > 416 Etheridge Elma M Mrs (o)- Wheeler Clyde M--5988-M Bellevue rd intersects m 419 6114-W Yelin Benj (o)--2243-R Stokes Robt N--5988-J 2300 Vacant 646 Horne J Benj (o)--4841-W 2302 Buck Ice & Coal Co 545 Oak av intersects 2320 Gans Alf N 2332 Yeomans Sami R (o)--1953 Jones David L 3202 Burke Effie B Mrs--63 3202 (r) Whitehead Jas (c) 2334 Essig Geo J 2336 Henderson Silas Y 2336 (r) Martin J Milton 2337 Dixon Talmadge C of Ga Ry Wesleyan Sta Curtis Ira (c) First & Last Chance fill sta Fry Isaiah (c) 2340 Aiken David H--2275-W 2342 Alley A K--937-J 2344 Hoffman Paul H;--1439 Goggins John (c)--6232 Horgan Danl C (o)--6232 Ide Hour Club--308-J 2345 McPherson John H (o) Idle Hour Nurseries green- 2346 Dismukes Jas C--4008 2346 (r) Harrell Everett L--6554-J hses--875-J Lee Mary C Mrs--5856-R 2400 Shouse Edgar S--1719-M 2402 Taylor Jemison W--5227-M Odell Arth B Pittman Chas W 2404 Rose Ernest C (o)--5227-J Redding Thos (c) 2406 McNair Wm O (o)--909-J 2410 Sherwood A Trawick (o)-- SScthaatitoznmaJnOCYarlBinagrbecue-- 601-W 2412 Daniel Jas W W (o)--1874-J 4648-J Threatt Lucinda (c) 2448 Parker C Hugh--2957-J Tyson Waller M 2450 Hatcher Albert S Jr--3446-W 2452 Hoagland Raymond L--820-W Wesleyan College--6185 Wesleyan Pharmacy--9562 2455 Blackburn Ray M France Ernest H (o)--3713 FORT HILL (EM)--North from 2457 Yeager Frank O--1441-J 704 Main, 1st w of Maynard Auburn intersects 120 Cain Cicera S--5751-W 2501 Sharpe Lila Mrs (o)--6590 121 Burns J Harry (o)--558-W 2502 Clark Mae E Mrs (o)--68 122 Vacant 2503 Hanson A Sidney (o)--1749-W 123 Griffin Jas A 2505 Shinholser Walter N (o)-- 124 Liles Jas D (o)--4048-J 6550 125 Leslie Geo H 2506 Huey Luke M (o)--2275-J Hill Thos Albemarle pi intersects 126 Vacant 2514 Oak Art & Gift Shop The-- 127 Griffin Lewis H 1379-J 128 Liles John A Walker Clare J Mrs (o) 130 Ward Jubal B Dr (o)--3871 2515 McAfee Eulah Mrs (o)--2995 130% Williams Oscar E--1430-J 2516 Chappell Nora A Mrs (o)-- 131 Griffin Henry L--2279 596 Berry Moses W (c) 598 Burney Claude (c) (o) Cowan intersects 600 Johnson Amy (c) (o) 602 Griggs Rufus (c) 604 Fluellen John H (c) 605 Brown Robt (c) (o) 606 Rutledge David (c) 607 Hubbard Edinburgh (c) (o) 608 Redding Eliza (c) (o) 609 Hubbard Edinburgh (c) gro 610 Solomon Mattie (c) 611 Lowe Wm T (c) (o) 612 Mohone Elvenia (c) 614 Spradley Cecil (c) 616 Hines Geo (c) 631 Jackson Wesley (c) 633 McMullins Blummer 635 Bell Otis (c) 637 Blount Annie K (c) (o) 639 Gebara Chas--5826-W 641 Ft Hill Cash Mkt meats-- 9326 Hall intersects 717 Smelter,Thos (c) 719 Ross Henry 721 Glover Edw (c) 723 Vacant 724 East Macon Sch (c) 728 Lowe Randall (c) 755 Wilson Rufus! (e) 757 Butler Mitchell (c) 759 Billingslea Abr (c) (o) Mitchell intersects 801 805 RGolobviners1oHn aBttieert (c) (c) 806 Singleton Wm (c) 807 Strong Mary (c) 809 Taylor Kyne (c) 2583 133 Shelley Claude B 810 Taylor Sami A (c) (o) 2518 Plunkett Robt G (o)--6574 Willingham intersects 813 (836) Smith Arth (c) 2520 Richardson Rhea W--1658 2520 (r) Billingslea Fannie (c) 202 Brown Wm R (o)--5751-J 203 Johnston J Robt 815 Glawson Harry (c) 817 Vinson Ida (c) Riverdale dr intersects 2524 Dessau Washington (o)-- 206 Trawick Wm A 819 Curry Thos (c). (o) 207 Keefer Missouri Mrs--220-J 821 Perkins Wm L (c) gro-- 4524 St John begins 3584-R Berkley dr intersects 301 Dixon Alvin W 900 Burdell Maryland M (c) (o) 2601 Phillips Chas H (o)--1468 2611 Jarrett Henry K (o)--6553 2612 Schmidt John E (o)--4520-W Euclid av Intersects 2700 Blossom Geo L (o)--1928 302 Holloway Maurice (o)--730-W 303 Vacant 304 Jones John C (o)--220-W 305 Pool Wesley S Thompson Owen P (o) --1727 901 Dantley Ashley (c) 905 Hampshire Frank (c) Williams begins 921 Jinks Lula (c) (o) |> 2717 Cason Geo T 306 Heyser John F (o)--2536-J 931 Tharpe Anthony --486 6544-J 425 Seibert Allen K--2518 453 Morgan Chas H--3009 455 First Ch of Christ (Scientist) Madison Intersects 501 Bray Wm L--1539-W 503 Coleman N Forest--2107-J 507 Rosser Geo E Rev (o)--292 517 Corbett Marion F Mrs 521 Putzel Isadore (o)--4316 525 Sheehan Robt E--1539-J 527 Hazlehurst Frank W--948 531 Halliburton Robt L (o)-- 3539-W 535 Rau Mary Mrs (o)--4425-W 541 Billings Thos E (o)--3539-J Radford Lee S--5933-J 547 Parker Laura R Mrs (o)-- 1105 Monroe intersects 605 Pig'n Whistle Sandwich Shop--4272 613 Hudson Weymon (c) (o) 629 Flournoy Wm F (c) 639 Power Oil Co br serv sta-- 2026 GEORGIA TERRACE--West from 505 Bailey av, 1st n of Montpelier av 200 Nichols John W 202 Harris John L (o) 204 Harris Wm C (o) 206 Anchors Wm S (o) GIBSON AV (SM)--East from 2526 Broadway 113 Vacant 114 Jackson Robt L (c) 115 Ward Narcissus (c) 116 Bonner Emma (c) 125 Vacant 131 Vacant Peacock intersects 202 (107) Greer Essex (c) 204 (335) Jones Susie (c) 206 (121) Hall Berry (c) 208 (113) Davis Julia (c) GILES (SM)--West from 1827 Broadway, 1st s of Wood 310 (312) Tissereau Louis (o) 311 Herring Wesley 312 (310) Hinson T Harvey Byars Raymond 313 Harris Ernest L 316 Hudson Harry C (o) 317 McConnell Columbus A gro-- 3089-R 320 Tindall Zollie T 3d intersects 450 Clements Delmos F restr Cedar intersects 501 Apartments 1 Palmer Stanton 2 Dixon Doshia Mrs 3 Lackay Edw D genl repr 4-5 Church of Christ GILMER--West from C of Ga Ry Shops 214 Howard Jos (c) 216 Sanford Mozella (c) 220 Thomas Geo (c) 222 Ross Fannie (c) 224 Johnson Maria (c) 226 Vacant 230 Lundy Harry (c) 233 Shoemake Linton (c) 235 Bearden Fannie (c) Bay intersects 303 Parker Ernest (c) 305 Thomas Jas (c) 307 Threat Moses (c) 310 Cooper Chuck (c) 312 Sampson Emma (c) 315 Farrer Chas (c) 317 Brown John (c) 318 Ward Addie (c) 319 Hall Chattie (c) 320 Robertson John (c) 321 Roberson Jack (c) 322 Oliver Mark (c) 323 Thomas Oscar (c) 325 Parker Lillie (c) 329 Hicks Warren (c) 331 Lewis Fannie (c) 332 Jones Mary (c) 338 Sparks Frank (c) 339 Frazier Lula (c) 340 Manning Robt (c) 342 Briley Arlena (c) 344 Vacant Hazel intersects 402 Bolden Mack (c) 410 Clark Edw (c) 412 Clark Etta (c) 414 Bivins Lonnie (c) 416 Bowden Ralph (c) 418 Ware Walter (C) 421 Scott Henry (c) 437 Vacant 441 Gassaway Chas (c) 442 Rhodes Iverson (c) 445 Towns Richd (c) 449 Veal Savannah (c) 453 Sanders Louis (c) 497 Ballard John (c) 498 Threatt Eug (c) Ash intersects 503 Humphries Sarah J (c) 505 Williams Wm (c) 507 Vacant 509 Vacant 511 Walker Chas (c) 513 Vacant 515 Vacant 517 Fair Berry (c) 519 Harris Fredk (c) 521 Williams Wm (c) 525 Brown Henry (c) 526 Johnson Wm (c) 527 Barr Wm (c) 531 Ponder Robt (c) 533 Combs Wm (c) Elm intersects 601 (28) Middlebrooks Minnie (c) 548 Baldwins and Telegraph's 602 (27) Vacant 603 (26) Jackson Win (c) 604 (25) Vacant 605 (24) Jackson1 Ida (c) 606 (23) Vacant 607 (22) Wise Richd (c) 608 (21) Vacant 609 (20) Mitchell Chas (c) 610 (19) Taylor Gertrude (c) 611 (18) Johnson Fannie (c) 612 (17) Grier Mattie (c) 613 (16) Taylor Joshua (c) 614 (15) Brown Wm (c) 615 (14) Brown Freeman (c) 616 (13) Johnson Ruby (c) 617 (12) Ross John (c) 618 (11) Dankin Andrew (c) 619 (10) Tyler John (c) 620 (9) Williams Lucille (c) 621 (8) Vacant 622 (7) Bivins Joseph (c) 623 (6) White Ernest (c) 624 (5) Vacant 625 (4) Williams John (c) 628 (1) Webster Danl (c) 1 I GLEN (EM)--North from ,,51 Woolfoik av, 1st w of Reese : 113 Gibins Nancy (c) f H6 Curry John (c) : 118 Stewart Amanda (c) 123 Lewis Inez L (c) (o)--4486 124 Gilmore Bishop (c) 126 (26) Jackson Ollie (c) 158 Battle Golduster (c) 161 (15) Waller Anthony (c) (c 169 Vacant ; 322 Hill Geo (c) 416 Thomas Geo (c) 765 McKibbins Raymond L Re (c) GLYNN AV--East from 1995 Lo Cabin blvd 2 Pratt Parks W--4608-W 6 Bayne Chas J (o)--3135-J 7 Martin Robt M (o)--4608-J 110 Vacant 118 Potts Julian (o) 124 DuPree Doris H Mrs (o)-- 4799-W 147 Walker J Cliff (o)--3135-W 148 Ring Chas H (o) 150 Wilburn J JThos (o)--3513-V I GORDON--West from 204 Bari left's la, 1st n of Bellevue av ' 121 Hill Otis (c) 185 Respess Mary F (c) r"1 ,# 187 Key Hattie (c) 188 Cole Wm (c) 189 Jackson Fannie (c) ' 192 Vacant 194 Jackson Zadie (c) (o) 301 Jones Dolly (o) 302 Howard Gus (c) 303 James Moses S (c) (o) 4330-J 304 Battle Robt (c) 306 Parker Chas (c) 354 Vacant GORDON (SM)--South f r about 1703 2d, 1st w of wood av j 115 Mitchell Emma Mrs ' 116 Burnett Chas M--1374-V 130 Shinholser W Jesse--32 1935 Macon City Directory 131 Stokes Otis R (6)--1079 132 Daily J Harvey--3032 133 Ryle James T 135 Horton Geo E Sr--2830-R GRACE AV (SM)--South from 115 Piedmont av 100 Hutchinson Paul 102 Hooten H Clifford 120 Scoggins R Thos 117 (200) Arnold Lewis C-- 3814-M Fairmont av intersects 201 Dyche Jack L 202 (103) Morrell Clarence 203 (309) Ogletree Ruth Mrs 205 (115) Severengen Wm W 210 (298) Watson Hiram A 215 (93) Watson H Cornelius-- 3114-W GRADY (SM)--East from 3601 Houston av. 1st n of Fulton 103 Stripling Jas P (o) 105 Gornto Willie E Mrs (o) 107 Adams Thos M 109 Ross Jas H 111 Story Ernest H 112 Whitehurst Walter J 113 Gilleland Dempsey (o)-- GRANT AV (S)--North from Brooklyn av, 1st e of Main 106 King Jos F (c)l 107 Stinsonville Bapt Ch (c) 109 Tanner Anna (c) (o) 110 Adams Henry (c) (o) 113 (2) Colbert Jas B (c) (o) 116 Battle Frank (c) (o) 749-M 114 Vacant 114% Russell Wm H 115 Miller Guy E 116 Collier W Thos 117 (123) Pierce O Eug 118 Harrison Jas C 120 Jones Ida A Mrs 121 Hamlin R Floyd (o)--749-R 122 Wheeler Sidney J 124 Hightower John W (o) 126 Hamlin Cecil L 128 Halsey Edna W Mrs nurse Bateman Roy F 130 (126) Campbell Carrie Mrs GRANT AV (V)--North from 4th av to Sheridan, 1st e of Ward 100 Beda Etta College (c) 102 (342) Thomas Susie (c) 103 Church of God (c) Douglas av intersects 200 (129) Pitts Hattie (c) (o)-- 6057-W 201 Vacant 202 (191) Covington Edw (c) 203 (185) Frederick Emma (c) (o) 204 Dudley Zella (c) (o) 205 Vaughner Millie (c) 206 Berry Claiborne B (c) 207 Hartwell Thos (c) GRAHAM'S LOT--East from 5th bet Mulberry and Walnut 3 Stovall Kate (c) 5 Marshall Fannie (c) 6 Heard Olo (c) 7 Livingston Sanders (c) 8 Vacant 9 Woodard Oliver (c) 10 Nealy Wesley (c) 12 Johnson Daisy (c) 15 Brooks Susie (c) 16 Martin Lila (c) 17 Vacant 18 Mobley Rachel (c) 305 Brooks Adeline (c) 307 Jones Fredk (c) auto repr 208 Clark Berry (c) (o) 209 Jackson Ethel (c) 210 (207) Rogers Walter S (c) (o)--1092-J Pole ends 211 Turner Edith (c) (o) 212 Jackson Edw (c) 214 Holliman Jas (c) 215 Vacant 216 (159) Black Nancy fc) 217 Parks Ella; M (c) (o)-- 1092-W 218 (161) Walker Frank C (c) (o)--5573-J 219 (136) Clay Zettler C (c) 220 Wheeler Chester A (c) 221 (134) McBride Elnora (c) GRAND AV (B)--From Atlantic north to 716 American blvd, 1st w of Mercer 222 (165) Sims Jas (c) (o)--. 6057-R 223 (130) Hunt John (c) 224 (131) Mabry Roy (c) 1 (2) Arnett Lucius B 225 (132) Lockett Agnes (c) 2 Carr Laura Mrs (o) 226 (125) Nims Hayes (c) 3 Patterson John T 227 Hicks John H (c) (o) Perkins J T gro 228 (127) Hyman Wm (c) 4 Perkins Walter E 229 Lavender Hubert (c) 5 Cox Benj 230 Burney Crawford (c) (o) 6 Russell Sami C 231 (124) Vacant 8 Arnett Sidney O 10 Belknap D Gordon GRANT CHAPEL AL (SM) -- 12 Dawson Jas J Jr South from 2231 2d, 1st w of 18 Cook Wm R (o) DeBorde 19 Dover Sidney 21 Vacant Brookdale intersects 100 King J Otis 101 Ross Eunice M Mrs (o)-- 5842-M 102 Franklyn Carey J (o) 103 (206) Odell Shealy L 104 (201) Bullock Wm 105 (204) Wellons Kenneth B 106 (203) Taylor Almeda Mrs (o) 227 Vacant 228 Duhart Rivers (e) 231 Grant James F 403 (3) Thomas Mary (c) 405 Vacant 525 Munson Chas (c) 526 (4) Williams Elijah (c) 527 (6) McCrary Julia (c) 528 Dinkins Elijah (c) 529 Hill John (c) 530 (8) Johnson Inez (c) 549 531 (192) McClendon Ida (c) 532 (510) Collins Laura (c) 533 (415) Brown Essie M (c) 535 Brown Turner (c) 537 Dorsey Lou (c) 538 Scott Annie (c) 539 (512) Nelson Wm (c) 540 (10) Everett Lee (c) GREEN -- Northwest from *83 Madison, 1st n of Woodliff 128 (230) Simmons Geo (c) 128 (r) Thomas Carl E (c) GREEN (PM)--West from Rose av, 1st s of Davis 86-87 Hutto Jos L 88-89 Vacant 90-91 Caldwell Bennett L 92-93 Johnson Gordon W 94 Parks Milton H 95 Brown Arth GUNN'S AL (V)--South from 308 3d av (V) 1 Vacant 2 Gordon John (c) 3 Morris David (c) 4 Johnson Bolena (c) 5 Sessions Julia (c) 6 Cosby Hattie (c) 7 Smith Henrietta (c) 8 Hill Sarah (c) 7 Mosley Rosa L (c) 111 Green St School (c) 114 Mahogany Jos H (c) 116 Almond Akin (c) 120 Gardner Ella F (c) (o) nurse 122 Floyd Etta (c) 124 Broomfield Julia (c) 125 Morris Meta (c) 126 Graham Wm B (c) 128 Walker Levi (c) 130 Tucker Delia (c) 132 (202) Davis Leola (c) 142 (206) Iderly Wm (c) (o) 96 Moon Carrie Mrs 97-98 Moye R Lafayette 99-100 Horton Wm D 101 Whitlock Thos C Jr 102 Herring Henry 103 Wilkes Harley 104 Mullis Henry L 106 Morrow Eug 107 Morrow Earl 108 Dugard Chas 109 Ellison Richd L 110 Barton Earl GUSTIN AV--North from Boundary to limits, 1st e of Wise 14 Hall Ella (c) 16 Taylor Eug (c) 18 Jordan Chas (c) 20 Giliiard Vinie (c) 101 Riverside Cash Gro 102 Lowder Wm (c) 104 Clowers Ellis (c) 106 Green John (c) 108 Grant Mary (c) 204 Little Jerry (c) 208 Smith Della (c) 209 Mitchell Minerva (c) 210 Sullivan Martha (c) 211 Tucker Lizzie (c) Rockhill la begins 212 Clark James (c) 213 Bullard Howard (c) 215 Nesbit Sami (c) (o) 216 Wimberly Edw (c) (o) 217 Wright Jas T (C) (o) 218 Merkson Jesse (c) 219 Waller Danl (c) (o) 220 Jeary Carrie (c) 301 Card Pleasant (c) smstrs 302 Griswold Eloise (c) 303 Lunsford Mortie (c) 304 Sellers Ophelia (c) (o) 305 Jackson Mary (c) (o) 306 Clark Cleveland (c) 307 Bailey Mattie (c) 309 Cooper Isaiah (c) 310 Holt Jos (c) gro 311 Staten' Ernest (c) 312 Bostwick Twiggs (c) 313 Lundy Miles L Jr (c) 314 Davis Herbert (c) 111 Pendley Ola Mrs GUSTIN PL (V)--East from 111 GREEN'S LA--East and West from 405 Madison, 1st n of Jefferson 39 Vacant 41 Vacant 43 Berg Jos (c) Collins pi intersects Holt av to Virgin la, adjoining Southland Mills 1 Fuller Joseph 2 Spruce John', W 3 Murchison Homer 4 Spruce Wesley C 5 Williams Chas A 47-(44) Johnson Augustus (c) 49 (54) Bell Bertha M (c) 51 (48) Hayes Ernest (c) 53 (50) Smith Wm (c) HABERSHAM AV--East from 1924 Log Cabin blvd, 1st s of Glynn av 113 Calhoun Ruby Mrs--898-W GRENADA TERRACE -- East from 3200 Houston av 101 Whitehead John H (o)-- 115 Harrell Emory S (o)--918-J 124 Harrison D Jewel--919-W 138 Williams Wm L (o) 4377-J 106 Horne Danl W (o)--4377-W 109 Kitchens Jos T--1078 116 McKinney Jos O (o)--2038 San Juan intersects 204 Clay Jake P (o)--1333-R 208 Griffin Gladis F--1333-J 210 Simmons Jas J (o)--6092-J Flamingo dr intersects 3440 Cranford Julian E dairy HALL (EM)--East from 900 blk Clinton rd, 1st n of Cowan 125 Clements Lillie M (c) 260 Burke Geo (c) 263 ( 667) George Berry (c) 264 (664) Crittle Walter (c)-- 1718-R 265 (665) Stewart Randolph (c) 266 (666) Johnson Estella (c) 267 (663) Duke David (c) (o) 315 Kitchens Bettie (c) 316 Walker Maxie (c) 317 Baker Mattie (c) 318 Davis Fannie (c) (o) 319 Davis Walter! (c) 320 Battle Clifford (c) 321 Vacant 322 Edison Delia (c) 323 McCarthy Reddick (c) 324 Ray Jas (c) (o) 325 Davis Benj (c) 326 Pennyman Chas (c) GRENADA TERRACE West from 3205 Houston av 111 Smith Claude W--3142-J 115 Owens Wesley P (o) 121 Ketchie W Louis (o)--1873-W 123 Bateman Emmett E (o)-- 2970-R 125 (314) Head J Kiel (o)--1203 127 (315) Ware Douglas B bldg contr 129 (324) Jessup Shepard 131 (224) Watts Arth B (o) GREEN (V)--West from 200 Bell av, 1st n of Roye 1873-J 133 (226) Vacant 100 (206) Ross Mary Mrs 102 (341) McCord Ethel Mrs 106 (210) Moore Henry (c) 108 (212) May Chas (c) 110 (304) Sledge Chas (c) GRESHAM LANE--North from 765 Spring to Orange, bet Rose Park and Forsyth 626 Danforth Josephine (c) 268 (660) Moss Mary (c) (o) Lexington intersects 303 (583) Kendrick Lucinda (c) Little Short intersects 400 (531) Jackson Henry (c) (o) 401 (735) Hall Annie (c) 402 (150) Green Wm P (c) < Center intersects 500 (21) Redding Anna L (c) (o) 501 (218) Meriwether Arth L (c) (o) 5.02 (460) Curtis Ella (c) 509 (19) Pope Grady (c) 504 (420) Bivins Henry (c) 505 (504) Shy Eula B (c) 506 (15) Ford Frances (c) 507 (307) Folds Chas H (c) (o) 507% Folds Laura (c) soft drnks 508 (458) Marshall Paralee (c) Ritchey al intersects 112 (220) Franklin Mamie (c) 114 (202) English Dock (c) 116 Howard Albert R (c) 118 Floyd John (c) 119 (112) Sledge Lillie (c) (o) 120 (222) Wimbush Frances (c) 122 (224) Howard Maria (c) (o) 124 (226) Johnson Ida (c) (o) 126 (228) Jones C Columbus (c) GUERNSEY LANE--South from Elm, 1st e of Telfair 154 (701) Matthews Mary (c) 156 (703) Williams Wm (c) 158 Carter Fannie (c) 162 (706) Smith John (c) 204 Williams Wm (c) 206 (156) Singleterry Julia 509 (309) Vaughn Minton (c) 510 (456) Burden Wm (c) 511 (311) Duncan Talton (c) 515 (497) Weinberg Louis 517 (499) Weinberg Louis gro Womack intersects 600 (251) Cummings Andrew ( 603 (252) Vinson Oscar (c) ()_ 605 Parker Leila (c) (o) 607 Gray's Chapel A Mi E Ch (c) Clark intersects 609 (241) Reed Hattie (c) 610 Wimberly Jas H Rev (c) (o)--5286-J 611 (240) Hunt Robt (c) 612 Watson Jas (c) 500 Brown Bertha (c) 510 McMickens Benj (c) 516 Stanford Nora (c) 518 Gross Ira (c) 552 Kindle Renee (c) 553 Johnson Wm (c) 558 Robert John (c) 566 Perkins Columbia (c) 120 Fairyland Dairy confrs--9648 123 Vineville Packing Co meats-- 253-4 124 Coleman's Pharm--1236 140 (120) Atkins Mrs bakery Middle Intersects 203 Wilson's gros--5274 203% Warren's Mkt meats 613 Stallworth Mack (c) 614 (411) Dean Richd (c) Fort Hill intersects 700 (690) Bell Julian (c) (o) 701 (224) Curtis Lawson (c) 703 Middlebrooks Jas (c) 704 (695) Bland David (c) 705 Ford Grace (c) (o) 706 (604) Barnes Kate (c) 707 (136) Billingslea Leonard (c) (o) 708 (605) Solomon Steph (c) Smith intersects 709 (612) St James Holiness Ch- ic) 710 (128) Freeman Ollie (c) (o) 712 (127) Johnson Robt (c) (o)-- 1799 716 (131) Cornelius Allen (c) Maynard Intersects 803 (442) Vacant 804 (440) Farley Estelle (c) HALL (SM)--South from Reid bet Elbert and Waterville rd 20 McNeal Walter (c) 22 Leonard Ruby (c) HAMMOND--West from 765 Bay, 2 s of Broadway 302 Vacant 309 Fitzgerald Jessie (c) lunch room 315 Swann Geo (c) 317 Jackson Eliz (c) 318 Hall Janie (c) 319 Corbin Nell (c) 320 Matthews Chas (c) 321 Kizzie DeWitt (c) 322 Wright Edw (c) 323 Hammond Geo (c) 325 Powers Ray 326 Stribling Peter (c) 327 Jones Wm (c) 329 Singletary David (c) 331 Vinson Henry (c) 331 (r) Finney Sara (c) 333 Sinclair Refining Co plant3211 344 Reese Carlton (C) 338 Pryor Otis (c) exp 342 Evans Mollie (c) 344 Burney Sadie (c) Proctor & Gamble Mfg Co cotton seed prods--1985 346 Walker Jesse (c) 347 Gill Arth (c) 349 Humphries Paul (c) 351 Cleveland Sarah (c) 353 Vacant Hazel intersects 416 Smith Mary (c) 418 Wimberly Hester (c) 420 Allen Judge (c) Parker al begins 426 Tolliver Benj (c) 434 Fair Zorena (c) 436 Holmes Arcelius (c) 438 Bird Chester (c) Ash intersects Elm intersects 602 Evans Louis (c) gro 603 Ga-Carolina Oil Co--637 608 William^ Sarah (c) 612 Banks Lonnie (c) 616 Banks Frank (c) 620 Butts John (c) 624 Stanley Thos (c) 628 Brown Wm (c) 634 Fowler Boise (c) 638 Johnson Lee (c) 640 Gilchrist Ida (c) 642 Hall David (c) Edgewood av intersects 701 Gary Sol (c) 702 Lovett Jack (c) 703 Merrill Chas (c) HANSON (SM)--East from 2900 Houston av, 1st s of Nelson 1 Williams Robt (c) 2 (350) Wilson Lonnie (c) 3 (312) Brooks Lee (c) 4 (315) Bass Cora (c) 5 (310) Bell Walter (c) 6 (313) Winn Ida (c) 7 Fry Walter (c) 8 (311) Webb Raymond (c) (o) 9 (302) Mitchell Chas (c) 10 (309) Stephens Marion (c) 11 (300) Thomas Otha (c) 12 (307) Hicks Jas (c) 14 (305) Ross Edna (c) 16 (301) Hubbard Robt A (c) (o)--445-R Simmons intersects 317 Vacant 324 Molton Hiram N 32fl| Harrington Robt F--1499-R 327 McCullough Lucy Mrs (o)-- 1499-W 328 Beckum Geo C--1499-J 330 Heath Danl D 332 McBride Bemon G (o-- 1499-M 337 Avera Emmett C (o)--1140 347 Carter Perue 356 Hudson Wm R (o) Bacon intersects 410 Cape Geo D 412 Self Geo G HARDEMAN AV--West from Intersection of Georgia & Washington avs 101 Vineville Lunch Rm (c) 103 Vineville Br Pressing Club (c) 105 Coffee Gro--9506 107 Moore & Boone gros--3982-3 107% Boone Henry C (o) 108 Leaptrot's Dry Clng Co-- 78-79 111 Morris Robt (c) 112 Estes Geo P furn repr--2068 115 Karesh Dept Store genl mdse 117 Vineville Fish Co--137 Bray Perry M gro 119 Rogers Inc gros 205 Volunteer Stores gros--3597 209 Muse Chas J--2004-J 212 Stripling Wm J (o)--4260 Virgin intersects 217 Wesley Mildred Mrs--3877-J 236 Houser Walter F (o)--2198 238 Wimberly Wm A furn rms-- 3070-M 240 Hackett Wm W (o)--4480-W 243 Gregory Minis H 245 Connally Jas L--4339-J 247 McMillan Donald--3070-R 249 Fitzpatrick Jas P--2751-J 250 McCrary Chas H--4294-M 254 Gibson Obadiah C (o)-- 2148-J 255 Massey Alma A Mrs (o)-- 2379 Apartments: 1 Hudson John R 2 Smith Albert N--2751-W 3 Bethune Geo R--4480-J 4 Bryan Jas B Jr--4294-J Street continued 268 Gambrell Harriet Mrs (o)-- 2148-W 269 Eubanks Mary W Mrs (o)-- 2629-J 270 Baldwin J Henry (o)--3164 271 Butts David M--1205 Craft intersects 300 Turner T Rad (o)--245 301 Clark Irma M Mrs (o)--902 Baker Emmett H 311 Pendleton Sallie P Mrs (o)-- 3833-J 316 Lane Hattie McK Mrs (o)-- 2250-J 319 Hatcher Marg P Mrs (o)-- 3153 322 Wimberly Brown (o)--8 339 Jones Geo S (o)--872 Pursley intersects 340 Hardeman Lula--6270- J 341 Burghard M Frances Mrs-- 1127 Wilson Mary M--5085 342 Moore Luther L--2897-J 346 Smith John R--1399-J Shaw M Edw bldg contr-- 4945 354 Collins Cora Mrs--3373-J 356 Adams H D (o)--2897-W 358 Piggly Wiggly gros--3773 360 Johnson Pharm--1414 362 Gulf Refg Co serv sta--9307 HARRIS--South from 225 Turpin, 1st w of So Ry 12 Porter Mozella (c) 29 Shine Benj (c) 41 King Geo (c) 43 Brown Cate (c) 44 McGee Elijah (c) 46 Lamar Neal (c) Cason Moses (c) 47 Barron John (c) 48 Nixon Alston (c) 100 Vacant 101 Carlisle Henry (c) 1935 Macon City Directory 551 102 Stanley Chas (e) Ridge av Intersects 662 Crosby Jas 103 Butler Wm (c) 104 Vacant 105 Mitchell Chaa (c) 109 Davis Jane (c) 203 Baston Wm M 668 Taylor Robt (c) 205 Cass Patk E (o) 671 Bibb Mfg Co (No 2) 5117 704 Dumas Chester M gro HARTLEY AV (Lynmore)--West 706 Andrews Gertrude (c) Fordvllle begins 111 Glover Albert (c) 123 Kendrick Oscar (c) 206 McCrary Jas (c) 228 Foster Banks, (c) 245 Patterson Wm (c) 297 McGee Jesse (c) 500 Vacant 509 Gallimore Epsie (c) 549 Haven Ethel (c) from 4048 Houston av 107 Gibson Geo G 109 Davis Jas W 115 Pitts Annie (c) (o) HATFIELD AL --North from from 918 Vineville av, 4 w Rog- 1301 Vineville av to DeSota pi ers av 102 Massey Wm W--1641-R 106 Domingos I Leroy (o)--5269 108 Watson Vera M Mrs (o)-- 5384-J 109 Lane V McKibben (o)--4328 114 Jelks Molly S Mrs-4592-J 115 Burghard Lucia E Mrs (o)-- 62 116 Clay J Emory Dr (o)--2523 120 Bowen Robt A (o)--696 121 Spratling J Hook Co)--5732 124 Woolvin Robt B (o)--2949-J 127 Owens Jas D (o)--3003 128 Jones Baxter (o)--2811-J 121 Dorsey Margt (c) 123 (102) Price Lula (c) 125 Howard Annie (c) 126 Vacant 127 Crawley Benj (c) 128 Vacant 201 Searcy Clifford (c) 203 Jones Wm (c) 205 Anderson John (c) 207 Lewis Mary (c) 209 White David (c) 211 Dunn Addie M (c) 215 Vacant 129 (36) Whitehead W Jackson 131 (35) Glass Raymond C . 133 (34) Nobles Oscar W 135 (33) Sexton J A Dannenberg av intersects 200 (56) Goins W E & Son gros 201 (32) Stevens Russell L 202 (94) Allen P Franklin barber 203 (31) Crenshaw John T 204 (96) Goins Geo W gro--9639 205-07 (30) Favors John A 208 (140) Willingham Bapt Ch 209 (28) Wright John W--4173-B 211 (27) Carter Curtis M 212 (17) Valentine Chas 213 (26) Headden Hardy H-- 4173-J 131 Williams Harry G-4410-R 132 McKay Albert (o)--1045 133 Reynolds Gladys Mrs--3874 135 Lowe Francis J (o)--4410-J 136 Bush Thos S (o)--1948-W 139 Slocumb W Clifford (o)-- 2845-J 140 Jones John A--5384-W 142 Patton Mary T Mrs (o)-- 2811-W 143 Stewart Wm E (o)--4150 144 Lovelace Ralph A (o)--1309 145 Burden Eug B--4459-W Elizabeth pi intersects. 201 Evans Rufus W (o)--2230-J 203 Williams J Lyle--3444-J 204 Bagwell Wm H--4028-N 205 Fulghum J Walter (o)--1215 207 Barnes Dewey D (o)--784-J 208 Cobb Wallis G (o)--6157-J HOLT--West from intersection of Orange and Spring, to Maple 114 Collins Robt E--5517 118 Moxley Collie S Mrs 119 Ratliff B B 121 Chapman, Lester H--4025-M 122 Buckner Earl L 123 Stiles Jos E 124 Pace Florence Mrs 126 Riley Danl H 127 Brannan Wm T--2036-J 128 Carswell Roger W 132 Barshow Frank A Murphy Mary (o)--1992-M 138 Smith Vivian S (o)--2340 144 Finney Robt L (o)--3080-J 150 Donnelly Ann C Mrs (o)-- 3608-W 156 Pritchett Bessie Mrs 209 Keenum J Benj--880-M HOLT AV N--South from 528 211 Chandler A Moye Clayton to Vineville av 214 Williams Edw T (o)--4028-R 104 (110) Moore < Stewart (c) 215 (25) Grady Littleton J 216 (19) Glass Sallie Mrs 217 (24) Kirby Henry J 218 (20) Dennis J Melton 219 (23) Mason Fred L 221 (22) Busbee Benj O 222 (54) Lynch Grief R--1421-W Lawton intersects 500 Edenfield Robt W--2808 Edenfield Margt W Mrs mus tchr Lanier High Sch for Boys Napier av intersects 604 Grier Geo W (o)--1788-J 606 McCullough Jas C (e)-- 4249 607 Kilpatrick Claude C (o)-- 5663-M 608 Scott Minnie G Mrs (o)-- 5770-W 609 McWilliams Robt S (o)-- 3049-J 610 Williams Walter E Jr 556 Baldwin's and Telegraph's 611 Killan Edith R Mrs (o)-- ' 2904 Watson Hugh A 3141 Watson Thos H 4218-W 2905 Atlantic Ice & Coal Co ice sta 3145 Calhoun John C--2244-W 612 Thames Mathew A--5153 2906 Howard Horace J 3145 (r) Plunkett John. P 613 Wilder C Eug (o)--3803 2908 Moore Eulys T 3155 Hudson B Grover--9339 614 Hamlin Jas O--349-J 2909 Collins John W Villa Crest begins Beech av intersects 702 Vacant 703 Brazzeal Jefferson J 2911 Smith Jas H--4503 3200 Vacant 2915 Hightower's Serv Sta--9537 3201 Moody Clifford A 2916 Hill Thos L--2430-R 3203 Little Groceteria--1832 704 Braxton Linnie Mrs Cleveland ends Fish Melvin K 705 Parker Henry A--5770-M 2918 DiVenuto Enrico gro (o)-- Williams J H C serv sta 707 Hall Irving E--1246-R 709 Huff Wm L--1246-J 5027 2920 Baldwin Wm L 3205 Pender J Wm bldg contr 3212 Weeks Serv Sta 711 Rogero Chas J Jr (o)-- 2921 Baldwin Henry W--473-R 3214 (3198) Batson Oscar M (o)-- 3852-M 712 Vacant 714 Creter Louis P--1135-M 716 Coursey Wm L--1135-R 723 Lutheran Ch of the Redeem- 2921% Baldwin Wm L auto repr Evergreen la intersects 2923 Flanagan Dennis J (o)--6083 2924 Home Edgar B 2925-29 Flanagan's. Camp (tour- 1792-W 3218 (3200) Stapleton John T (o)-- 6293 Grenada te*r *intersects er 725 Harvey Geo R (o)--1855 727 Woodruff Theo P--4160-J 784 Garden Harry--3302-J 785 Vacant 786 McFarland Jas F (o) 789 Baird Lyman R (o)--3258 790 Dennard H Leon (o)--4160-M 792 Skinner W Bryan--4160-W HOLT AV (V)--South from junction of Forsyth and Vineville av, 1st w of Virgin la 102 Dorsett Nina M Mrs--3284-W Haas Albert A--5929 106 Broome Willie M Mrs (o)-- 2228 108 Detling Blandina D Mrs (o) --1923-J 110 West John E--3284-J O'Neal Wm J 112 Lane Ellen Mrs (o)--2314-W Gustin pi begins 216 Southland Knitting Mills Inc --780 HOUSTON AV (SM)--A continu- ation of Broadway, s of Charles ist) 2931 Ivie Pinkney P--4065-W 2998 Ezell Geo E barber Georgia Cafe Groceteria The Saliba Geo Saliba Mary Mrs McCahill Tinus Rutherford* a*v *intersects St James intersects 3000 Huston Av Vulc Shop 3001 Jenkins Henry A--1556 3002 Huff Lucius P 3003 Hadarits Jos P (o)--2158-M 3004 Turner Mamie Mrs--2244-M 3005 Beaty Herschel F (o)--6459-J 3007 Fox Henry A Ponce de Leon intersects 3011 Butler Walter C gro--2281 3019 Lockerman Andrew J serv sta 3020 Finney F Lee--2385 3021 Finney & Hudson Co furn reprs 3022 Watson Albert F (o) Ella intersects Ormond ter intersects cor Bruce Chas H Sch--9333 Villa Esta intersects 3300 Hunt's Tourist Camp 3303 Vacant 3304 Newton Percy W (o)--2642-J 3307 Williams John H C--2322-J 3309 Bernhardt Mary E Mrs (o) 3319 Brown Neill H 3327 Parker Ernest P (o)--170-J 3329 Turner Jas C (o)--2322-W Lynmore av intersects 3401 Rogers Elisha H--3495-J 3404 Robertson Edw B Bedingfield Susie--3495-W 3447 North Pole restr Cox Wilmer M (o) 3475 Vacant 3481 Jones Grover J gro--1263 3490 Lane Reuben M 3492 Ohio Garage 3494 Gunter L L barber 3496 Vacant 3498 Parks Pharm--2327 Richmond begins 3500 Harper H Grady 3501 Smith Harry M 2642 Bazemore Nettie H Mrs (o) 3024 Bexley John W (o) Martin Wm N --1801-W 2644 Malone Gordon 3026 Vacant Mill av intersects 3028 Smith Oliver F (o)--4633-W 3502 Tarpley Jas W 2646 Smith Edw P--2419-J 3030 Westbrook J Robt (o)-- 3505 Stallsworth Robt L serv st* 2648 Dunker Leroy W--941-W 2245-J --3297-J 2650 Sawyer Alton W--6309-R 3032 Chapman John A (o)--25(55-J 3506 Linenkohl Boyce A (o) Crisp begins 2719 Sanders Margt Mrs (o)--52-W Franklin intersects 3033 Lackay John F (o)--1103 Grady begins 3601 Aiken Wm P serv sta 2721 Stewart J Vester--5199-J 3034 Burnham Richd E C (o)-- 3602 Bailey Walter, H--2980-R Dixie av intersects 2607-J 3604 Denson John W (o)--2980-J 2723 Wright Athos W serv sta-- 3035 Vacant 6026 3036 Hobbs Homer G (o)--1991-J 3606 Gilbert Willis L 3607 Hamlin C Hubert (o) Sawyer Coal & Ice Co No 3 3038 Brown Thos E (o) 3609 Dixie Hwy Garage reprs 2799 Rogers Inc--2799 2801 Gt A & P Tea Co gros 2803 Darity Carlton C 3040 Clance Missouri--3840-J 30441 Westbrook Viola M Mrs --2607-R (o) 3611 Gordon Jas A serv sta Rocky Creed rd * Intersects 2804 Yarborough Wm J (o)--941-J 3042 Dyer Chas W (o)--1612-J Fulton begins 2808 Morgan John B 3043 Burkhalter Natha L-- 3704 Vacant 2810 Mitchell John C (o)--765-J 849-XW 3705 Etheridge Bros gros--4436 2829 HightoNweelrsoSn eHnudrslbut (o) 2831 Hightower Mary E Mrs (o)-- 765-W 2833 Rich Dennis 2834 Malone Wm J Jr (o)--765-R 2835 Rich Dennis fruits 2837 Irby Janie M Mrs 283714 Self Geo G confr 2838 Busbee Ada Mrs (o) 2839 King Marie Mrs (o) 2846 Georgia Serv Sta Hanson ends 2900 Younis David I (o)--4896 Stella's Beauty Shop 3044 Rachels John Clemmie (o) Henry intersects 3102 Chapman's Grbceteria--181- 182 3105 Shorty's Place (tourists) Masters Waring R 3106 Smith Wm O barber 3110 Harper Henry G auto repr 3111 Brannon Ellis W Brannon's Serv Sta--9451 Heard av intersects 3135 Buddy's PI barbecue Newberg intersects 3706 Goodin Henry C 3707 James Paul (c) blksmith 3708 Petty Arth M (o)--3708 3710 Melton Emma G Mrs--2654-W Troup begins 3800 Smith Gustave E (o)--3552-W 3801 McWilliams Robt F (o) 3802 Nottage Danl A--2795-J 3803 Briggs Arch R bldg contr (o)--2654-M 3805 Bolton Geo T (o) 3807 Evans Fredk W (o)--3818-W 3808 Chance Jos M (o) 3809 DuPree Rufus J (o) 1935 Macon City Directory 557 3810 Le Guin Alf A--3818-R 30 Allen Hansel H 408 Flewellyn Annie (c) (o) Davis begins 40 Lavender Richd B 411 201) Smith Danl (c) 3900 Leverette Lucius (o) 42 Wallace Noble B 413 (142) Shelley Saul (c) 3901 Shuttles Jack C (o)--3818-J 43 Waller Jeff D 6th av intersects 3904 Skipper John W (o) 44 Maxwell J C 483 Jordan Edgar (c) 3905 Pope Chester C--4394-M 45 Morgan Robt M Ga Industrial Home 3909 Castellow G Edw (o) 46 Wallace Bailey W 7th av intersects 3912 Smith Harry H--4003 47 Moore Leonard C * 3913 Etheridge Jas E 48 Hooks Lucile 8th av intersects 3914 Lewis Walter L 49 Johnson Irvin 3917 Middle Ga Tourist Camp 51 Ryle John T INGLESIDE--A suburb west of 3980 Campbell Albert B 52 Weaver Willie T city limits 4001 (4095) Gunter T Rufus 53 Brooks J Henry 4003 (4097) Voellinger Willis E 54 Beck Jos O INGLESIDE AV (I)--Northeast baker 55 Akeridge Sami N from 1901 Vineville av to 600 4004 (3910) Smith Letha E Mrs 200 Waller John W blk of Ridge av (o)--3818-M 201 Bray Henry A 100 Vacant 4005 (3917) Rogers Serv Sta--9312 202 Vacant 104 Clements Geo M 4007 (409) Harper Wm W--2795-M 204 Vacant 4011 Rogers R Malcolm 206 Butler Wm R A 105 Barfield Geo R Jr--3620-J Barfield Dorothy L nurse 4012 Bennett W Ida Mrs (o) 212 Reed Lilia Mrs 4016 3948) Rogers Lawson D (o) 216 Thompson Ross 106 Davis Lee (o) 107 Salter R Kirkland--2094-J --4158-R 220 Blackshear Chas A soft 108 Vacant 4018 (3952) Sullivan Harvey E (o) drinks--5680-J 110 Thwaite Chas E (o)--4884-M --4158-J 242 Leslie Walter L 112 Jones Barna C--2094-W A041 Edwards Homer J 246 Law Annie Mrs Ridge av intersects 4101 Meadows Eug H gro & serv 250 Edge Matthew sta 254 Stevens Mattie L Mrs 4103 Meadows Eug H (o)--1158-M 256 Dix Tony R 205 Hearn Paul (o)--4984-J 209 Allen Pleasant D (o) Emily pi intersects Hartley Intersects 258 Spikes Thos J 307 (96) Vacant 5000 Hi-View Serv Sta Main Intersects 309 (98) Stillwell W Alex | 123 Pinholster James C !' 124 Smith T Freeman (o) H 127 McDonald Wm T--3996-J 133 Evans Columbus P (o) JASAMJNE AV-West from Oak; land av, 1st n of Belmont 160 Bryant Jas W (o) 380 Wibelset HJaacrkrsyonB L(--0)(--0)1533-R South from Napier av, 1st w of Inverness av 500 Barnes Jos (c) (0} 502 Pless Wm (c) JEFF DAVIS --East from 110 Emerald, 1st n of Flanders 110 Stewart Felton 112 Vacant JONES--A continuation of Oc mulgee, north from Orange to 211 (108) Vacant 213 (108) Vacant KEY (U)--South from end "i Dempsey av, 1st w of Park Madison 111 Vissher Janie (c)--3063-J 113 Gaines Cora (c) 115 Walker Jas E (c) (o) 117 Green Patsy (c) 120 Andrews Lily B (c) 123 Easley Brydell (c) 124 Brown Susie (C) 126 Simmons Mary (c) JORDA--East from 220 Norris, 1st s of Broad 101 (4).Bonner Thos (c) (o)1250 104 (5) Reynolds Wm F (c) 105 (6) Bonner Visia (c) (o) 108 (7) Gross David (c) 109 (8) Rice Eug (c) (o) 113 (9) Smith Felix (c) 98 Cliett Lonnie (c) 100 Cliett Wm (c) (o) 106 Burleigh Peter S (c) (o) 119 Burleigh Robt (c) (o) 120 Denton Albert (c) (o) 121 Wilder Albert (c) (o) 175 Jones Alonzo (c) 180 Mt Lebanon Bap Ch (c) 198 Denson Ada (c) (o) 128 Fleming Little (c) 129 Smith Robt L (c) (o) 117 Chambliss Roecoe (c) 118 Curry Walter (c) KINNETT--See Holt av (NHts) 130 Smith Chas H (c) 132 Davis Hattie (c) 133 Duncan Wm (c) 139 Feagin Irene (c) 140 Smith Maude (c) 143 Tabor Hugh L gro College Intersects 207 Vacant 212 Lewis Wm (c) 125 (10) Smith Laura (c) KITCHENS (EM)--North fro"1 JORDAN'S AB (SM)--West from 2d, 1st a of Williams 218 White Isaac, (c) 219 Pounds Georgia (c) 220 Sanders Oscar (c) 221 Copeland Essie (c) 222 Vacant nr 901 Taylor, 1st e of Norris 100 Chappell Sami (c) 110 Roberson Drucilla (c) 112 Neely Jesse (c) (o) 202 (100) Davis Baldwin (c) (o) 204 Whipple Chas (c) 205 Whipple Lelia (c) (o) 213 Thomas Wm (c) 214 Foggy Ray (c) 215 Goddard Candus (c) (o)-- 1442-W 218 Hendricks Geo (c) 220 Davis Aminzer (c) (o) 221 Nelson Lizzie (c) 226 Burdell Ulysses (c) 228 Miles Luke (c) 229 Cray Mary (c) 230 Pugh Amanda (c) 232 Graddick Margie (c) 233 Little Wm (c) 234 Smith Clifford (c) 237 Jordan Lillian (c) 243 Smith Mary L (c) 223 Byrd Florence (c) 224 Goodin Sami (c) 25 Vacant 226 Riley Wise S (c) 228 Brown Alex (c) 230 Nash John (c) 234 Hudson Henry (c) 236 Jordan St Baptist Ch KNOTT (SM)--South from e"*1 of Jeff Davis to E11 120 Hollingsworth Frank D 121 Johnson J Howard Hambrick Paul C 123 Copper John E 125 Britt Jerry M 126 Jenkins Luther A JOSEY--West from 3209 Houston av 3308 Hammack H Wyatt--170-W 127 Willis Gordon F (o)--2353 128 129 Johnson Shepard Bonnie D Chas D (o)--l'84 131 Lindler W Parks--2114 KAHN'S AB--South from Tinsley la to Forsyth bet Monroe tt Frank al 132 Stephenson L Edw (o) 138 Freeman Harry H 140 Strozler Paul L , 569 Baldwin's and Telegraph 142 Garner Wm M 144 Aids Frank R Cor South Side Ch of Christ School ends 103 Cargill Edw S (o) 219 Clark Hehry D--6156-J 104 Maner Roy C--4968 221 Dohn Adolph (o)--2478-W 138 Haden W Thos (o)--1799-R 222 Leonard Howard N (o)-- 139 Stewart W Kenneth (o)-- 1094-J 214 Bloodworth Minnie L (o) 3394-J 225 Miller Wm E (o)--6056-W 219 Wilburn J Frank (o) 221 Howard Ross 222 Hollingsworth Paul E 141 Taylor W Harry--4444-J 227 Crenshaw John W--452-W 152 Carver Archie S 153 Trimble J Thos (o)--919-M Carling *av* in*tersects 224 Vacant 164 Thomas Clyde A Duncan av intersects 225 Lockhart Alice Mrs (o) 165 Shipman Alex H 413 Dean Wm H 28 Loveless Wm L (o) LAUREL AV-(NH)-Northwest LAKE (B)--North from Bellevue from 217 North (NH) rd, 1st e of Melrose 101 Schoonmaker Burton H--4688 1 Vacant 103 MacEwen Harry L--1452-M 2 Vacant 105 Roberts Wm H 3 Vacant 106 Huhn Henry R (o)--3103 4 Vacant 110 Shepherd Wilmer W (o)-- 5 Vacant 4660 6 Vacant 112 Lord Pauline S Mrs--3035-J 200 Vacant 119 Baggarly Alvah C--2987 303 Vacant 121 Clinkscales Cody G--6345 305 Vacant 125 Lanier Louis D--3954-R 307 Vacant 126 Branan Emma H Mrs (o)-- LAKE CITY (EM)--West 210 Clinton, 1st s of Main 4 Beck Jasper N 5 Graham Geo 6 Byrd Oscar 7 Etheridge Otis Johnson Monroe 9 Dubose John H 10 Graham David 11 Taylor Omer L 12 Corbett Jas 13 Gordon Lonnie V 14 Byrd Wm E 15 Dixon A Elmon 16 Garrett Lucy Mrs 17 Byrd John M 18 Brantley Robt L 19 Haddock Jas L 20 Carmichael John 21 Hood Robt A 23 Batchelor Chas M 25 Sharp Harrison S from ' 5444-J 137 Smith Archie J (o)--6122 142 Malone Carrie Mrs--4506-W 143 Wilkinson Chas W 145 Lamb John R (o)--3760-M 149 Pickett Chas A 157 Kelly W Frank (o)--3760-R 159 Vacant 168 Heard J Milton (o)--495 169 Middlebrooks Leola B Mrs-- 5088-J 170 Tharpe Benj C--415-M 177 Tidwell C Coleman (o)--6147 181 Williams Chas H (o)--4506-J 182 Richter Geo L--4058-J 185 Maple Orlie E (o)--3760-W 186 Marshall Allen W (o)-- 4058-W 187 Vacant 188 Snipes Reuben W (o) 193 Barker Geo M (o)--8512-J 194 Keiser John M (o)--3922 196 Waite Kath C--1606-J LAMAR (V)--North from 400 197 Holsenbeck F Dorsey-- Ylnevllle av. 1 w of Forest av 6235-M 9 King J Franklin--4721-R 199 Hall Wm R (o)--1606-W 101 Leverette John A--3790-J 102 Gregory R Carl--4721-W Lucas Robt B--1323-J 103 Vacant 104 Quin Hugh W (o)--67 105 Barker Barney B--3674-J 106 Johnstone Walter T--1112-J 107 Willis Geo A (o)--1112-W 108 Kendrick Mary W Mrs (o)-- 5015-J 109 Burts M Eug (o)--5015-M 110 Rand Edw H (o)--199 111 Rees Albert W Rev--3755 112 Thomas Jack R 113 Baker Frank F (o)--3428 114 Vacant 115 Weir Jack 116 Vacant 117 Holmes Oliver C 118 Corbin Jas B 119 Butler Gibson L--4398-J 120 Andrews Wm H (o)--5135-J 122 Brooks John B (o)--4398-M 123 Vacant 124 Pritchett Claudius T LAWTON AV--West from 341 Adams, 1st n of Coleman 90 Harshbarger Clarence H (o) --1730-M 91 Cheatham Iola Mrs (o)-- 5763-J 94 Saunders Eliz Mrs 95 Poe Annie S Mrs (o)--6319-J Linden av intersects 102 Vacant 103 Vacant 105 Sears H Nathan--4921-W 108 Armstrong Jas W--985-W 112 Jordan Geo W (o)--2864-J 115 Gilbert Irma R (o)--4921-J 117 Simpson Annie L (o)--4921-M 120 Brown W Merrell (o)-- 1274-W 121 English Harlow D 123 Butler Thos J (o)--6156-W * 124 Norwood Geo M (o)--1463-W 125 Armstrong Victor E--812 126 Grayson Annie A Mrs 127 McCrary Felton D--6031 McCrary Betty C Mrs beauty LAMONT AV (LCHts)--South from Log Cabin blvd, 1st w of shop 129 Bliss Oliver R--6156-R Edna pi Johnson av intersects 414 Davis Daisy (c) 416 Grenon Alida Mrs 420 Champion Cora (c)--7 421 Glover Frazier C Randolph av begins 422 Waller Lizzie (c) 424 Harris Julia (c) 426 Hunnicutt Sarah (c) 428 Williams Susie A (c) 432 Johnson Junior (c) 436 Harris Alice (c) 442 Spears Eurie L Vine intersects 500 Atlantic Refining Co serv sta--2887 LAWTON RD (B)--South from 314 Industrial Home rd Austin Frank (c) Austin Wm (c) Fleming Jos (c) Gordon Ella (c) Johnson Geo (c) Lowe Nimrod (c) (o) Owens Wm L (c) (o) Pittman Josephine (c) Roskins Laura (c) (o) LEE (EM)--West from 258 Church 1st n of Garden 105 Vacant 106 Sapp Jas W 107 Vacant 108 Vacant 111 Murner Amos 112 Collins Chas L (o)--4288-W 115 Rice Mary F Mrs 116 Wooten Jas H (o) 117 Jarrell J Lee 119 Butts E Chas 154 Skinner Bonnie 156 Steadman Andrew J Center interseets 201 Lindsey Andrew H (c) 210 Jackson Walter (c) 218 Buckner Fannie (C) 220 Whitby Fenley (c) 224 Vacant 225 Stanford Wm H Rev (c) (o) LEE (Lynmore)--West from 4041 Houston av, 1st n of Hartley 100 (107) Bailey Andrew C-- 5433-R 101 Arnold John H--5433-M 109 Bryant Eliz Mrs 110 Gibson Oliver C (o) 111 Griggs Jesse T (o) 124 Young Zack B (o)--5433-W 126 Adams Levi B 200 Hill Robt R 201 Dorman Olivia LENOX LA--West from 7 Witkowski's la to 105 Telfair 1 Glover Mary L (c) 3 Vacant 5 Brown Lessie B (c) 1935 Macon City Directory 561 7 Felton Ella (c) 9 Williams Mattie (e) 11 Jones Jetty (c) LINDEN AV--South from C of Burton av Intersects Ga Ry, 3 east of Duncan av 510 Lawson Henry B (o) 105 (44) Bryant Louisa (c) 512 Aiken J C--3666-W LEXINGTO.\ (EM)--North from 601 Bread, 1st w of Center 119 Ruff Montroy (c) restr Astor intersects 121 Lester Rosa L (c) (o) 123 Pitts Ross (c) (o) Woolfoik intersects 202 Jones Annie L (c) (o) 210 (300) Finney Susie (c) 219 Finney Chas (c) 228 Collier Chaney (c) 319 (121) Vinson Mamie (c) 320 (720) Jones Clifford (c) 326 Roberson Wm (c) 390 (102) Hutchins Daisy (c) Hall intersects 404 (104) Stanford Maggie (c) (o) 406 (106) Godwin Cora (c) 501 Williams Henry (c) (o) 505 (192) Fults Annie (c) 508 Warren Evans (c) 509 (114) Morris John (c) 111 Washington Columbus J (c) 113 Tucker Aretha (c) 115 Mitchell Wm (c) 139 Freeman Lizzie (c) 140 Vacant 150 Vacant 154 Harris T J (c) Chestnut intersects 201 Paris Cleo E gro 205 Freeman Clifford (c) 211 Washington Margt (c) 217 Vacant 219 Dennison Emmett (c) (o) 221 McGure Minnie, (c) (o) 227 Taylor Minnie (c) Dennenberg av begins 301 Irby Carlyle A 305 Moore Eulalia (o)--6006-W Oglethorpe intersects 308 Boone Toof A--2703 312 Burch Thos E--5763-W Rembert av begins 316 Linden Apts 514 Tanner Wyander H (o)-- 4163-J 515 Leaptrot Clarence A (o)-- 2214-R 516 Bray Jas W (o)--2651-J 518 Wilson Sally B Mrs--5545 Wilson Louise (c) 522 Toole Frank L (o)--2651-M 524 Willis Harry (o) 525 Vacant 526 Willis John W--3648-W Carlisle begins 527 Rustin Chas M (o)--4588 523 Otto Julius H III--2651-R 530 Sowell Leon V (o)--2552-R 532 Hodges H Raiford--3468-J 534 Meeks Beulah L Mrs--1530-J 536 Reinefeld Wm H--1530-W 538 Winn Wm M 542 (1) Spillers Jas E (o)--6021-R 542 (2) Livingston Wm C--1530-R 546 Warren Thos N (o) 548 Kimes Albert A Apartments: LIBERTY (SM)--West from 1632 (A) Chandler Wm L--4385 1st to Telfair, 1st s of Edge- (B) Vacant wood av (C) Murphy Robt H 550 Parker Thos--4698-W Livingston av begins 550 Parker Thos 600 Stephens Pearl Sch 420 Brinson Wesley (c)--2892-J 421 Jackson McKinley (c) 422 Lewis Maggie (c) 426 Vacant 427 Simmons Green (c) 435 Green Arrie (c) 440 George Amelia (c) 444 Moorman Bernice (c) 464 Murray Louis (c) (D) Darby John J--2442-M Street continued 322 Schell Anna B Mrs (o)-- 4094-J 326 King Jas R Lawton begins 514 Hazlehurst Wm H (o) 515 Holloman Clinton--551-M 519 Hertwig Herman (o)--2708-W 520 Sumner Mattielu Mrs Log Cabin wy interesects 601 Odom Jos A (o)--4698-R 603 Silvius Chas T (o)--4698-J 607 Watson Cleon W Lamont intersects 609 Rushin W Clifford (o) 610 Hill Jos B 611 Riddle Leon G (o)--4698-M 612 Clarke Hill E--919-R 613 Bell Clinton B 919-J LINCOLN AV (V)--North 203 Douglas to Sheridan from 523 Barfield Mattie Mrs--2670-J Darby John--551-R 526 Fitts John C (o) Bell Edith Mrs beauty shop 614 Allen J Crayton (o)--1959-J 615 (719) Nolan Mark A (o)-- 138 Durham Rufus (c) 145 Jackson Geo W (c) 147 Stewart Richd C (c) (o) 149 Thomas Phyllis (c) Jones Philip (c) 150 Primus Isaac Jr (c) 151 Boynton Lucy (c) 152 Thomas Felix (c) 153 Grady Wm S (c) (o) 154 Reaves Madie (c) (o)-- 2919-W 155 Smart John (c) 156 JacksSn Dosh J (c) (o) 157 Butts Nina (c) 159 Knight Chas (c) 160 Grady Robt B' (c) (o) 162 Thomas Edgar (c) (o)-- 2919-J 173 Matthews Ernest (c) 173% Kelley Gertrude (c) (o) 174 Nims Otis (c) 175 Gilmore Annie (c) (o) 177 Wilmore Annie M (c) 178 Felts Lucille (c) 180 Williams Roosevelt (c) 190 Vacant 191 West Reno (c) 195 Sparks Wm S (c) (o) 200 Lavender Leonard (c) (o) 205 Johnson Edgar (c) (o) 208 Prater Wm (c) 209 Wright Jas F (c) 210 Thomas J Walter (c) (o) 303 (198) Crowder Theo (c) 307 Vacant 527 Darby Harry H (o)--3395 534 Walton Hattie W Mrs (o)-- 2670 As*h *en*ds Coleman av begins 601 Chichester's Tatnall Sq Drug Store--382 603-05 Tatnall Sq Dry Clng Co- 9503 607 Tatnall Sq Barber Shop 609 Vacant 617 White Jas B gro--1146 619 Macon Butter Co--5878 Montpelier av intersects 625 Vacant 626 Meadows John C (o) LOG CABIN BI.VD--A continuation of Napier av bey Bailey av 120 Sewell Mack N (o)--3666-J 122 Huthnance Annie D Mrs (o) 124 Newby Lytle R (o) plmbr-- 2146 126 Brown Chas T (o)--3357-W Richm*on*d begins Virginia begins 307 (193) Mize Walton E (o) -- 1532-R 309 (197) Brooks Paul W (o) Macon av Intersects 422 Baumgartner Chas F (o) 423 Durden Wm O (o)--2214-J 424 Dozier Eug R (o)--2214-W 3308-W 617 (1753) Slappey Mary Mrs (o) --3308-W Hill interesects 619 Clark Overton P (o)-- 3220-W 620 Hatcher Robt P (o)--3308-J 621 Utley Leroy J--3320-J Edna pi begins 703 (1795) Tom's Place confr 705 1797) Vacant 707 (1799) Green Lewellyn D gor --1216 Thomas begins 801 (1801) Meeks Clifford M gro 805 (1800) Log Cabin Ser Store gros--6126 Pratt Everett H Log Cabin dr intersects 905 (1919) Norris Chas B-- 6021-M 907 Wright Geo S (o)--5440 909 (1923) Goodrich Fredk W (o) bldg contr Hill Crest rd intersects 910 Daniel Buford N (o) Habersham Intersects 912 Smith Henry I 814 Odom Norman H 919 (1985) Bentley Jas A 921 (1989) Giles John B (o)-- 4152-J 923 Goggins Nonie B (o)--4152-W 925 (1993) Ozburn Harwell C (o) --668-J m Baldwin's and Telegraph's Del Park begins 1015 (2009) Wilson Marvin P BOG CABIN HEIGHTS--A sub- 106 Reddick Joshua (c) division w of Napier Hts 111 Reese Lizzie (c) 1017 (2011) Wilson Clay 113 Gonder Wm (c) 1103 (2013) Jarret Arth (c) (o)-- BOG CABIN WAY--North from 115 (112) Perry Jos (c) 4809-M Bog Cabin blvd, 1st w of Ba- 117 Brown John (c) 1105 (2015) Jarret Walter (c) (o) mont .118 Gilbert Mildred (c) (o) Berkner intersects 101 Yancey Raymond A 120 Smith Kate (c) 1109 Abrams Mamie (c) (o) 103 Land Ernest M 121 Howard Haynes (c) 105 McGraw Susie M Mrs 122 Jackson Cornelius (c) BOG CABIN DB--West from (1800) blk Bob Cabin blvd 800 LONG (SM)--West from to White, 1st s of Ell 2504, 2d 125 Wells Lottie (c) 129 (11) Pullens Wm (c) 150 Johnson Mamie (c) (o) 102 Meeks Clifford M (o) 23 Vacant 152 Phoenix Chas (c) (o) 103 Manning Bruce E--3330-J 137 McKinney Wm (c) 154-Clowers Ernest (c) 104 Middlebrooks H Harris-- 323 Howard Clifford (c) 158 Hooks Wm (c) (o) 5509-W 105 Parker Chas L (o)--5509-J 340 Hill Mary (c) 342 Hicks Charlotte (c) 163 Barton Carl (c) 164 Donaldson Annie (c) (o) -- 106 Patat I Prince--2651-W 344 Vacant nurse 107 Slade Gladys Mrs (o)-- 1434-W 346 Vacant 422 Vacant 165 Vacant 170 Lawrence Henry (c) 109 (107) Mathews J Northrop-- 201 Sparks Julia (c) (o) 3054-J 110 Carter John J--3610-J BONG BANE--South from Rock- 203 Turner Wm (c) (o) hill, 1st w of Orchard 204 Dago Elnora (c) (o) 114 Urquhart Julian F (o)-- 101 (222) Bailes Henry (c) -205 Griswold Bennett (c) 1434-R 103 (224) Anderson Jas (c) 208 Jackson Anna (c) 115 Griffin John H (o) 107 (171) Wilkerson Mary (c) 209 Pleas James (c) 116 White John B--2519-J Hudson intersects 211 Wood Wm (c) 118 Nobles Jas D 108 (106) Davis Mattie-L (c) 216 Robinson Alice (c) 120 Hogan Wm O 109 (104) Ames Moselle (c) 221 Lowrey Edw (c) 121 Kline Frank W--851-J 111 (103) Howard Homer (c) 222 Hopkins Leila (c) 122 Harrell Eason H 113.(100) Collins Eug (c) 223 (220) Price Mary (c) 123 Pinkerton Mattie Mrs (O) 115 (98) Newton Minnie B (c) 224 Pitts Eug (c) 124 Ross Robt W (o) 127 (79) Vacant 225 Cunningham: Pleas (c) 126 Vestal Vernod (o) 129 (77) Vacant 228 Fults Homer (c) 136 Bailey Minnie C Mrs--815-W 133 (81) Hendricks John (c) 230 Vacant 138 Hewatt Claude A 139 (85) Vacant 232 Moughon Wm (c) 144 Log Cabin Presby Ch 236 Smith Love (c) Highland Intersects BONG ST BA (SM)--South and ---- Lynwood Cem (c) 200 Hale Frances Mrs (o)-- West from Bong to White 201 Methvin Paul--3610-W 101 Collins Savannah (c) MACON AV--West from 191 Bog 202 Goforth Wm M--3118-J 112 Hodges M B (c) Cabin blvd 203 Coppock Jas 116 Walker Jas (c) 170 Welch Jas T (o)--3587-J 205 Whiting Geo 209 Vacant 182 Hunt John A (o)--3357-R 206 Turner Mamie L Mrs (o) 223 Fountain Chas (c) 207 Goodrich Richd C 209 Craps Wm M 211 Horton G Rosewall--3118-W 212 (215) Pinkerton Robt A (o)-- 2519-W 214 McCaleb Dec (o) 217 (216) Sargent Wm H (o)-- 225 Hamilton Edw (e) 228 Ivy Dennis (c) 305 Rogers Estelle (c) 373 Walker Carlton (c) 424 Kemp Alice (c) 480_Barnes Bennett (c) 505 Vacant MACON AV (EM)--East from end of Bowman, 1st n of Hall 23 Vacant 26 (205) Gross Henry (c) 30 Goodman J Wright (c) (o) 34 (318) Bryant Alice (c) (o) 6212-J 219 (218) Smith Leonard L-- 1821-R 221 (220) Lyon Wm J (o)--319-J 223 (226) Mason W Frank (o) 225 (224) Bryan J Scott--2519-R 300 (319) Getson Carrie Mrs gro --3846 307 (308) Brown Hartridge B () 308 Kitchens Andrew C (o) 311 (310) Sanders Elmer C (o)-- 998-J 312 (363) Bartlett Milton T 318 Durr Ralph N (o) 320 (423) Aiken Ira P (o) 417 (418) Eisher F Lester (o) 998-W 423 (422) Tucker John W 431 (430) Cooper O Grady drap- eries (o)--723 432 Connell Sherley E (o) 434 Keppler Louis 437 (504) Green Geo G (o) 440 Edwards Zeke (c) 443 (506) Payne Eldridge 444 Cliett Albert (c) 645 Vacant BYNMORE--A Subdivision south of South Macon bet Antioch rd & Houston av BYNMORE AV--East from 3200 Houston av to Antioch rd 100 (3400) Cornelius C Wm (c) San Juan intersects 201 Kemper Marvin 202 Etheridge Hubert C 207 Swinney Luther T 216 Durden John L--3855 Durden & Son fish 220 Embry John H--1770-J .224 Plunkett Clarence G (o)-- 1770-M Flamingo dr intersects 306 Ellis Wm S (o)--6364 308 Goodwin Lester C LYNMORE ESTATES--A Subdivision se of Bynwood & e of Houston av BYNWOOD AV (V)--North from 401 4th av (V), 1st w of Davis MADDEN AV--South from 618 ' Montpelier to Jasmine 102 Kendall Jas D (o) Kendall John B bldg contr-- 3097-W 104 Ruffner Harry (o)--2234-M 105 Shepherd Jas G (o) 106 Bragg Palmer E--6549-J 107_Bunn Wm M (o) 108 Marshall Douglas--570-J 109 Stewart Robt A (o)--2234-J 110 Deavours Wm A--1773-J 111 Mallard Wm D--6549-R 112 Smith C Fred (o)--3041-W 114 Thames Wilbur M--3041-J 115 Hearne John M (o)--6007-W! 117 Graham Edwin A (o)-- 6007-J 119 Flanders Levy J 121 Coley Perry N (o)--5915 123 Cork Chas M (o)--2234-W 130 Darity Wm T MADISON -- South from Rose Hill Cemetery to Jefferson Ter, 1st n of College Oak Ridge Cemetery 1935 Macon City Directory 563 ---- Riverside Cemetery (supt-- 338 Hill Geo (c) Smith Lavosier V 1816) 340 Curtis Bessie (c) 171 Stocks Peter C (o)--5848-J Wolff Wm Cemetery 341 Carswell Otis (c) 172 Benner Robbie T 152 Ross Mary (c) 153 (154) Flournoy Ben] (c) 342 Rozier Anna (c) 344 Mooney Jas (c) 175 McKellar Idus E (o)--3810-W 178 Bailey Geo W--3030-J 154 Vacant 346 Sampson Napoleon (c) 181 Dent J Thos (o)--2632-J 155 (156) Bailey Carrie (c) 158 Smith Annie (c) Jones St la intersects 160 Andrews Lily M (c) Jones intersects * * Gustin av begins 204 Williams Marinda (c) drs mkr (o) 205 Parker Hugh W (c) (o) 206 Little Albert (c) (o) 207 Moore Roy (c)--5249-J 209 Lowe Dovie (c) 211 Reeves Lenora (c) 212 Corbin Danl (c) (o) 213 Ray Haywood (c) , 214 Chambers Booker (c) Williams la intersects 215 Persley Thos K (c) (o)--3563 217 Cloud James (c) 222 Brown Carrie . (c) (o) 224 Stevens Chas (c) 226 Little Jesse (c) 228 Miller Andrew J (c) 230 Ellen Wesley (c) Hendricks la intersects 247 Ga Academy for the Blind (c)--1599 254 Hargrove Wm '(e) 256 King Wm (c) 258 Cornelius Henry (c) 260 McCoy Leroy (c) 261 Howard Lavercia (c) 261% Smith Moody L gro 262 Jemison Wm (c) Green begins 263 Finney Jack (c) (o) 264 Farmer Edw (c) 266 Anderson Ira (c) 269 Ragin Marie (c) (o) nurse 270 King Jas (c) 272 Vacant 274 Vacant 275 Davis Wm (c) meats 276 Brown Mary (c) 278 Vacant 280 Vacant 282 Evans Andrew (c) Woodliff intersects Boston la intersects * * * Stewart la intersects 352 Thomas Essie (c) 354 Fields Annie (c) 355 McClerry Remus (c) (o) 356 Railey John D (c) 357 Wilburn Mary (c) 358 Horne Wm H (c) 361 Stephens Deliah (c) 367 Jackson John W (c) (o)-- 1559-J 371 Colbert Joseph (c) 375 Holmes Taylor (c) 377 Wilcox Calvin I (o)--4035-W 380 Davis D (c) 382 Scott Robt (c) 383 White Grace M (c) (o) 385 Patrick Mary (c) 389 Muse Robt (c) (o) 393 Harvey Geo (c) 2d av intersects 405 Brown Henry (c) Lockhart Isaiah (c) auto mech 411 Vacant 413 Rutherford Herbert (c) 428 Vacant 430 Powell Nellie (c) 433 Baull Ollie (c) (o) 435 Trimble Clem (c) 437 Easton Sidney E (c) (o) 439 Harris Sadie (c) 441 Keating Eliz--1016-J MAGNOLIA--West from 466 Spring 104 Moseley Wm W--698-J 108 DeBorde Alice Mrs--3779-J 110 Jeter Mattie Mrs (o)-- 3161-R 114 Cosbyl Essie I Mrs--256-J 116 Walker Alice Mrs--3600 120 Hancock Oris A 121 Sconyers Mattie B Mrs 122 Williams Lester E 123 Kemper Hattie--2202-W Mullins Haws L 125 Brooks Jas L--4127 185 Glover O Clarence--5718-M Fountain Myrtle nurse 186 Popper Steve Gift Shop antiques 189 Hose Leila B Mrs (o)--5053 190 Ruark W Howell--770-R 193 Russell Alice Mrs--1830-M 198 Stubbs Jesse C--770-M Orange intersects 216 Reynolds Louise V Mrs Reynolds Nellie music tchr-- 3058-W 220 Cannon Mildred Mrs A (o) Stubbs C Kirkland--3058-R Apartments 1 Vacant 2 Hall Jack J--3058-J 3 Lewis W Hillman 4 Vacant College intersects MAGNOLIA DR--North from Milledgeville rd, 1st e of Reese 147 Sanders T"hos (c) MAGNOLIA LA--North from end of Cherry to Orange, 1st w of Georgia av 101 (10) Vacant 102 (150) Henry Wm (c) 103 (9) Vacant 104 (304) Vacant 105 (11) Vacant 107 (5) Vacant 109 (6) Grier Julia M (c) 110 (113) Jones Eliz (c) 111 (1) Vacant 112 (555) Davis Rebecca (c) 113 (16) Vacant -114 (557) Smith Wm (c) 115 (17) Vacant 116 (554) Smith Mary (c) 117 (14) Mabry Essie (c) 118 (552) Stinson Mattie (c) 119 (24) Curry Lizzie (c) 121 (25) Henry Alonza (c) 123 (202) Lockett Leonard (c) 125 (204) King Lillian (c) 129 (205)King John H (c) 131 Farrar Adeline (c) 137 Berry Fannie (c) 302 Filmore John (c) 304 Calhoun Bertha (c) 305 Vacant 306 Threatt Annie (c) 308 Mason Jos (c) 309 Everett Nash M (c) (o)-- 4170-R 310 Woodard Cecil '(c) 312 Faulk Ada (c) 315 Williams John T (c) 316 Vacant 317 Glover Josephine (c) 318 Rouse Henry (c) 320 Edwards Evan (c) 325 Culver West (c) 328 Hardwick Robbie (c) 329 Gantt Rosalie E (c) (o)-- 1825-J 330 Davis Etoy (c) 332 Cornelius Walter (c) 334 Banks Milton (c) 335 Woolfolk Grace (c) 337 Timothy John (c) gro--9452 127 Urquhart J Lewis--3161-W 130 Lane Harvey T (o)--4137-W MAIN (EM)--A continuation of 134 Jarratt W Devereaux (o)-- 5th, north bey Ocmulgee river 4074 130 Watts W Thos 137 Laster Reuben J (o)--2103 Water intersects 140 Fagan Beulah W Mrs (o)-- 200 Arnold Benj F fruits 3401 204 (203) Lloyd Geo 142 Suddath Roy V--2202 206 Kitchens Lucy Mrs 143 Carter Sami L (o)--4965-J 214 Binns Taswell 144 Bright Margt Mrs 224 Wood Robt L 146 Jones Thos G 235 Bibb Mfg Co (Plant No 1- Sanders Robt H 149 Bailey Mary J Mrs--5718-R 4661 244 W U Teleg Co (br)--1761 I 153 Hanks Lester F Rev--1830-W 246 Thompson Budrow (c) barber 156 Baker Effie H Mrs (o) 157 Sandefur John W--3810-J 246 (r) Wright James B (c) clo presser 161 Gewin Christopher C--2632-W 162 Saye Florence A Mrs (o)-- 248 Dukes John H gro 248% Wood Elmo 5718-W Elliott intersects 165 McWilliams Ellen E Mrs (o)-- 250 (208) Vacant 733-J 252 (234) Elder Willis G gro-2377 166 Jones W J--2202-R 167 Thames Lelia M Mrs--2202-J 254 (236) Bibb Shoe Shop repra9110 561 Baldwin's and Telegraph'* 256 (238), Vacant 614 Vacant 1128 Edwards Chas L (o) 262 Postal Teleg-Cable Co (br) 6416 264 Ward John W 266 Wrights Gro 266% Thomas Wm H (c) phys-- 6341 268 Handy Geo gro 268% Paul's PI confrs 270 280 Sicuretta Texas Co JTohseepsheirnve1 Mrs (o) sta--9263 280 (r) Childers John L 618 Melton Walter M 622 Neel Senie J Mrs (o) 623 Worsham Claudya F Mrs (o) --1222 624 Day Mattie L Mrs (o) 625 Lavender Mathie C 627 Massey Irvin B 628 Vacant 629 Potter Ras G Fort *Hi*ll begins MAIN --A continuation of Auburn av e of Tyrone blvd 103 Brooks J A Sch (c) 105 Brooks Maxwell (c) 107 Johnson Luke (c) 109 Ray Florence (c) (o) 111 Greer Annie L (c) 113 Gaston Eliza (c) 116 Stinsonville A M E Church (c) Flanders intersects 301 Kite Jesse 302 Gruhn Wm J gro--4381 302% Gruhn Wm J 303 Ryle J Thos--2660-J 304 Coffee Cup Cafe 306 Dixie Roll & Cot Co Inc- 2617 311 Shaw V Jack 312 Brewer Wm J barber 312% Loose-Wiles Biscuit Co-- 2376 316-18 Florida Fish & Oyster Co- 3113 317 Pittman Guy W--592-J 318% Stefano Geo (o) 320 Bridsev Flour Mills (br) 324 Wilson's gros--2132 326 Hamlin W Edw gro--5837 329 Bibb Mfg Co (whse) 330 Dime Store The variety 332 Rogers Stores--9709 336 McCrary DeWitt Drug Co Inc --196 338 Kennington's Mkt meats-- 3540 338% Balkcom A Peyton 340 Balkcom's Pharm--4317 Clinton Intersects 400-04--Scarboro Bros Serv Sta-- 4376 403 Sawyer Ice & Coal Co (br) 405 Hyatt Hady 406 Jones Robt T gro 407 Sharp Ossie 408 Gholson's Cash Gro 409 Nasworthy Jas H 410 Fort Hawkins Lodge AF&AM 411 Woodall A B 412 East Macon Ice & Coal Co Schnell av intersects 426 East Side Barber Shop (r)Slappy Loretta (c) 428 Byrd Ida M Mrs--1525-W Hydrolia intersects 431 Tanft Car Service Sta--1336 503 Anderson Sue Mrs 509 Hall Wm O 513 Stripling Emory R--4274-R 521 Thomas Barney M--5827-W 551 Vaughn Jas R--394-W 553 Holston Alice A Mrs--992-W 559 Smith Wm D (o) Cutters Green intersects Balkcom av begins MALLOY'S AL--South from 410 701 Couch & Woodall gros--666 703 Tidwell Henry S--1695 Ash, bet 3d & Broadway 5 (122) Simmons Lula (c) 704 Schaefer Minnie Mrs (o)-- 3127 708 Cranford W Lafayette (o) 709 Amason Warren R 709 Lyles Wm S 711 Kitchens Jas T 712 Williamson Thos H (o)--1433 7 (134) Bivins Primus (c) 8 Vacant 9 (132) Robinson Eddie L (c) 11 Little Nellie (c) 12 Vacant 13 (113) Burney Wm (fc) 14 (131 Carmichael Emmett (c) 713 McCullough Hulett 716 Watson Arth L 717 Morgan Georgia W Mrs (o)-- 6292-J 15 (8) Sparks Thos (c) 17 (135) Crews Jas (c) 18 (11) Ivey Lester (c) 26 (26) Leonard Fredk (c) 718 Wright Nora Mrs 721 Couch F Jerome (o) 24 (23) Davis Henry (c) 26 (21) Green Edw (c) Fairview intersects 722 Cowan Wm M (o)--3835-W 724 Woodall Henry F (o)--5992-M Maynard intersects 801 Quarterman Jas N 803 Liles Wm C gro--9324 804 Evers Roderick C (o)-- 5992-R 805 Jabo Thos (o) 807 Smallwood Thos L 811 Parker Laurie L gro--9570 813 Smith Gatsy R Mrs 815 Campbell Wm H Hoffman T Richd 818 Hollis Mayburn J 820 Etheredge Wm R 822 Vacant 823 Burns Robt B 825 Elliott Willie B Mrs 826 Blount G Wm 827 Cannon Wm E 828 Woods Mkt meats 835 Estes Emyal E (o) 837 Beck Callie Mrs 839 Jordan Ada M (c) 841 Hanks Anna (c) 843 Singleton Mary (c) Norris intersects 900 (r) Benson Wm B Hester Robt L 1001 Jackson David L gro Short intersects 1006 Glover Claude (c) 108 Dewberry Rejoiner (c) 1010 Hall Winkfield F (c) gro (o) 1012 Seabrook Jerry (c) 1014 Seabrook John (c) MAPLE--Northwest from 752 Oglethorpe to Boss Highland av ends 117 Meadows Milton H Latta pi ends 153 Mills Gro Co Cole ends 202 Ryals Andrew J (o)--695-W 204 Beall Henry W (o)--1824 252 Herndon Bradley H 258 Gunn Henry E--1444-W 261 Thomason Jas U 266 Woodruff Emma (o)--5113 267 Hutcheson John H 268 Vacant 269 McCoy Sarah Mrs 270 Doles Mittie Mrs Aurtry Mrs (o)--1409-- Park pi ends Calhoun begins 317 Vacant 318 Worthy Robt (c) 319 Clements Anthony (c) 320 Johnson Ada (c) 322 Vacant 325 Manning Wm (c) 326 Jackson James (c) 336 Evans Sarah (c) 337 McGee Ellen (c) 338 Hamlin John (c) 339 Harris Clinton 341 Stokes Jennie 357 Bragsdale Chas (c) 363 White John (c) 364 Vacant 370 Vacant 600 Chapman Wm F 1016 Dudley Geo L (c) auto repr 601 Pruett Elisha L (o) gro 1018 Calhoun Richmond (c) 602 Taylor Marcus T (o) 1020 Brown Wm E (c) 604 Liles Wm C 1022 Reid Lewis (c), 605 McConnell Thos H (o) 1024 Aaron John H (c) (o)-- 606 McConnell Willie M Mrs (o) 3254-M --1982 1024% Jackson Eli (c) 607 McConnell Willie M Mrs --2707 Jones intersects 608 Chapman John 612 Tyson LeRoy gro 1026 Chancellor Chas L gro < Broad ends 1101 Hammock Wm J gro 1108 Turner John W nurserymn-- 2259-J 1120 Scott Claude MARION AV (LYNMOBE ESTATES)--Southwest from 200 Antioch rd to Carman pi 10 Tribble John C 369 Durden Danl B 404 Howell Hubert D--5671-M 405 Smith Eric 435 Kirkwood Herman L (o) 501 Carroll Joseph S MARION PL (W Hts)--South from 412 Montpeiier av, 1st e of Oakland av 1935 Macon City Directory 565 9 George Durward F--935-W 109 Pitts Annie (c) 504 (555) Mayes Lucius (c) 14 Hurst John P (o)--3848-J 110 Powell Ella (c) 505 Battle Carrie (c) 16 Smith Mary Mrs--1425-J 111 (187) Pipkins Henry (c) 506 (524) Hill Stella (c) 17 Rett Louis E 112 Hogan Louis (c) Clarks la intersects 20 Tomlinson Wm T--3081-R 114 Simmons W Henry (c) 507 (509) Woodall Annie (c) 25 Smith Louis C 115 Strozier Emma (c) 508 (526) Bryant Wm T (c) (o) 32 Wright J Milton (o) 33 Durham C Jos--1425-M 116 Jackson Eula (c) 118 Alexander Lillian' (c) 509 510 (519) (530) FTuhlolrenrtoJnohnElHiz1 (c) (c) (o) 40 Shaw Fred L--1425-W 119 (121) Davis Lizzie (c) 511 (527) Ridley Nathan (c) 41 Yearty Emmett F--3081-W 512 (532) Lundy Chas (c) 44 Askew Newton G--5627-J MAY AV (Unionville)--South 515 (529) Grant Addie (c) 49 Daniel Emory A--1425-R from nr 930 Montpelier av, 2d w 516 (537) Freeman Will (c) (o) 56 Chew Wm H--3844-J of Pio Nono 517 (531) Haddock Rachel (c) 57 McGriff Leon G--5627-W 100 Hawkins Henrietta (c) 519 (535) Butler Ella (c) 101 Callaway Handy C (c) Hall intersects MARSHALL AV (C Hts--(North 102 Harpe Lewis (c) 613 Jones Mary (c) from 2013 Vineville av to Ridge 104 Harvey Malissa (c) 614 (540) Smith Jas (c) av, 2 west of Park av 105 Waller Nelson (c) 615 Robinson Lola M (c) 101 Brown Leon D (o) 102 Bailey Marvin Z--6282-M 106 Slocum Wm (c) 108 Wisdom Milton (c) 616 618 SGwreeeenneSyimFan(cn)ie1 (c) 103 Carlisle Alex O 109 Parker Jas (c) 619 Evans Robt (c) 104 Johnson Jos E 110 Davis Hollis (c) 622 Clowers Mack (c) 111 Calhoun Isaac (c) MARTHA (EM)--Northwest from 112 Rutland Geo (c) Mitchell intersects 701 Chillers Walker (C) 120 Powell 113 Smith Eliz (c) (o) 707 (800) Gray Lewis (c) 450 Brooks Obie (c) 114 Vacant 708 (558) Bivins Louis (c) 451 Green Asa (c) 156 Battle Robt (c) (o) 709 (800) Mitchell Giles (c) 452 Card Floyd (c) soft drinks 157 Ryan Mary (c) 710 (75) DeShazar Alice, (c) E 2d intersects 159 Myers Oscar (c) 712 Sharpe Edw (c) 501 Clowers Randolph D (c) 161 Davis Ellis (c) 714 Thomas Irene (c) 503 Clowers Randolph D (c) gro 162 Johnson Rosa (c) 716 (800) Virgil Wm (c) 505 (504) Mathis Dock (c) 164 (604) Vacant Taylor intersects 506 Ward Mary (c) (o) 165 Gibson Jas (c) 800 (139) Turner Eva (c) 507 (509) Evans Gussie (c) 167 (606) Johnson Wm (c) 801 (810) DeShazar Wm (c) (o) 508 (505) Wimberly Dessau (c) 169 (163) Bradshaw Julia (c) (o) 804 Fultz Bernard (c) 509 Finney John D (c) 806 Richardson Squire (c) (o) 510 Bimbley Isabelle (c) MAYNARD (EM)--North from 804 813 (875) Bowman Wm (c) 512 Pierson Frank (c) Main, 1st e of Fort Hill 815 Childs H Walter (c) 514 Stephens Henry (c) (o) 517 Vacant 547 Gordon Frank (c) MARY (Artope Hts)--South from 1236 College 171 Fuss Leroy (o)--1543-W 103 Couch Edw L 105 Woodall Ashby T 133 Byrd Robt T--5992-J 134 (131) Boothe I Newton Willingham intersects 217 Hall Talmage W 218 Glover L Ruth Mrs 863 Eason Reynolds (c) Williams intersects 900 (881) Davis Robt (c) 901 (950) Open Air School 902 (882) Glawson Jesse (c) 903 (88) Ford Clisby (c) (o) 904 (883) Crawford Edw (C) MASON (SM)--South from 602 Colquitt 102 Fox Benj (c) (o) 110 Slocumb Annie (c) Charles intersects 220 Myers Paul 220 (219) Shepard Wm A 222 Atwell Jas W--1818-M 225 (51) Patterson Jos A (o) Pettigrew John 229 (52) Leslie Homer L (o)-- McCLAIN LA--West from 728 Pine to Hemlock, bet New and 1st 321 Walker Anderson (c) 328 Edmonson Arth (c) 201 (7)i Ringwood Lucius (c) (o) Crisp intersects 401 Millirons Marshall (c) 403 Mason Wm (c) , 405 Dobbins Dock H (c) 1818-W 231 (53) Sanders Geo T 256 (56) Mixon Benj F (o)-- 520-W Broad intersects McDonald AV (V)--North from Rogers av to Corbin av, 1st o of Clayton 106 Sharpe Jas P (o) 407 Jones Mary (c) 401 Hunt John (c) (o) McGEE--Northwest from 2015 402 (504) Benford Thos L (c) MASONIC HOME RD--North and 403 Curtis Hugh Vineville av to Ridge, 1st e of Riley west from nr 515 Boulevard thru 403 (344) Sharpe Henry J (c) (o) 103 Herrington Herbert C Shirley Hills 404 (506) Carswell Jos (c) 105 Crambes Peter S (o)--2525-J 225 Duffy Robt G (o)--3565-M 405 (346) Gordon Lula (c) 107 Jobson Arth B (o) 254 Ingham Ralph E (o)--4560-W 406 (508) Pitts Andrew J (c) 281 Newton Linton S 407 Hunt Wm M (c) (o) McKAYS AL--South from 553 Ash, 285 Patton T Emory (o) 408 (510) Wiggins Ned (c) (o) bet 2d & 3d 287 James T Cleveland--4560-J 409 Coley Wallace (c) 125 Vacant 291 Roberts Wm G (o)--405 410 Purnell Thos (c) 127 Vacant 309 Sparks Willis B jr--229 411 (352) Durham Junior (c) 129 Garland Benj (c) 356 Knight Earle Mrs (o)-- 412 (514) Williams Wm (c) 131 Kelly Rose (c) 3565-W 413 (354) Pitts John N (c) 133 Tillman Benj (c) 358 Deshausher Geo (c) (o) ' 414 (516) Reid Isaac (c) soft drinks MAY--East from Pio Nono av, 2d 415 (356) Jackson Sami (c) MELROSE (B)--North from Bellevue rd to C of Oa Ry, 1st e s of Montpelier 416 (700) Wimberly Alex (c) of American blvd 105 Dubose Matthew (c) (o) Cowan intersects 25 Wilder Eldred (o) 106 Webb Julius (c) 501 Early Sallie (c) 26 Caldwell Jas L (oj 107 Ross Elijah E (c) (o) 502 (520) McCall Robt (c) barber 28 Schrimshire Georgia Mrs 108 Ross Brigie W (c) 503 (507) Benford Elnora (c) (o) 32 Vacant Baldwin's and Telegraph's 33 Vacant 34 Durden Wiley 35 Vacant 36 Vacant 37 Vacant 37% Vacant 525 Grant Annie P (c) 526 Williams Lizzie (c) 527 Butts Walton (c) 529 Lewis Dolly (c) 534 Nelson Lizzie (c) 536 Davis Arizona (c) 349 Daniels Simon (c) (o) 375 Smith Wm (c) (o) 379 Franks Carrie (c) 381 Porter Robt (c) 383 Grant Geo (c) 38 NeSmith Evelyn Mrs 40 George Clifford 100 (190) Pritchett Walter H-- 2253-J Fairmont av intersects E 2d intersects 619 Vacant 621 Butts Danl (c) 622 Dennis Ulyses (c) (o) Academy intersects MIDDLE LA (EM)--North from 114 Elliott 113 Thompson Bessie M (c) 120 (402) Thomas Alex (c) 200 Pendley Waymon E 212 Grimsley Geo f 217 Vacant | 307 Hendley Jos C (o) | 308 Lundy Melvin | 309 Sim3 Mary Mrs (o) l 312 (313) Durden Benj W (o) | 315 Drake Wm f 317 Crump Jas I 319 Sisk Harry L I 321 Walden Wiley W I MELROSE (EM)--North and south from 251 Broad, 1st w of | Clinton | 385 Martin Claudia (c) I 386 Kizzie Rufus (c) 1 387 Mack John (c) I 388 (381) Walker Dessau (c) 6 390 (380) Mitchell John (c) | 392 (378) Davis Walter (c) | 394 (376) Wilburn Sidney (c) (o) Broad intersects 412 (265) Miles Moses J (c) f 415 (260) Williams Frank (c) ^MELVIN PL (Lynmore Est)-- 1| mell from Marion av to Tram- 100 Vacant 102 Clark John B sMERCER (B)--North from AtlanItic av, 1st e of Grand av 202 Haralson Jesse C 302 Marshall Henry C (o) dairy- 1269 323 (24) Bartlett Robt L f 325 Johnson Leymon MERCER TER--Southwest fr( 613 Adams 98 Smalley W Talmadge-- 1158-W 100 Condon Wm F (o) 102 Mansfield John A--1809-J MERRITT AV (I)-East frc 1201 Ridge av 623 Weathers Fred (c) (o) MIDDLE (V)--North from 203 Hardeman av, 1st n of Monroe 110 Maynard Alice (c) drsmkr 112 Robinson Jean M (c) 114 Dillard Estelle (c) 115 Parham Alonzo J (c) shoe repr 117 Vacant 119 Coleman Andrew F (c) 121 Randall Dora (c) 129 Robinson Anna (c) cafe (o) 131 Robinson Anna (c) 135 Donaldson Jesse (c) 136 Carswell Mattie (c) 140 (141) Brown Nancy (c) 143 Culpepper Mary (c) 145 Hope Edw (c) (o) 146 Bailey Mamie (c) 148 Shannon Leila (c) 150 Sanford Lee (c) 152 (154) Ivey Edw (c) 153 White Mary E (c) 154 Wade Clara (c) 155 McCombs Lovely (c) (o) 156 Williams Pearl (c) 158 Dempsey John T (c) (o) 159 Ross Bros (c) gros--9595 1st av intersects 206 Vacant 208 Holmes Mariah (c) 209 McCoy Simon (c) (o) 210 Starks Hattie (c) 211 Stokes Erma (c) 212 (216) Walker Cornelia (c) (o) 214 Williams Leila (c) 215 Spivey Claude (c) 221 McWhorter Edw (c) (o) 225 Walker Arth (c) 233 Campbell John (c) (o) 235 Berg Joseph (c) gro 235% Walker Daisy G (c) (o) 237 Vacant 238 Daniel Mary (c) 240 Wilson Lizzie (c) 242 Benton Lois (c) (o)--3133-W 254 Finsley Jos (c) (o) MIKADO AV--South from 103 Grady, 1st e of Houston av 202 Dix Lee A (o)--2265-M 203 Denson Leila (o) 204 Arnold Rufus J--2265-J 205 Lyon Mamie M Mrs (o)-- 2975-J 208 Woods Wm N--2975-XW 209 Boland Jas W (o) 210 Mikado Baptist Ch 211 Boland Andrew D Fulton intersects 300 Harper Aaron D (o) Harper Nora B Mrs nurse 301 Shinholser J Granniss (o) 303 Hutchings Virgil R (o)-- 749-J 304 Thomas Auburn R 305 Grace Chas B (o) 307 Vacant 308 Tharpe Lee H (o)--2507-W 309 King Geo H 311 Grant Wm R (o)--2975-M 406 Youmans Obie B (o) Troup intersects 408 Huff Gertrude P--2973-R 412 Rawlings T* Arth 414 Johnston Wm F 415 Bankston Geo D (o) 116 Davis Lonnie J (o) 418 Gordon Felton J (o) 420 Durden Leon F (o)--2608-W 424 Durden Alsey F (o)--2608-J 425 Clarke Harry H Davis intersects 501 Hunnicutt J Frank 504 Campbell Harvey L contr (o) --4394-R 505 Ennis Clifford L 506 Mills Junius P (o)--'704-J 509 Stokes Zora P (o)--39-J Burke intersects 601 Coleman Thos M 602 Dorough Augustus B Rev-- 704-M 603 Brewer James W 605 Broome Aileen Mrs (o) 620 (520) Pierce N Allen 122 Jenkins Elbert--1673-J 124 Hall L Emmett (o)--6579 126 Berliner Harold (o) 128 Rehfeld Frank W (o)-- 1673-M 129 Simmons Jas M--1610 131 Fisher Guy L--2789 MDDLE (EM)--East from 3 Burnett 255 Vinson Walter (c) 256 Hill Lela (c) (o) 257 Whipple Jas (c) 2d av intersects 300 Davis Alex (c) 309 Johnson Rosa (c) (o) ; 310 McEvoy Wm (c) (o) 315 Kendricks Chas L (c) (o) 316 Vacant 319 Collins Thos (c)--3123-J Chatham intersects 702 Harrell Sandy B (o) 704 Hughens Wm 706 Osborne Lee 711 Griggers Robt A (o) 801 Norton Cleveland 803 Keth Carl A (o) 805 McCowen Richd B (o) 807 Bloodworth H Otis (o) 809 Lawrence Homer 437 Ashley Hettie (c) 439 (448) Williams Henry (c) Middle la intersects 445 (505) Lewis S L (c) 447 (707) Courtney Annie M I Edison intersects 520 Jordan Luther (c) 522 (509) Hollis Primrose 035 Macon City Directory 320 Walker Danl (c) (o) 321 Carter Roscoe (c) barber 325 Ephraim Sophie (c) 333 Gibson Ella L (c) (o) 336 Pate Joseph (c) 338 Walker Booker (c) 340 George Edgar (c) 342 Mims Danl (c) 344 Brown Alonzo (c) gros MILL--South from Roff Home av to Lawton, 1st w of Holt av 1 (75) Greenway Robt L 2 (76) Greenway Lois L 3 (74) |Copeland Jas F 1 4 (77) Foxworth John F 5 (73) DeFore Gostin P E 6 (78) King Jas R 567 7 (72) Graham Henry A MITCHELL (EM)--East front n 132 Dezurn Roosevelt (c) 7 (79) Searbary Otis T end Lexington, 1st n of Hall 133 Pearson Martin (c) 9 (71) Williams Ralph J 3 Wilson Willie L (o) 134 Brown Ulysses (c) 10 (80) Carter Chas B 5 Wells Marie (c) (o) 11 (TO) Morgan Wm K 102 Clowers Jefferson C (o) MONROE (V)--South from Wood, 12 (81) Griffis Jas F 103 (2) Vacant cliff to C of Ga Ry, 1st n of 13 (69) Williams Alice Mrs 104 (3) Williams Geo (c) Madison 14 (82) Adams Wesley 106 (104) Lockett Mary (c) 307 Greer Annie (c) 15 (68) Williams Oscar 107 Hill Jas (c) 309 Stokes James (c) 16 (83) Long Carrol E Center intersects 311 Lash Hattie (c) 17 (67) Harfes Sami R 108 Clowers Alonzo (c) 312 Bruggs Mattie (c) 18 (84) Land Green B 110 (109) Person Ulysses (c) 314 Bonner Annie M (c) 19 (66) Wright Annie Mrs 112 Wilson Otis (c) (o) 316 (318) Gilmore Lillie (c) 20 (85) Cranford Isaac H 133 (136) Morris Jas (c) 318 (316) Brown Annie (c) 21 (65) | Godfrey Luke D 135 Haynes Alex (c) 320 (314) Hunter Osceola (c) 22 (86) King Jas M Chesney intersects 322 (312) Brown Anna (c) 23 (64) Dykes Julia 202 Hunter Wm (c) 324 Fulton Mary (c) 24 (87) Stephens Geo C 204 Williams Domingle (c) 325 Mathis Wm L (c) gro--9233 25 (63) Creamer Gertrude Mrs 206 (242) Rockmore Geo jr (c) 326 Henderson Sara (c) 26 (88) Dennis Maggie Mrs 240 Solomon Lula (c) (o) 327 Wilson E Mae (c) 28 (89) Bartlett Chas W 243 TVrus Andrew H (c) (o) 328 Stevens John (c) 30 (90) Bragg Joel R 246 Stallworth Caesar (c) 329 Watson Leonard D (c) shot Womack intersects repr--9431 MILL AV--West from 3501 Hous- 353 (352) Murphy Mary L (c) 332 Ivey Henry (c) ton av 402 (401) Pitts Wm (c) 333 Hollomon Annie (c) 101 Wheeler John R 102 Willingham Maybell Mrs (o) 103 West Geo E 104 Everidge Jas T--3984-R 105 Wade Walter H (o) 106 McDaniel J Thos (o) 110 Pickering Geo A (o)--2992-J 111 Jones Allen B (o) 113 (215) Baldwin Jos B 117 Arnold John T--2992-M: 120 Valentine Robt L (o) 132 Patterson Archie O (o)-- 2992-M 149 Lester Jas W (o) 150 Johnson Marion W 155 Tracy Mattie Mrs (o) End Harris Chas A (o)--2984-W 404 (403) Card Andrew (c) 406 (405) Card Boysie (c) 408 (407) Jones Annie B (c) Mitchell la intersects 442 Pounds David (c) 452 (25) Randall Annie B (c) 453 Miller Press M (e) 456 (455) Vinson Miley (c) 498 (28) Lowe Randall (c) (o) gro Fort Hill intersects 503 (152) Vacant , Smith intersects 541 (141) Solomon Hattie (c) 543 (215) Stephens Wm B (c) 545 (203) Roberson Noah (c) (o) 547 (144) Wright Frank (c) Maynard intersects 335 Watson Sara (c) 336 Shipman Louis H gro 337 Winters Thos (c) Stewart la intersects 339 Holt Silas (c) 341 Kinchen Fannie (c) 348-52 Hill Viola (c) restr 354 Lee Louise (c) 356 Bailey Sarah (c) 363 Mathis Wm L (c) (o) 367 Allen Irving (c) 368 Griswold Florine (c) (o) H?r 369 Brown Clara (c) 370 Sanders Clara (c) (o) 371 Love Cleo (c) (o) 372 Grier Wm (c) 374 Didley Sami (c) (o) 377 Piercy Sophia E (c) MILLEDGEVILLE RD (EM)--A continuation of Main bey limits 602 Grey Lewis (c) 606 Smith John (c\ (o) Ballard ends 378 (384) Spencer Lula (c) (o) 379 Brooks Ida (c) 380 Walker Mary L (c) (o) 1132 Tidwell Annie T Mrs (o) 1136 Nipper Robt K Magnolia dr intersects 1137 Melton Alf W (o) 1138 Bell Wm B (o)--3201-M 1139 Baker Jas gro 1140 Walters Frank E 1141 Rooks Chas T 1142 Mixon Ellis T (o) 1143 Martin Wm A serv sta Little Namon K 608 Stephens Jas L (c) MITCHELL AL--South from 452 Elm, bet 3d & Broadway 402 Stinson Archie (c) 403 Tolbert Fletcher (c) 404 Vacant 406 Harty John (c) 408 Smith Henry (c) 410 (22) Bryant Lula (c) 412 Griggs Lizzie (c) 383 Elliott Mattie C (c) (o) 385 Jones L Alf (c) tailor 387 Jones Carlton (c) Green al intersects * * * 2d av intersects 403 Hicks Robt (c) 407 Miller Mary M (c) (o) 408 Butler Mamie (c) 410 Perkins Emma (c) 412 Allen Alonzo (c) 1144 Baker Jas (o)--5392-W 1145 Cox John (o)--5369 1146 (1) Baker Clarence E (o) Ard Tully C (o)--6535-W 1148 Log Cabin Sinclair Sta--9374 (2) Summers Chas E (o)-- MITCHELL 1 LA (EM)--North from 407 Mitchell 1 Vacant 2 Carter Edw (c) 3 (103) Jones Edw (c) 413 Samuel John B (c) 414 Dobbs Letha (c) 415 Cleveland David (c) 416 Rivers Clara (c) 417 Kyles Jas G (c) 418 Stewart Maude (c) 6535-R 4 Chapman Minnie (c) 419 Hudson Industrial Sch (c) 1150 Stripling Robt G (o)--3201-R 1150% Stripling Robt G Jr (o) 1151 Sharp Geo B MITCHELL LA (V)--South from 475 Douglas av 421 McCrary Geo D gro 424 Bostic Emma (c) 428 Dennis Mollie (c) 1152 Martin Ira L (o)--1575-M 131 Sweet Carrie (c) 432 Manson Chas (c) 1154 Baldwin Amie Mrs 218 Wright Carrie (c) 436 Jones Henry (c) 1156 Kitchens John C fill sta 220 Davis Emma (c) 440 First Congregational Ch 1157 Bryant Elijah 231 Howard Wm (c) Jefferson intersects 1161 Reeves Chester R gro 453 Brown John (c) (r) Horne Jos E MOCCASIN SLIDE--South from 455 Brooks Mary (c) 1165 Brown Marvin M--5392-J 5th, bet Walnut & Ocmulgee 467 Barksdale Byron B--4384-J 1190 Kitchens Jas W (o) gro-- 114 Jordan Magnolia Fulwood Lucy nurse 5392-M 115 Johnson Isaiah 475 Graddy Louis F--1620-J 1194 Wilson Moses P (o)--2461-J 116 Ingram Wm (c) Holmes Mamie Mrs (o) Royster F S Guano Co--865 130 Johnson Rebecca (c) Georgia av intersects 568 Baldwin's and Telegraph Cor, Macon City Fire Dept Pump Co No 2 Truck Co No 2 122 Rogers Inc gros--9704 Johnson* av* in*tersects 708 McCallum Chas L 711 Almond Aubra A (o)--2653 716 Burch Frank N (o)--2098-M Pump Co No 4 Washington av intersects Bell av begins 200 Melton W R gro--4037 724 Abel Alma R Mrs (o)--3856 732 Miller Sallie Mrs.--4352-J 505 McCary Robt (c) 202 Murray Marion V 739 Balcolm Albert F (o)-- 509 Spivey Milton (c) (o) 509 (r) Hooks Fannie (c) 515 Rogers Claude S (c) (o) 518 Curtis Anne (c) 519 Webb Emily (c) 520 Watkins Henry (c) 522 Smith Relliford S Dr (c) (o) --5946 203 Thurston John A 204 Asbell Edw B 206 Parker Wm L (o)--4448-W 208 Robinson Thos W--5267-J Filsinger Harry E 255 Jones Rosa L Mrs Carling av intersects 301 King H L--2193-J 3360-J 740 Hensley Jno H 741 Vacant 748 Aaron Ralph S (o) 749 Odom Athol E--1533-J 756 Kidd Jas H 757 Odom Wm W (o)--5311-J 764 Bradley Jos D jr 523 Hutchings Frank J (c) (o) 314 Amoco Serv Sta 765 Rittenberry Lizzie 624 Thomas Robt T jr (o) 316 Vacant Kimbrew Emmett V 528 Johnson Jos E 600 Linden av to beginning ol . rj Columbus rd 99 Thtnall Square Ser Sta-- 9281 101 Standard Oil Co ser sta 102 Vacant 103 Burnette Wm D 104 Freeman Minnie G 105 Vacant 106 Tharpe Wm H 108 Holloway Jas C (o)--2788 110 Alpha Lambda Tau Frater- nity lllGreat A & P Tea Co The groi 112 Pope Geo R 114 Seventh Day Adventist Ch 115 (109) Drew Thos H (o)-- 5619-W Cheney Julius P 120 Vacant 420 Moore Cary B Frazier Luther F 421 Hancock Clarence H (o)-- 3919-M 501 Gober's Serv Sta--4501 505 Jo Jo's confr 515 Miller A L High Sch 516 Hi-Lo Gro--2516 Long Burnett A Allen Ira O (o) 520 First Ch of the Nazarene Virginia av intersects 526 Cheney John J (o)--4320-W 528 Amason G Ross (o)--4320-R Hicks al begins 600 Meaders Purlonia Mrs (o)-- 6106 604 Irby Wm O (o)-4320-J 605 Harris Oscar L (o)--357-J 606 Wilder Mary F Mrs (o)-- 2445-J Willis John W 607 Tidwell Romer T (o)-- 2445-W 608 Beck Jack I--4301-R Ninadel dr begins 610 Johnson Noah W 612 Leavitt Bessie (o)--2304-J Owen C Robt 614 Lamb Chas F 618 Moseley Guy L--6549-M Madden av begins 924 Vacant 926 Brown Wm M 930 (870) Callaway Henry (c) (o) --2776-M 931 Sanders Abron (c) 932 1872) McKinney Edw R 933 Andrews Mattie Mrs gro 934 Gibson Thos (c) restr 935 Maxwell Dock (c) 937 Webb Ada L (c) (o)--265-J 938 (892) Exch Store The gro-- 1361 Reynolds Susie C 939 Woodson Lula (o) 940 (502) Wawfork Laura (c) (o) 941 Penn Lucinda (c) 943 Moseley Albert (c) 944 (510) Young Clarence T--9616 Barfield Lester L 945 Hopkins Geo 946 (935) Carswell Vera I 947 Cox Thos E (o)--4833-W 948-52 Vacant 954 (937) Wynn Jas E 956 (939) Temple Gus (c) 960 (1003) Stone Sami W (c) (o) 962 (1007) Chapman Eng J (c) 964 (101(1)) Conner Danl N (c) 966 Morgan Cain A (c) (o)-- 5612-J 968 Mace Wm A (c) (o) 1935 Macon City Directory 569 970 Tharpe Louise Mrs 972 Chapman Leonard 974 Klein Louise (o)--4374 976 Riley Otho R gro--9614 976 (2) Calhoun Edw 978 Bruce Jno H--4036-J 978 (2) Berkner Wm P 979 Maynard Lbr & Sup Co 980 (975) Grace A Dewey (o) 981 Bob's Barbeque Pit 982 (977) Hatcher E Cornelius 983 Clark Ernest (c) 984 (979) Taylor Sami L (o) 985 (975) Gates Thos G (c) 986 Sims Oliver (c)--237-R 987 (978) Gates Thos G (c) gro 988 Johnson Arthurlee (c) 989 Causey Steph W serv sta-- 9132 990 Green Chas A gro 991-93 Knight Jas H gro & lunch 216 (556) Jackson Irene (c) 217 (857) Johnson Dora (c) 219 (280) Wilder Abr (c) 222 (559) Vacant 223 (285) Aveline Bap Ch (c) 224 (552) Vacant 225 (101) Vacant 226 (175) Vacant 228 (174) Vacant 229 (113) Huff Marshall (c) 230 (122) Graham Sarah (c) 231 (112) Rozier Andrew (c) 232 (121%) Vacant 233 (111) Vacant 234 (223) Hart Jeannette (c) 235 (110) Farmer Anna (c) 236 (221) Johnson Sara (c) 239 (131) Hicks Mary (c) 241 (226) Hutchings Martha (c) 243 (226%) Rutley Caleb (c) MULBERRY--West from 8th to Spring, bet Walnut & Cherry Cor, Cropper R C Co agrl implts5466 7th intersects 101 Brown Peter (c) 105 Cunningham Lela (c) 107 Hogan David (c) 108 Vacant 109 Vacant 111 Hopkins Katie (c) Gas House la intersects 113 Martin Carrie (c) 115 Macon Gas Co (plant) 6th int*ersects C of Ga Ry intersects * * 5th intersects 301 Millican Fred fl serv sta-- rm 992 Slocum Wesley (c) 994 Calhoun Ernest (c) (o) 996 Calhoun Early (c) (o) 998 Boone Wm (c) 1001 Berkner Jos H MORGAN (U)--East from 1st av, 1st s of Montpelier av 100 Hightower Griffin (c) (o) 101 Williams Emmett (c) 104 Hart Hattie (c) (o) 9305 305 Swift Wm O confr--9237 307 Schall Paint Co--326 309 Vacant 311 Vacant 315 Hotel Macon--4600 1005 Davis Benj F gro--1344 1007 Hutto's' Garage 1009 Johnson John C (o) 1011 Newson Henry 1021 Clay Clarence H MORGAN AV--West from Edgewood, 1st s of Winship 221 White Jos (c) (o)--953 227 Taylor Edw (c) 233 Davis Perry (c) 321 Dure & Beeks Co ins--556 Dure Leon S Co investments Hotel Macon Co Realty Investment Co Broadway intersects 400-02 Cozy Corner Cafe--1731 MOORE (SM)--East from 333 San Juan 4 Houser Beulah Mrs--451 6 Goodwin Wm R (o)--5238 MOORE AL--North from 425 New 239 Williams Maggie (c) 243 Dorsey Otis (c) 249 Vacant 287 Anderson Della Mrs 291 CriS|well Roy Mercer Univ Stadium to Spring & e from 103 Washington av to Cherry Oakland av ends 304 Waters Wm L 1 Wilson Lucile (c) 313 Thames Thos J--1916-J 2 Vacant 317 Cheves Wm H 3 Vacant 388 Hardeman John W 8-9 Vacant 397 Stephens Mark R 11 Rhone Annie (c) 398 Raby Wm P 12-15 Vacant 430 NeSmith W Oscar 24 Bivins Arth (c) 150 Davis Amanda (c) 151 Walker Frank (c) 152 Brown Ethel M (c) 153 Jones Simon (c) 154 Thomas Tempie L (c) 172 Bivins Walter (c) 305 Brooks Edw (c) 413 Davis Emma (c) 760 Aaron Mattie (c) 770 Jones Priscilla (c) MORRIS (B)--South from 206 Industrial Home rd 101 Anderson Geo R (c) gro 103 Anderson Geo R (c) 105 Vacant 111 Howard Walter (c) 113 Maddox Nathan (c) (o) 114 Smith Mary (c) 120 Howard Louise (c) 772 Walker Fannie (c) 773 Davis Danl (c) MOUGHON (V)--North from 509 3d (V), 1st n of Linwood 402% Frat Order of Knights of Am--3827 403-05 Stroberg Body & Fender Wks--3051 404 Miraglia Edw gro 404% Deep Sami 406 Glasco's Barber Shop 407 Smitty's Battery Serv 408-10 Huhn C & Son hdwe-- I 1275 409 Cassidy's Garage, reprs-- 9600 413 Drive It Yourself--2951 414 Mulberry Market meats-- f 4181 414% Davis Walter E watch repr a 415-19 Chapman's Garage--2951 416 Blue Front Lunch Rm 418-20 Cameriero M Frances Mrs 1 gro--750 Cameriero Louis meats 422 Royal Peanut Co confr 422% Doe John 452 Rogers Stores gros--3316 452% Martin Jas M furn rms-- 1 6089-J 456 Great A & P Tea Co gros- 1 MOORE AV--West from Rock av, 1st s of Dempsey av 500 Rountree Bessie (c) 501 Cuyler Rebecca (c) 503 (500) Parham Alonzo (c) 505 Mathis Mary L (c) 507 Vacant 122 Pitts Walter (c) (o) 130 Smith Jos (c) 132 (128) Jordan John H (c) 134 Brantley Isaac C (c) (o) 4th intersects 201 Vacant 203 Newton Felton (c) 9611 456% Burnell Fred 458 Piggly Wiggly Stores--4618 460 Peacock Allie M Mrs 462-64 Birdsey Flour Mills (br) I gros 466 McCommon Bros (br) dry gds I 466% Vacant MOORE LA--West from 153 New to Spring 202 (72) Vacant 204 (17) Vacant 206 (543) Lester Henry (c) 207 (545) Anderson Isaiah (c) 209 (116) Vacant 210 (555) Williams Wm (c) 211 (115) Fanning Grady (c) 215 (858) Pitts Clarence (c) 210 Bailey Jacob B (c) (o) 211 Cobb Wm (c) 220 (227) Battle Lucy (c) 221 Martin Annie (c) (o) 233 Vacant 224 Smith Bertha (c) 225 Dennis Everett D (c) (o) 227 (211) Burney J C (c) Eason Thos (c) 228 Proctor Eliz (c) (o) 229 Gibbs Caesar (c) 470 Spiller's Restr--9246 Cor Federal Building Post Office--830 County Agr Agt--6316 County Home Demstr Agt 6316 U S Army Organized Reserve 1 --1831 U S Army Recruiting Ofc U S Comr U S Dept of Agr--6316 570 Baldwin's and Telegraph's I U S Dept of Labor--274 401-04 Park & Strozier lawyers-- 811-12 Golsan Willard R jr phys U S List Atty--603 3667 1266 U S Dist Court--5481 Smith J Lundie lawyer---3667 813 Blossom Geo L mfrs agt-- U S Dist Court Clk--274 Currie Brainerd lawyer--3668 6471 U S Int Rev Agt--571 406-08 Baldwin Cecil A lawyer- 817 Bazemore Wallace L phys-- U S Int Rev Coir--5397 811 4947 U S Marshal--6411 Scarborough Richd F lawyer 818-20 Hall John I phys--2116 U S Navy Reo Sta--3276 --811 Wasden Chas N phys--2116 U S Post Office Inspr Plunkett Robt G lawyer-- Phillips A Maynard phys-- U S Probation Officer--4777 1646 2116 U S Referee in Bankruptcy- 409- 901-05 Vacant 1 497 ham lawyers--1147 906 Felder Thos S lawyer--4026 U S Weather Bur--821 410- 907 Vacant 1 3d intersects 369 908 Stukes Joseph T dentist--21 501-09 Stewart Oil Co serv sta-- 411 Atkinson Mallory C lawyer-- 909 Vacant 4116 369 910-11 New Hampshire Fire Iiis 502 Jacob's Phar--1271 412-13 Ga Nat Guard 121st Infty Co--725 504 Davis F Clark phys--2700 Hdqtrs Granite State Fire Ins Co- Rex Optical Co Ga Nat Guard Instrs 725 606 Bruce Terminix Co extermi- 414 Vacant 913 Snelling J Palmer-C S Pract nators--2261 Smith L C typewriter agcy-- 415 Fowler Benj J lawyer--886 417 Fountain James A phys--6121 136 | ! 914-18 Harris, Russell, Popper & 2261 418-20 Walker Chas H phys--3387 Weaver lawyers--4861 608 Hatcher & McCrary Inc ins-- 6186 Co-operative Fire Ins Co of King Jas L phys--2341 501-02 DeFore & Estes lawyers-- 919-20 Murphy Robt H dentist1371 1086 1001 Fire Co'iS Adjustment Bur State of Ga Mut Ins Agcy Macon Ins Agcy Hatcher, Turpin & Hogan Inc ins & real est Georgia Underwriters Inc 610 Fickling Hotel--9365 611 Brown-Kline Sign Co--1781 512 Poplar Cafe--9511 514 American Restr--9323 516-22 Georgia Casualty Building Rooms S 101 Dessau Realty Ins Co--271 102 Ga Casualty Sandwich Shop --3172 103 Sheridan Leo D paints--3171 Alliance Corp The 104-05 Levie Otis H broker--1300 108-10 Am Optical Co--3832 111 Ga Mtr Finance Co--5371 201-03 Davis Ins Agcy--23 204 Kansas City Life Ins Co- 5661 205 Nash Chas E real est--108 206-07 Chandler & Strickland Co ins--426 208 Dick Thornton A chiro--1491 209 Vacant 210 Schofield Ins Agcy Inc--1541 Lewis Julian S ins--1541 212-13 Vacant 215-17 Gilmore A Ellison jr law- yer--4806 Long Oscar L lawyer--4807 Casson R Habenicht lawyer-- 4806 218-19 Vacant 220 Macon Trading & Investment Co--293 301-06 Prudential Ins Co of Am-- 2111 307 Vacant 308 Conaway Paul M lawyer- 1711 Sanders Wm H lawyer--1711 309 Vacant 310-13 Cotton States Fertilizer Co--4987 314-15 Christian Scienc Reading Rm 3527 316-19 Vacant 320 Bell Hallie B lawyer--1817 Adams V Jas lawyer 503 Vacant 504-10 Met Life Ins Co--797 511-13 Penn Mut Life Ins Co farm loans--2721 514 Macon Cred Bur--881 515-17 Johnson Walter T lawyer --5816 Moore Lloyd D lawyer 518-19 Vacant 520 Meriwether Wm W phys-- 1946 601-05 Cork & Cork lawyers--1 606 Respess E Roy dentist--4817 607 Vacant 608 Jenkins Wm A dentist--3246 609-11 Siegel Alvin E phys--2662 612 Bartlett Chas L lawyer 613 New England Mut Life Ins Co--1950 614-18 Hall & Bloch lawyers--391 Napier J Hamilton lawyer 619 Hall Chas H--1626 620 Odom Realty & Ins Co--1456 701-04--Childs Wyatt B ortho- dontist--4341 705-06--Nat Life Ins & Accident Ins Co of Nashville Tenn --4046 708 Jelks Albert A osteopath-- 1177 709 Boswell W Chas phys--561 710-11 Rawls Lewis L phys--1217 712 O'Neal B P Jr & Co bonds-- 1418 713 Vacant 714 Vacant 715 Suarez Raymond phys--1231 Swilling Evelyn phys 716 77 Grice &; Grice lawyers--837 7181226 719phys--457 801-02 Selden John A phys--627 803-04 Jordan John R dentist--436 805-07 Adams Irby H phys--1072 Newton Ralph G phys--496 Richardson Rhea W phys-- 496 808-09 Southwestern R R Co--34 810 Porch Leon D phys--4907 Inc--3336 1002 Valentine E Henry dentist- 2726 Brown Carl H dentist--3216 1005 Gates Paul G dentist--5797 1006-20 Jones, Johnston, Russell & Sparks lawyers--96 Street continued 517 Kell Alex shoe repr--4006 519 Spivey Harry A (c) tailor- 981 Lee Sam ldry 519% Socks Sami 523 Vacant 525 Hotel Lanier Hotel Lanier Cafe Hotel Lanier News Stand 549 Sparks Specialty Co 552 Am Printing Co--3286 553 Syracuse Sami fruits 554 Lyles Benj F restr--9122 554% JohnSon Clebie Mrs mus tchr Jones Lucille Mrs mus tchr 556 Dennis & Dennis archts--962 Macon Dental Depot labty-- 971 Holmes Wm B dentist--971 557 Davis J LaFayette real est --476 Davis & Birch ins--476 558 Palace Barber Shop Bishop John T clo clnr 559 Pittman M C Roofing Co-- 1783 Hainline John L int dec--2646 559% Vacant 560-62 McClure ofc Equip Co--903 Lyon Harris & Brooks print- ers--876 561 Sou Paint &1 Varnish Co-- 563 2276 Hardeman G 2 G Co real est-- 1963 563% Letter Shop Inc The--4521 564 Macon Typewriter & Office Sup Co--1087 Dewberry Effie ins--1087 Atlantic Refractories Co Inc brk mfrs--283 565 Williams Luther & Son pri- vate bk--1586 1935 Macon City Directory 671 565% -67 GAB Sch of Com- 311-12 Daly Jos K cert pub accnt 3 Herman Emma M Mrs-- merce--621 --1796 2048-J 566 Washington Building 316-16 Vacant 4 Herman Jerome--2048-W Rooms: 401 Vacant 5 Franklin Josey 1 Hancock John M lawyer--1837 402 Vacant 6 Marsden Alice Mrs--2125-R Sanders Wm L loans--1837 403 Rubin Sami N phys--3700 7 Cagle Guy N--2935-W English Norman E lawyer-- 404-05 Am Nat Ins Co--2917 8 Peterson Thelma--3209-J 1837 2 Churchwell Daisy L lawyer-- 406-07 Sigman John M phys--4286 Robarts Wm G ins Street continued 814 Pitts Mortuary--146 1007 408 Vacant 817 Wallace Robt E--975-J Gillon O Grady lawyer--2616 409-12 Equitable Life Assurance Beebe Eliz drsmkr 3-4 Lewis Arth lawyer--2681 Soc of U S--4305 821 Barnes Avey Mrs furn rms-- Daly Augustin lawyer--2681 413-16 Hall Thos H phys--4216 2249 Horne Eug lawyer--2681 501 -03 Vacant 854 Burke Leila G Mrs--1449 5 Vacant 502 Peninsular Life Ins Co-- 855 Katherine Court Apartments 6 Martin Wm E lawyer 504-05 Carolina Life Ins Co--1036 Apartments: Hirsch Emile I lawyer 506-07 Vacant 100 Slade Jos W--3224-J 7 Vacant 508-10 Life Ins Co of Va--1380 101 Harrison Alf M 8 McClellan Wm A jr lawyer-- 511-12 Wallace & Wallace law- 102 Kalish David M 939 yers--2431 103 Vacant West Wm W lawyer--939 513 Macon Academy Mus Co-- 104 Vacant 9-10 Vacant g 1966 105 Boger Wm K ( 11 Vacant Bldg Ofc 106 Reilly Henrietta G Mrs 12 Grace Walter J lawyer--2762 514 Vacant 107 Payne Ethel Mrs--2474-W 13 Vacant 601 McCowen Richd B lawyer-- 200 McKay Henry M Jr--594-W 14 Fausett J Albert--1732 1657 201 Kimbel Kenneth--1469-M Jacobs Thos A jr--1732 602-05 Morgan & Morgan Ins 202 Vacant 15 Burnett J Phelman lawyer- -A-gcy--1811 203 Kelly Arth R 5826 606 Charis Corp corsets--6466 204 Etheridge Jas P--209-W 29 Macon Vocational Sch--3626 607 League Ellamae Mrs archt-- 205 Hawkins Ralph 3d fl Kaigler's Business College- 2346 207 Johnson Wm--2712-R 3517 608-10 Interstate Life & Accident 300 Elkan Eli (o)--209-J Street continued Co--1623 301 Kessler Max H--2104-J 568 Grenone's Barber & Beauty 611-13 Schuster M Richd dentist 302 Bass Irene L Mrs--209-R Shop--9628 569 Holt A T Co real est--946 --847 614 Grinalds Arch S lbr buyer-- 303 Wilkinson Frank L--895 305 Fried Hattie K Mrs--3651 Irby Bros Inc plmbrs--4571 4966 400 Kuhr Edith Mrs 571 Atlantic Refining Co serv sta 7th fir Vacant Kuhr Dorothy elocution tchr -4697 Street continued 401 Daniel Tillie K 572 Andrews Magruder locksmth 619 Vacant 402 Earnest Carlisle--594-M --9370 652 Yoman Dance Studio 403 Vacant 572-A Kitchen's Kitchen restr 654 Smith's Battery & Elec Co 404 Rubin Sami N--2115 574 Chapman's Pharm--1860 --5126 405 Vacant 2d intersects 658 Vacant Street continued Court House (side ent) 660 First Presbyterian Ch--2025 856 Roberson Kate M Mrs (o)-- 610 Crockett Roy W loans & real 663 Hotel Arcadia--9593 588 est--2141 667-73 Firestone Auto Sup & Serv 860 Taylor Fannie Mrs furn rms j Newton & Newton ofc Stores serv sta--116 --3209-W 610-20 Salvation Army Building 1st intersects 864 Terrace Apartments 612 Salvation Army Young Peo- 710 Masonic Temple Apartments: ples Chapel 716 Vigal Mar^e Mrs (o)--889-W 1A Cottrau John D--3095-W 613 Jones Malcolm jr radios--731 717 Mulberry St M E Ch (South) 1B-E Taylor Fannie Mrs bdg- j 615 Remington Rand Inc typewriters--1241 --4566 South Ga Conference Bd of 1728 IF Gordon Jack A 616 Salvation Army The--2326 Christian Education--4246 2A Rawls Lewis L--6366 617 Grand Building The 718 Gans Floy B Mrs--889-J ' 2B Kelly Jas H--1417 Rooms: 720 Graham Wm W--3847-J 2C Jackson Albert--679 201 Vacant 722 Beard Carl L--949-W 2D Thornton Wm B--3095-J 203-05 Chapman H D & Co whol Carey Aurie nurse 2E Elliott Russell H--5167-M lbr--2476 753 Childs Jas R--3251-J 2F Murray J Milton--5239 Reid H M & Co who lbr-- 756 Wood Thos J 2G Vacant 2476 757 Fleming Wm P (o)--864 3A Barry Arth P--4892-M 206 Lamar Walter D ofc--1169 759 Chambless C Eug 3B Voight Andrew W--4913 207 Com Casualty Ins Co 761 Edwards B Felton 3C Spitz Chas A 208 Dove Wm B phys--930 765 DuBose Jas H (o)--5260 3D Mailey Christie C--190-W Joanis Wm C dentist 768- King J McDuffie--3064 3E Brooks Gordon V--255 210-212 New York Life Ins Co-- 769 Branan Jos J (o)--3419 3F Weinstein Sami S--2570-W 316T 774 Mobley Walter E (o)--1714 3G Ethridge Robt A--2080 213-14 Vacant 215 Vacant New intersects 4A White Geo F--145 4B Williams Jas B 301-04 Vacant 305 Vacant 801 Grand Lodge Bldg F & A M 802 Bigby Frances Mrs (o)-- 22T0-M 4C Vacant 4D Mitchell Nan--1668 4E Miller Wm W--1443 306-08 Penn Mut Life Ins Co-- 804 Mercer Edw B (o)--2655 4F Conner Wm M--3524 887 810 Block Apartments 4G Kaplan Ira--502-J Paine Guy E ins--887 Apartments: 5A Scarborough Ernest L-- 309-10 Progressive Life Ins Co-- 1 Block Aleck (o)--484 4004-J 1537 2 Jordan John R--2172 5B Senft H P--4892-J 572 Baldwin's and Telegraph's gP*. 11 -Jin.li.m 5C Lilly Juanita Pat 230 (133) Davis Edith F (c) 502 Goldgar Bernard (o)--5096 5D Oliphant Fred G--5167-XJ 231 (212) Lowe Cora Lou (c) 503 Langston Mabel Mrs (o) 5E Mayfield Isham A--190-J 505 Adams Louis D--3457-J 5F Snook Russell A--502-R MYRTLE (EM)-West from 111 506 Keen Osee F Dr--1932 5G Vacant Balkcom av, 1st s of Main 507 Morgan Mary E Mrs (o) Street continued 105 (11) Peavy Wm F 511 Birch Ada Mrs (o>--2272-W 865 Fuller Chas H 108 (5) Lawless John I 513 Odom Sherman E (o)--2603-J Turner Jas--1018-R 114 (9) Branch Gordon 514 Merritt B Frank (o)--3509-J 866 Watson Mattie Mrs--1969-W 115 (6) Jones Taylor M 515 Snyder Louis N (o)--210 867 Wright Margt Mrs (o)-- 119 (7) Ezell Jas 516 Blair Madge R Mrs (o)--71 4898-J 123 (8) Wood Obie L 517 Allen Walter G--1845-J 869 Caldwell Lewis J--3934-J Jones av intersects 518 Johnson Chas W (o)--3740-W 868 Crawley Chas E (o)--3340 869 Caldwell Lewis J--3934-J 869% Webb Jesse T* 871 Bennett Eloise R Mrs--1023 Stancile Hoyle T 200 (101) Hawthorne Jas R 210 (99) Cooper Bertha Mrs gro --9472 NAPIER AV--West from Cole- Patterson intersects 600 Kinney W Oscar--1050 601 Elkins Henry W (o)--1159-W 659 Roush Kate M Mrs (o)--5368 660 Truesdel B Rhett (o)--3740-R 875 Starr J Henry (o)--4619-J 877 Martin J Oscar--4619-W 879 King A Rawson--1661-J man av to limits 105 Smith Chas M (o)--1725-W 106 Chappie Wm E (o)--309-W 107 Hamrick Horace C (o) 662 Benson Frank C (o)--2076 663 Hubbel Geo W (o)--5338 664 Stripling Pinkney W (o)-- 2639-J IS MULBERRY LA--(See 7th bet Walnut and Mulberry) MURRAY AL--North from Broadway, 1st w of Pine Buster Btlg Co--5061 4 Scott Wm (c) 5 Hughes Emma (c) 5% Richardson Jas (c) 6 Hunt Johnson (c) 7 Scott Bertha (c) 8 Wilson Rosa (c) 9 Brown Geneva (c) 12 Holster Carrie (c) 88 Lee Finkey (c) 724 Gilbert Julia (c) 802 Morgan Lula (c) 802 (2) Barron Wm (c) MUTUAL AV (V)--West from 66 Forest, 2d n of Douglas 100 Foster Richd F (c) 101 Holt Adam (c) 102 Williams Rufus (c) 106 Redding Elijah (c) (o) 107 (119) Zeigler Wm (c) 109 (128) Threatt Clark (c) (o) 111 Fambro Dinah (c) (o) 122 Stroud Jas O (c) Penn av intersects 200 Vacant 201 Douglas Vinson B (c) (o) 5394-R 203 Wilson Phoebe 204 Vacant 205 (123) Hicks Louella (c) 207 (121) Reid Ruffin (c) 209 Felts Wm B (c) 210 Meadows Wm M (c) (o) 211 Patrick Robt G (c) (o) 212 Galoway Horace (c) 214 Irvin Wm (c) Howard Martha (c) 215 (303) Lockett Arth (c) (o) 216 (314) Patrick Henrietta L (c) 217 Lamar Sami (c) 218 Wimbush Hattie (c) 219 (224) Smith Fletcher C (c) (o) 220 McNair Georgia (c) (o) 1908-J 222 Hill Wm Z (c) 223 (221) Evans Nathl (c) 225 (216) Williams Henry (c) 226 (223) Hilley Wm (c) 227 Foster Claude (c) 228 Vacant 108 Joiner Bennett A--4589-W 109 Williams Annie G Mrs (o)-- 5748-J 110 Slocumb Howell E 111 Anderscen Jennie Mrs (o)-- 5152-W 113 Chappie Alf B serv sta 114 Domingos Robt B--4235-J 116 Smith Lena (o) 122 Vandiver Eliza Mrs (o)-- 2256-J 124 Coe Myron A (o)--5184-J 126 Lamb Henry S (o)--5184-R 128 Johnston T Allen (o)--1921-W 129 Davis Nell Mrs (o)--4109-J 130 Martin P Webster (o)-- 1921-R 131 Fry Dave G 134 Williams Horace G--1788-R 135 Miller Arth A--5663-R Holt av Intersects 200 Early Paul K--4218-J 202 Vacant 204 Hardeman Robt U--2196 206 Vacant 208 Few Mark C Blackburn intersects 301-07 Naperian The 301 Gostin E Lamar--3067 303 Burney Linda A Mrs 305 Rau Harry L 306 Vacant 307 Williams Jeff L--2410-W 311 Bishop F Jos (o)--1075 312 Stephens Robt L 318 Taylor Mattie E Mrs (o) 324 Yancey Chas B 330 Ellis Oscar L (o)--3014-M 336 Walker Lewis A (o)--2515 Hendley av intersects 401 Davis Ethel A Mrs (o) 6335-J 403 Strozier J Searcy (o)--2423-J 404 Minton Mack B--3014-R 405 Gaillard W Palmer--2674 406 Cary Jesse H (o)--125-W 407 Stansbury Dale F--2423-M 410 Chapman Carl F (o)--1404-W 412 McBride John E (o)--2528 414 Pattillo Wm A (o)--3660-J 461 Hoskins Roy B--2272-J 463 Ryle Jas G 465 Chambers Jas J (o)--3457-W 467 Allen Amos B (o)--4002-J Birch intersects 500 Moore Ernest L (o)--5110 501 Birch John N--2348-M 666 Hodges Ralph T--2450 668 Odom Chas A (o)--2639-W 670 Cherokee Hts M E Ch 685 Clark John B (o)--2128-J Pio Nono av intersects 701 Benford Carter G Mrs (o)-- 2128-M 702 Martin Haidee (0) mus tchr --4927-J 704 Hodges Chas T--4131 705 Sigman John M Dr (o)--969 706 Harris David C Jr--5404-J 708 Walker Horace D--3407-J 710 Tanner Stanley K (o)--6306 711 Shepherd Louis A 332 Lee Wm G (o)--10 421 Cole May S Mrs (o)--231 A 367 (334) Shoats Maria (c) "i i 3"77-J \ <- t - $76 Anderson Wm T (o) Baldwin's and Telegraph Holmes Pearl L Mrs OAK AV (I)--North from 2302 Belmont av Intersects Johnson R Fleming (o)--2610 Forsyth rd, 1st e of Tyrone blvd 201 Brady Estelle Mrs (o)--1095 j ---- Masonic Home of Ga--1021 102 Smith Edw W Jr (o) --1332 205 Young James S (o)--912-W I McKenzie Emmett G (o)-- 104 Booker Chas J (o)--2964 210 Vacant j 6155 105 Vaughn Herschel J (o)-- 247 King Homer J Porter John A (o)--2324 1719-J King Benj H I Shirley Hill Club Jaques Sami R (o)--870 109 Higgison Theo W (o) 111 Gabriel Fredk B--2918-W 249 Harper Hansel L (o) 251 Bartlett Walter L 252 McDaniel Harmon C |[ NUSSBALM (SM)--South from nr OAK CLIFF RD (SH)--North 253 Terry Ida I 853 Edgewood av to Plant from Nottingham dr, 1st n of 255 Phillips A Lionel 108 Thomas Mattie (c) 109 (728) Neville Ashley (c) 110 (772) Mallory Sami (c) 111 (726) Clayton Wm (c) 112 Vacant 113 (728) Vacant 114 Davis Martha (c) 116 (778) Danielly Emma (c) 120 (780) Waller Sol (c) 122 (782) Knight Daisy (c) 123 (730) Vacant 124 (784) Canady Roosevelt (c) 125 (732) Lucas Chas (c) (o) 126 (786) Ard Wm F gro--9169 127 (229) Randall Bradley (c) 129 (725) Vacant Prince Intersects (153) Reynolds Peyton (c) (157) Greer Robt (c) (159) Toomer John (c) (121) Bason Emma (c) (301) Mitchell Frank (c) (203) Dumas Thos (c) (o) Elizabeth intersects 147 (210) Holt Fannie (c)-- 6075-J 149 (214) Wilson Hollie (c) 151 (216) Finney Jos (c) 153 (218) Johnson General (c) 155 (408) Jones Warren (c) 157 (313) Williams Henry (c) Jackson Spring rd Winship Intersects 154 Elkan Stanley A (o)--1369 267 Jones Wm E gro Block Herbert (o)--464 268 Payne Robt L Sparks Augustus O B (o)-- 271 Shepard V Neal 1009 Webb Jas T Jr (o)--2827 OCMTJLGEE--West from 7th, 1st s of river OAK HAVEN AV--South from 103 Bernd G Co (whse)--1624 816 Vineville av 6th intersects 114 Alwood Wm E (o)--2812-J Cor Stewart Oil Co (whse) 117 Hall Thos H (o)--905 118 McClamrock earner B-- DeFore R Emmett--5809-J 201 Driskell Hattie 2509-J 203 Frazier Robt (c) 119 Beeks Walter H (o)--3928 207 Ford Richd (c) 123 Murray E Bobo--1431 209 Vacant 124 Solomon Steve M Jr (o)--4595 211 Curtis Morris B Delaware av Intersects 213 Johnson Della (c) 201 Vacant 203 Smith Mattie Mrs (o)-- 5th intersects 345 Turner's Bldg Sup Co 5949-W Broadway intersects 205 Taylor Martha R Mrs (o) 454 Vacant 5949-M 458 Vacant 206 Cone E Albert--3583 3d intersects 207 Walters Cecil W--899-R 516 Peterson Vivian 209 Lewis Bernard M (o)--899-W 520 Iverson Alice B Mrs (o) 234 Hunt Thos B 522 Arnold Benj F English Intersects * * .* 548 Harrell Celia Mrs--1080-J 552 Vacant C of Ga Ry intersects 556 McCoy Walter R 300 Atlantic Cotton Mills Inc-- 2d intersects 197 614 McNeill Edw B 159 (345) Phillips Eunice (c) 161 (347) Taylor Granwell (c) gro Henrietta Intersects 164 (400) Little Rock Bapt Ch (c) 165 (317) Walker Frank (c) 167 (319) Toomer Mary (c) 168 (136) James Earlie (c) 169 (321) Barrett Benj (c)-- 3644-a 174 (415) Freeman Carl (c) 175 (323) Griswold David (c) 176 (416) Davis Lillie (c) 181 (325) Arnett Annie (c) OAKLAND AV--South from 415 Montpelier av, 1st e of Jenny av 101 (98) Wheeler Cath Mrs (o)-- 2805-W 103 (100) Wheeler Jas W Jr (o) 125 Connell Wm G--714-W 127 Hutchings Herbert H 131 Taylor Rufus H 133 Jones phas W (o)--4478-W 135 (133a) Briggs Harry (o)-- 4478-J 137 (135) Parker Wm R (o)-- 4460-R 139 (137) Barfield Andrew J-- Academy begins 615 Riverside Arena dancing 619 Macon Little Theatre ' 1st intersects 702 Jones Thos (c) 704 Little Thos (c) 725 Purofoy Jos (c) 727 Johnson Jas (c) 729 Burden Oscar (c) 731, Glover Wm (c) 752 Edmond Oscar (c) 754 Hall Jas (c) 756 Jackson Walter 758 Andrews Jas (c) 766 Jackson Danl (c) 4460-M 141 (139) Baughcum Elisha J 152 Dickson Curtis (o)--2860-J 154 Freeman John S (o)--5020-J 156 Howell Orbin D--4460-J 158 Bailey Thos P--4460-W 160 (101) Fincher Ira D (o) 162 (132) Newberry Columbus M 768 Mitchell Janie (c) 770 Clark Walter (c) New intersects 803 Cleveland Minnie (c) 805 Brooks Julia (c) 807 Fleming Beatrice (c) (o) 810 Walls Sami (c) 811 Washington Mary (c) (o) 3156-J 812 Goddard Willie M (c) 166 (136) Milligan Robt J 168 (138) Wolf Abr 813 Ford Arth (c) 814 Gilham Eula (c) 170 (140) Brown John F (o)-- 815 Cummings Lizzie (c) 6257 Jasamlne av Intersects 190 Burroughs Asa B--3959-J 819 Davis Jos B (c) 820 Harris Louis (c) 852 Hicks Thos W (c) 191 Gilbert Frank I (o)--456-J 192 Smith Albert C--912-J 853 Carswell Jas (c) 854 Odom Albert (c) 197 Cheek Aldine L (o)--1245-J 855 Stevens Cleveland (c) Macon City Directory 577 857 May Thos (c) 858 Jackson Clarence E (c) (o) 5460-J 859 Griffin Edgar (c) 861 Phelps Jerry (c) 862 Middlebrooks Jas O (c) (o) 863 Wilcher Sami (c) 865 Benn John (c) 867 Hutchings Danl (c) 869 Gordon Jas (c) Spring intersects 908 Tillman Jas R (c) 909 Askew Corinne (c) 910 Sallette Jesse (c) 911 Vacant 912 Vacant 913 Ridley Reuben (c) 915 Thomas Sanford (c) (o) 916 Wright Dora (c) 920 Porter Fredk (c) 921 Dennis Jos (c) 952 Clemons Sol C (c) (0)--670 953 Lewis Lee A (c) Fowler Sophronia (c) drsmkr 959 Mattricks ..Sallie (c) 959 (r) Collins Laurie (c) 962 Harris Nancy (c) 963 Thomas Susie (c) 964 Melvin Ernest (c) 966 Smith Wm (c) 967 Simmons Wesley (c) 968 Fuller Thos D (c) 970 Vacant 974 Vacant Franklin Intersects Cor Ga Power Co (sub sta) 1012 McGee Geo (c) clo prsr 1014 McRae Victoria (c) 1016 Walker Jas (c) 1018 Chambliss Walter F (c) 1020 Hawes Jas (c) 1021 Curtis Mamie (c) 1022 Simmons Luther (c) 1024 Ga Power Co (garage)--4100 1058 Ricks John (c) 1060 McNabb Ruth (c) 1062 Valentine John (c) 1066 Solomon Louis (c) 1068 Street Carrie (c) Hill intersects 1100 Vacant 1102 Dunn Leon (c) (o) 1130 Little Fannie (c) 1160 Calloway John (c) 325 Central Bedding Co--527 Macon Mattress Co Broadway intersects 770 Couey Lizzie Mrs Jackson intersects 902 Spear Josie Mrs 414 Brown Wm (c) 906 Bateman Albert G--2484-J 416 Ross M Summerford (c) Bateman Terrel M Arch begins 430 Middle Ga Pro Mkt--9117 910 Webster Sarah L Mrs Mills Thos W 438 Shadburn John D auto top mkr 440 Oetter Elec & Welding Co3576 444 Vacant 446 Odom Variety Wks furn reprs--9653 448 Vacant 3d intersects 500 Crawford Clarence E prod 512 Hardy Rufus E 915 Fair John T 916 Linder Ferrell H 918 951 Marshall Cleo (901) Mansfield G Willis S gro-- 9268 uyrntio Vy t_y Lie 954 Jones Kenneth E 957 Mt Olive Bap Ch (c) 959 Brown Clement (c) 962 Stanley Maggie Mrs--5309-W 963 Holland Jos (c) 965 Evans Thos W (c) (o) 513 Tomlinson Paper Box Co-- 966 Green James O 4936 970 Abel Sidney W gro--3743 514 Chitfy Leo E 970% Early Annie Mrs 515-19 Williams F W Furn Exch 971 Grant Fredk E 516 Bartlett Mary L Mrs Calhoun intersects 518 Davis Gilbert--4333-M 1002 McCreary Wm T gro--5160 520 (552) Byars Geo W 1004 Elliott Mattie Mrs 521 Vacant 1005 Sires May D Mrs (o)-- 524 (5b2) Asbell Horace B-- 4461-W 1042-M 1009 Adkins John (c) 525 Self Lawrence S (o)--1042-W 1010 Vacant 553 Snow John O 1011 Johnson Daisy (c) 555 Jones Jas J 1012 Pope Mary Mrs 557 Adkins Jos C 559 Clark Wm E 560 Fulford Herman 570 Word Frank H 2d intersects 608 Vacant 612 Linch E Irdell (o)--2758-W 615 Askew F Reid--5920-W 616 Smith J Monroe 619 Clarke Dora Mrs 623 Mercer James H White Eva L Mrs 625 Sutton Sidney W hair tonic mfr 1015 Davis Oscar (c) 1016 Durden Ruby Mrs 1017 Vinson Wm (c) 1018 Burke Martha (c) 1019 Hogan Glover (c) 1020 Curtis Wm N 1021 Robinson Ida M (c) 1052 Vacant 1053 Vacant 1056 Tipton Wm L 1057 Wilder Lula 1062 Davidson Sophia Mrs 1064 Tucker Claudie Mrs 1068 Chanin Eva Mrs (o)--5309-J i 1072 Chanin Eva Mrs gro 630 Gardner Murray R--4878 Ross intersects 635 Ivey-Turner Ice Cream Co-- 1100 Hamburg Louise Mrs fruits 1211 1105 Hunnicutt James T 649 Hogan Sarah (c) 1106 Hamburg Emmett M 653 Peeples Sarah (c) ,1109 Harvey Jack L 655 Carlisle Mattie (c) Prince Sylvania' (o) 688 Bibb Mfg Co No 2 Clinic 1114 Leverett Cullen C--1183 1st intersects 1116 Hawkins Wm M--1451-J 701 Bibb Mfg Co No 2 Auditorium 1120 Sinclair Lena M Mrs 1162 Anderson Dock (c) 1164 Lattimore Dooley (c) 716-18 Whatley B Jewett 1123 Vacant 720-22 Wommack Jamie R--936-J Shamrock intersects OCMULGEE LA--North from 953 Ocmulgee (nr car barns) 105 (921) Parker Annie M (c) 106 (953) Bell Simon (c) 107 (956) Taylor Sicey (c) 108 (953) Hughes Robt L (c) 110 (954) Dennis Thos (c) 112 (955) Lawson Jos (c) 114 (957) Ford Augustus (c) 116 (536) Emory Thos J (c) 724-26 Vacant. 728-30 Nicholson Ida Mrs 732-34 Bennett Jesse G 736-38 Vaughn Wm J 740-42 Tanner Ruth 744 Lamb Harvey B 746 Chastain Geo S 748 Vacant 750 Powell Chas M Highland av ends * * 1157 Lowe Jas E (c) (o) 1159 Browder Jos (c) 1160 Ivey Rufus L--5747 1162 Zemlich Karl V (o) 1163 Carter Annie (c) (o)--2542-K If 1164 Ward Theodosia J Mrs-- 112-M Van Landingham Clyde II- 1451-M 1166 FlorosGustavus (o) 1171 Hart Alex J (c) (o) College intersects OGLETHORPE--West from 1000 (estimated) 5th to Linden av 306 Ga Roofing & Sup Co--3121 Rock Wool Insulating Co So Floor & Insulating Co 320 Kenny C D Co whol coffee-- 1936 m. Maple begins 752 Langford Leroy 754 Lane Walter B 756 Kinley Chas T 758 McCoy, Green S 760 Baker Geo 762 Miller Henry E 764 Haygood Choice S--4461-J 1219 Abney Guyton G (o)--515-W | 1223 Jemison Jeannette P Mrs- 3421-R Tatnall intersects 1309 Oglethorpe Private Infirmary --2400 Evans Archie P phys Fountain Jas A phys 578 Baldwin's and Telegraph'* Hall Thoa H phys 117 West Mary (c) nurse 378 Wagner Fannie L Mrs-- Keen O F phys 140 Vacant 2160-W Rozar A Robt phys 1321 Oglethorpe Private Infirmary Nurses Home 1357 Neel Roland H (o)--819 1363 Swain Henry Rev--1109 Adams Intersects 1401 Jones Fredk L--3656-J 1403 Porch Leon D Dr (o)--1422 1405 Steger Frank B (o)--3913 1407 Jones J Blount (o)--5112-M 1409 Keel Wm A--2978 1416 Jackson Eloise Mrs (o)-- 5112-R 1420 Chapman Merle E--3146-W 1424 Martin Louisa Mrs O'HARA LA--South from Edge- wood av, 1st n of Broadway 206 Britton Hattie (c) 422 Walker Zannie (c) 431 Verner John (c) 432 Granville Ezekiel 434 Butler Matt (c) 436 Vacant 438 Peters Minnie (C) 440 Vacant 442 Waters Eliz (c) 446 Rhone Edmond (c) 502 Harris Argo (c) 504 McGee Chas (c) 506 Anderson Chas (c) 508 Fowler Joseph (c) OLIVE (EM)--East from 210 Clinton, 1st s of Maian 350 Dennis Allen --3547 OLIVER AV (LCHts)--North from 103 Hill Crest rd 101 Dennis Adelle J Mrs (o)-- 2747-J 107 Toole Kath Mrs (o)--2747-W OLIVER AV (SM)--East from 2480 Broadway, 1st n of Central av 71 (130) James Alex (c) 72 Hawkins Ernest (c) 73 (102) Lawson Dennis (c) 74 Waters Marvin B (c) 75 Calhoun John (c) 76 (175) Collins Della (c) 77 (174) Brown Jas (c) 78 (176) Lawson Geo (c) ORANGE--South from 111 Jones to Cotton av, thence southeast to 1st Rose Hill Cemetery 200 Barnes Jas B gro 205 Harris Lewis A (c) 207 Branham Percy (c) 211 Stone Dicy (c) 217 Pound Isaac (c) Ocmulgee intersects 220 Ingram Jessie (c) 221 Allen Maggie (c) 222 Johnson Carrie (c) 223 Anderson Geo (c) (o) 225 McCormack Lillie (c) (o) 226 Brown Randall (c) 227 Clark Nathan (c) 229 Holmes John (c)--1841 230 Holland James (c) 231 Carroll Chas (c) (o)--4415-M 232 Smith Lilia (c) 234 Powell Robt (c) 236 Powell Chas (c) 240 Mason Robt M (c) Orange St la intersects 252 McClellan Wm A Jr (0) 255 Johnson Wm F 257 Gilman Thos H--5914-J 258 Hubbard Senie M Mrs (o)-- 1017-R 259 Pell Sami B 260 Vacant 261 Vacant 267 Cannady Clarence M 271 Richards Geo M--2175-W 275 Stubbs Peter W (o) Lowrey Jas A Jr--2175-M Walnut ends 280 Johnson Berner R--1033-R 280% Mason Newell--2175-R Greater Foster Adv Serv novelties 281 Brown Oscar E (o)--4300-W 284 Codington Eug B--1017-W )285 Nixon Gena H Mrs--*2420-J 288 Davis Aurie S Mrs (o)-- 2459-J 297 Shiver Wm H--2585-J Bond Intersects 304 Flowers Arth J (o)--1472 307 Burr Geo (o)--2420-W 313 Gaddy Maggie Mrs--2420-M Strickland Arth G--2420-R 317 Hendricks Annie Mrs--1047-M Renfroe Lucille nurse 379 Swint Columbus R (o)--974-J 380 Vacant 385 Daly Jas J--6514-W 389 Goepp Rudolph (o)--2047 Goepp Helen mus tchr 393 Flowers Albert T--4010 Georgia av intersects 456 Oliver Annie H Mrs--3015-J 460 Stinnett Wm S (o) 463 Holmes Minnie Mrs (o)-- 1015 464 Southwell Marvin L--3820-W 465 Eubanks Fannie Mrs--4527 470 Donovan Wm--1815-J 471 Pate Sami G--2584-W 473 Kennedy J Vernon--5813 474 Apartments 1 Brantley W Irwin--3775-W 2 Brown Maynard W--1815-R 3 Heck Myrtle 4 Tharp Chas B Street continued 475 Washington Apts Apartments: 1 Ryals Wm E--3775-J 2 Powell Geo H--1815-W 3 Ware H Percy--3544-J 4 Morris Homer M--3820-R 5 Sanders Aubrey D 6 Closson C E--2584-R Street continued 480 McCrary Geo D--2584-J 482 Vacant 483 Alexander Myrtle R Mrs (o) --1370-J 484 Fitts Wm M (o)--2584-M 486 Poythress John M Bayne Sami E--1815-M 489 Slocumb T Hugh 494 Hamilton Anna E Mrs (o)-- 5415-W Jones Marion M mus tchr Magno*lia int*ersects Washington av intersects 506 Walker Robt L mus tchr 510 Faulk Wm--1005-M Durden Jas 514 Taylor Bessie nurse--1201 Houser Mary A Mrs 516 Parrish Julia A Mrs (o)-- 3997 Cotton Linda nurse O'NEAL'S AL--South from 717 Main, 1st e of Balkcom av 318 Hardwick D Frank 320 Ross Claude F Mrs (o)-- 519 Bd of Education Garage-- 5637 103 (42) Martin Mary (c) 105 (2) Vacant 107 Green Robt (c) 109 Glawson Beatrice (c) 111 (3) Johnson Amelia (c) 113 (4) Bland Henry (c) 142 Anderson Sallie M (c) 2160-J 520 Colonial Apts 321 Sparks Jos R--2414-W Apartments: McDuffie Ella nurse 1 Ogden Fannie T Mrs--359 322 Dupriest Hiram H--1460-W 2 Glover Eliz V H Mrs mus 350 Cork Chas D S (o)--687 355 Payne Wm S Jr (o)--6192 tchr--888-J 3 Dure Leon S--499 359 McCowen Clarence D (o)-- High ends 891 533-47 Nevarro Apts OPERA HOUSE AL--East from 1st to 2d, bet Walnut and Mulberry 6 Brown Annie M (c) 6 Vacant 7 Vacant 11 Stanley Jas (c) 14 Mark Herbert (c) 101 (1) Terrell Annie (c) 115 Robertson Wesley (c) 116 Jones Henry (c) 359% Coggins J Wilbur--724-W Apartments: 360 Murphey Willard M--2569 Dent Quinton H 1 Chambers Fredk E--282-W 2 McRae Mitchell E 361 Gilmore A Ellison Jr--3045-J 364 Blount Eugenia W Mrs (o)-- 3 Renfroe Arth J 4 Baker Arth M--5451 4438 369 Mills John A (o)--1391-W 371 Dasher John 'JJ--3612 Coburn Anna Mrs--5385 5 Ramsey Rosa J Mrs--2163-J 6 Perkins Eunice--483 372 Lee Danl I (o)--6454-J 374 Yates Durwood M (o)--2380 375 Richardson Burt P--5155 376 Turpin Wm C (o)--2817-J 7 Ingram Ellen E Mrs--3759-J Dennard Rosa Mrs--1843-W 8 Dure Nela 9 West John T--2824-J 1935 Macon City Directory 579 SAAS66AS666666S3A636t32552552S5t25155tpr7p16550pt52r5595587777r2713776614322e1rpt3a1555e554e5a41322579122a820102r189117He111456e113P1291114G34raR08e6S-1VJ3-WEe2r3PP2eH-0rR8979FHT62J4e515JS2t80t97VVtorVBetAABMttVViHelVBHSmVSoooBaaDSteL7mtWoHGiMt7mBDC(rgoaHayPCaGaLLBDrhtURaVnRRmr5ssJ5srsciforaanacctn5paanadbahacatlcoraoenoa)oatVcsefFeItasod0sea2nCieaPoW1rerccffocuFaaudeencSeeccpsHziccKouacneadsenncenDmwosmoogdeop7rria9venihanenoaannannnsraodenetadoaeaomoeareoecSsnnnirrgardngbekd5t2lnnwhgmpaenTyitantnnnsdinttlarrftdsondiinnfolyecllesoennacrnelnet-s-aatleeiistiAyesdnnerdoshherrisoilttti:MJgshWrtnbseaBinrltsirntnrk:ttslanol:ttrosiWotnnymoTHcyFwpndeVtneueilyeenaRhsnoLleelAguCuJy:ntJtndeMneeuokJenyPteWoutahrdJtrrOsatRaoJeeiehoMtWoouerxlhnsepgayaAPraCWverAoEMeEoAnasdrodnATJavrAJLbstJPheuotdrCTRtndmiGsJsayLshahlLrdnomshimuaaTdlRthBnpsiRJeEavalpDekyA--htoMnLcnaFFCnlrnJoahrgaeoaetmkCeireOLiRtadJauaABibseksAulronMltnsceskmnesl(Jr--aLn3l--e--yJSeyswJRDbtiiarouhrn--eD----rp--sdJ0eJe((rCndrBa)yapyisSedneHSrWioo3--L2st1----n3eL(eMbJ--ocsasye(s--5--15o)j)0e25--67anoeoe--e--n(D--H7)9251427c--9-2r)ol--d2l(JnnM(946M9011(7--5s0(9tl2o2--)ror11Aso1c2s231u---279---5--1-28)5)34R9)rR)4W-32--39----rE2--223p--25(sJ50RJW7J-s52o255-0--1-Rt9e2421R)28sW72281(---1--38856oW-7JJ08M8-25)-10J1--W-9-3WR06O222199999999599599595999ORm8381818888108801888800880062008805080888718788742867671666790A7766752377575r62125202u21017310000903153212a201617J2%6V65B%42(%85FM45WlVED0N%W-5HW7GC901VW015noGHSBABgRW7AHJMCGWS%HluHBSa5BNvSTgGVBGhGy3ECaemhWieaKooWHoWoWahMBSrela6oTVuhhmogdlataaaeLBenkcteaecGaaaachysaryiiosulEce)hoianirwgugOpiiidhialr,gnha--acRdoneattezkexGslyprwarhipoittldvataaiilnePbcabortie1lebml!heinihidtoeatphsletonGdisreweecamlnrrieoaiwunanitlheedaeesall8rhsSaer3abofahmamoomasabweenedattnyaieneetstsaszwnnrnrort6itkHnilnT7JTaariLGmoasJrnnnyyleneltJneeelneglRdnnT9tssoo0tkCoeaoremkoienhRoaengnSClttCoiGHotCen-LJi5JJrdMIslsRsrdsrtRorWWdrrCLlLhsoLydoWcheCJsplonWarorBPJpes-auReioahJeeasWtrlibopnJksuaoanAoehrnLesilBeWsM*arvJJrpaHcaaaMJCCmiCJuaoyyieihHADlTboHCRmnazhWDultuiSvedCnasie--eerpEmderlrlbuGnCnyhasm--tnaeW(bSrnliihkJGDialgsylhainoasrraeheaniRma*ricltnscLePitlilraLnJa--itieasnoleanl--taSab(venileaa--O)nds5--nhnCteis--HareMHtugc--(olilMstsrCsWeieotMtritMr4ChdmsetMAc(syAt1euL)l--nradstiiA*--3(syMneorEeu21nps--E5M)yntdi3o2rrr(o7tG----Te2--tr--sSA)tJaar9idr3srt7os--s--uh)pC43essBe6(0fee2hsc5--Cr------s---Hr19)(0es--o26(ctrr4--H5sW5s410--c3o4--te(Lamo--9s296G(c)s-s5aM6(--s0Co8-f81(-)51t43141ocJn)(0o1---ee1d-Jt7o---rWs9)03--62m5cu220379X8)49Jst39JM)hdo--0cer)01-8--09s51)--02524141s--9--4sJm6r1Mmt99u-9-JR73-1-57429si5rR14R5J-J984s921s-31-sy--3t2MO20-J7J28RJ-t-c--2--J92844TRJW-7ch2t50-W(4c--J02ro16J-h--J)6-|JRr5O1111O30330330220229299222999291189SO1818511T110011302110111111111119181117110004631R110001111911H7051131122315921B21122229228125117201346yR11219800001001JV00H9008H767MC4561310D9HJC8C64R5M20oSD97AJO8r54S3o21MRSMCCMHRGoHSVTJAPoWCDoCuahuuoc(oa(nO((Fcao(((((((Ra(((odt(((((nHe1((((c1ta(n11o21ch((y412doa((o41(re21s1hlie1v2ce61ahn1rhlhae81r971buvl5461anS251lly2N52C0ei2r9a20N4le2t82anb01ot1rs8sn6apir)0nkmAicli)22)enrs)aa0f))400ebiom8)p119t6se)949nos2ss40nattto)838)n1rotmeDfs7s)ha5daalen)End7o)s)onr))k)))Tb))niR)))seeM)nobn)lsi0i)Gno)SSr3tDJlrAtsbn)enoerFccirndrJEeCneSGnsdiMt2sllehtWHaA,DnVsFnCVRJVpsnmVBrVWPeentseWnaVvrdGPhyStllHiaRo-paWtWhJdcoosogJmoelSTtoellesJcegdWWCsJbuyaav1coarbLvonhapcaoolakiaewsruBawAPonnBasnnJihkoaorLoEo,tKrStsricfoghclciJlhkeBcnrlacAhysscGShubaHetasLlcxvaaileewftamsciruemEaelHyaRevteareoalaCnrnadba1RilMs(egnatsboxmoueVleodRCedekmlnsnlrnlrninHernnIAsnBLnnJgsnus--lrmFLJltaaophaloneRnnxastls--es)rnyWrtwh--etLtIeFttttaFotraHFunbrr--ielduheaye(o--rueureiinWHaAIrorn--doMtsRnEioLlLFJoc(Jso--nrs(ndD4fmCAyfnsrvElosNnoo)eoyMtmooiffE4MaoA2iaotaEoaBEr--e(e(i)lmR--5i)rhpateMuedo7rsRWDoo6ona(8s(d--ltnoki--uaeSer((RaaLI6dradoGR((eahoter0gl))tn4r8oin6--o--s--e--froocyi(nia4----(san8s)rlwts-)p(((iH2s)oc83(9dseeo2a)r))--QrkhloMoto4Keocnl1--SAc(e----9)ehae-)V488f1esl14c(--())Cw4(2)c7enc-)--dJi(6qr(fe--c(--c--15--acy6o2W64Jt7)((6f0c2coctrAi21y(1)n((s)ue69(c0c4ot)6199s5so)-c26))((co(89cm(154ss1--(8)()1iL-J09c5co0rt6)0c2)mc)82)rc(232Wt7-a-d4))8)-c4)e4())89W65R6((3(9(--W(4c)-o4oo-81-7o(2fo2J)C-J31W)c-))2r)(J(-3R2)o)I9ecJ00r-))m4 jI|'lj m Baldwin's and Telegraph's I 106 Johnson A Albert (o)--4948-W 108 Snow Wm A (o)--4205 131 (12) Long Maude (c) 175 Vacant PARKWOOD AV --West from 178 Holloman Elvenia (c) 123 Jackson Fred A (o)--1066-R Belvedere dr, 1st n of Ridge 179 Jamerson Helen (c) 127 (161) Vacant 106 Chandler Carter E--5840 129 (163) Brown Chas F (o)-- Albemarle intersects PARK PL--South from Columbus 1066-M 110 Upchurch Phillip O--5119-W to Maple, 1st w of Holt 131 (165) Drinnon Everett S-- 204 Valentine E Henry (o)--954-J 105 Park View Apts 3426-J 206 Holmes John P (0)--3055 Apartments: 133 Adams Harry (o)--3426-W Rlverdale dr Intersects 1 Little E Wallace 148 Miller Jas H--2669-M 310 Scharff Byron D--3804-J 2 Barker Wm D 154 Watson Walter C--2669-R 312 Liles Marion H (o)--3976 3 Weir Thea--3523-J 156 Clay Margt J Mrs (o)--1066-J 420 Pennington Claude L Dr (o) 4 Parkerson Theo M--1798-J --3185 Street continued PATTERSON (NHts)--South from 460 Wood Wm T (o)--709 106 Shouse Jas P (o)--4411-R C of Ga Ry to Beech, 1st e of 108 Harris W Floyd--44-R Plo None av g PALACE AV (B)--West from 308 110 Rainwater Lester F--5309-R 109 Randall Herschell (c) II; Dover, 1st s of Ayers rd 112 Dixon John L-A63-J 190 Causey Dona M Mrs fi 106 (156) Reeves Edgar 114 Vacant 199 King Wm Rev (c) (o) 174 Braddy Walter E (o) 116 Amos Ezra E--2652 201 Hicks Wm (c) 176 Dyche Mell B 117 Kitchens Cohen B--2484-M 202 Vacant 178 Heath John H 118 Hatfield Jas W--5904-R 203 Mathis Willie (c) PARADISE AL--West from 5th to | Broadway, 1st n of Walnut 2 (121) Elis Ida (c) 4 (123) Peters Prank (c) j 6 (124) Hendrix Perry L (c) 7 (118) Ellis Nathan Jr (c) 8 (127) Welcome Bapt Ch (c) 9 (1) Grier Carrie (c) | 10 (154) Vacant 11 (2) Jackson Sami (c) ; 12 (205) Vacant '' 13 (3) Johnson Wm (c) 4. 14 (156) Kelley Jos K (c) j;j 15 (4) Holmes Geo (c) gj!i! 17 19 (6) (7) Troutman Emma Hooks Rufus (c) (c) - PARK (B)--Southwest from 2822 gt"- Forsyth rd g 104 Pitts Abner C i 106 121 Ellis Ernest C Davis E Cliff (o) 125 Patterson Carl B--175-J C of Ga Ry crosses * Berkeley dr intersects ' 201 (301) Bartlett Wm E 204 Elmore J Gregory (o)--5907-J 209 (203) Moore Oliver T--3309-J 120 Heriot Steph C 123 Sheridan Robt E (o)--5904-M 128 Vacant 129 Sheridan Edw A (o)--1035-R 135 Hall Grover T--6448-W 135% McGinty Milton C 137 White Pauline Mrs--6448-R 137% Caldwell Otis L--6448-M 141 Lavendar Oscar T (o)--44-W 147 Harrison John E--1035-W 151 Jewett Felix C--2630-J 153 O'Cain Walter L 155 Ashley Frances Mrs PARKER AL--South from 420 Hammond 1 Winton Chas (c) 2 Mitchell Homer (c) 3 Washington Ethel (c) 4 Vacant 5 Vacant 6 Vacant 7 Godfrey Be Annie (c) 8 Baker Richd (c) 9 Jackson Lucy (c) 10 Finney Major (c) 11 Perry James (c) 12 Finney Mary (c) 205 Willis Fred (c) 207 James Malinda (c) 209 James Jesse (c) 210 (221) Scott Eliza (c) 213 Vaughan John (c) 219 Range Chas H (c) 220 Ross Richd (c) 222 Hudson Thos (c) 225 Hudson Conelius (c) 227 Fry Mary (c) 229 Thomas Walter P (c) gro 231 Anderson Millie (c) Randall ia intersects 301 Butler Ivey (c) 303 White Lewis (c) 304 Randall Harry T C (c) 305 Miller Acy T (c) 307 Miller Acy T (c) gro 310 Patterson Alberta (c) 311 Miller WmB (c) 312 Shedrick Jerry (c)--3008-W 314 Harris Lillie (c) 315 Plummer Walter (c) 316 Webb Calvin (c) 317 Bell Emma (c) . 318 (320) Davis Horace H (c) 320 (318) Tenie Carl (c)--5975-W 344 Robinson Wm c)--5975-J 356 Stubbs Chas A 210 Doty Henry J (o)--5907-W 215 (211) Scott Wm C (o)--3283 Ayres dr intersects PARKER AV (V)--East from 300 blk Corbin av to Rogers av 439 Vacant 441 Trippe Joshua (c) 736 Barber Howard D (o)--3260-J 307 Biggerstaff Cleve W 11 Scott Howard (c) (o) 744 Joseph Fred H--4954-W PARK (U)--South from nr 1411 ; Dempsey av, 1st e ;of Key 103 Denton Wm (c) 104 Stewart Geo (c) 105 (432) Williams Quillie (c) 229 Stroud Wm (c) 230 Johnson Julius (c) 12 Johnson Thos J (c) 13 Cox Nora (c) (o) 14 Scott Leilia (c) (o) 15 Wisdom Oscar (e) 17 Thomas Emily (c) (o) 18 Goolsby Jas (c) 19 Johnson Anderson (c) 20 Carter Hattie (c) 746 Witcher Julius G--2740-W 760 Nirenstein Myer 772 Albright J Oscar 784 Schaefer Emanuel A--2582-W 785 Ware T Marcy--3568 796 Carver Gail L (o)--2582-J 797 Oliver Carl S (o)--854-M 801 Adams Todd L(o)--6382-M PARK HOTEL AL--Xorthwest ;% from 451, 1 Stubbs 1st to Thos New (c) 2 Cochran Walter (c) 3 Clark Winnie (c) 4 Kelley Ada (c) 5 Juhan Lillie (c) f 6 Curry Willie (c) 7 Thomas Henry (c) 16 Calloway Thos (c) 127 Scarborough John (c) 129 (15) Middlebrooks Prances 1 (c) 21 Pitts Wm M (c) 22 Burch Sampson (c) 23 Holmes Lewis (c) 24 Wimbush Lee (c) 26 (17) Scott Jas (c) 28 Burch John (c) 51 Huff Ellen (c) (o) 52 Bowman Danl (c) PARKER'S LA--South from 239 Roff Home av 1 Lowry John T 2 Foster Wm 3 Nelson Lizzie 823 Matson Robt G--1954-J 845 Goldstein Chas--6382-W 847 Turner JuPlian H--2098-J PAUL (L)--East from 714 San Juan av 108 Swift Wm 0--3553 110 Hooker Henry C--2265-W 120 Law Albert W (o) PEACHTREE (EM)--East from 200 Hydrolia to limits, 2d s of Main 101 Adams Sherwood W 1935 Macon City Directory 681 Jones av intersects PEARCE (EM)--North from 262 100 Hudson David (c) 123 McNeal Gerald Main 156 Brantley Lillie M (c) 125 Adamson Clarence H (o) 103 (264) Dupree Luther E 158 Mason Jos (c) 126 Schell Wm L 106 (265) Tinsley Fannie M Mrs 160 Williams Elijah (c) Balkcom av intersects 107 (266) Matthews J Oscar 161 (8) Thomas Benj (c) 203 Brewer Mary O Mrs 108 Carmichael Wm C 162 Jones Sami (c) 205 Smith Fannie C Mrs (o) 110 Kelsey Nora L rMs 163 Williams Mattie (c) 206 Hobbs Ephraim B 112 Williams Jos H 207 Marsh Geo H 114 Handy Geo PHILLIPS LA (EM)--West from 208 Marsh Sallie A Mrs (o) 116 Roberson David (c) (o) 250 Church, 1st n of Garden 250 Stevens Robt 251 Pruitt Jas H PEARL (SM)--East from 119 253 Johnson Clarence E--1833-J Flamingo dr, 1st south of Heard 257 Johnson John D--1818-R 122 Philmon Homer A (o) 260 Faircloth Nonie M Mrs(o >-- 125 Johnson Albert R (o)--1349-M 5992-W 126 Howard John H (o)--1349-W Fairview av intersects 127 Griswold J B--1349-R 301 Gill Effie M Mrs 128 Rountree John A Rev--3453 302 McKinney Benj F (o)--6292-M 129 Payton C Elijah 304 Davis Jack D 306 Johnson Marvin PEBBLE (SM)--West from 1809 307 Foster Wade H 2d to Telfair, 1st s of Bright 308 Harrelson O Homer 501 Sanders Harvey (c)--3758-J 309 Reynolds Lucy W Mrs (o) 503 Woodson Josie M (c) (o) 310 Roberts Wm J 312 Davis Sidney V 505 Edward Wm E (c) 507 Williams Wm J (c)--3758-R 316 Butts Walter E Stripling la intersects 401 Dorsey Alberta (c) (o) 402 Johnson Dimon (c) Wilder intersects 603 Durham Sallie (c) 607 Kellam Reedy (c) 611 Morgan Ella (c) 112 Ellis Robt (c) 115 (122) Chappel Belle (c) 117 Bowen Wm (c) 119 (126) Hunt Jacob (c) 123 (6) Vacant 125 (8) Nelson Dequilla (c) 127 (120) Dennie Annie B (e) 131 (123) Lyons Walter (c) 136 Woodard Knox (c) 138 (135) White Letha (c) 140 (134) Middlebrooks Mandy (c) 144 (133) Williams Eva (c) 146 (132) Barber Julia (c) Reese Julia (c) Center intersects 414 Buck Mary (c 415 McKay Annie (c) 416 Wood Abner W (c) 407 Daniel Wm (c) 620 Lewis Jas L (c) (o) 409 Small Prentice (c) 621 Middlebrooks Barnett (c) 410 Turner Jas (c) (o) 630 Dunn Jos (c) 411 Coaston Alf (c) 412 Lane Curtis (c) 633 Smith Minnie (c) 640 Ware Edw W 413 Jackson Peter (c) 641 Anderson Benj (c) 414 Daniels Henry (c) (o) 647 Jackson James C 416 Clowers Ernest (c) (o) 648 Vacant 419 Gray Wyatt (c) 656 Yaughn Katie Mrs 420 White Isaac (c) 422 Vacant PECAN (V)--South from end of 423 Durham Henrietta (c) 1st av (V), 1st nw of Craft 424 Kellam Wiley (c) 130 Tolliver Wm J (c) 132 Ivory Wm (c) PEACOCK (SM)--South from 107 134 Wright Jas (c) Gibson av, 1st e of Antioch rd 136 Terry Arth (c) 100 Davis Sami (c) 138 Hand Twymer (c) 101 Vacant 140 Gilman Lessie (c) 102 Heard Sami (c) 142 Kimbro Clarence (c) 103 (212) Hines Eula (c) 144 Holloway Janie M (c) 104 Dean Jos (c) 145 Brookins Cleo (c) 105 (656) Burley Lumpkin (c) 147 Cleveland Rosa (c) 201 (162) Hughes Wesley (c) 149 Grimes Val G (c) PIEDMONT AV (SM)--West iron 2615 2d, 1st s of Long 100 Adams Louis G 101 Bryant Walter F (o) 103 White Roland E (o)--29-W 105 Smith Olive (o)--744-R 106 Powell Mack H 110 Butler Jas M (o) Grace intersects 111 Story Alf K (o) 115 Ashton Paul F (o)--'744-J 118 Lynch Bernice C (o) 119 Royal Ralph 120 McCuen J Vascoe--2909-J 123 Thomas John R (o)--5327-J 125 Durden Andrew B 129 Oldham Joseph E--744-W 130 Caruthers Geo W (o) 131 Lowe Allie Mrs (o) 132 Odom Clarence E (o)-- 1912-W Florence intersects 202 (160) Ringwood Robt J (c) 135 Small Geo C--5327-W 203 (159) Golden Wm (c) (o) shoe PENN (V)--North from 345 Doug- 136 Brown Jos H (o)--320-J repr las av 137 Hardy* John B--1912-R 205 (100) Munson Walter (c) (o) 111 Taylor Viola (c) (o) 138 Ridley Horace E (o) Charles intersects 113 Williams Robt (c) (o) 140 Fletcher David C 115 Farley Martha (c) 141 Dotts Howard F--5327-R Crisp Intersects 117 Vacant 142 McKinnon Morvell E 400 Burns Wm (c) 121 Gray Annie (c) 143 Marshall Onan E 402 Johnson Leroy (c) 123 Simmons Webster D (c) (o) 144 Roquemore Walter 300 Williams Jeanette (c) 145 Humphries R Sami (o)- PEAR (EM)--South from 347 302 Hughes John Jr (c) 1912-M Flanders, 1st w of Main 216 Vacant 218 Butler Doshia (c) 219 Dowdell Earlie (c) 220 Lowry Julius (c) 221 (202 )Vacant 223 (208) Conner Rosa (c) 224 (717) Glover Geo (c) 225 (204) Rogers Georgia (c) 226 (719) Thompson Budrow (c) 227 (722) Binns Georgia (c) PETERS AL (EM)--South from 265 Broad to Academy al 431 Johnson Emma (c) 432 Johnson Peter (c) (o) 437 McIntosh Emma (c) PIERCE AV (V)--North from 1111J Vineville av 101 Hudson Danl E--1243-J m 103 Anderson Murray E furn reff| 439 Rollins Isadore (c) 441 Whitaker Wm (c) 443 (433) Davenport Otis (c) --914-W 104 Lamb Perry H (o)--3969-W ; 105 Taylor Margt B Mrs--1243-fff 444 Cross Willie M (c) 106 Richardson Willoughby L 445 (435) Williams Mary (c) (o) 107 Vacant . 228 (721) Hooks Isaac (c) PHILLIPS AL (SM)--South from 107% Fried Theo D 231 (270) Vacant Grant's Chapel al, bet 2d and 108 Marshall Wm J (o)--5725-? W2S6II.81II Vuacsa--nt mi iiiii Knott 110 Brooks O Lynewood (o)--M 583 Baldwin's and Telegraph 112 Thomas Minnie G Mrs (o)-- 523 Worsham & Sherrill gros-- 112 (108) McDonald Vernon E 1243-R 3561 114 (111) Sanders Isadore F 114 Vincent Frank T (o)--3206 550 Johnson Mark lunch rm 114% Lanier Chas F--3470-M 552 Peacock Joel A PINKERTON--South from 107 116 James Wm E--3470-J 553 Vacant Roff Home av, 1st w of Pio 118 Morgan Flemon E D 555 Lassiter Nannie E Mrs (o) Nono av 120 (149) Bernd Arth (o) 556 Lynch Julia F Mrs drsmkr 100 Wilson Alf 122 (153) Asbell 1851-J J Andrew (o)-- 608 2d Vacant Intersects 102 (301) Edge Jeff J 104 (101) Revell Edgar 123 McGehee Jas T (o)--4745 617 Temple Walter P Jr (o)-- 105 (305) McCallum Herman 124 (140) Wail J Brad (o)--6585 2530-W 108 (303) Nelson Horace 125 Parham John H 619 Middlebrooks Laura Mrs-- 126 (142) Holley Harry L 4746-W Elizabeth pi Intersects 620 Cornelius Margt J Mrs-- 129 Wall Penelope Mrs (o)--914-J 2954-W 110 (105) Scott Leonard (c) (o) 112 (103) Taylor Wm T 114 (104) Daniel Jesse L 135 Thomas Bobt H--5891-J 621 McCowell Lizzie PINSON (SM)--South from 117, 137 Sutton Fred J--3033-J 652 Boone J Danl (o)--3149-W Buena Vista av, 1st w of 4000 139 Little Wm L--1851-W Boone Eliz mus tchr blk Houston av 141 Dickson Mary L Mrs (o)-- 3470-W 201 Methodist Orphans Home-- 350 Boulevard ends 653 Morris Fannie L Mrs 656 Carter Levi B Currie Ella L Mrs Messer Myrtle 657 Wellons Jos B (o)--178-J 120 Skipper Clarence A 122 Berkner Howard L--2795-W 124 Hancock Wm H (o)--2654-J 126 Martin Walter T 202 Dubose Winston H (o)--1983 204 Richardson Max W (o)--5628 206 Moran Otis A 208 Jones Norman S--4194-M 210 Roberts Herman--5781 212 Brazzeal C David McDonald intersects 300 Etheridge Greene B (o)-- 4194-J 302 Jones I Hardeman--880-W 310 Williamson Geo E--880-R 312 Guy Earl M 348 Lundy Bright W (o)--4194-R 350 Davis Stuart C 351 Camp Jay W 352 Caraker Minnie Mrs (o) 356 Cherry W Comer PINE--West from So By Shops to Spring, 3d s of Cherry Dickey W S Clay Mfg Co- 617 So Ry System (shops)--3371 7th intersects Dixie Cafe & Commissary-- 1503 ' CDeixniteralPoufr GCao Rsyal(asrhyoplso)ans 5th intersects 354 Horne Hannah (c) 356 Gunbolt Ella (c) 362 Russell Thos (c) 364 Slim's Lunch Rm Broadway intersects 412 Collins Thos (e) blksmth-- 9430 415 Bibb Mattress Co--5576 419 Boland's Garage 444-48 Spivey & Pritchett auto reprs 447-449 Colbert Mfg Co auto reprs --2306 457 Vacant 160 Exchange Bldg Kinney W O & Co cotton 658 Vacant 1st intersects 706 Garfield Chas H (o)--339 PIO NONO AV (V)--South from 1100 blk of Vineville av to Anthony rd 708 Hall Clarence S 710 Andrews Edw C Matthews John B--2880-J 712 English Emmett A--280-J 714 Cannon Robt L 715 Windman Mamie Mrs--932 716 Stripling Jas H 718 Favors G Dana--301-J 720 McDaniel Oscar P--3503-R 721 Clance J Edw 722 Wester N Roscoe 724 Price J Marvin 726 Herrington Horace O (o)-- 5514-J 750 Williams Cosby E--896-J Odom Jolly J Sanders Reuben G 753 Autrey W Herbert 756 Sharp Wm L Ray Marie Mrs--5514-M 759 Sheffield Nancy Mrs--3849-J 761 Cunningham C Clifford (o)-- 3046-W Wheeler Chas A 765 Floyd Ida E--5226-J 767 Taylor Sidney L (o)--2968-J New intersects 801 Moseley Wm T--2291-W 803 Wagnon Wm C--2291-J 805 Arnold Thos W--2194 807 Vacant 809 Travers Thos 809% Harris Ada M Mrs 820 Macon Hosp--5800 Ridley Chas L phys 649 McBrearty John (o)--475-J 854 Proctor Geo D 856 Durloo Louise Mrs--5814-J 859 Douglass Chas H (c) (o)-- 3232-J 860 Lane Thos R (o)--5814-W 863 Nesbitt Sarah (c) 103 Nottingham Warren G Jr (o) 4851 104 Robinson Chas W (o)--4149-J 105 Turlington Wm T (o)--4413 107 Wynn Geo O (o)--4540 109 Colbert Carrie (o)--3061-J 111 Wyche John C (o)--5406-J 118 Swinson W Edw (o)--6048-W English av ends 129 Glover Mortimer W Rev (o) --6034 200 (302) Cohen Max gro 202 (304) Cohen Max 206 (306) Norris Chas 258 (310) Moore S Claude 266 (312) Vacant 272 (312%) Hill Launie 290 Vacant Stanislaus cir intersects 300 Chambliss Mkt--5211 301 (201) Atlantic Ice & Coal Yd --5098 302 Vacant 303 CFD Pump Co No 6 304 Collins Jas 310 Jarrell Thos J 314 (224) Stevenson Sarah Adamson Bettie E (o) 316 Church of God 321 Vacant Roye intersects 360 Moore Goebel 362 (328) Bobbie Hqmer 384 (332) Quinn Jesse B Patter*son* la ends Suwanee intersects 387 (257) Pelt Jas H Randolph intersects * Crest av begins 414 Sorrow J Wesley 470 C &broEkerSs--erv260(side ent) 3d intersects 510 Yates Mtr Co (side) 511 Brake Henry T---3169 514 Boone J Danl gro--3718 518 Zettler Hse, furn rms Forehand Dugal J PINEVIEW AV--West from 2837 Houston av, 2d s of Dixie av 100 Douglas John W Jr (o)--1685 101 (104 Stewart J D Edw 104 (105) Keys John L 106 (107) Jaemrson Walker 107 (106) Sorrell Geo W 108 (109) Roberts Edgar T 110 (111) Graham Steley M 418 (220) Sheftall Minnie (c)-- 419-J Cherokee av Intersects * * * Randall la intersects 433 Howard John (c) 435 (211) Battle Evans (c) 456 Braswell Jas J (c) (o)--2633-J 500 Vacant 502 Vacant 1935 Macon City Directory 683 504 Hardin Geo S gro 505 Walden W Clell (o>--2128-W 507 Vacant 518 Gibson Van (c) gro Dempsey intersects 254 Vacant 1000 Thomas Funeral Home --East from 4103 14 (86) Johnson Bromer L Houston av Singleton Wiley T Campbell av intersects 1 (269) Preston Della (c) 3 (11%) Sanders Comer (c) 5 (221) Vacant 7 (222) Murray Henry (c) 8 (268) Vacant 610 (270) Morris Sami (c) Nussbaum Intersects 100 Staley Oliver D (o) 103 Mauldin John D (o) 105 Stokes Carlos E (o) 150 Hudson Edgar N (o)--5820-W RAILROAD AV (V)--West from Linden av along C of Ga Ry, a continuation of Klnnett 15 McAllister Annie Mrs 17 Cranford John C 20 (84) Hightower Wm H 22 (82) Vacant 23 Joyner J Albert 24 (81) Joyner John T 26 (79) Vacant 28 (78) Vacant 702 Clements Wm (c) 704 (616) Jackson Alf (c) 706 (618) Thomas Alf (c) 707 (605) Brown Thos (c) 708 (620) Calhoun Geo (c) 709 (619) Williams Richd (c) (o) 102 (147) Stephens Wm (c) 105 (218) Byce Jas (c) 108 (149) Bell John (c) 110 (166) Vacant 114 (812) Hoges John (c) 115 (254) James Marvin (c) 29 (77) Massey Alex 30 (75) Vacant 32 (73) Riley C Hilliard 34 (24) Blow Ellis L 36 (104) Rodgers Simpson B (o) 38 (102) Rivers Gussie Mrs (o) 711 (617) Summerford John (c) (o) 712 (622) Goolsby Jas (c) 116 (215) Vacant 117 (531) Ponder Thos (c) 118 (114) Barrett Henry (c) RANSOME AV (V)--West from Clisby pi, 1 s of Vineville av " 713 (621) Cain Minnie (c) 714 (624) Clark Johnnie B (c) 119 (530) Vacant 120 (212) Gaines John (c) 106 Head Geo W--2169-J 715 (615) Rockmore James (c) 121 (721) Nicely Buford (c) REESE (EM)--North from 1108 716 (626) Scott Sol (c) 122 (227) Griffin Artie (c) Main, 1st e of Bowman 717 (611) Rawls Asberry (c) 718 (628) Wadley Lovie (c) 719 (610) Simmons Edw (c) 720 Wright Mary (c) 123 (539) Jones Thos (c) 124 (239) Chaney Preston (c) 125 (541) Pierce Ira (c) 126 (240) Moore Virana (c) 102 Reese Mary S Mrs (o)-- 3323-R 110 Hardy Wm C 721 (613) Bledsoe Edw A (c) 722 (632) Simmons Jos (c) 723 (612) Belvin Jettie D (c) (o) --3235-M 726 (636) Bowden Lizzie (c) 728 (638) Bedney Ruth (c) 730 (640) Carter Roscoe (c) 732 (642 Cole Fannie (c) PRINGLE (EM)--West from 513 r Fort Hill, 1st n of Woolfoik 101 Taylor John H (c) (o) 102 Nelson Mila (c) 103 Vacant 104 105 (105) (107) Northern Stanford Lula (c) Lloyd (c) | 106 (110) Williams Lee (c) | 107 (907) McElroy Jessie (c) ; 108 (102) Turner Wallace (c) 109 Vacant 110 Vacant 111 Greeley Jefferson (c) j 112 McElroy Frank F (c) (o)-- 4270-R : 113 (600) Clark John L (c) PROGRESS--South from 411 For.i syth to C of Ga Ry, bet St Panl and Monroe 127 (543) Vacant 130 (242) Taylor Mamie (c) 131 Bedingfield Allen (c) 131 (204) Moss Minnie (c) 132 (245) Wesley Wm (c) 133 (202) James Corine (c) 150 Chambers Lbr Co--966 Kinnett-Odom Co coal & ice-- 771 Holt av Intersects 201 (122) Hughes Dudley (c) 203 (310) Winbush Florence (c) 205 (368) Moore Virginia (c) 207 (367) Bailey Bertha (c) 209 (366) Bivins Rachel (c) Willingham Cotton Mills--300 RANDALL LA (NH)--East from 400 blk of Pio Nono, 1st n of Napier 100 (406) Staley Pierce (c) 101 (403) Jackson Lennos (c) 102 (404) Hughes Lucile (c) 104 Hardison Geneva (c) 106 (105) Jones Watson (c) 108 (102) Coley Maria (c) RANDOLPH (EM)--West from 362 Church, 1st s of Broad REID i(SM)--East from 2000 Broadway, 4th s of Edgewood av 28 Vacant 29 Johnson Wm (c) 30 (27) Brown James (c) 32 (26) Cain Lillie M (c) 34 (25) Stokes Susie (c) 110 Stokes Lizzie (c) 112 Thomas Anna (c) 114 Earl John (c) 116 Moore Louis (c) Elbert intersects 202 Eady Jas 207 Hickman Rosa Mrs 208 Fulford Foy W 211 Wall Benj F 212 Vacant 213 Cheatham Ernest W 216 Goodson Redden J 217 Myers Derius 218 Aides Danl W (o) 219 Hatfield Millie Mrs 220 Collins Eufa Mrs 222 (298) Russell John B 224 (300) Byrd Alice Mrs 225 Ellis Thos A 227 Merritt John 229 Drawhorn Wm C 231 Hester Jas O 15 McElroy Wm J--2109-J 21 Vacant 22 Brady Jas E--2109-W 310 Reid Omer M 312 Lominick Bartow T 314 Cribb M Alice Mrs Chappell intersects 302 Vacant 304 Hickman Wm C auto repr 26 Lucas Mattie D Mrs Newton Carrie M Mrs (o)-- 317 Parkman John U Mrs 320 Henderson J Grant 309 Epps Eliz Mrs 310 Holtzclaw Essie Mrs 2956-W 27 Sheperd Dessie B 321 Fountain Marvin L 323 Mullis Bobbie L 317 Reid Jacob C 322 Horton Barney" 1935 Macon City Directory 587 324 Akridge Cleveland Mrs 325 Marshall Roy 104|EIliott Wm I (o)--2023-W 105 Schaffer Geo A BEMBERT AV--West from Linden to Carling, 1st n of Dannenberg 101 Odom Boykin B (o)--3146-J 102 Moore Alan A--452-J 104 Allen Lucy B (o)--5615 109 Beggs Wilma Mrs (o)--4699-J 114 Lee John D--3060-M 115 Smith T Ellis--4094-R 119 Edings Julian B (o)--563-R 122 Wilder Chas J (o)--452-R 125 Formby Jos E 127 Reynolds Leroy P (o) 128 Shepard V Colley (o)--2478-J 129 Register Otto P (o)--5763-M 130 Hartness Wm W (o)--5834 131 Snipes Ada 132 Small Edw T Rev 133 Mosley Mary Mrs--4419-J 134 Goodloe Lester C Smith Chas 109 Ellington Elmer D 111 Jones A Henry 113 Paris Thos N (o)--1849-R 116 Ross Edgar J 116% (120) Coggin Jasper L (o)- 1849-J 118 Griffin Mangham E (o)-- 2023-M 119 Gardner Fredk P (o) 119% Edwards Robt E (o) 120 Hayes Geo W 121 Carter Fredk W--2023-R 123 Baird John L--1849-W 124 Collier Ollie O 126 Lynch Letitia Mrs (o) 127 Smith Asa R (o) Kemper av intersects 129 Ramsey Wm C (o)--2023-J San Juan intersects 400 Smith Minnie Mrs 406 Shelley Bennett Y (o) 135 Worsham Alberta Mrs (o)-- 4419-W Worsham Clarence J 136 Askew Milton D--6156-M 137 Booker Arth P 138 Norman J E (o) 139 Roland Henry P 140 Vaughn Claybron RIDGE (I)--West from 107 Kenmore pi 101 Humphreys Floyd H (o)-- 4242-W 103 Ezell Kate E (o) 169 Ernest Wm H (o) wood 1st av intersects 201 Blanks Otis L (o)--5649-J 510 Vacant 511 Horton Lucius J (o) 513 Fincher Robt F--2206-W [ Po 517 Baskin Wm H Jr (o)--1729 519 Cutter Wm H (o)--3999-w Fa 540 Birdsong Richd E (o)-- 3999-R 19 G1 542 Burkett Claire (o)--3880-J 11 Nt ---- Adams Geo W--562 135 Dt 544 Sheridan Leo D (o)--2918-J 17 Ca 546 Wrede Roland--4110-W 548 Jeffreys Edw G (o)--5879 THE Oak av intersects Cowa 650 Ramsey John W (o)--2560-W 15 Vi 651 Nesbit Noye H (o)--4579-ty 117 Jo 654 Vacant 19 Si 656 Vacant 21 St 659 Tharpe Robt A (o)--6340 123 Cc Tyrone blvd intersects 125 A1 702 Weaver Olin H (o)--1564 127 P( 705 Lawton Osgood P (o)--2073-R 129 M 722 Butt Richd L (o)--5035-J 131 Di 724 Wynne Robt F Jr--4234 133 M 728 Grimes John H--4191 135 W 731 Bonner Robt--3788-W 732 Dodds Sami D (o)--5494 736 Ellington Jonah R (o)--759-W| 738 Gordon C Herbert--2560-R 741 Lucas Chas P (o)--1304-J 743 Teal Dempie B (o)---3173-J 745 Black Wm F (o)--2073-J 747 Marshall Loyd W--1720-W REYNOLDS AL--East from Hemlock, bet 1st and 2d 724 (8) Fuller Chas (c) 726 (8) Ford Emma (c) 728 Cooper Lizzie (c) 729 Harvey Maynard (c) 730 (8) Stamps Wm (c) 772 Humphries Louis (c) 773 Griggs Walter (c) 774 Murphy Chas (c) 775 Fuller Geo (c) 777 Rogers Carrie (c) 778 Dixon Ella (c) 779 Johnson Homer (c) 779% Brown Mack (c) 780 Nixon Alex (c) 781 Martin Bertha (c) 782 Smith Ella (c) 784 Masten Toysie (c) 786 Lester Wm (c) 1219 Harvey Mannie (c) 1220 Hicks Isaiah (c) 1221 Massey Mary (c) RICHARD (U)--East from Pio Nono av, 3d s of Montpelier av 100 Bell Robt (c) 102 Mitchell Rufus (c) (o) 103 Jones Lula (c) 104 (122) Mitchell Jethro (c) 104 (123) Mitchell Jethro (c) 105 (141) Harden Lillie (c) (o) 106 (127) Colbert Ethel (c) 107 (152) Hollis Thos (c 108 (193) Cullens Oscar (c) 402 Colbert Pinkie (c) 404 Hatfield Lula (c) 409 Dee Wm (c) RICHMOND--East from 3500 Houston av, 1st n of Grady 100 Kimble John C 101 Vacant 102 Whitehurst Cornelius A 103 Shepard Roger O (o) 202 Jones J Clifton--5649-W 749 Moore Ernest C--2073-W 203 Brown Eug D (o)--2247-J 751 McKay Jas W (o)--3322 204 Hurst Needham W (o) 753 Russell Raymond D (o)- 206 Jenkins Homer L (o)--3620-W 207 Jenkins Wilde E (o) phys-- 2247-W 208 Watson Hubert C--3620-XM 210 Tallent Claude 211 Hunt Jefferson B (o)--5456 212 Nottingham Harry E (o)-- 4242-J Ingleside av intersects' 307 Perry Robin T 308 Underhill Dillon 313 Collins Robt M--9080 314 Vacant Hartley av intersects 3173-W 755 Powell Chas M--2506 756 Bollinger Robt A contr-- 6580 757 Parks Wm M--2224-W Auburn av intersects 800 Wilson Robt L (o)--1379-M J Belvedere dr intersects 906 Bennett Carl C (o)--4219-J 908 Willums Jas W (o)--4768-J I 910 Acree Maurice M (o)--1398 1 riv; fron 205 E 206 K 222 S 223 G 224 C 225 L 226 C 227 V 229 G Albemarle pi intersects 235 J 240 E Riverdale dr intersects Crumps Pk av intersects 407 Cleaveland Robt E (o) 1850-W 409 Hearn Sallie T Mrs (o)-- 6060-J 410 Fanning Geo W (o)--6060-M Marshall av intersects 412 Macon Carrie Mrs (o) 5644-W 413 Griffith Percy D (o)--1262 414 Cotton Harold W (o)--4685 416 Clifton Chas M (o) 417 Clarke Geo A--6060-W 417 (r) Reid Lovett (c) 418 Quillian Marvin C (o)--3482-J 420 Love Henry A (o) McGee intersects 424 Bloodworth Wm G 426 Defore Ardell 427 Ingleside M E Ch (South) 1102 Selden John A (o)--6540 ROB1 1106 Wing Augustus M (.o).---33351.^Pr` 1108 Hill Julian B (o)--3908-J i'jsj 1110 MacDonell Allen M (o)--65Sj Merritt av intersects 1201 Brown Leon (o)--5520-J 1202 Fuller Jones B--832-R 1204 Bullard Danl Jr--3798-J 1206 Oberry John W--3184-W j! 1208 Batchelor Lonzo N (o)-- I 3784-W 1212 West John H (o)--3184-R E, 1298 Davis F Augustus (o) bldji; contr--2705-J Alexander Sch No 4 Roycrest dr intersects > 1302 Smith Chas P--5320-W 1305 Swain S Alf--705-W 1307 Gignilliat Arth M--5320-M Roberts pi intersects 428 429 Vacant Rodgers T Furlowx (o)-- 1144-R Forest Hill rd intersects 1401 Crockett Roy W (o)--82 Riley av intersects 506 Durden John L 507 Nolan Walter K (o) 508 Pittman Clarence G (o) RILEY AV (CP)--North from bfi` ginning of Forsyth rd, 4th w of 371 Park av 509 Gavin Chas M (o)--4032 105 Brown Evelyn 588 Baldwin's and Telegraph's 1936 w -1729 i-W a Powers Jos B (o) phys-- 4852-W TO Farres A Wm--230-W Ridge av Intersects 393 Causey Wm (c) (o) 400 Mosley Thos (c) (o) 404 Lee Jesse (c) 406 Lewis Emma (c) (o) 229 Mote Enmon M 231 Foster W Marion 232 Taylor Mabel Mrs 233 Brown S Franklin 29 Glover Wm (c) BO-J 31 Nelson Emma (c) Davis Andrew (c) (o) 234 Bray Edw ROCK AV--South from 330 Demp- 234 (r) Harris Frank H sey av 236 Harper Thelma Mrs H8-J 17 Carswell Raymond (c) 100 Gray Cora A (c) gro 104 Hill John (c) 236 (r) Tucker Howard R-- 4298-J 879 THEY (EM)--North from 300 Cowan, 1st e of Center 560-W '9-W 5 .7 |19 Vinson Mary L (c) Jones Clifton (c) Singleton John W (o) (c) 121 Stallworth Benj (o) 123 Cornelius John (c) 125 Allen Major (c) 106 (342) Robinson Julia (c) 108 (341) Green Eliz (c) 110 (340) Battle Lucinda (c) (o) 112 (342) Walker Chas (c) 114 (106) Jones Sallie (c) 116 Tabor Harry (c) 118 Lockett Edgar (c) 240 Vacant 242 Bowden Bertie Mrs 244 Tucker Wm L 248 Causey Arth F Patterson* b*egins Pio Nono av intersects 553 Couch Geo E 127 Pope David (c) ROCKHILL LA--West from 211 554 Couch Ruel C ' 129 Mack John (c) Green, 1st s of Northwest Boun- 131 Davis Mary L (c) dary ROFF HOME LA--West from 234 133 Maynard Silas (o) 102 (648) Hardwell Thos (c) Roff Home av to Pio Nono av 135 Wilson Ned (c) 109 Hester Cherrie (c) 110 (75) Vacant 116 Johnson Laura (c) 124 Herron Gertrude Mrs RIVER RD (NH)--North from 118 Brown John (c) 125 Causey Annie Mrs Jfjciinton rd, 1st e of Masonic 119 Ball Nelton (c) 127 Purvis Charlton A TMS"HoCmleayrdAlex 120 Nelms Troy (c) 121 Jones John (c) 130 Vacant 131 Cox Maggie Mrs Clay Elmo (o) 122 Vacant 133 Martin Troy S Clay Jennings (o) 123 Vacant 135 Williams Jack Clay Jos (o) 124 Howard Maud (c) 149 Moss Carl L Hollomon Ellis L (o) 126 Rockhill La Ch (c) 159 Kitchens Fred A Kendall Leonard J (o)-- 127 (1) Farmer Edw (c) gro 177 Holder Fletcher L 2863-W King Lizzie (c) ROFF HOME PL--South from RIVERDALE DR (I)--North vom 2524 Forsyth rd 205 Dempsey Norbert A (o)--4535 206 Newton Chas E Jr--281 222 -Stainton Sami D--3585-W )-M I 223 Gardiner Geo A (o)--1419-W 224 Collins Frank W--3585-J ROCKY BROOK DR (SH) -- Northeast from Jackson Spring rd Foster Robt M (o)--543 Rozar A Robt (o)--1529 ---- Spearman Robt E (o)--775-J l9-J S8-J 4311 225 Loh Lawrence M (o)--1803 226 Carter Ray--2510 227 Watson Wm H (o)--3303 229 Gardiner G Alf (o)--1419-W 235 Juhan Wm J Jr (o)--5605 240 Brown Dennis F (o)--5876 ROCKY CREEK RD--West from 8607 Houston av, 1st s of Mill av 101% Valentine Ruth Mrs 102 Hudson Robt B 103 Martin Nannie E Mrs (o) 0 ROBERTS (U)--East from Pio 103% (r) Roquemore Thos (c) Nono av, 1st s of Montpelier av 104 Owens Lawson--6146-R 100 Price Geo (c) 105 Swanson Harvey P (o)--381-J Roll Home 1 Meeks Carlos G--1977-J 2 Radford Eliz Mrs 3 Brown Corinne Mrs 4 Dewberry Herman H 5 Crow Susie Mrs 6 Arnett John 7 Collins Jerry T 8 Childree Allen 9 Whitten John H 10 Ryles Frank W 11 Amerson Pete J 12 Gibbs Arth G 13 Goodman Wm J 14 Farr James B 64 Smith John T 101 Edwards Henry (c) 108 Stevens Bascom S (o)-- Arnette Jos T 102 Reese Willie (c) 102% King Shannon (c) J 104 Clark Dock (c) 6146-W 113 Philmon Thos D (o) 250 Upchurch ROGERS AV (V)--North from 509 Vineville av, 1st e of Corbin 107 Fields Robt (c) 252 Smith Jas O (o) 100 Asbury Wilkes R--4202-R T 110 Rainey Wm (c) ROBINSON RD (LCHts)--West from 805 Log Cabin blvd 327 Tharpe Sarah (c) bill 332 Robinson Joshua (c) (o) 253 Fordham Mary L Mrs (o)-- 6146-J 310 Evans David F contr-- 6146-M 316 Stevens W Albert (o) M i bf W oi ,ph'6 334 Gibson John W (c) (o) 337 Franklin Elmore (c) (o) 353 Lundy Wm W (c) (o) 358 Robinson Hester (c) (o) 360 Lindsey L C (,c) 362 Winchester Robt P (c) 364 Joiner Emma (c) (o) 365 Branan Isaac (c) 365 (r) Carter Clara (c) 366 Jackson Moses (c) (o) 367 Jackson Moses Jr (c) (o) 369 Huckaby Thos (c (o) 371 Jackson Mattie (c) 383 Smith Letha (c) 387 Vacant 388 Pine Ridge Primitive Bapt Ch (c) ROFF HOME AV (V)--West from 50 Holt av to bey limits Webb Coal Co--2187 107 Champion Thos Cutro al begins 110 Goodwin Nancy (c) 112 Andrews Nannie (c) 114 Harris Wm (c) 115 Ward Emma (c) 116 Johnson Wm M (c) 117 Guyton John (c) 118 Cotton Rachel (c) (o) 119 Adams L Andrew 120 Story Effie 121 Harden Rita Mrs 211 Atlantic Cotton Mill Sch 219 Mallory Mission Bapt Ch 102 Crandall Mary L Mrs (o)-- 3625-W 103 Vincent Ned (o)--1813 104 Stanley Wm K (o)--910-W 105 McGee A B ---- Rushing Mattie--5185 106 Morgan Wayland B (o)-- 3720-J Rackley Ernest W--2498 107 Brown J Frank 108 Pate Jesse H (o)--910-J 109 Jones S Fielder--3724-J 110 Horton Marie S Mrs (o)-- 2075-R 111 Strickland Wm H--2406-W 112 Davis F Clarke Dr (o)-- 5254-J Clark Wallace R--2406-M 113 Corbin Culver C (o)--674 114 Jordan E Ross (o)--2770-J 114% Hunt Lucy G Mrs (o)-- 2770-W 115 Small Ralph B (o)--328 Macon City Directory Small Annie K Mrs int dec 103 Dowdell Jos (c) 336 Jones John E 116 Goolsby R Cullen Jr--4522 105 Walker Jas (c) 338 Pettey Little Mrs--6025-E 117 Pittman Henry W (o)--4507 107 Jackson Emma (c) Read John G 118 Carswell Mary L Mrs-- 109 Wilson Madison (c) 339 Norris Lula Mrs (o) 2075-W 111 Wilson Mary (c) Ash intersects 119 McMillan Eug C (o)--4225-W 113 Duncan Arth (c) 406 Ham Jas F 120 Little Leslie H (o)--5343 115 Morgan Curtis (c) 408 Thompson Cary Mrs 121 Hedgepath Jeanette Mrs-- 413 Hollomon Collie--3822-J 2352-W ROSE LANE--See Spring 416 Benton Danl M (o) 122 Bridgers G Herbert (o)--3243 419 Reed John B (o) 123 Skelley Edison--2075-J ROSE PARK--Continuation of 422 Willis Robt L (o)--1588-1; 124 Campbell S Vinton--3623-J Hemlock beyond Spring 423 Amerson Nancy Mrs (o) Layfield Ammie C Mrs-- 114 Nix A Elyert Mrs (o)--1753 1588-J 2352-J 115 White Roswell R--6365-W 429 Parham Zelota Mrs--3027 125 Jacks Lee H 125 Nelson Edna R Mrs (o)-- 432 Trawick John C 126 Sanford Shelton P--1694-J 3876-J 433 Childs Thos O--3027-J 127 Jones J Calvin (o)--2352-R Turner Clarence--3542 434 Truman Dorothy B Mri 127% Cooper Otis O 131 Drake Wm F (o)--3430-W 436 Bond Margt Mrs 128 Roughton Richd P--289 135 Weinstein Max (o)--3430-J 437 Harris Lonnie O 129 Johnston Benj B (o)--3400 139 Herring Pearl--5292-M Harris Wilmer A 130 Vacant 143 Bartlett Blanton I--3876-W 438 Spence Ernest R 131 Whitaker Cecil F--2225-W 147 Moses Wm 440 Pritchett Rachael Mrs--5i; 133 Buxton John N (o)--5265-J Schall Mary L Mrs (o)--5574 Elm intersects Clayton begins 515 Varnedore Wheeler (c) 203 Davis Edwin S Jr--576-W ROSE PL--West from nr 637 518 Daniel Mattie (c) 205 Vacant Orange 519 Hudson Wm (c) 207 Giles Alice E Mrs--3900-J 1 Jordan Eug H--6318-M 520 Pitts Berry T (c) 209 Thurman M Merritt (o)-- 2 Johnson Harvey L 521 Lamar Foustine (c) 2750-W McGoldrick Jos P (o)--5268 522 McGee Chas (c) 211 Buxton Raiford E (o)--2750-J 3 Walker Walstein L 524 Green Mittie (c) 217 Anderson Jas L (o)--1522 4 Ennis Henry G--5075-M 526 Riggins Clifford (c) 5 Nipper Chas A--2623 528 Jones Adeline (c) ROOSEVELT (V)--West from 115 6 Nirenstein Leon Edgewood av intersects Penn, 1st n of Douglas Davis Chas L--1741-J 602 Watson Wm (c) 83 (114) Williams Russell (c) 93 (113) Bonner Shelton (c) 120 Vacant , 123 Robinson Viola (c) 124 King Taylor (c) 125 James Eva (c) 131 Jones Sol (c) 134 Howard Clara (c) 135 Chaney Maynard (c) 137 (140) Walker Winston (c) 138 Dudley Carey (c) 139 Vacant 203 Chambliss Kittie (c) 205 Maddox Jesse E (c) (o)-- 7 Carswell Kenneth E--3393-R Head Juliette Mrs (o) Head Gilbert--6318-J ROSS--Southwest from 280 Columbus 103 George John G--3370-W 106 Sessions Mamie 108 Belding Merrill Myrick Roscoe 122 King Lula (c) 130 Leonard Clifford (c) 131 Layfield Oliver D (o) 135 Kimbrew Ada E Mrs (o)-- 604 Davis Dora (c) 606 Roberts Alice (c) 608 Vacant 609 Wooden Eliza (c) 610 Vacant fill Barron Wm (c) 612 Thorpe Chas (c) 614 Golden Arth (c) 615 Boone Ada (c) 616 Vacant 617 Ellison Reesie (c) 636 Star Mkt gros--3166 651 Banks Geo (c) 652 Hall Wm H (c) 6112-W 206 Williams John (c) 207 Wynn Eug (c) 2195-J Mayo Geo W Maple intersects ROSS ST PL--East from 1 1st n of Maple 208 Davis Porter (c) 139 Gunnell Walter 1 Walker Jas (c) 210 Dudley Polly (c) Parks Candis Mrs 2 Ellis Wm (c) 211 Taylor Georgia (c) Oglethorpe intersects 3 Shedrick Nathl (c) 212 Caruthers Thos (c) 217 Goodyear John K 4 Brown Henry (c) 213 Davis Reuben (c) 218 Stripling Herbert L 5 Wooden Lee (c) 214 Vacant 221 Woodward Felix W 7 Quarterman Wm (c) 215 Jackson Thos (c) 222 Avery Roxie M Mrs--3609-J 8 Finney Anna (c) 217 Matthews Lula (c) (o) 226 Walker Henry G 9 Sims Lizzie (c) 220 Lawrence Jas (c) (o) 227 Carlos Wm ^S 10 Banks Frank (c) 222 Patrick Floyd D (c)--3073-W 232 Crawford Wallace G 11 McGee Felix (c) 225 Kemp Pauline (c) 233 Mercer Martha 12 Lucas Charlotte (c) 226 Brooks Jas (c) 239 Gordon Sami (o) 227 Brown Lemon T (c) 240 Howell Clayton M ROYCREST DR (1)--North 228 Person David (c) 243 Wolf Moses 2900 Forsyth rd, 1st w oi 229 Lowe Wm (c) (o)--6112-J Threatt Dora (c) College *pi * in*tersects erdale dr 105 Jackson Emmett L (o)- 230 (235) Lamar Arth (c) Hazel intersects 5320-R 231 Jones Lucius (c) 307 Willis Lillie T Mrs (o) 233 Vacant Hilborn B Walter ROYE (CH)--West from 381 317 Moran Wm C mus tchr Nono av, 1st n of Suwaneel ROSE AV (PM)--South from Bel- 319 Vacant 102 Kendall Sidney (c) levue rd, 1st w of Forsyth rd 320 Patton Clara Mrs 103 Ashley Essie (c) Payne City Community Hse 321 Rainey John W--6048-M 104 King Olden B (c) {o)--29 324 Odell Kate Mrs 108 Collins Clarence ROSE CREST AV--South from 325 Barker Robt T 110 Crowder John Edgewood av, bet 1st & 2d 334 Pope Sallie Mrs 112 (150) Meeks Jas J 101 Singleton Naomi (c) 335 Hughes Aug--2219-J 114 Vacant Baldwin's and TelegM 116 Wynn Yancey L 118 Estes Wm H 120 (175) Vacant 163 Goodloe Lilia (c) 309 Coulter Wm R 315 Gilman Gro Gilman Onnie F (o) 400 Banks Lucy C (c) (o) 165 Mims Adolphus (c) (o) 169 Kind Elisha (c) Bell av intersects 200 Hartry Luke (c) RYALS AV--South from Ransome av, 1st w of Clisby pi 101 Ricketson James E--2169-M 202 (174) Boone Sylvia (c) 204 (203) Askew Wm (c) 206 (224) Davis Arth L (c) (0) 208 (220) Harris Seymour (c) (o) 212 (227) Fountain Asa (c) 214 (229) Robinson Jas (c) 216 (240) Hudson Sami (c) 300 (164) Thomas Chas (c) 302 (258) Josey Eli (c) 304 (256) Edwards Robt (c) 306 (243) Brooks Lucy (c) ST JAMES AV (SM)--West from 3000 Houston av 101 Boon Mattie L Mrs--3889-J 102 McCowen Roy N (o)--2158-J 103 Smith Bewel B 105 Parrish Sol A (o)--4065-M 106 Pierce Gordon I--3889-R 108 Toole Ambrose W 109 Copeland Ernest C (o)-- 2034-W 308 (238) Simmons Alonzo (c) 312 (240) Tolbert Henry (c) 316 (242) Mitchell Chas (c) 318 (343) Hill Hattie (c) Hawkins av intersects 400 Marchman Leola (c) (o) 402 Wilder Nathl (c) (o) 410 Clarington Jas (c) ST JOHN (EM)--West from 302 Fort Hill, to Church 101 Hughes Kittie C Mrs (o) 102 Grimsley Geo T 103 Martin Dominigos 104 Lynn Dewey 105 Ryles Jos K 106 Jones G Dewey (o)--220-R UBY (V)--North from 342 Douglas av, 1st w of Forest av 100 Vacant 107 O'Brien Thos 109 Houston W Bernard (o)-- 1303-J 102 Cook Aaron (c) 104 Jefferson Annie M (c) 106 Givens Raymond Jr (c) 108 Holt J C (c) ST PAUL--West from 400 Forsyth to C of Ga Ry 1 Roberts Jesse C 110 Davis Eliza S (c) 112 Davis Robt (c) SAN JUAN--South from 106 Villa Crest, 1st e of Houston av UTHERFORD AV (SM)--East from 3000 Houston av, 1st s of Cleveland 97 Nazarene Mission 108 Griffin Berry L (o) 110 Deal Fernando D (o)--2559-W 112 Byrd M Lilia Mrs--5462 114 Moncrief Marion W (o)-- 2559-J 116 Deal Jesse B 118 Gresham Ferdinand W 121 Holloway Jeff 123 Cone Jack 125 Batchelor Mary A Mrs (o) 333 Brantley Harry T Villa Es*ta*int*ersects Lynmore * av* intersects Moore* in*ter*sects Richmond intersects 714 Woodall Jas W (o) 718 (208) Woodall Chas J (o) 720 Davis Jos W (o) 724 Stovall Geo R Fulton intersects 800 Sherwood Lbr Co--1763 12 Noble Howard 14-16 Ward John T 18 Floyd Clarence E 20 Wallace Leslie D 22-24 Floyd L Belle Mrs 26 Avret Nathl T 28 Floyd Wm S Olive intersects 30-32 Murphy Henry J--4275-J 34-36 Wright Jas 38-40 Poole Eva Mrs 113 Holcomb Bryant M 132 (419) Warren John W 134 Wood Chas SCHOFIELD--North from Hudson, 1st w of Gustin av 42 (50) Eady Paul W (c) 48 (52) Vacant 50 (58) Davis Annie L (c) 64 Franks Jas (c) 66 Hall Ella (c) 68 Willis Jesse (c) (o) 70 Smith John (c) 71 Wright Annie (c) 72 Jackson Jesse (c) 73 (80) Lockett Chas (c) 75 (82) Sims Jas (c) 77 (78) Jackson Chas (c) 82 (168) Jones Emma (c) 88 (134) Vacant 92 (4) Stevens Rufus (c) 94 (5) Adams Crawford (c) SCHOOL (SM)--West from 2301 2d to Knott 107 Gregory Homer F 111 Stewart Walker W 112 Bassett Mallary E (o)-- 2114-W 114 Hart Jos D 115 Standridge Chas C 116 Gregory Hannah Mrs 117 Avery Gordon A 119 Hamilton P Thos--2114-J 121 Harvey Edw D--983-J 252 (253) Harper Frank R 254 Manning Paul W SHAMROCK--South from College to Ash, 1st w of Ross 96 Penhyman Albert (c) 98 Jenkins Henry (c) 127 Jenkins Thos A 129 Vacant Bacon intersects 206 Cone Asolene Mrs (o) nurse McDermott Sarah W Mrs 210 Thurmond J Clifford (o)-- 2433-W 279 McDonald Wm H 281 Harmount Edwin H--3889-W 283 Hammond Andrew J 285 Carmichael E Emory--4065-R 287 Hightower Sumpter C 289 Hawkins Frank H 291 Etheredge Edw C SAPP AV (U)--East from 100 Key, 1st s of Dempsey av 100 Holt Sami (c) 103 Williams Beulah (c) 104 Jackson Emma (c) 107 Hopkins Geo (c) 108 Edwards Chas 111 Howard Alex 112 Hodrick Oscar (c) 113 Jackson Richd (c) 114 Lawrence Sallie (c) 115 Sledge Collie (c) 117 Mathis Henry College intersects 122 Vacant 126 (125) Mathis Edw (c) Columbus intersects * * * Oglethorpe intersects 212 Pope Elder (c) 216 Holliman Julian C (c) 218 Hester Sophia (c) 220 Little Roy (c) 222 Vacant 224 Vacant College *pi* in*tersects 293 Johnson Gaines M 295 Freeman John B Simmons intersects 300 White Andrew J 302 Duffell Wm O 303 Clark Harry 304 Hutto Garfield 305 Pate Geo T (o)--3889-M 306 Preston Qscar D 307 Watson Benj W 308 Radcliff Jas E Blount ends SCHATZMAN--West from 421 Broadway, bet Cherry and Poplar Parcel Delivery Co--416 SCHELL AV (EM)--South from 411 Main to Taylor av 2 Daniel J Frank 4 Howell Clarence 6-8 Wade Arth W 10 Massey Herman B Hazel intersects 311 (321) Hencely Leila 313 (319) Shell Clifford A 314 Mitchum Jas E--1379-J 315 Hatton Wm W 316 Vacant 328 Vacant 330 Vacant Ash intersects SHAMROCK (B)--South from 367 Robinson rd 1935 Macon City Directory 591 103 Clyde Juia (c) (o) 105 Dixon Clinton (c) SHARD (SM)--South from 185 Henry, 1st e of Houston av 107 Burnett Chas I (o) SHORT (PM)--East from Bellevue rd, 1st s of Rose av 74 Hullett Geo C 75 Whitlock Thos C 76 Welch A W 77 Adams Horace 107 Grover Sallie (e) 108 Thomas Jos (c) 109 Byrd Harry (c) 110 Foster Shell (c) (o) 115 Brantley Benj (c) (o) 78 Vacant SHERIDAN (V)--West from end of Grant av to Lincoln, 1st n of Pole 79 Durden Elmer A 80-81 House Earl J 100 Taylor Lemon (c) SHORT AL (V)--West from La- mar av, -St n of 400 blk of SHIRLEY HILLS--A suburb nor of North Highlands, and e of Vlneville av 482 Clark Leroy (c) Ocmulgee river 484 Wright Warren (c) SHOALS AL (EM)--South from 448 Clinton, 2d w of Center 411 Gordon Willie (c) 444 (5) Billingslea Mallnda (c) 448 (7) Vacant 485 Wilson Thos (c) (o) 486 Hpward Sol (c) 487 King Lavina (c) 488 Allen Ora (c) 489 Butts Marcenia (c) (o) Shoals la Intersects 452 Sherman Willie M (c) (o) 611 DeVoes Georgia (c) 612 Gordon Ruben (c) 613 Johnson Annie (c) 619 Hanks John (c) SHORT LA (EM)--North from 205 Cowan, 1st w of Center 107 Manley Jas (c) 109 Balkcom Elder, (c) 110 Battle Mazie (c) 111 Brown Roberta (c) 112 Vacant SHOALS LA (EM)--Northwest Hall intersects from 452 Shoals al 200 New Jerusalem Primitive 111 Brown Annie (c) Bapt Ch (c) 113 Hanks Lucy (c) 220 Butts Wm Rev --West from Flo e Nono av, 1st n of Dempsey av /'; 103 Buckney Julia (c) SUWANBE AV--West from 200 R Pio Nono av, to Hillcrest av H 384 Kuhn Fredk V--2357 a 390 Turlington Walter C--3903 396 (405) McCord Wm E--3872 Inverness intersects 401 Williams Wm V (o)--3195-J Crescent av intersects S!v 402 (389) Bell Hallie B (o)--554-W SY1CstAsMOofRE3d--aWvest from Forest, 1*113 (121) Hawes Edw H (c) gro fi 115 Pinkston W Asberry (c) * 117 Baull Wm (c) (o) if 119 (123) Whigham Luther (c) (o) Tatnall la intersects 119 St Luke Hosp (c)--1157 120 Hopkins Chas (c) 121 (119) Bradley Laura (c) 122 Ellis Lucius (c) 123 (121) Hampton Susan (c) 125 (143) Green Celia (c) (o) Chestnut intersects 202 Williams Rubin E 204 Clay Georgia 206 Goodwin Beennie F--4077-J 208 Gibson Thos A 217 Rogers Pearl--3789-W 219 Lavender Clinton D (o)-- 3789-J 221 Jenkins Rufus F 222 Scarborough Jas A--3299-W 223 Martin Oscar L (o)--3789-M 229 Green Wm A--1527-R 230 Sheridan Albert HI--1527-W 232 Campbell Enoch B--3385-J 233 Evans Archie P--2400 234 Macey Jos M--3421-W Oglethorpe intersects TATNALL LA--Northwest from 117 Tatnall la 111 Jackson Chas (c) 113 Evans Wm (c) 119 Brown's Chapel Bapt Ch (c) 120 Long Laura (c) 122 Curry Dossie (c) 124 Crawford Phoebe (c) 126 Guyton Fred (c) 204 (1) Whitfield Mack (c) 206 (2) Harpe Wm (c) 208 (4) Wilson James (c) 210 (650) Griswold Eva M (c) 212 (3) Mims Chas (c) 214 (128) Vacant 215 (264) Vacant 216 (129) Vacant 217 (252) Vacant TELFAIR--South from intersec- tion of Hawthorne and Hazel 100 Comer Edw (c) 101 Burney Walter (c) 103 Daniel Walter (c) 105 Young James (c) 115 Honea Dock (c) lunchrm 117 Overstreet Anna (c) 121 Patterson Jas (c) (o)--5558 123 Foreman Green J (c) (o) 127 Jordan Rachel (c) 131 Lightfoot Robt (c) 163 Clark Mary (c) 165"Mitheell W Henry (c) 168 Thomas Zeb (c) 169 Reddick Isaiah (c) Ash intersects 201 Clowers Bessie (c) gro 215 Clowers Geo (c) (o) 216 Washington Jennie (c) 217 McClendon Berry B Rev (o) (o)--6480 218 Evans Isom (c) (o)--2488-J 220 Dumas Danl (c)--3978-R 221 Stevens Wilson W (c) (o) 226 White Ohgerreter (c) (o) 227 Fleming Matthew L (c) (o) 229 Lockett Dock (c) 230 Cater Albert (c) (o) 232 McElhaney Robt (c) 233 Little Arth (c) 234 Caslin Chas (c) (o)--3953-J 235 Griffin Ethel (c) 236 Richardson Pearl (c) (o) 238 English Hannah (c) (o) Elm intersects 302 Matherson Edw (c) lunchrm 304 Howard Lillie G (c) (o) 312 Frederick Martha (c) 313 Grigsby Evalena (c) 314 Middlebrooks Laura (c) (o) 315-17 Robertson Zack (c) barbecue 392 Wood India (c) 5 122 Goode Mattie (c) TATNALL SQ--One blk north of 394 Threatt Bessie (c) I 123 (119) Huff Vanderbilt (c) H 124 Young Mary (c) (o) Mercer Univ 396 Lewis Lorenzo (c) 398 Lewis Easter (c) t 128 Lockett Martha (c) (o) K 130 Risby Emory (c) I 132 (131) Rogers Eliza (c) I 134 Jones Ulysses (c) TAYLOR (EM)--East from Fort Hill to Kitchen, 1st n of Mitchell 138 Reese Jas (c) (o) Ballard intersects Englewood av intersects 420 Stuckey Blanton (c) 422 Lindsey Lucille (c) 425 Ingram B S Sch (c) I 136 Morris Aggie e(c) !, 138 (141) Brown Jas (c) (o) 140 (137) Pate Elisha (c). . I 141 (138) Vacant I 142 (140) Green Nesby (c) 143 Lowe Bigus C (c) (o) 144 Franklin Lonniee (c) (o) 146 (145) Burton Blanchee (c) 318 (418) Morgan Grant (c) (o) 340 Frederick Abr (c) 401 Skinner Ephraim J (c) (o) 403 McCall Wm (c) (o) Norris intersects 900 (890) Davis Edw (c) ; 901 Henry Barnard (c) 147 (151) Tasker Beenj (c) (o) 148 (146) Butts Amanda (c) 149 Brown Irene (c) 150 (147) Mathis Wiley (c) j 152 Ingram Emma (c) TAYLOR AL (EM)--South from 901 Taylor to Fort Hill Cemetery 6 Collins Sami (c) 7 Butler John (c) i 154 Smith Annie (c) (o) I1 , 156 Latimer Adolphus (c) 158 Shatteen Violet (c) TAYLOR AV (EM)--South from 42 Hydroila, 2d e of Main 160 Hardeman Theo (c) 28 Wade John W 162 Davis Obie (c) 29 Adams Bartow 164 Foster Jas (c) 30 Jones Wm B 31 Smith Robt L | TATNALL--South from Forsyth 32 Beck Edw O to Oglethorpe, 1 w of Adams 33 Findlay Harry 111 Lawson Annie (c) 34 Lyles Robt L 113 Irving Sallie M (c> 35 Williams Geo J 114 Lewis Martha (c) (o) j 36 Mosely Arth W 116 Conner Frank (c) 37 Clark Mack L 117 Dyer Crawford W (o) (o)-- 38 Laveneder Lydel B 2746 39 Smith Milo W 429 Flanders Jacob (c) 431 Collins Wm (c) 436 Starke Chas (c) 442 Edwards John W (o) gro Brig*ht e*nds Prince ends 505 Lansing Maude Mrs 506 Mason James D 507 Vacant 510 Vacant 512 Holmes Christopher 513 Womack 528 Gray Mansfield F 532 Howard Harvey 535 Herring John L (o)--5549-M 538 Grant Robt A Pebble ends 545 Atwell Mary F Mrs gro-- 2408-J 549 Atwell Geo D Henrietta begins 551 Riley Jas (c) 553 Williams Jas (c) 557 Hester Robt L gro 603 Smith John (c) 605 Sutton Albert (c) 1935 Macon City Directory 595 607 Green Edw (c) 614 Waits Troy L gro 616 Jackson Wm (c) 618 Dixon Marshall (c) 207 (404) Vacant 208 (240) Vacant 209 (248) Wright Pink (c) 210 (242) Vacant 214 Hart Dock (c) (o) 224 Harrington Ernest (c) 226 (133) Phillips Bessie (c) 239 Harvey Luther (c) 633 Jones Augusta Mrs (o)-- 212 (240) Vacant 241 Smith Estella (c) 2045-J 214 (238) Vacant 243 Barrett Joseph (c) 215 (434) Lundy Wm E (c) TENNEY AV (SM>--Northwest 216 (236) Stevens Rosa (c) 245 King Alex (c) 271 Carswell Sherman (c) from 250 Jeff Davis, 1st s of Emory TINDALL AV (SM)--South from Elizabeth intersects 301 (302) Durham Thos (c) 116 Dunn John H (o)--3130-R 900 blk Edgewood av, 1st w of 303 (300) Dixon Jerome (c) 118 Vacant Campbell 305 (308) Hill Mary L (c) 119 Edwards Corliss H (o)-- 3130-J 122 Copper Jos T 123 Jones Claude E (o)--5458-W 101 Thompson Richd (c) 102 Wynne Chas (c) 103 Durham Allen (c) 104 Benford Carrie (c) 307 (304) White Lucius (c) 309 (306) Davis Eug (c) (o)-- 3235-W 310 (346) Lamar yinie (c) 125 Clark Deester C (o) 128 Brown John W 105 Williams Cleveland (c) 106 Durham Wm (c) 312 (344) Vacant 314 (342) Waters Moses (c) 131 Happoldt Chas E 134 Campbell Wm M 107 Booker Mamie (c) 108 Hardeman Columbus (c) 316 (340) Chappell Amos (c) (o) 326 Irvin Wm (c) (o) 138 Bassett Annie R Mrs 139 Lamon Sarah C Mrs (o)-- 5242-J 109 Collins Arth (c) 110 McElroy Eli (c) 111 Bass Eva (c) 329 Williams Lula (c) (o) Henrietta intersects 400 Williams Benj (c) 141 Aids Wiley D 112 Dreyford Wm (o) 402 Vacant 143 Wiggins W Carl 115 Jackson Lillie (c) 436 Perry Addie (c) (o) 148 Scarborough Dillie I Mrs-- 492-W 116 (188) Hill Jas (c) 117 Mallard Richd (c) (o)-- 437 Kilgore Walter (c) (o) 438 Hill Walter (c) 150 Hamilton Albert D--3130-M 3491-W TERMINAL AV--West from 225 118 Baker Rosa (c) 120 Sanders Edw (c) 440 Cody Edw (c) (o)--1320-W 441 (469) Leary Oscar (c) 443 Willis Joseph (c) Walnut, bet 6th and 5th 122 Smith Priscilla (c) 444 Patrick Sami (c)--5833-R 3 Vacant 124 Jones Frances (c) 445 Gragg Chas H (c) 5 Ruan & Co mdse brokers--928 194 Marshall Uriah (c) 446 TMnity C M E Ch (c) 7 Barden & Taylor whol gros-- 142 196 Jones Rufus (c) 198 Johnson Nathl (c) Curd intersects 541 (441) Stafford Olivia (c) 9 Ouzts-Mitchell & Whaley Inc brokers--964 Prince intersects 202 Calhoun Lyman (c) 545 (445) Lowe Geo (c) 547 (41) Mohone Grant (c) (o)-- Kent & Herin whol gros--746 210 McCrary Mary (c) (o) 11-13 Macon Banana & Prod Co Inc--697 1292-W 109 Oglesby Graham Rev 549s (4393)55R4-aJwlins Sarah (c) (o) 111 Sandefur Wilson G TINSLEY LA--Northwest from TEXAS (SM)--North & south from 712 Charles, 1st e of 128 Donaldson Sidney E 134 Donaldson Revester 555 College to Frank av 101 (25) Paul Laura M (c) Toombs 102 (554) White Benj (c) 101 Howard John (c) 104 (204) Moss Aaron (c) THOMAS (Mikado pi)--East from 3952 Houston av 103 (27) Fitch Lillie (c) 106 (540) Vacant Colquitt Intersects 200 Zachery Alonzo (c) 201 Johnson Luther (c) Charles Intersects 302 Pitts Richd (c) Crisp intersects 3 Kah Geo T (o) 100 Molton John T Jr 109 English B Wallace (o)-- 3469-J Capital av intersects 202 Richard Wilmer E (o) Arlington pi intersects 109 (29) Jackson Leroy (c) 111 (541) Decker Ethel (c) 112 (550) Little Oscar --832 106 Holmes Wm B (o)--5608 WALL ST LA--North from 7th to 6th, bet Cherry & Mulberry 107 Thomas Jas A (o)--1634 116 Vacant 119 Winchester Thos H (o)--618-J 121 Grubbs Alf L--719-W 4 Wynn Orie (c) 5 Bryant Dollie (c) 6 Haddock Bessie (c) 19 Billingslea Eugenia (c) VIRGIN AL--See Virgin la 123 Graham J Ellis--5079 Woodland av intersects 26 Archer Ella M (c) 28 Byron Wm (c) VIRGIN LA (V)--South from 341 Sanleman av (opp Pursley) 204 (100) Harris Peter (c) 206 (120) Wright Warren (c) 207 (123) Walker Sol (c) 208 (122) Harper Emma (c) 209 (125) Howard Hayes (c) 211 (127) Richardson Other (c) 212 (6) Jones Florence (c) 213 (143) Boswell Chas (c) 215 (131) Nixon Clifford (c) 216 (206 (Simmons Sarah (c) 218 (367) Vacant 220 (12) Jones Susie (c) 224 (446) Rouse Wm (c) 226 (43) Byars Thos (C) 228 (44) Vacant 230 ( 21) Vacant 232 Williams John H (c) 201 Tharpe G Herbert (o)--1805 202 Long Margt M Mrs (o)-- 5380-J WALL'S AL (o) 1215 (1123) Young Lymon (c) (o) j Bowman intersects 5 Brown Joseph (c) 6 Cornelius Tillman (c) Wellbourne begins 1301 (123) Hill Benj (c) 1303 (514) Wimberly Gifford (c) r 7 Beell Anna (c) 8 Finney Robt (c) Madison intersects 101 Barnes Benj (c) 103 Hill Otis (c) 104 Daniel Emma (c) 105 Tuff Roland (c) 106 Smith Wm J (c) 107 Thomas Edw (c) 108 Cowan Minnie L (c) 109 Cornelius Oneal (c) Bostic la intersects 111 Ford Matilda (c) 113 Newsome Joseph (c) 115 McDowell David (c) 117 Youngblood Benj (c) 119 Crumbley Rebecca (c) 121 Simmons Edna M (c) 123 Mosley Mattie (c) 127 Anderson Mary (c) 128 Wesley Romeo (c) 129 Church of God (c) 134 Hutchings Emma (c) 136 Stanford James L (c) 138 Stubbs Ella (c) Siam begins 428 Vacant 429 Vacant 452 Flowers John W (o)--4099-W 453 Robinson Laura Mrs 455 Bagley Leo WOBSHAM AV (Lynmore Estates)--Southwest from Antioch rd, 1st s of Fulton 56 Keen Jas W (o)--5671-W 369 Clark Claude C 465 Ledbetter Hubert (o) 530 Redd Percy R 555 (427) Hartsell Willard 556 Hose Felton H (o) WRIGHT AL--North from Spring, bet Willow & Ocmulgeee 27-32 Vacant 557 Campbell Eug 560 Ogburn Leon B (o)--4099-M 563 Holloman Jas F Lexington begins 600 (356) Hinson Henry T--344-J 601 Cowan T Walker 603 Hinson Wm A 604 (352) Roberts Frank 606 (350) Carmichael Jos F WYCHE (SM)--East from 2166 2d, 1st s of De Borde ! 108 Briscoe Agnes (c) 111 Wilder John T (c) 112 Rainey Rome 117 Wilder Mamie (c) 124 Akins Thos (c) 127 Chatfleld Minnie B (c); 16S Ballard intersects 607 Crumbliss Sewell H 608 (306) Walls Harris C WYCHE'S AL--East from 2104 2d, 1st s of Giles 615 (301) Cowan Lillie M Mrs (o) 2115 Statham Eug (c) --1594-J 2116 Knight Jack (c) Center intersects 2117 Mack Edw (c) Monroe intersects 700 Stembridge Jack C 2118 McCoy Sami (c) I 202 Scott Hattie C (c) 204 Maddox Sim (c) 702 Mitchell Wm R 703 Holloway E Hughes 2119 Barge Emma (c) 206 Bonner Julia M (c) 704 Jones Clarence G YATES AL--Northwest from 136 208 High Frances (c) 706 Pierson John S (o) Yates av to 2d 210 Williams Cleveland (c) 212 Richardson Ida (c) 214 Pennyman Andrew (c) 216 Litte Eug (c) 218 Lewis Susie (c) 707 (720) Folsom Marcus B (o)-- 3504-J 708 Williamson Nora Mrs 713 Wyche Benj F--2456-W 716 Vacant 203 Card Booker (c) 205 Stone Andrew (c) 211 Bryan Annie M (c) 212 Walker Mattie (c) 219 Freeman Mary (c) 220 Brooks Fannie (c) 221 Todd Babe (c) 720 Dismukes Monroe Womack intersects 804 Munsch Annie Mrs 213 Middlebrooks Mattie Edison intersects (c) 30: 258 Vinson Dora (c) 226 Harris Paul (c) 805 Hubbard Lucy I Mrs--4979 260 Johnson Wm (c) 227 Norbert Wm (c) 228 Toomer Beatrice (c) 229 King Della (c) "* Purvis Reuben 808 Ryles Geo T 809 Patterson Lonniee E YATES AV--Northwest from Em* erald, 1st ne of Flanders 230 Scott Elder (c) 231 Vacant 810 Lyles J Frank 812 Liles Wiley W 94 (93) Stinson Alf L 96 (95) Leslie Lena R Mrs 232 Vacant 813 Lavender Minnie L Mrs (o) Emerald intersects 233 Vacant Fort Hill intersects 234 Wimberly Lonnie (c) 931 Davis Lula (c) 234% Cubie Annie (c) 933 Cullens Wm (c) 235 Dugan Henry (c) 236 Vacant 237 Cheeves Albert 4170-J (c) (o)- Maynard intersects * Norris intersects 238 Davis Marshall (c) 239 Lockhart Geo (o) (o) 240 Slaughter Robt (c) 241 Grady Hampton (c) 242 Wilson Chas (c) 243 Vacant 247 Culpepper Lena (e) 249 Lane Annie (c) 253 Vacant 255 Felder Simon (c) 257 Carswell Lindsey (c) 259 Lamar James (c) 261 Thomas Fannie (c) 263 Williams Clifofrd (c) 265 Jones Aaron A (c) 267 Cooper Lucius (c) | 1100 East Side Memorial Institutional Bapt Ch (c) 1101 (801) Edmond TUt (c) 1103 (803) Taylor Hattie L (c) 1105 (805) Wimberly Henry (c) 1113 (222) McCarty Chas (c) (o) 1115 (221) Ponder Pink (c) 1119 (112) Keaton Oscar (c) 149 (349) Lyles Duke (c) 1151 (811) Lundy Claudia (c) Short intersects | 1200 (1100) Vacant 1202 (1134) Cullins Lennie (c) 1204 (339) Vacant ! 1208 (404) Whitehead Anthony (c) 1210 (326) Booker Lee (c) WOOLFOLK (EM)--East Melrose to limits, 1st n of from Broad [ 1211 1212 1213 (110) Waters Jos (c) (327) Jackson Mahala (175) Williams Ida M (c) (c) 101 Cheshire Jos E 102 Boatwright Jennie (o)--478-M 104 Shelton Chas L 105 Vacant Gant intersects 108 Asbell Walter 109 Pruett Ira A (o) 110 Defore Danl 111 Smith Susie Mrs (o)--1482-W 112 Sharpe Harrison 113 Vacant 114 Vacant 115 Vacant 116 Hornsby Paul 117 Byrd Ferdinand E Byrd Hiram V 118 Gurganious Homer 119 Chester Hansford D Center intersects 120 Smith Lizzie G Mrs 122 Vacant 123 Lundy A Malissa 125 Vacant 126 Vacant 128 Vacant 129 Brisendine Wm E 130 Vacant 604 Baldwin's and Telegraph's ."Maiwa Southwest from river, 1st se * * * 2 Willett Dora--1510-J ; New ! Ellison Wm (c) Ocmulgee intersects Poplar intersects 3 Burdge Wm R 506 Ga Nat Guard Armory 508 Stansell Potato Chip & Sand- 4 Bryant Oscar D Street continued [ Hendrix Irene (o)--5118-R 1 Newsome Wm F--2313-M i Vacant ! Vacant 1 Hunnicutt Edw R - Leming Vassar F ) Filsinger Conrad N 1B1 Sanders Wm W 122 Roberts Thos M 124 Logan Lonnie N--1542-M lijil McKinney G Willis Sloan Nora C Mrs (o)-- 5118-W ffi? Carr Annie C Mrs wich Co Inc--5976 866 Holcomb Christopher C 510 Vacant 512 Wood Thos L plmbg contr-- 867 Kimball John J (o)--6523-W 870 Collins Jesse D (o)--3282-W 529 874 Layfield Edw R (o)--3741-J Master Plmbrs Assn of Macon Stephens Walter C Arch intersects 514 Muecke 4364 Rudolph J antiques ---- Price S B Free Library 920 Muecke Wm F (o) --- Storage Battery Co The--447 920 (r) Jordan Olin (c) 518 Vacant 554 Wilson Florence Mrs bdg-- 960 Tharpe Raymond L 970 Champion B Jeff serv sta-- 2841-J 9328 555 Vacant 557 Osborne Otto O Oglethorpe intersects 1011 Fincher Arth B 164 Greene Fredk J--2447-J 567 Norris J Leslie--3571-J 1013 Bibb Mfg Co club hse 3IBg---- DWainll*iesl CJuWdsmon J 568 White Kate Mrs--1670-J 569 Lowe John A--2233-J Bibb av intersects 1015 Vacant H6S Rooks Mary 570 Plum St Serv Sta--9175 1017 Ellis Whitford C Walnut intersects Plum intersects 1029 Motes W Clarence *:J02 GeeSlin Benj F ' ` 600 McKenney & Adams serv sta 1031 Moore Irvin *"3 Simmons Walter B --9444 1039 Holtzclaw Earl J Mound Wessie V--2842-W Russell Wm E 6 Smith Mattie Mrs 9 Parrish Sallie T furn rms-- 6272 0 Branan Henry L 5 Pair John E--3754-J - Pair Laura H Mrs furn rms 16 Meath Nora Mrs (o)--739-J .17 Hamilton Annie W Mrs-- 3676-W 20 Soloman Eliz Mrs--3739 52 Finley Lola E Mrs (o)-- 1684-J Whitehurst Eugenia J Mrs (o) furn rms Mulberry intersects 01 Goodrich Silveftown Stores serv sta--6311 20 Joiner Bennett A serv sta 21 Wagner Marie--2644-J Brown W Ralph Mann Jack N--2644-J Stbkes C Baxter 352 MacMillan Tire Retreadihg-- 1716 353 McArthur Paul A--2752 McArthur LuCile Mrs physio therapist 354 Southern Mtge Co Inc--3315 - Holding Comm Co--3315 357 Beall Trueser Mrs--2286 361 Kea Emma Mrs furn rms--; 2644-M 362 Macon Auto Exch--9185 ,3--64 Auto Banx used cars--2867 Chambliss Roy auto repr 369 Nolan Alvin E--6264 601 Congregation Sherah Israel 605 Kane Mary Mrs--2594-J 608 Clark Leonard D--5735-J ---- Smith G Harvey 613 Wood Hollis J--5479 Richards Carson 616 Yeomans Hershall V--2783 619 Roberts Lelia Mrs furn rms --3829 620 Thompson Wm W 622 Tyner Chester G 624 Blasingame Grady W 626 Higgison Wm R 654 McNelis Patk G--5918-W 655 Jonees Albert E--2594-W 658 Cassidy Hananh Mrs (o)-- 2120-W 659 Adleton Horace--3028-M McCullough Jas C 668 Cassidy Cecile Mrs (o)-- 5918-J 669 Jonees Jas D--2567-J Pine intersects 702 Graddy Henry D--742-W 706 Grant Mary--3149-M Whited Sallie Mrs 712 Wilson Jas M--3859-J 717 Bedingfield Geo (o)--4215 Gibson Clifford B ---- Hughley Minter Matthews Jetta Mrs 720 Williams Chauncey D--1619-R 722 Mullenix David H--143 Radio Service Co Stansell Wm H 723 Stembridge Lena Mrs--1994-J 753 Evans T Edwin 754 Newton Arth F (o)--1335 1039 Walker Jerry 1041 Stewart Leonard H 1043 McGahee Thos W Hawthorne intersects 1203 Vacant 1205 Billingslea Burrell (c) 1207 Vacant 1209 Roberts Henry (c) 1211 Flowers Alberta 1226 Gardner Rufus (c) 1230 Williams Emma (c). 1234 King Clarence (c) 1238 Henderson Eva (c) Hazel intersects 1303 Thomas Lucretia (c) 1304 Friendship Bapt Ch (c) 1309 Fann Tob'ie (c) 1311 Reed Wm (c) 1313 Holloway Jas (c) 1314 Taylor Clinton (c) 1315 Davis Lucius (c) 1316 Ingram Thos (c) (o) 1322 Mitchell Minnie (c) 1324 Young Israel (c) 1326 Danley Wiley (c) 1327 Miller Ollie (c) 1329 Tinsley Wm (c) 1330 Thomas Ethel (c) 1331 Glowers Eug (c) 1333 Tinsley Kimball (c) 1335 Baker Julia (c) Ash intersects 1413 Atwood Dorothy M (c) 1414 Merritt B F Coal & Wood --4997 Elm intersects 1524 Person Wm B (c) 1526 Spivey Oliver (c) Co 379 Y M C A--4271 Cherry intersects 759 Stevens Mattie--5514-W 760 Branan Helen Mrs 1528 Hill Obie (c). 1531 Byrd Thos M 401-09 Municipal Auditorium--44 Johnson Belle B Mrs (o) 1535 Vacant -- Vandergriff Edwin C ofc Stubbs Albert J--3963-J 1537 Yaughn W Frank 451-53 Young Bob Used Car Exch 771 Thompson Jos A--3424-J 1539 Benson Mary Mrs --9118 Hemlock intersects 1541 McCune John Hudson Clifford T sign pntr 820 Wellons Colin E--660-J 452 Piggly Wiggly gros--3268 822 Clemonts J Monroe 454 Sapp Ellis R gro--9290 Harvey Hershel--2030-M 1543 Watson Wm J Edgewood av intersects 1600 Holmes Lewis (c) 852 Shelverton Fannie J Mrs (o) 1603 Germany Frank (C) (o) 464 Trading Post genl mdse--768 3869 859 First St M E Ch 468 Macon Volunteers Armory 861 Harbour C Byrd Rev--3307 472 Volunteer Pharm--926 865 Apartments 1604 Easton Dena (c) 1606 Frazier Chas (c) 1630 Woodward Lizzie (c) (o)-- J2892-W I Cotton Intersects 1 Sanders Isrella Liberty intersects 1935 Macon City Directory 605 1632 Schumake Mozelle (c) 1633 Vacant 1634 Holden Jas (c)--5851-R 1638 Vacant 1640 Sanford Jas (o) 1642 Rhynes Dock (c) 1ST (SM)--West from Plant, 1st s of Dempsey av 100 Morgan Carl R 102 Morgan Hubert M 104 Hamlin Lovett C College intersects 204 Lee John W (o) 1ST EAST (EM)--East from river to Broad, 1st n of 2d 301 Patterson Levi (c) 302 Hall Luellen (c) 308 Appling Rosa (c) (o) 314 McGarr Ella (c) (o) Flanders intersects 401 Woodford Wm (c)--5319-J 404 White Arth (c) 405 Jackson Ernest (c) 407 Miller Wm (c) 408 Lundy Ida (c) 409 Smith Dora (c) 410 Giiliard Sarah (c) 411 (415) Napier Henry (c) 412 Vacant 414 Tuff Wm (c) 416 Hairston Peter (c) 417 Vann Harrison W (c) (o) Marth*a i*ntersects Melros*e intersects Washington intersects 501 Latham Jas (c) 503 Smith Ollie (c) 503(4 Tolbert Chas (c) 509 Thomas Chas (c) 511 Dunn Solomon (c) (o) 517 Brisker Ola (c) 623 Jackson Maria (c) 525 Bowers Edw (c) (o) 526 Burden Emma (c) 531 Brown Jas C (c) 129 Stroud Wm (c) 136 Vacant 203 Head Geo (c) 205 McWhorten Henrietta (c) 207 (193) Blassingame Ariie (c) (o) 501 Hickson Chas B (c) (o) 100 Keefer Bessie Mrs 102 Vacant 104 Lee Alex B (o)--2593-J 105 Elder W Grady--5654-W 106 Wells Wm D (o)--50 108 Dunbar John G--5654-J Harper Mamie M Mrs 1ST AV (V)--A westward continuation of Jefferson, 1st n of Hardeman 100 Stevens John (c) 134 Coleman Leila (c) 138 McCall Carrie (c) 139 Heerndon Ella (c) (o) 140 Piercy Alex Z (c) 141 Reeves Albert (c) (o) 142 Goodwin Fannie (c) (o) 143 Hatfield Pelligrine M (c) (o) --4422 145 Brookins Terry (c) (o) 147 Warren M E Ch (c) 150 Thomas Scott (c) 152 Brown Hattie (c) (o)--1108-J 173 Battle Mattie (c) 110 McCrea Wm K (o)--2503-W| 111 Smith Sallie M Mrs 117 Hawkins Jas W--1979 122 Vacant 123 Griffin David J (o)---2321-J| 124 Zarks Max--1080-R 128 Chestny Percy (o) 151 Mason Minnie H Mrs (o)-- | 1435-J 151 (r) Jackson Thos 155 Frick Geo E--2207-W 163 Feb Josephine S Mrs--1352| 165 Joiner Florence Mrs (o)- 2866-J Walnut intersects 207 Cheves Serv Sta--5832 208-12 Macon Transient Bur--21I| 211 Rowe Nannie Mrs Middle intersects 215 Wynn Henry (c) (o) 217 Myers Gertrude (c) (o) 219 Williams Geo (c) 224 Gatson Wm L (c) (o) 226 Glasco Alvin L (c) (o) 227 Napier Comer (c) 231 Capel Bessie (c) (o) 236 White Edw (c) 238 Jones Kate (c) 239 Williams A Julian (c) (o) .-- 215-21 McCord R A Mtr Co--11 216 Renitz Benj B lawyer--28161 220 Macon Gas Co--6561 256 Ideal Storage Garage--8280 1 256% Vacant 258 Lee A B PImbg & HestinJ Co--2851 260 Eves Elec Co contrs--77 Bibb County Court House Board of Public Education^ 247 1108-M Boy Scouts of Am--2581 244 Leslie Jas (c) 247 Ross Richd L (c) (o)--4775-J 250 Frayser W Neal (c) (o)--264 252 Murphy Anna (c) 255 Banks Geo W (c) (o)--1088 City Court of Macon--1751 County Comrs--412 County Court of Ordinary-| 2428 County Court Reporter-- 260 Spivey Wm (c) (o) 264 Gary John (c) County Jail--261 County Juvenile Court--371 268 Duhart Anderson (c) 273 Jones Clara (c) (o) 280 Davis Josephine (c) (o) 281 West Preston (c) (o) 284 Dawson Wm H (c)--1108-W County Law Library County Probation Officer-- | 3646 ---- County Sheriff--448 County Solr Genl--390 1ST AV (CP)--North from Vineviile av to Ridge av, 1st w of Kenmore 100 Callaway Claude N (o) 104 Langston Henry (o)--1858-R 108 Lifsey Irene T Mrs (o) 289 Fulmore Virgil G (c) (o) 290 Carswell Mattie (c) 296 King Edw (c) 297 Goins Filmore (c) (o) 299 Holloway Bose (c) Johnson Howard L gro Crafts intersects County Superior Court--553 County Surveyor--3821 County Tax Assessors County Tax Coir--661 County Tax Receiver--1084 County Treas--317 Macon Bar Assn 1ST AV (II)--South from 1000 Montpelier av to Neel 101 Riley Essie E (c) 105 Holliman Arth (c) 107 Hickson Wesley (c) 109 Slocum Wm (c) 110 Roquemore Wm (c) 111 Nixon Sami (c) 112 Watkins John H (c) 113 Dewberry Cora (c) 114 Aaron Cassandras (c) 115 Vacant 116 McClinton Evelyn (c) 117 Cornelius Robt (c) (o) 118 Coleman Alice (c) 119 Davis Asa (c) 120 Simmons Jas (c) 121 Bray Chas (c) 122 Vacant 124 Easley Julius (c) 126 Henry Edwin (c) (o) 306 Davis Dove (c) 307 Burke Thos (c) 310 Price Mary (c) 311 Sutton Geo (c) 313 (327) Stafford Josephine (c) 130 Hill Josephine (c) (o) 2608 Cannon Benj H--3774-W 538 Merriweather Arth (c) 133 Carey Jas (c) (o) 2610 White Mabel Bapt Ch 539 Evans Minnie (c) 137 Raiford Mark (c) 2615 Hamlin Jos W ---- McGee Carrie (c) 137 (r) Holmes Viola (c) 2619 Jones Fredk N 540 Norwood Annie K (c) 138 Jackson Tassie (c) Rousseau Edw H 541 Nixon Pinkie (c) (o) 142 Smith Estella (c) Piedmont av intersects 542 Waters Murray (c) 146 Davis Ambrose (c) 2635 Busbee Allen C--29-R 2636 Vacant 2637 Newby Burns--3422-J 543 Hamilton Emanuel (e) (o) Lawton la intersects 148 Vacant 2d (UNIONVILLE--South from 149 Hurley Leila M (c) (o)-- 2639 Simmons Wm W--3193-W Dempsey av, 2d w of Pio Nono 6152-W 2640 Triangle Pharm--1738 , 110 Childs Chapel (c) 155 Fisher Sylvia (c) (o) 1935 Macon City Directory 609 -- 3112111111111523d325d233123311033003137333331033033s3--133237790266059622241424322321202812s32e121212122291259289A9478222127203727A048726I94t6122556M51Vy315KG1444130WK54A1LSS9923K33B38625v2D8C^2062J6473V658L35C269bBYC416RT5HFoMGA4LAe1w80eoeaeJBa0eAB0no8ToGMnLBJolaMeGaTMGiulWGaLolwoSoyrclLoonaSoiJeHTrdMHooRanlvTtooilwSvlJoHVVlyauvareJCltWrJrel6hn(oatowoeurgwcbreoepriporrhoheyioweniiwoeaa,oralynmhWtmoreoihult1taeAttnyoeCsmsehmfyynosChoiaareetkoodvrean3ntenhynecomrciro3ehnall1iyoterawmslmyt1egnlcc2esdaitnfa5dlalorntysherrncsabBnmkMDHe55eielomnrsnBWWtfnefrrLuWsdCaaarOsrd2grondorrrDWl2ehhsas-eKarrstoissaoJnytmustJrlLoumRJ)nmesDWnneRA5Je8riaiwlhanrolKlnoiATiosEnosRo--mmeldymaleauwnmmolrin-MedlnattRlSMmsulRSPtoncaEeJniohSnnJEiJdannandalesmicnodastcJgMnTMakttnleosaatGFsdondyesSulnSlolleadRCWWkiiBasthMaMoRsaertvOHoal(AehuHeemharhSwrLbscMNWoisoPteaRlmaws(Wai(cenaahoefeeratWoiaelrJnacB(olJotcumiprreasrnu)Jaie(Creasath(bwce(irabple)ib(osiesNJemai)mct--tot(rr--ccclnsedncCMa)tyLch(Ksnehis(eiLthect(eyCitmh)hc)o)(hc(he--ei((rei)crlcnesurC(e()(otrMLcccac3(ueho4cn)--t--ny(cd(t)cn)ecTircmlCtaef)l)3ctsc)(8c)ese4()(g)((e)lr((sr)(c((rn5ra)c(5c()ecc3lho81(ccsocce((irW(s)((ol(c4H())o)9g)((a9((oc--8))c)e1os)c)Fec(mc))cccc--)e2h))c()e4)8(c)))f(()()))c(c9)(6-cl9c(ctc(((o()oR(4)oors1(())oo2toDdr)(c(()J)((c1cs)r3(io(oo)5--)))o--cr)vio)o7e5()))0s))s(()5o)m--e---3m8too6(M-)r(o-41))Jp()o3Jk)43o,-)--4r-5,--)4J-7tJ--T44444444~43T13311331130000-- 336--66335546633136338--46253533363333339515235301-- 32-352831112F211A111K22H2-13B13S-00SP1701G--0DG0B086H51C16342113H110M3M%8-e6S-66TMCW4hrMat8.oaeM5415%410V%G-l1aruM%inaJno%GTMtoPo-eBSUs6y-v9u5tJtWBhaU1aWayTarFacnoNeee5itiatPD1eaGMrbtcLoobHoeSm9rhnce3oCnaylzCe'i3rnMnCe2enialru55VlndVBndespclCe4D2gonrem1Bseouoeycadheedal0litss5reorrl1e6cddoi2ttoMSdrhl37iraea6d5cirelne--so3eunitionlesofw6oire1a)'a--r2ayoloo0DsaWgnea4da01fnegopekrlneeemnt6DtseDWssn9Wn6erds8npncctlDcnv7nBJmwf6adaugr&d4irrmrsthadat5eL--t5tC4&ieS1lawOoa'cDdaeierla9MratrlesenoSB7n&ormFS1d--etTslaCRyyebans&eenllahmsW1InnaBlTymEt7ad2ooDhlnretPlGBuni1weshehiltnotTpcohLa7enrWSJ4lEe1naCwcotlpepsWBJpEirCHcLrahldoe'rerIJJeesiesor1inrhiu8SiPoeSrtiatssSnoesylnhsooieoionlslcrlxoaa2tySamogs6elSCeotAasw--tncoemdaSnCiyetmClhortnJTyrpn--CuyhgPmgersTkowgreGhtdISstruerrrlfnoWi--eCFCoroeshrICirn6rorceevioaNrenrlshBh--PnioBynt3edsgpnosi9Cnose--onpuotyraC(&dgP(tHaeso4Jeg0pis----htsnaea0Ibb(c'alse--slC--7i--teeiIe7opcc2nosaeta)lct2iiditrrglor4CnLAnIrrplsad)o5S--43nlot6dsrCwroCbscr2Lt2p0aGrnaus4esae7&cl11w0lse--trcenhgBt2i1kyoecaeoew5rosnysc40ew9nlslbco61ldtroeucm3iyk6dae7a&r3to4hesrsgeyntgpasS--r8tr--trCes2ytmu5snoe--drseseogordS(ss2tr0pateoeGbsnb(3n--rars2h9)sests2ss7rlrnet5ooli--IPC----)0-6adriddI7pr86rssne7roo4tsycC---o66666666666655666656655'6622125551515512111550552500-- 510050523519965554654534-101242591%3471-1144-1044114106507437474612544474567D26646502MMBJ582-85G5S11L55WS22SV7%28T-9111UR29o%7GV0S%1A6%0F1S1C1arHV0Vp-98m%-VoaBoeoSeC-69eDoA7Da%GsiVMEGoeaWab5a&u3BMV'e9trlrS--Tid0uaaMtccWLaaHLa--PBSa4ootso2decSMrlerarasARnrKRa2aVpapickkc3lanmasck9aerricotriayPeudaGertibV9nnSw4lDyNyt2saas8acosA3amaosposcSan4oP7GililaaAkclmcCsa9sr5edu5pnatycnb--8lnEnlll8n-0(nittnl-rac5oanntonhafulrn7ad5taua2eslioltrtPalc1CcFegor7eRpto7rtAaiBekse8SoAosginkcnrtnaml5Clostt6ctsynlDrnrt5i--emngMphB3araaiyeemC6--n--nle--anoS1trmaeagytsoatrSielAnauaeilnn8t--rgmrneylDeeeC'reeeGbrrbolltnmnt--eyhhenaymrgne3tF72tsesids9o6suobttrnurineSoMwMebnrSmboseera37ot0s6nc0ng1dgieiRngiBrtor2trId8HJeevCHmt2uAnee14rIBeo1PiotbegergHnaty&sn0kCodocrnnr6etrir0cnP7ootMysdnfuCCCBe'Clrva0lntrtovJWeoohbgr0co--ektSsngepiiraScBMS0rooosoo&Strl--nunncEuntDgtpGsgrbeyer--sLreI&hoSh4CkRr--asofsrtarpCO&CtldnteCretCCecG3r9oaortiorLlneesuslc--rEsWae1'cmnsccane1it2CoiodaTphsC5Dctcchne--r--Sl6CsfCu1opt--&3sg--f4aCCoteIi4cs4roeaCbEbestooriedec1sra&oCn--1ida82&71nxm--stooe--ro1--aeant9euC1Ssone0c--6i3eeaC--id0TrrLs1op9--sotni00ogus46l3I2br2oba--dost6D--5hbC1 tu11 n1iganti8--33249rwu5teeoe17eaSa6ers4sno2o2c752tsrrosp1sa4n3ueol1t0360Ho6cut--im4go7trt9smo17vIprdh9avern6de1eersl1c1-pln("IIJ Baldwin's and Telegraph'! -91 Kelly-Springfield lire Co Power Oil Co serv sta--3181 1304 Hobbs Leila Mrs 1305 Russell Christopher C Mann Jack Battery Co--6296 1306 Johnson Jos B Pine intersects 1308 Vacant 7bl-07 Yates Motor Co autos--1445 702 Standard Parts Co auto parts--1770 1310 Hill Alf 1314 Green Grady Cherry Andrew J --- Berliner Harold trans--1700 1318 Jones Mary E Mrs--1184-J %06 Carburetor & Elec Serv Inc 1325 Brown Lonnie M --3828 1327 Barfield Darian 8 Pafrish's Garage--3750 10 Burke Hugh A 1328 Jackson Ernest Sanders J Homer 11-15 Roberts Frank autos--5950 1329 Drawhorn Ira J 2 Vacant Logue Amanda A Mrs 14 Matthews Robt A (o) 1330 Avery Feleix P 1723 Langford Sarah E Mrs (o)-- 1691-J 1726 Simmons Jas T 1728 Mize Clarence S (o)--1691-W Violet av intersects 1777 Whitaker Dollie B Mrs (o) 1778 Vacant 1780 Vacant 1782 Jordan E Washington 1783 Vacant Wood intersects 1800 Bush Edw D 1801 Hardy Jas C Williams Thos J 1807 Durden Martha N Mrs (o) 16 Vacant 17 Bibb Auto Serv reprs--717 18 Lanier Louise Mrs 53 Freeman Fannie (c) 65 Dyer Benj H gro 67 Ansley Robt E cbnt mkr Oak Intersects 1331 Lawrence Jas B 1811 Stripling Ethel Mrs 1332 Truesdell Pearl M (o)--1551-J 1812 Vacant 1333 Gilbert Jas F (o)--3883-J 1814 Anderson Jas T 1335 Sitton Emmett L (o) 1817 Bowen Alice Mrs Ash intersects 1823 Smith Annie Mrs 1405 Booker Otis H (o)--2462-J Giles intersects 1411 Allen Wm E 1903 Wadsworth Arth P * * 1414 Simpson Arth B 1907 Hester Loren G Hemlock begins Collins Chester D 1912 Pearson Ralph E 2 Brown Wm W gro--9138 1419 Simpson Jos A 1913 Brown C Noble 808 McElwee Pearl Mrs 1420 Robinson Walter H 1917 Heath Ira C 812 Smith Mary 1421 Kines Lester 1918 Everson Arth 816 Wilson Louise 1424|Weaver Howard A 1921 McDonell Teresa Mrs (o)-- 817 Thomas Adam (c) 1425 Carter Frank W--2462-W 818 Hillard Susie M Mrs (o)-- 1427 Howard Harry T 2805-J 1922 Smith Clifford S 1023-W Rich Walter L 1974 Elkins Geo T 819 Williams Wm (c) 1429 King Miles V Johnson Geo F 821 Johnson Edw (c) 1430 Pearson Simeon B 1975 Moore Augustus (o) 851 Redding W Dawson (c) 1431 Kitchens Wm W 1977 Gore Emmett W 857 Jones Mattie B (c) 1432 Birdsong C Walker 1980 Edwards Sami 859 Miller Annie (c) Elm intersects 1985 Thornton Robt L 862 Wiley Sudie Mrs 1502 Cook Edgar B--557-W 1986 Hinson Mary E Mrs (o) 865 Croft John Shedd Hattie Mrs (o) 1992 Wilcoxson John R 866 Raines Annie B Mrs 1505 Cuningham Celeste (o)--2399 1993 Lisenby Jasper M 871 Morris Mary Mrs 1507 Burke Annie Mrs (o)-- 1998 Isaf Betrus (o)--5530-R Arch intersects 2895-W Jenkins intersects City Weighing & Ins'pr Bur 900 County Relief Admn surplus sups--6321 901 Odom Serv Sta--9353 Oglethorpe intersects 1005 Walton Wm (c) 021 Kelly Arth (c) 1025 Chambers John (c) 1031 Davis Lessie (c) 1039 Manson DeWitt (c) Hawthorne intersects Turner Tabernacle A M E Ch (c) 1200 Manson DeWitt (c) 1204 Shelly Nellie (c) 1206 Edgefield John (c) 1208 Vacant 1214 Ball David (c) 1214 (r) Bell James (c) 1215 Malone Pearl (c) 1216 Butts Pharisee (c) 1217 Durham John (c) 1510 Smith Jas M Calk Ellen C Mrs nurse 1514 Burke Wm M (o)--2895-J 1517 Jones Addison D (o)--2965-J 1519 Barineau Wm L Waits E Curtis 1520 Green Birdie Mrs--1283 1525 Joiner Nancy E Mrs 1528 Huckabee Edgar L Wade J Lester--5554-J 1529 Richards Lonnie C 1531 Ussery Hattie Mrs--5554-W 1532 Dewberry Sallie A Mrs (o)-- 590-J 1533 Andrews Jas W 1536 Carson Steph T 1537 Harrington Wm T 1539 Adams John H 1541 Smith Jas B--557-J 1542 Chance J Edgar (o)--792-W Edgewood av intersects 1633 Ord Claude 2001 Capps Ethel Mrs (o)--5530-J 2007 Watson Gussie T 2008 Moncrief Geo 2010 Vacant 2011 Worsham Mitchell 2017 Jones Chas W (o) 2020 Ogle Chas 2023 Christian Raiford 2025 Tarver Spencer G 2027 Buckner Lamar F 2028 Vacant 2032 Morris Arth M De Horde intersects 2080 Hinson Mary L Mrs 2084 Johnston Mary L Mrs Moye Cynthia Mrs 2085 Allen Corlas--3089-J 2090 Vacant 2091 Haynes Henry H 2095 Vacant 2097 Goodin Ida Mrs (o) 2098 Thomas John W (o) 1218 Vacant 1218 (r) Bryant Carrie (c) 1634 Jordan Sidney J 1666 Gray Raleigh J 3d (U)--West from 222 6th av 1219 Gates Robt (c) 1667 Hightower Clyde J 101 (100) Bailey Geo (c) (o) 1220 Cleveland Simeon Jr (o) 1670 Simmons Marion 102 (130) Hill Dennis (c) (o) 1222 Vacant 1673 Davidson Geo D 103 Fleming Otis (c) 1225 Bailey Viola (c) 1674 Harris Wm H (o) 105 (206) Hill Jos (c) 1227 Spencer Della (c) Gordon intersects 106 (204) Stuckey Wm S (c) 1229 Baker Mamie (c) 1701 Goldwire Hal M (o)--4670 200 Wyche Wm E (c) 3d St la intersects 1702 Yeoman Arth 201 Hester Lizzie (c) 1231 Sawyer Wm (c) 1706 Stephens Oran E 203 (2) Kelley Minnie (c) 1233 Thomas Robt (c) 1709 Muecke Rhinehart E (o) 204 Howard Benj (c) Co) 1235 Vacant 1710 Jones Robt L 205 Walker Fredk (c) 1237 Vacant 1716 Shine J Wm stoverepr--5253 207 Hill Janie M (c) Hazel intersects 1717 Dover Quinn E 208 Thomas Floyd (c) 1301 Copeland Steven W gro Ryle Chas E 210 Brown Jas (c) (o) 1935 Macon City Directory 611 3d AV (B>--North from 199 Industrial Home rd, 1st w of 2d av 101 Washington Geo (c) 103 Bellevue Bapt Ch (c) 109 (121) Wesley Josie (c) Burkner intersects 201 (1) Bowman Nathan D (c) 202 (2) Billings Lillie (c) 205 McClain Lilly (c) Willis Laura (c) 207 McClain John (c) 217 (524) Jones Eliza (c) 232 Jackson Florine (c) (o) 237 Duval Paul Jr (c) (o) 239 Bryant Mary (c) 242 Ray Julia (c) (o) 243 Webb Wm (c) * 246 Lewis Perry (c) 247 Miller Robt (c) 256 Wiggins John (c) 257 Logan Martha A (c) (o)-- 5149-J 262 Howard Sylvia (c) (o) 263 McCarthy Clarence (c) (o) 267 Scott Ruth (c) 3d AV (SM)--South from Dempsey av, 1st w of College 101 (370) Weiss Frank E (o) 102 Wilson Gussie R Mrs 105 (372) Marigham Jas D (o) 107 Hunnicutt Jas C (o)--2713 108 Ogburn Robt E--2739 1st intersects 203 (103) Perry Pearl Mrs (o)-- 268 Lockett Mary (c) (o) 269 Bonner Evelena (c) 272 Hampton Henry (c) (o) 273 Solomon Eva (c) 275 Lee Sanford H (c)--5149-R, 3(8 Iowa Gainor (c) 314 Hobbs Lucy (c) 316 Oliphant Mamie (c> 319 Holloway Clark L (c) 319% Martin Chas (c) 3038-J 207 Sherwood Gugel E--1429 211 Modena Peter M (o)--4980 212 Morgan Ross E 320 Robinson Belle (c) Empire av intersects 321 Bailey John (c) 321% Solomon Lee (c) 3d AV (U)--South from 947 Montpelier av to Dempsey av 101(510) Thomas Rufus (c) 102 Turner JVm (c) 103 (115) Barnes Jos (c) 104 Young Clarence (c) 106 (71) Stone Geo(c) 107 McFarlin Mabel (c) 108 Vacant 109 Fambro Fannie M (c) 110 Benn John B (c) 323 Cullers Dallas (c) (o) 324 Adams John H (c) 325 Taylor Rufus L (c) (o)-- 3892-W 326 Sparks Wyatt A (c) (o) 330 Carey Julia (c) 332 Stevens Robt B (c) (o) 333 Walker Gaddie (c) 336 George Daizel C (c) (o) 337 Duval Paul (c) (o) 341 Dennis Alex (c) (o) 410 Barrow Andrew W (c) (o) Hoge intersects 112 Curry Andrew (c) (o) 113 (361) Hart Richd (c) 117 Walker Lillie M (c) 119 (334) Causey Wm (c) 121 (119) Patterson Mack (c) 3892-R 413 (420) Gross Emma (c) (o) 415 (464) Pitts Geo (c) 416 (417) McMath James M (c) (o) 417 (450) Davis Lester (c) (o) Plateau intersects 419 (468) Garfield Wm (c) (o) 201 Seal Jas (c) (o) 202 Ross Chas W (c) 203 Hatcher John (c> 420 (417) Fennell Estelle (c) (o) --5352-J 421 (472) Mack Mamie (c) 204 (206) Davis Giles (c) 206 (350) King Rilla (c) Harris intersects 300 (207) Frazier Mary (c) (o) 303 (314) Beckum Wilson (c) 309 Boyd Kizzie (c) 357 (211) Whiting Jerry (c) (o) 359 Miller Sami (c) (o) 422 (419) Fields Leonard (c) (o) --5149-M 423 (474) Turner Julius (c) 424 (421) Cleveland G Gordon (c) (o) 425 (424) Pleasant Hill Gro 426 (425) Taylor Viola (c) (o) 501 (509) Rivers Henry (c) Taylor intersects 363 Houseworth David (c) (o) 503 (510 Ferrell Ralph (c) 512 Mason Geo W (c) (o)--4952-R 365 Mathis Edw (c) 514 Vacant 367 (344) Brown Chas B (c) 368 Brown Edith (c) 518 Wright Edw (c) (o) 521 Williams John (c) (o) 369 Perdue Alonzo (c) 524 Boston Victoria (c) Neel intersects 525 Daniely Arth (c) 1 Starling Mattie (c) 2 White Lucius (e) 3 Harvey Allen (c) 4 Cook Ruby (c) io: Street continued 10: 603 Welch Lois (c) (o)--4302-1 io: 606 Vacant 10 609 Johnson Wm J (c) (0) 10 610 Lay Vera (c) 10 611 Dunn Geo H (c) (o)--3251 10 612 Vacant 11 617 Golden Julia (c) 620 Cooper Mary L (c) (o)--1 622 Patterson Jesse (c) gro--1 623 Williams Lucy (c) 625 Winn Ella (c) Forest av intersects 700 (702) Hunt Sylvester (c) 701 Zellner Smith 702 (700) Sheftall Jackson B 1 704 Scott Octavius (c) 705 Hunt Thos J" (c) (o) 707 Bailey Boysie (c) 709 Howard Jas (c) 710 Pitts Eug (c) 711 (708) Davis Geo (c) 711% Abrams Monroe (c) Brief intersects 712 Hood Frank (c) 713 Jones Ophelia (c) 714 Vacant 715 McKinney Robt (c) 716 Felton John (c) 717 Harding Steph (c) 718 Johnson Rachel (c) (6) 719 Jackson Nora (c) 721 Solomon Z Cicero (c) (o) 730 (742) Stephens David (c) 742 (730) Walker Burton W - (c) (o) 805 Ammons Jas A (c) (o)-- I 5121-J 806 Gibbs Erasmus E (c) (o) I 807 Griffin Jas (c) (o)--764-W I 810 Risby Kathleen (c) 820 Bailey Robt (c) (o) 821 Johnson H Wesley (c) (o)| 764-J 826 (830) Henderson Mattie (c)| 829 Vacant 830 (826) Brown Thos (c) (o) I 831 Felton Maria (c)--5121-M I 833 Mabry Ida (c) (o) 852 (854) Ingram Chas O (c) (o| --5121-R 853 Lyons Eug (c) 854 (852) Stancel Jas (c) (o) I 855 (856) Shiver Louise (c) 857 (858) Sanders Pinkie (c) 859 Gordon Cash Gro 3d ST LA--West from 1229 3d, hi n of Hazel 370 Gross Sherman (c) (o) 374 Lamar Robt (c) 3d AV (V)--West from 349 Middle, 3d n of Hardeman av 206 Mills Jos (c) 526 Gary Sami D (c) (o) 527 Vacant 529 Little Susie (c)--4952-W 531 (530) Williams Jesse (c) 535 Brunson Zack A (c) (o) 538 (539) Wise James 1 Robinson Edgar (c) I 2 Jones Victoria (c) 3 Vacant I 4 Taylor Jas (c) 5 Scott Arth (c) 6 Vacant 207 Spivey Harry A (c) (o)-- 541 Hudson Mattie (c) 5359-W 542 Peters Joseph (c) 209 Barnes Genie (c) (o) 544 (540) Walton Wm (c) 210 Harris Laura (c) (o)--5149-W 546 Walker Idabel (c) restr 7 Shinholser Matilda (c) I 8 Vacant I 4TH (U)--South from Dempseil 215 Mills Gordon (c) Ward intersects av, 4th w of Pio Nono av I 217 New Hope Bapt Ch (c) 220 Thomas Sebron (c) 231 Wilson Norwood (c) (o) 600 Paris Thos N gro--9589 602 Clement Apts Apartments: 109 Cornelius Henry (c) 110 Leaptrott Angeline (c) (o) 112 Ballard Emma (c) (o) 612 Baldwin's and Telegri'iiioH AV (B)--North from 211 Inustrial Home rd, 1st w of 3rd sTM10r1t Joiner Pauline (c) 102 Jackson Eug (c) 103 Turner Lilliee (c) 104(7) Poole Manny (e) 105 Robinson Hattie (o) 106 Hill Perry (c) 109 (108) Kinsey Bee (e) (o) 111 Federal Home Mkr's Class (c) m4 (201) Fraley Malachi (c) fl Burkner intersects 233 Thompson Wm (c) (o) AV --North from 413 |fjfl --5000 sey av, 3d w of Pio Nono av dustrial Home rd, 1st w al S Rooms: 100 Redding Jas (c) (o) av 101- 105 1C01 oCf uGmmRying(sdivJapsasWs ag(ct) 100 Bellevue A M E Ch (c) || --305 106 Jackson Wm (c) 107 Rhodes Edw (c) (o) 9 102- 14 So Ry System (claim agt) 108 (114) Fraley Martha (o) | --36 5TH (V)--Northwest from 311 109 Cressville Sch (c) So Ry System (div supt)--36 Monroe to Lynwood 112 McCollum Anna (c) 107-15 C of Ga Ry (frt dept)-- 1 Vano Pearl (c) 4724 118 C of Ga Ry (spl agt--3137 119 Ry Exp Agcy Inc (rte agt) 3 (7) Venable Pearl (c) 5 West Ella (c) 7 Nelson Cleveland (c) 122-26 So Ry System (chf dispr) 9 Williams Amanda (c) --4632 11 Hutchings Lula (c) 201 L & N R R Co (coml agt)-- 110 Lawson Wm (c) 686 112 Coleman Ella B (c) (o) 202-204 C of Ga Ry (Macon div 114 Veal Mazie (c) engr)--4700 116 Bland Mary (c) (o) 206 C of Ga Ry (Macon div supt) 128 (130) Vacant --4700 130 (18) Gibson Lawrence H (c) 212 C of Ga Ry (Macon div train 132 (142) Davis W Allen (c) (o) mstr)--4700 133 Tremble Calvin (c) (o) 214 C of Ga Ry (chf dispr)--3701 134 Ryan Emma (c) (o) 215 C of Ga Ry (claim dept)-- 135 St Mary's Bapt Ch (c) 3107 138 (139) Williams Pink (c) 216 C of Ga Ry (signal dept)-- 140 (88) Hutchings Pinkie (c) 4700 164 Forsyth Estelle (c) drsmkr 218 C of Ga Ry (supv of bldgs 170 Coker John (c) & bldgs)--4700 172 Brown Wm (c) C of Ga Ry (supv of tracks) 178 Clark Delia (c) (o) --4700 209 Johnson Frank (c) 220 C of Ga Ry (record dept)-- 213 Glover Maggie (c) 4700 215 Solomon John (c) 224 C of Ga Ry (tel & teleg dept) 218 Lane Lovey (c) -4700 219 Brown Annie (c) Street continued 220 Brunson Sara (c) (o) 451 Freeman-Dent-Sullivan Co 221 Alfriend Clifford (c) prod--1386 222 Randall Fredk (c) (o) 453 Burney Bros Co--3016 223 Vacant 461 Liberty Candy Co Inc--2490 225 McCall Wesley (c) Poplar intersects 228 Vacant 503 Southland Coffee Co--867 229 Smith Cleveand (c) 511-13 Macon Paper Co--2697 230 Parker Eug (c) Express begins 231 Worthen Lucius (c) 555 Nat Biscuit Co--1200 232 Henry Jasper (c) 575 Swift & Co creamery--2526 Hillard S 235 Pollock London (c) M23D6 rBayerLryineS--al1l8y0 (c) Empire Dixie Coal Co Inc-- 240 Davis Harriet (c) 5721 244 Peters Eliz (c) C of Ga Ry (frt depot)--4718 245 Overton Queen (c) Ga R R (frt24d7epLoat)t--im4e7r18Exie (c) 249 Brown Ola (c) 250 Carswell Sanford (c) (o)-- 1975-W 251 Murray Mattie (c) Davis intersects 254 Garner Mattie (c) 258 Freeman Izetta (c) 263 Stewart Prent (c) 264 Jones Mattie H (c) Clark intersects 6TH AV (SM>--South from jl Plant, 1st e of 6th av 208 Evans Wyatt C 210 Ammons Geo M 216 Hayes Geo B 222 Grant Sarah J Mrs--5458-llH Tenney av intersects 316 Rogers Lemuel P--5458-J I 326 Addison Mildred V Mrs (o) EH 4154-J 336 Giddens Robt 346 Peavy Claude Mrs 7TH--Southwest from the riveH 3d s of Broadway ---- Central City Park Brown J Henry soft drink* I 9252 Downie Bros Circus 7 Lokey Louis (c) Walnut intersects 15 Smothers Joseph (c) 16 Felton Mary (c) 17 Harris Lillie (c) 18 Vacant 19 Densley Onie (c) 20 Johns Wm (c) 21 Hubert Minerva (c) 22 Dennis Rena (c) 23 Reese Ollie (c) 24 Harris John (c) 25 Vacant 26 Bonner Mamie (c) 27 George Daisy (c) 28 Jenkins Major (c) Mulberry intersects 345 Vacant 349 Hub Fish & Oyster Co--4826 Wall intersects 351 Seventh St Bapt Mission (c|H 353 (14) Young Docia (c) 355 (12) Ford Jos (c) 357 Young Wm (c) 359 (2) Hicks Lillie (c) 361 (3) Johnson Wm (c) Willingham Sash & Door Coll plant--156 Cherry intersects Poplar intersects Raible J R Cooperage Co I 303 Bentey John (c) 304 Jolly Henry T (c) (o)--3165-R 313 Fletcher Virginia (c) (o) 7TH AV (B)--North from Indus I trial Home d, 1st w of 6th at If: 320 Vacant 321.--Vacant a S 11 101 Rhymes Lloyd (c) 107 Barnes Gussie (c) 614 Baldwin's and Telegraph' ) (O) M (c) rH-iJEast * west from s end of 101 Tucker Edw (c) Cherry -- M D & S Ry ofe & shops -- Heard Bros plant 103 Vacant 10T (108) Clay Alonzo (c) 10TH--Southwest from ft of Poplar to limits Bibb Clay Products Co Murray Robt (c) Ocmulgee W AV (B)--North from Indus- 9TH AV (B)--North from Indus- 10TH AV (B)--North from Indus; Ice Co-itMriaTl Home rd, 1st w of 7th av trial Home rd, 1st west of 8th av trial Home rd, 1st w of 9th av Jo ice p'asH >--467 from 413 J 1st w oil 2 Ch (c) (o) rtha (o) I ') (o) h from 1 av rs--5455-uI rsects 5458-J I V Mrs (o)l 2o--48MIl ision (c1l loor Cl e Co Ij Inoiul 6th 31(1 raph'I MSS Macon City Directory 619 HOW MANY IN YOUR FAMILY?\ ALL WILL ENJOY READING THE MACON TELEGRAPH AND MACON EVENING NEWS -- THEY ARE FAMILY NEWSPAPERS. NEWS OF THE WORLD--BUSINESS, POLITICAL AND FINANCIAL FOR DAD NEWS OF FASHIONS, SOCIETY AND STORE NEWS FOR MOTHER . . . SPORTS AND SERIAL STORIES, TOO, FOR OLDER SONS AND DAUGHTERS. SPECIAL FEATURES FOR THE YOUNGSTERS, WITH DAILY COMIC STRIPS TO DELIGHT BOTH YOUNG AND OLD ... AND 16 PAGES COLORED COMICS EVERY SUNDAY . . . YES, WE BELIEVE THAT YOU WILL AGREE ... Every Member of the Family Will Enjoy The Telegraph and Evening News They Are Truly Family NEWSpapers Macon Evening --AND-- News The Macon Telegraph Telephone 6500 616 Baldwin's and Telegrap /OK TO STERCHPS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 BALDWIN'S AND TELEGRAPH'S MAC GEORGIA I BUSINESS DIRECTORY AND LIST OF NATIONALLY ADVERTISED BRANDS 1935 Containing the names of all business firms, Industrial plants and professional men and women, arranged in alphabetical order under their properly classified business headings; together with the names of nationally advertised brands and trade-marked articles, with the name and address of the local distributor or agent. MTTndieatea Nationally Advertised Brands Copyright 1935 by Baldwin Directory Co., Inc. Signature Only SAME DAY ACCOUNTANTS SOUND FINANCIAL INSTITUTION Daly J K 311 Grand Bldg ACCOUNTANTS--CERTIFIED PUBLIC The First National Bank & Trust Co. IN MACON Trust CompManeymboefr Gofeorgia Asso602 CHERRY ST. PHONE 2834 Baggs L D & Co 308 2d Geoghegan & Norris 504 Macon Sav Bk Bldg McFerrin J M 604 Bib Bbldg ADDING MACHINES Burroughs Adding Mach Co 613 Mul- berry For Reliable Salary People ACADEMIES--RIDING ipiVOLI RIDING CLUB Forsyth rd I extd Rivoli Ga ADDRESSING LETTER SHOP INC THE 563% Mulberry Macon Trading and HATCHER & McCRARY. INC. Business Property-Sales & Leases--General Insurance Surety Bonds--Loans--Investments 608 Mulberry St. Phone 6186 Invest- ment Co. 220 Ga. Gas Bldg. X IPlUhlloCneta\J2O93 cNair Lumber & Supply Co., 266 Fifth St. Phone 1400 S5 Macon City Directory -------- ----- - ---- ^ Everybody Reads Macon Evening1 News, The Macon Telegraph Factory Distributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 336 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. A THE Trip ENGLAND CHIROPRACTOR To Means a Start on the Road to Health ADJUSTERS--INSURANCE Fire Companies Adjustment Bur 1001 Ga Casualty Bldg Murphey Otis A Co 601 Bibb Bldg ADVERTISING (Direct MaU) TETTER SHOP INC THE 563% Mulberry (Novelties) Greater Foster Adv Serv 280% Orange (Out Door) PACKER ADV CORP 462 Plum AGRICULTURAL IMPLEMENTS Cropper R C Co Mulberry cor 7th Gantt Mfg Co Bay cor Elbert McCormick Deering Store 660 Broad- way SEARS-ROEBUCK & CO 662 3d AIR CONDITIONING MILLIRONS PLMBG & HEATING CO 107 Cotton U^-AIR AND WATER HOSE BOSTON--A S Hatcher Co 596 3d I SINCLAIR--McKenney & Adams 600 Id A Vine cor Culver SINCLAIR--Sinclair Refining Co Ham* mond at So Ry TEXACO--TatnaU Sq Serv Sta 39 Montpelier TEXACO--Texas Co The 77# Division WHITE FLASH--Atlantic Serv Sta 91 Coleman IMTAUTOMOBILE PARTS AND SUPPLIES (Batteries) CROSS COUNTRY--Sears-Roebuck * Co 552 3d FIRESTONE--TatnaH Sq Serv Sta 99 Montpelier GLOBE--A S Hatcher Co 586 8d VESTA--Chapmans Garage 413 Mulberry WILLARD--Bob Stevens Serv Sta Ml Walnut Willard--Frieds Garage 352 Broadwl? WILLARD--McKenney & Adams 609 Id A VlnevUle eor Culver (Battery Chargers) GENL ELEC--A S Hatcher Co 596 3d (Brake Lining) THERMOIB--A S Hatcher Co 596 Jd (Cranes) WEAVER--A 8 Hatcher Co 596 3d (Gaskets) VICTOR--A S Hatcher Co 596 3d (Greasing Equipment) BALLCRANK--A S Hatcher Co 599 3d WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7th. Phone 278 Phone 156 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 620 Baldwin's and Telegraph* LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. (Ignition) GUARANTEED--A 8 Hatcher Co 596 3d (Jacks) BLACK HAWK--A S Hatcher Co 566 Sd WALKER--A 8 Hatcher Co 596 3d (Lacquers and Paints) ACME--A 8 Hatcher Co 596 3d (Reamers) WATERVLIET--A 8 Hatcher Co 596 3d (Seat Covers) CRAWFORD--A 8 Hatcher Co 596 Sd (Spark Plugs) CHAMPION--A 8 Hatcher Co 596 3d CHAMPION--Dannenbergs 463 Sd (Springs) EATON--A S Hatcher Co 696 3d (Tires) ALL-STATE--Sears-Roebuck ft Co 552 Sd DUN61L1OBPr--oaDduwnaloyp Tire ft Rubber Co FIRESTONE--Tatnall Sq Serv Sta 99 Montpelier GATES--A 8 Hatcher Co 596 3d GOODRICH--Dannenbergs 463 3d GOODYEAR--McKenney ft Adams 606 1st ft Vlnevllle cor Culver PENNSYLVANIA--Chapmans Garage 413-19 Mulberry US Royal--Frieda Garage 352 Broadway YALE--Bob Stevens 8erv Sta 601 Wal- nut (Wrenches) BLACK HAWK--A S Hatcher Co 596 3d AUTOMOBILE PARTS DEALERS (Batteries) CHAPMAN'S GARAGE 413 Mulberry DANNENBERGS 462 3d Macon Storage Battery Co 215 3d MANN JACK BATTERY CO 669 3d SEARS-ROEBUCK ft CO 552 3d Smiths Battery & Elec Co 654 Mulberry Smittys Battery Serv 407 Mulberry (Battery Chargers) DANNENBERGS 462 3d HATCHER A S CO 696 Sd SEARS-ROEBUCK ft CO 552 3d (Brake Lining) CHAPMANS GARAGE 413 Mulberry HATCHER A S CO 596 3d (Tires) Central Tire Co 405 Poplar CHAPMAN GARAGE 413 Mulberry DANNENBERGS 462 3d DUNLOP TIRE ft RUBBER CO 611 Broadway Goodyear Serv Inc 561 3d Kelly-Springfield Tire Co 687 3d MacMillan Tire Retreading 352 1st SEARS-ROEBUCK ft CO 552 3d (Tools) HATCHER A S CO 596 3d (Used Parts) DuBOSE J H ft SON 121 Poplar HEARD J F 610 Broadway Levine Tire ft Parts Serv 100 5th McCord Used Auto Parts 671 Broadway (Valve Refaeers) SIOUX--A 8 Hatcher Co 696 3d (Vulcanizing Equipment) SHALER--A 8 Hatcher Co 696 3d AUTOMOBILE RENTING CHAPMANS GARAGE 413 Mulberry AUTOMOBILE REPAIRERS (See Also Garages) Baldwin W L 2921% Houston Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate mcclure office equipment co. 5M60o Mulberry StM . imeographs and Su*p*plies Phone so< Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 M3# Macon City Directory 631 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. 614 MUECKE & SONS CO * New St. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures Phone 636 Bibb Auto Serv 717 3d Bolands Garage 419 Pine Broadway Top & Body Shop 715 Broad- way Butler W H (c) 1801 Broadway Carlisle Bros 2111 Vineville (V) Cassidys Garage 409 Mulberry Chambliss Roy 364 1st CHAPMAN'S GARAGE 413 Mulberry CHAPMAN'S GARAGE Drive It Yourself Phone 2951 413 Mulberry St. Clays Garage 615 Broadway Davis J D 114 Whitehead Dennis E D (c) 640 Washington Dixie Hwy Garage 3609 Houston Dudley G L (c) 1016 Main (EM) Ga Auto Co 517 Plum Harpers Garage 3110 Houston (SM) Hickman W C 304 Reid Huttos Garage 1007 Montpelier Jackson E E 858 Broadway Jones Fredk (c) 307 Grahams lot Lockhart Isaiah (c) 405 Madison (V) McCORD R A MTR CO 215 3d McPadden R A 2104 Vineville (V) MONKS GARAGE 618 Broadway Ohio Garage 3492 Houston (SM) Parrishs Garage 708 3d ROBERTS FRANK 711 3d Sheffield M C Post Office al Skelley Edison 1034 Broadway Smallwoods Garage 257 5th Snead Garage 617 Broadway SOLOMON STEVE M JR 462 Broadway Souther R L 811 Broadway Spivey & Pritchett 444 Pine Terrell Auto Elec Co 607 3d Tyner C G 705 Broadway United Auto Co 860 Broadway Willingham Auto Co 552 2d YATES MTR CO 707 3d AUTOMOBILE SERVICE (AAA Service) MONKS GARAGE 618 Broadway (Body Repairing) Bibb Body & Fender Wks 454 Plum Colbert Mfg Co 447 Pine Stroberg Body & Fender Wks 403 Mul- berry (Frame and Wheel Aligning) MONKS GARAGE 618 Broadway (Garages) CHAPMANS GARAGE 413 Mulberry McCORD R A MTR CO 215 2d MONKS GARAGE 618 Broadway ROBERTS FRANK 711 3d SOLOMON STEVE M JR 462 Broadway (Ignition Service) CHAPMANS GARAGE 413 Mulberry MANN JACK BATTERY CO 669 Sd (Lubrication) ATLANTIC SERV STA 01 Coleman CHAPMANS GARAGE 413 Mulberry TATNALL SQ SERV STA 99 Mont- pelier (Parking) CHAPMANS GARAGE 413 Mulberry (Storage) CHAPMANS GARAGE 413 Mulberry City Storage Garage 411 Poplar Ideal Storage Garage 256 2d MACON AUTO EXCH 362 1st McCORD R A MTR CO 215 2d Supreme Storage Garage 461 2d (Tire Repairing) ATLANTIC SERV STA 91 Coleman CHAPMANS GARAGE 413 Mulberry Houston Av Vulc Shop 3000 Houston TATNALL SQ SERV STA 99 Mont- pelier (Top Manufacturers) Shadbum J D 438 Oglethorpe (Washing) ATLANTIC SERV STA 91 Coleman CHAPMANS GARAGE 413 Mulberry JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone H45 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 Griffin Wm (c) 210 3d TATNALL SQ SERV STA 99 Mont- pelier (Wreeker Service) CHAPMANS GARAGE 413 Mulberry CHAPMAN'S GARAGE Drive It Yourself Phone 2951 413 Mulberry St. MONKS GARAGE 618 Broadway A tttomobii.es (Passenger) CHRYSLER--Prank Roberts 111 Sd DsSOTO--Yates Mtr Co Inc 767 3d DODGE--S M Solomon Jr 462 Broadway FORD--R A McCord Mtr Co 215 2d LINCOLN--R A McCord Mtr Co 215 2d PACKARD--Yates Mtr Co Inc 707 Sd PLYMOUTH--Frank Roberts 711 3d PLYMOUTH--S M Solomon Jr 462 Broadway PLYMOUTH--Yates Mtr Co Inc 707 3d (Trucks) DODGE--S M Solomon Jr 462 Broadway AUTOMOBILES FOR HIRE CHAPMANS GARAGE 413 Mulberry ANKING faculties to please you. B The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates fino. CHERRY ST. PHONE 2834 U^-BACON PRIDE OF DIXIE--T & T Packing Co 750 Division BAG MANUFACTURERS--BURLAP Bibb Bag Co 472 Broadway Central City Bag Co 5th cor Mulberry BAKERS (Retail) Atkins A H 204 Forsyth Atkins Mrs Bakery 140 (120) Hardeman and 414 2d Central Ga Baking Co 216 Cotton Collins Baking Co 205 Cotton GILLS BAKERY 818 VinevUIe Sunlite Electrik Bake Shop Inc 466 2d Veellinger W E 4003 (4097) Houston Wheeler Geraldine D (cakes) 302 Hines ter (V) CHAPMAN'S GARAGE Drive It Yourself Phone 2951 413 Mulberry St. (Wholesale) Am Bakeries Co 451 Plum Loose-Wiles Biscuit Co 312% Main (EM) Nat Biscuit Co 555 5th Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE This Directory Was Published By The Originators AWNING DEALERS DANNENBERGS 462 3d BANKS CITIZENS & SOUTHERN NATIONAL BANK 461 Cherry CITY BANK & TRUST CO 617 Cherry Of The ABCD Type MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY Of City Directory McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1835 Macon City Directory Everybody Heads Macon Evening News, The Macon Telegraph Macon Bottling Co. Phone 3266 LET US PLAN YOUR NEXT ADVERTIS- ING SALES CAMPAIGN FOR YOU USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston, S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. CITY BANK AND TRUST COMPANY Banking in All Its Branches No Affiliates Trust and Savings Departments Phones 1755-1756 Cherry and Cotton Aves. FIRST NATIONAL. BANK & TRUST CO 602 Cherry THE FIRST NATIONAL BANK & TRUST CO. In Macon Member of Trust Company of Georgia Associates WILLIAMS LUTHER & SON (private) 665 Mulberry LUTHER WILLIAMS & SON Banking in All Its Branches Insurance of All Kinds Luther Williams Frederick W. Williams 565 Mulberry St. Phone 1586 SPBAR EQUIPMENT CENTRAL FITTINGS--Muecke & Son Co 614 New BARBERS Allen P F 202 (94) Holt Bateman E E 318 Broadway Brantley Clinton 408% Poplar Braswell J A (c) 507 Broadway Brewer W J 312 Main (EM) Brockmans Barber Shop 400 2d Brown's Barber Shop (c) 315 Broadway Callaway Barber Shop (c) 101 Cedar (U) Cherokee Barber Shop 803 Montpelier Commercial Barber Shop 308 Cherry Dupree Barber Shop 510 2d East Side Barber Shop 426 Main (EM) Ezell G E 2998 Houston Flynts Barber Shop 409 Cherry Gay Barber Shop 458 3d Genones Barber & Beauty Shop 568 Mulberry Giles Foster (c) 205% 5th Glascos Barber Shop 406 Mulberry Gunter L L 3494 Houston Hatfield G W (c) 313 Broadway Hawkins Ernest (c) 204 (104) Charles Hawkins W W 2004 2d Hayes Barber Shop 553 Cherry HOTEL DEMPSEY BARBER SHOP 363 3d Hunt T J (c) 413 Cotton Jackson T Ellen (c) 215 5th Jordon J M (c) 908 Montpelier Lane C B (c) 613 Broadway Lightfoot Robt (c) 1213 Broadway Lindsey Barber Shop 1012 2d Long R W 1005 Broadway Palace Barber Shop 558 Mulberry Palm Barber Shop 316 2d Palmetto Barber Shop (c) 463 Broad- way Peeks J W (c) 464 Poplar Sharp Chas (c) 754 Elm Sheftall Jack (c) 313 3d Smith Gertrude (c) 319 Broadway Smith W O 3106 Houston Snipes Wayne (c) 161 5th South Macon Barber Shop 2661 2d Southland Barber Shop 565 Broadway Stephens Bob Barber Shop 206 Cotton Stewart R C 117 Douglas (V) Stripling R G 471 3d Taskens Barber Shop (c) 638 Washing- ton Tatnall Sq Barber Shop 607 Linden Thompson Budrow (c) 246 Main (EM) Trawick W R 17 Bellevue rd Tripp O C 1504 Broadway Vineville Barber Shop 820 Vineville Watkins G L 611 3d Wellons K B 1917 Vineville Wesley Arth 808 Hazel Williams H W 2140 2d BARBERS SUPPLIES Southland Barber Sup 566 Poplar BATH ROOM FIXTURES DANNENBERGS 462 3d WILLINGHAM SASH & DOOR CO 467 3d SMTBATHING suits B V I)--Joe N Neel Co 456 Cherry BRADLEY--Jos N Neel Co 466 Cherry BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 467-468 Plymouth- De Soto--Yates Motor Co.--Packard--Phone 1445 Baldwin's and Telegraph'* LOOK TO STERCHPS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 jy-BATTERIES (See Automobile Parts and Supplies) BATTERY DEALERS CHAPMANS GARAGE 413 Mulberry Macon Storage Battery Co 215 3d MANN JACK BATTERY CO 669 Sd Smiths Battery Elec Co 654 Mulberry Smittys Battery Serv 407 Mulberry BATTERY MANUFACTURERS Southeastern Battery Co 757 Broadway BEAUTY SCHOOLS Davis Ethel B 362 % 2d Tronce Beauty Institute 652% Cherry BIBB MATTRESS CO 415 Pine MEADERS MATTRESS CO 453 Arch sggfBED ROOM FURNITURE COLONIAL--Sterchi Bros Stores Inc Cherry sw cor Broadway BED ROOM FURNITURE DEALERS STERCHI BROS STORES INC Cherry sw cor Broadway W-BEDS SIMMONS--Johnson Bros 461 2d SIMMONS--Marshall Furn Co 556 Poplar SIMMONS--Sterchi Bros Stores Inc Cherry sw cor Broadway Macon GmO. Bottling Co. PHONE 3 2 6 6 BEAUTY SHOPS Artistic Beauty Shop 151 Cotton Bell Edith 613 Log Cabin dr Cherry Beauty Shop 605 Cherry COLLEGE BEAUTY SALON 451 Col- lege DANNENBERGS 462 3d Davis Ethel B Beauty Shop 364 2d Elmore 204 Park (B) Flynts Beauty Shop 409 Cherry Freemans Beauty Salon 502 Walnut Jozefs Beauty Shoppe 312% 2d Lee Mary (c) 332 Jackson Lueree Beauty Shop 903 Cherry Marinello Beauty Shoppe lobby Bibb Bldg Mary Ann Beauty Shop 620% Cherry McCrary Bennie Mrs 127 Lawton Robinson Estelle 215 Bibb Bldg Stellas Beauty Shop 3043 Houston THORPE R S & SONS INC 515 Cherry VANITY BEAUTY SHOP 352% 3d IMBEDDING SIMMONS--Sterchi Bros Stores Ine Cherry sw cor Broadway QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway BEER BUDWEISER--Buck Ice & Coal Co 2302 Forsyth rd OLD SOUTH--Atlantic Ice & Coal Co Waterville rd TRU BLU--Buck Ice & Coal Co 2302 Forsyth rd BEER DEALERS (Retail) BRADYS PLACE 163 5th Bruskies 508 2d Cherrio The 220 Cotton Pleasant Hill Beer Parlor 630 Wash- ington (Wholesale) BEDDING DEALERS STERCHI BROS STORES INC Cherry sw cor Broadway bedding manufacturers (See Also Mattress Mfrs) ATLANTIC ICE & COAL CO INC Waterville rd Beverage Sales Co 259 5th BUCK ICE & COAL CO 2302 Forsyth rd Cooks Beer Co 264 5th jax Brewing Co 675 Broadway Wagner Brewing Co 802 Broadway HATCHER & McCRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Signature Only SAME DAY M 0 N E For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 625 Everybody Reads Macon Evening News, The Macon Telegraph FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 326 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. A Trip To THE ENGLAND CHIROPRACTOR Means a Start on the Road to Health BEER EQUIPMENT MANUFACTURERS Joes Pool Room 1241 Broadway Pastime Billiard Parlor 411 3d MUECKE & SONS CO 614 New BLACKSMITHS BELT LACINGS FARMER C W 419 Poplar BELTING DEALERS Bibb Supply Co 203 Poplar FARMER C W 419 Poplar Collins* Thos (c) 412 Pine Dean W L 1117 Napier James Paul (c) 3707 Houston McCallum H C 816 Montpelier Sff-BLANKETS NASHUA--Dannenbergs 462 3d MTBELTS AND SUSPENDERS HICKOK--Dannenbergs 462 3d HICKOK--R S Thorpe & Sons Inc 515 Cherry BEVERAGE MANUFACTURERS (See Also Bottlers) BOARDING HOUSES Dunn Myrtice 218 Georgia Magnolia Inn 555 2d Smith Lula P 768 Cherry Taylor Fannie 864 Mulberry apt IB Wilson Florence 554 1st NEHI BOTTLING CO 1911 Broadway MACON COCA COLA BOTTLING CO 416 Oak DtTBEVERAGES COCA COLA--Macon Coca Cola Bottling Co 416 College BICYCLE DEALERS BOILER WELDING ACME WELDING CO 619 Broadway BOILERMAKERS TAYLOR IRON WKS & SUP CO 1011 Broadway Capitol Cycle Co 506 2d DANNENBERGS 462 3d Fry Bros 403 Poplar Macon Cycle Co 465 Broadway SEARS-ROEBUCK & CO 552 3d WALKER CLIFF CO 515 Poplar BONDS (See Investment Bankers) BOOK CASES BURKE J W CO 406 Cherry fP^BICYCLE TIRES ROLLFAST--A S Hatcher Co 596 3d |PP*BI CYCLES COLUMBIA--Cliff Walker Co 515 Poplar DAYTON--Cliff Walker Co 515 Poplar ROLLFAST--A S Hatcher Co 596 3d BILLIARD PARLORS Arcade Billard Parlor 561 Cherry Douglas C H Jr (c) 361 Broadway Hatfield P M (c) 323 Broadway Idle Hour Billiard Parlor 551 Cherry BOOK STORES Browns Book Store 416 2d BOOKBINDERS BURKE J W CO 406 Cherry FLYNN PRINTING CO 505 Broadway BOOKKEEPING SUPPLIES BURKE 3 W CO 406 Cherry McCLURE OFC EQUIPMENT CO 560 Mulberry J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. PHONE 373 P"MlHyI moI uth' --l De" So'to-- 11 "I Yates Motor Co.---- 'I. Packa' rd-- -- PjhonI. e I 144"5**' Baldwin's and Telegraph'* LOOK TO STERCHPS for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan. Manager Phone 3121 McCLURE OFFICE EQUIPMENT CO. OFFICE OUTFITTERS Phone 903 560 Mulberry St. * BOTTLERS (See Also Beverage Mfrs) Buster Btlg Co Murray al Dr Pepper Btlg Co 650 3d MACON COCA COLA BTLG CO 416 Oak NEHI BTLG CO 1911 Broadway NU ICY BTLG CO 612 Broadway BOWLING ALLEYS Lucky Strike Bowling Alleys 359 Cotton BOX MANUFACTURERS (Paper) MACON PAPER CO 611 5th TOMLINSON PAPER BOX CO 613 Oglethorpe (Wooden) Jeffreys-McElrath Mfg Co Bellevue rd nr Forsyth rd Maxwell Bros Inc ft Poplar So Crate & Veneer Co ft Poplar BRASS POLISH BROKERS (Bonds and Stocks) Brown & Groover 503 Cherry Fenner & Beane 363 3d Levie O H 104-05 Ga Casualty Bldg Trust Co of Ga 417 2d (Merchandise) Ouzts Mitchell & Whaley Inc 9 Ter- minal Ruan & Co 5 Terminal BROOMS KUHN MFG CO 314 Broadway fHFBUILDERS HARDWARE CORBIN--WUllngham Sash ft Door Co 467 3d BUILDING AND LOAN ASSOCIATIONS MACON FEDERAL SAVINGS & LOAN ASSN 417 Broadway BUILDING MATERIALS BUILDERS LBR CO INC 130 Cherry Central Sash & Door Co 354 2d plant Waterville rd DUNLAP ROOFING CO 266 5th McCOOK J W LBR CO Ash nr Broad- way MeNAIR LBR ft SUP CO 266 6th KUHN MFG CO 314 Broadway IWBREAD GILLS BAKERY 813 VinevlUe BRICK DEALERS BUILDERS LBR CO INC 130 Cherry MeNAIR LBR & SUP CO 266 5th BRICK MANUFACTURERS Atlantic Refractories Co Ine ofc 564 Mulberry Bibb Clay Products Co 10th cor Oak Cherokee Brick Co end Waterville rd Standard Brick & Tile Co 460 Broadway MeNAIR LUMBER & SUPPLY CO. BUILDING MATERIAL 266 Fifth St. Phone 1400 MIDDLE GA LBR CO 214 College Ross Co The ft Poplar Sheridan C F 415 3d Turners Bldg Sup Co 345 Ocmulgee WILLINGHAM SASH & DOOR CO 457 3d BUILDINGS Al Sihah Temple Mosque 715 Poplar Bankers Ins Bldg 211 Cotton PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 75 C. W. Farmer rubber belting HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OR. MORE AUTOBANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from V. M. C. A. McNair Lumber & Supply Co., 266 Fifth St, Phone 1400 M8S Macon City Directory 627 Everybody Reads Macon Evening News, The Macon Telegraph CLAUDE TRAWICK COAL CO., INC. A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 6779 201BEtetdT'fL' SILVER STAR C0ALS AND PChoK neE59 Bibb Bldg 403 Cherry Bibb County Court House 2d at Mul- berry Broadway Bldg 461 Broadway CITY HALL Poplar at 1st OURTESY and ser- Conductors Bldg 408 Poplar Doctors Bldg 700 Spring Douglass Bldg 351 Broadway Ellis Bldg 201 Cotton Exchange Bldg 460 Pine Federal Bldg Mulberry cor 3d First Nat Bk Bldg 409 2d Ga Casualty Bldg 516-22 Mulberry Grand Bldg 617 Mulberry Grand Lodge Bldg F&AM 801 Mulberry Hardeman Bldg 105 Cotton Independent 515 2d Order Odd Fellows Bld6g Jaques Bldg 407 Broadway Knights of Pythias Bldg (c) 556 New Lee Bldg 512% 3d Macon Sav Bk Bldg 150 Cotton Masonic Temple 710 Mulberry Monica Court 353% 3d Municipal Auditorium Cherry cor 1st Napier Bldg 502% Poplar Salvation Army Bldg 610-20 Mulberry Washington Bldg 566 Mulberry Willingham Bldg 569 Cherry G vice to all. The First National Bank & Trust Co. IN MACON Trust CompManeymboefr Goeforgia Asso602 CHERRY SciTa.tes PHONE 2834 CABINET MAKERS Ansley R E 767 3d MACON CABINET WKS Poplar nr 8th Muecke Art Craft Studio 616 Poplar MUECKE & SONS CO 614 New CAFES (See Restaurants and Cafes) burial vaults MEMORIALS INC 2200 Forsyth j HTCAKES GILLS BAKERY 813 VlneviUe CANDY MANUFACTURERS BUS LINES Bass Bus Lines 320 Broadway Colonial Lines 320 Broadway Southeastern Greyhound Lines 320 Broadway So Stages Inc 320 Broadway ofc 609 3d Southland Coach Line 320 Broadway BUS STATIONS Union Bus Terminal 320 Broadway BUSINESS SCHOOLS GAB Sch of Com 565% Mulberry Liberty Candy Co 461 5th McAfee Candy Co 657 Poplar Odom J J Candy Mfg Co 253 5th Wade C A 322 Johnson CARBIDE DEALERS Kingman & Everett 570 Broadway Linde Air Products Co 201 Poplar 1WCARBON PAPER WEBSTER MULTICOPY--McClure Ofo Equipment Co 560 Mulberry Kaiglers Business College 3d fl Washing Bldg CARPET DEALERS MERRIMAN SCH OF BUSINESS THE 158 Cotton i STERCHI BROS STORES INC Cherry W cor Broadway WILLINGHAM SASH & DOOR CO. ,, . __ Manufacturers Store: 457 3rd1sfcH' DOORS' MOULDING AND MILLWORK Phone 278 Factory: Cherry & 7th. Phone 156 Baldwin's and Telegraph^ LOOK TO STERCHFS for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 I>0'lUu' St Shop At SEARS and SAVE QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway igJ(J"CARFET SWEEPERS BISSELLS--Kuhn Mfg Co 314 Broadway CARPET SWEEPERS--DEALERS KUHN MFG CO 314 Broadway CASH REGISTERS Nat Ca8h Register Co 155 Cotton CASKET MANUFACTURERS Macon Casket Co 1501 Broadway McNAIR LUMBER & SUPPLY CO. BUILDING MATERIAL 266 Fifth St. Phone 1400 WILLINGHAM SASH A DOOR CO 457 3d CEMETERIES Fort Hill Norris nr Cowan Jones Chapel Cedar (SM) Lynwood (c) end Lynwood av (V) MACON MEMORIAL PARK INC ofc 153 Cotton av, cemetery on Columbia rd extd Oak Ridge ft Madison (V) RIVERSIDE Madison at Jones Rose Hill end Orange Unionville (c) Pio Nono av nr Taylor Wolff Wm ft Madison (V) CATTLE DEALERS CERTIFIED PUBLIC ACCOUNTANTS TAT PACKING CO INC 750 Division (See Accountants--Certified) Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. JPf'CEDAR CHESTS CHAIRS LANE--Johnson Bros 461 2d "CEMENT SIKES--McClure Ofc Equipment Co 660 Mulberry CHEMICAL CLEANERS Macon Federal ALPHA PORTLAND--McNair Lbr A Sap Co 266 5th ALPHA PORTLAND--McNair Lbr A Sup Co 266 5th ATLAS WHITE--McNair Lbr A Sup Co 266th 5th INCOR QUICK SETTING--McNair Lbr & Sup Co 266 5th LONE STAR PORTLAND--McNair Lbr A Sup Co 266 5th MAGNOLIA MORTAR--McNair Lbr A Sup Co 266th 5th PENN-DIXIE--Builders Lbr Co Inc 130 Cherry PENN-DIXIE PORTLAND--McNair Lbr A Sup Co 266 5th CEMENT DEALERS BUILDERS LBR CO INC 130 Cherry McNAIR LBR A SUP CO 266 6th WHIZ--Kuhn Mfg Co 314 Broadway CHEMISTS Morris-Flinn Co 622 3d CHILDREN'S SHOPS DANNENBERG'S 462 3d jflyOHINA CAMARK--Kernaghan-Goodman Inc 411 Cherry CONTINENTAL CERAMICS--Kernaghan-Goodman Inc 411 Cherry COPELAND A THOMPSON (Spode)-- Kernaghan-Goodman Inc 411 Cherry PICKARD--Kernaghan-Goodman Inc 411 Cherry Savings and Loan Assn. Loans On Bibb County Real Estate McCLURE OFFICE EQUIPMENT CO. Mimeographs and Supplies 660 Mulberry St. Phone 903 Phone 5036 McNair Lumber & Supply Co.. 266 Fifth St. Phone 1400 1935 Macon City Directory 629 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. M 614 New St. MUECKE & SONS CO. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures Phone 636 ROSEN THAI.--Kernaghan-Goodman Inc 411 Cherry- WEDGEWOOD--Kernaghan-Goodman Inc 411 Cherry CHIROPODISTS Rhodenhiser R B 316 2d CHIROPRACTORS Chiropractic Health Home 501 College Cox H C 505 Bibb Bdg Dick T A 208 Ga Casualty Bldg ENGLAND ARCH 613 Bibb Bldg CHRISTIAN SCIENCE PRACTITIONERS Snelling J P 913 Ga Casualty Bldg CHURCHES (Adventist) Seventh Day 114 Montpelier av Seventh Day (c) 7 Spring (African Methodist Episcopal) Bellevue (c) 100 6th av (B) Grant's Chapel (c) 504 Charles Gray's Chapel (c) 607 Hall (EM) Greater Allen Chapel (c) 426 North Holsey Temple (c) 261 Washington av Jones Tabernacle (c) 612 Cowan St Luke's (c) 1048 Pio Nono av St Paul's (c) 210 Powell Stewart Chapel (c) 565 Cotton av Stinsonville (c) 116 Main (S) Turners Tabernacle (c) 3d cor Haw- thorne Warren (c) 147, 1st av (V) (Baptist) Aveline (c) 223 (285) Moore la Bay Street (c) 122 Bay Bellevue 305 American blvd Bellevue (c) 103 3d av (B) Bethel Primitive 96 Flamingo dr Bethel Primitive (c) Henderson (B) Beulah (c) 1613 Broadway Bloomfield (c) Columbus rd nr limits Brown Chapel (c) 119 Tatnall la Bryant Tabernacle (c) 217 (117) Disroon al Calvary Free Will Cedar cor Wyche (SM) Cedar Grove (e) 132 Brewery al (PH) Cherokee Heights 718 Napier av Childs Chapel (c) 110 2d (U) Corinth Primitive 323 Beech av East Side 255 Church (EM) East Side Memorial Institutional (c) 1100 Woolfoik Ebenezer (c) 757 Elm Elizabeth Primitive 912 Clinton rd (EM) First (c) 567 New FIRST--Washington av cor Hunt pi Friendship (c) 1304 1st Fulton (c) 506 Hawthorne Gilfield Primitive (c) 92 Hazel Green's Baptist Tabernacle (c) 201 Toombs (SM) Harmony (c) 330 2d av (V) Jordan Street (c) 234 Jordan's al Little Rock (c) 164 (400) Nussbaum Lizaboro (c) 105 Davis (NH) Lizzies Chapel (c) 126 Bartlett's la Macedonia (c) 164 Hazel Magnolia (c) 316 Jackson Mallory Mission 219 Roff Home av Mikado 210 Mikado av Mt Calvary (c) 200 Antioch Mt Lebanon (c) 180 Key (U) Mt Moriah (c) 213 Powell Mt Olive (c) 957 Oglethorpe Mt Temah Primitive (c) 303 North (V) New Bethel (c) 404 Division New Hope (c) 217 3d av (V) New Jerusalem Primitive (c) 200 (135) Short la New Zion (c) 304 Edgewood av Pine Ridge Primitive (c) 388 Robinson rd St James (c) 217 Edison St John's (c) 103 Bonaire St Luke's (c) 161 Broad St Mary's (c) 135 5th av (V) Salem (c) 101 (209) Henry (SM) Second 1437 2d Seventh St Baptist Mission (c) 351 7th Shiloh (c) 421 Applewood av South Macon Primitive 2620 Broadway Stinsonville (c) 107 Grant av (S) Tabernacle 902 2d Tatnall Square Ash cor Adams Tremont Temple (c) 534 Cotton av Union (c) 306 E 2d (EM) Unionville (c) 932 Pio Nono av Uxbridge Mill 123 Bellevue rd Vineville (c) 461 Chestnut Vineville 413 Vineville av Vineville 1035 Vineville av Welcome (c) 8 (127) Paradise al JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phcfne 1445 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 White Mabel Memorial 2610 2d Willingham 208 (140) Holt av (Christian) First 265 High (Church of Christ) Central Ch of Christ 710 Orange Ch of Christ 501 Giles Ch of Christ (c) 501 Henrietta East Side 375 Church (EM) South Side, Knott cor School (Church of God) (Lutheran) 4Via RpdftfilTlftr 723 Holt (Methodist Episcopal) Bass Chapel 3102 Forsyth rd Centenary 940 College Cherokee Heights 670 Napier av East Macon 100 Church (EM) First Street 859 1st * Ingleside 427 Ridge av (I) Morrison Memorial 174 Henry (Lynmore) MULBERRY STREET 717 Mulberry Second Street 2130 2d Vineville 221 Vineville av Ch of God 116 American blvd Ch of God (c) 103 Grant av (V) Ch of God 316 Pio Nono av Ch of God (c) 129 Woodliff (Mormon) Latter Day Saints 408 Poplar (Nazarene) (Colored Methodist Episcopal) Bethel 806 Pio Nono av Trinity 446 Tindall av (SM) (Congregational) First (c) 440 Monroe (Episcopal) Christ 520 Walnut St James 101 Courtland av St Paul's College cor Forsyth (Free Methodist) Free Methodist 220 Belmont av (Holiness) Bivins Tabernacle (c) 521 E 2d (EM) Ch of God in Christ (c) 823 Ash Hazel St Pentecostal 858 Hazel Rockhill La (c) 115 (126) Rockhill la 6t James (c) 709 (612) Hall (EM) Saints of Christ (c) 503 Crisp Sanctified (c) 416 Ash (Jewish) First Ch of the Nazarene 520 Montpelier av Nazarene Mission 97 Rutherford av (Presbyterian) East Macon 377 Clinton FIRST 660 Mulberry Log Cabin 144 Log Cabin dr Tatnall Square 752 College Vineville 441 Vineville av Washington Av (c) 221 Washington av (Roman Catholic) ST JOSEPH'S 812 Poplar St Peter Claver 428 Ward (V) (Scientist) First Ch of Christ 455 Georgia av (Undenominational) Gospel Tabernacle 728 Blackburn av Roberson Tabernacle 110 Gaillard (V) SALVATION ARMY THE 616 Mulberry CIGARS AND TOBACCO (Retail) Congregation Sherah Israel 601 1st Temple Beth Israel 870 Cherry Brown E C 453 2d Schulte A 501 Cherry Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 631 Everybody Reads Macon Evening News, The Macon Telegraph J- W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 (;hmy a Macon Bottling Co. Phone 32 6 6 TELL THEM AND YOU WILL SELL THEM USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston. S. C. (Wholesale) Macon Cigar & Tob Co 651 Broadway HP^-ceay-fire FIRETITE MORTARS--McNair Ebr & Sup Co 266 5th FIRETITE PEASTIC-McNair Ebr & Sup Co 266 5th Watson Jas (c) 339 4th av (U) White ED (c) 863 Ocmulgee Williams W W 419 Adams Wimberley J H (c) 610 Hall (EM) Wingfield S B 1703 2d Wright L H 111 Coleman av (Christian) Small E T 132 Rembert av CLAY PRODUCTS (See Also Brick MIrs) Dickey W S Clay Mfg Co Pine cor 10th Genl Reduction Co ft Poplar (Church of Christ) Blankenship K T YMCA McElroy Jack 726 Date av CLEANING SUPPLIES KUHN MFG CO 314 Broadway (Episcopal) Claiborne R R Jr 460 Hill Crest av Glover M W 129 Pio Nono av CLERGYMEN (Adventist) (Holiness) Oglesby Graham 109 Thomas (LCHts) Chapman M E 1420 Oglethorpe Reid James (c) 518 Clinton (Jewish) (Baptist) Baker A C 232 High Ballard J W 325 Duncan av Bivins E D (c) 208 Cedar (U) BOONE J P 121 High Butts Wm (c) 220 Short la Calhoun E J (c) 994 Montpelier av Cephus Nathl (c) 238 Telfair Davis J T (c) 227 Chestnut Dofiough A B 602 Mikado av Evans I W (c) 330 Ward (V) Evans J H (c) 558 Monroe (V) Forrester C A 1127 College dr Greenwood N S (c) 300 Antioch rd Hall W M (c) 529 Clinton Hinesley W F 101 Inverness av Hoyt E W (c) 402 (307) Henderson (SM) Hudson J H (c) 552 Chappell (SM) McClendon B B(c) 217 Telfair Monsees J A 325 Adams Northington H F 908 Napier av Philips W L (c) 408 Ward (V) Riley E E (c) 103 1st av (U) Sammons J E 208 Delaware av Saxon J T (c) 125 (220) Norris Stitt C W 250 Church (EM) Taylor H F (c) 409 (536) Henrietta (SM) Terrill L, M (c) 517 Calhoun Marcuson I E 204 Buford pi (V) (Methodist) Cleveland Bradley (c) 418 (432) North Cook E F 99 Vineville av Apt D2 Davis H H (c) 318 (320) Patterson Fountain M A (c) 653 Spring Greene H V (c) 422 (438) North Harbour C B 861 1st Harmon J A 219 High Jefferson R J Johnson Silas 2(4C7) 212 Powell Vineville av McNair Elisha(c) 575 Monroe (Vj Milligan R J 166 (136) Oakland av Moore Frank (c) 466 Hawthorne Outler A C 101 1st Reese J D 103 Ridge av (I) Rountree J A 128 Pearl Scott W E 104 Church (EM) Shopshire James (c) r 502 (481) Charles Solomon Z C (c) 721 3d av (V) Stanford T B 203 Jeff Davis (SM) Stephens H T (c) 711 Charles Webb J R 648 Pio Nono av (Nazarene) Morgan O F 125 Colquitt Shelton E M 412 Belmont av BUILDERS lumber company LUMBER AND BUILDING MATERIAL Office 357 Cherry St--Factory 130 Cherry St--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phono 1445 632 Baldwin's and Telegraph's LOOK TO STERCHPS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 (Presbyterian) UNCLOTHING--MEN'S Harris A G 112 Buford Landrum C L 426 Carling av McCrorey Lawrence (c) 236 2d av (Y) Wilcox G W 102 Culver (V) (Roman Catholic) Barthlen Alphonso 430 Ward (V) McDonnell peter s. j. 814 poplar Slttler Alphonso 430 Ward (V) CLOCK DEALERS MATTHEWS R H INC 409 Broadway FASHION PARK--Jos N Neel Co 456 Cherry GRIFFEN--Herbert Smart CIo Co 559 Cherry HICKEY-FREEMAN--Jos N Neel Co 456 Cherry KCPPENHEIMER--Herbert Smart CIo Co 559 Cherry MICHAELS-STERN--Jos N Neel Co 456 Cherry MIDDI SHADE--Dannenberg's 462 3d SOCIETY BRAND--R S Thorpe & Sons 515 Cherry jmf-CLOCKS CLOTHING DEALERS BIG BEN--Kernaghan-Goodman Inc 411 Cherry NEW HAVEN--Kernaghan- Goodman ill Cherry SETH THOMAS--Kernaghan-Goodman 411 Cherry SETH THOMAS--R H Matthews Inc 409 Broadway CLOTHES CLEANERS AND PRESSERS (See also Dry Cleaners) Bishop J T 558 Mulberry Broadway Cleaners (c) 1222 (1232) Broadway CRESCENT LDRY CO 519 2d ECONOMY SHOE REPRS & DRY CLNRS 564 Cherry Elec Dry Cleaning Co 115 Cotton av Hill Dry Cleaning Co 816 Vineville av INDEPENDENT LDRY CO 452 2d LEAPTROT'S DRY CLEANING CO 108 Hardeman av McGee Geo (c) 1012 Ocmulgee MILADY CLEANERS 692 College New York Clnrs 557 Cherry Porter's Dry Cleaning Co 610 New Robertson Lafayette (c) 315 Broadway Sharp Chas (c) 752 Elm SNOW'S LDRY & DRY CLEANING CO 766 Poplar TATNALL SQUARE DRY CLEANING CO 603 Linden av Vineville Br Pressing Club (c) 103 Hardeman av Wright J B (c) 246 (r) Main (EM) (Men's) Bashuk Edw 554 Poplar DANNENBERG'S 462 3d DAY'S 406 3d Gay CIo Co 458 3d Hayes CIo Store 553 Cherry Ivey E N 305 Broadway NEEL JOSEPH N CO 456 Cherry RELIABLE OUTFITTERS THE 572 Cherry Schwob Co The 403 Cherry SMART HERBERT CLO CO 559 Cherry THORPE R S & SONS 515 Cherry X V Clothes Shop 454 Cherry (Second Hand) Ideal Clothing Store 1235 Broadway Michael Jos 462 Cotton av (Women's) Barfield Dress Shop 360 Broadway Beverly Dress Shop 414 3d DANNENBERG'S 462 3d Daring Shops 552 Cherry Globe Dress Shop The 404 3d Kaybee CIo Store 416 3d Lerner Shops Inc 520 Cherry Mangels of Ga Inc 420 3d Mary Elizabeth Shop 566 Cherry Mayson's 359 3d Peggy Hale Inc 468 Cherry Putzel Rose Mrs 810 Montpelier av Snyders Ready-to-Wear 609 Cherry HATCHER & McCRARY. IHC. Business Property---Sales & Leases--General Insurance Surety Bonds--Loans--Investments 608 Mulberry St. Phone 6186 Macon Bottling Co. PHONE 3 2 66 Signature Only SAME DAY For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 633 Everybody Reads Macon Evening News, The Macon Telegraph FactoryDistributors Faints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 836 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. A THE Trip To ENGLAND CHIROPRACTOR Means a Start on the Road to Health CLOTHING MANUFACTURERS Adams Mfg Co 7 Express Happ Bros Co 674 Broadway CLUBS (See also Associations) Bibb County Democratic Women's Club Hotel Dempsey Business and Professional Womens Club 200 Baconsfield (NH) Catholic Club House 521 New Elks Club 127 Cotton av Idle Hour Club RD 1 Forsyth rd Ingleside Garden Club 107 Plaza Kiwanis Club Hotel Dempsey Lions Club Hotel Dempsey Macon History Club 350 Olive Macon Musicians Club 554% Muberry Macon Study Club Mercer University Macon Women's Club 200 Baconsfield Masivic Club 518 Walnut Pilot Club 200 Baconsfield (NH) Porterfield Garden Club RD 3 RIVOLI RIDING CLUB Forsyth rd extd RlvoU Ga ROTARY CLUB OF MACON GA THE Rutherford Garden Club 220 Lynmore av Shirley Hill Club Nottingham dr (SH) Sketch Cub 130 Georgia av Utility Club 518 Walnut Vineville Garden Club 716 Forsyth W'COAL BLACK STAR--B F Merritt Coal & Wood Co 1414 1st BLUE GEM--Empire Dixie Coal Co 5th at Plum BONNY BLUE--Atlantic Ice & Coal Co Waterville rd CREECH--B F Merritt Coal & Wood Co 1414 1st CREECH--Buck Ice & Coal Co 2302 Forsyth rd CREECH--Empire Dixie Coal Co 5th at Plum DIXIE GEM--Atlantic Ice & Coal Co Waterville rd LIGGETT--Atlantic Ice & Coal Co Waterville rd MARATHON--Riverside Ice & Coal Co 5th at Bridge MONTEVALLO--Riverside Ice & Coal Co 5th at Bridge MONTEVALLO--Atlantic Ice & Coal Co Inc Waterville rd RED ASH--Empire Dixie Coal Co 5th at Plum REGAL--B F Merritt Coal & Wood Co 1414 1st SO. STAR--Atlantic Ice & Wood Co Waterville rd COAL--BAGGED EMPIRE DIXIE COAL CO 5th at Plum COAL DEALERS (Retail) ATLANTIC ICE & COAL CO 212 Walnut, 301 Pio Nono av and Waterville rd nr Reid EMPIRE DIXIE COAL CO 5th at Plum KINNETT-ODOM CO 154 Railroad av MERRITT B F COAL & WOOD CO 1414 1st RIVERSIDE ICE & COAL CO 5th at Bridge Sawyer's Ice & Coal Co 6th nr Mulberry TBAWICK CLAUDE COAL CO 201 Edgewood av WEBB COAL CO Boll Home rd (Wholesale) KINNETT-ODOM CO 154 Railroad av TBAWICK, CLAUDE COAL CO 201 201 Edgewood av COAL--STOKER EMPIRE DIXIE COAL CO 5th at Plum 1WCOAL STOKERS IRON FIREMAN--Lowe Elec Co 131 Cotton COFFEE ROASTERS KENNY C D CO 320 Oglethorpe Southland Coffee Co 503 5th WTCOKE A. B. C.--Riverside Ice & Coal Co 5th at Bridge J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 634 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 COKE DEALERS (Retail) ATLANTIC ICE & COAL CO Waterville rd MERRITT B F COAL & WOOD CO 1114 1st TRAWICK CLAUDE COAL CO 201 Edgewood av WEBB COAL CO Roff Home rd (Wholesale) TRAWICK CLAUDE COAL CO 201 Edgewood av COLLEGES (See also Schools) CENTRAL CITY COLLEGE (c) 1035 Clinton rd MERCER UNIVERSITY Ash cor College WESLEYAN COLLEGE Forsyth rd extd at Wesleyan Sta Wesleyan Conservatory 500 College COMMERCIAL PRINTERS (See also Printers) BURKE J W CO 406 Cherry COLD STORAGE ATLANTIC ICE & COAL CO Water- ville rd BUCK ICE & COAL CO 2302 Forsyth rd J. W. BURKE COMPANY OFFICE EQUIPMENT PRINTERS Phone 74 and 75 406 Cherry St. COLD STORAGE--FURS SNOW'S LDRY & DRY CLEANING CO 766 Poplar f|^~COLLARS ARROW--Dannenberg's 462 3d VAN HEUSEN--Dannenberg's 462 Sd COLLECTIONS Alliance Corp 103 Ga Casualty Bdg DOCTOR'S BUSINESS BUREAU & COLLECTION SERV 420 First Nat Bk Bldg THE FIRST NATIONAL BANK & TRUST CO THE FIRST NATIONAL BANK & TRUST CO. In Macon Member of Trust Company of Georgia Associates Henry I j (C) 805 Broadway MACON CREDIT BUREAU 514 Ga Casualty Bldg COGGIN & MANN 618 Poplar HOLT & HANBERRY 367 Broadway JONES & CONEY 411 Broadway JONES & CONEY COMMERCIAL PRINTERS "Your Work Delivered When Promised'' 411 Broadway Phone 3087 MURRAY PRINTING CO 471% 3d RICHARDSON ENGRAVING CO 461 Broadway SMITH & WATSON 517 Poplar CONFECTIONERS Apex The 551 Broadway Ballizia Frank 21 5th Cheeseman's Ice Cream Shops 355 3d Duffy P A 672 Cherry FAIRYLAND DAIRY 120 Hardeman av Green Front The 564 Poplar Hester P W (c) 17 5th Jo-Jo's 505 Montpelier av Kahdy A G 467 Broadway Kennesaw The 557 Broadway Nesbit Maggie (c) 515 Cotton av Norris W J 809 Broadway Palace of Sweets 304 Cherry PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 75 C. W. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OR MOKE AUTOBANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Sendee Used Cars Bought and Sold 364 1st St. across from Y, M. C. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 63S Everybody Beads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Ave. Phone 59 Paul's PI 268% Main (EM) Raymond's Drink Stand 208 (154) Center (EM) Self G G 2837% Houston Silver Dollar 316 Broadway Socks Sami 555 3d Sou's Place 1931 2d Swannee Sweet Shop 356 2d Swift W O 305 Mulberry Tom's Place 703 (1795) Log Cabin dr Webbs Place 670 Cherry Williams H W 2142 2d Yellow Jacket The 559 Broadway CONSERVATORIES Wesleyan Conservatory College CONTRACTORS (Building) Amerson G C 107 Carlisle av Andrews A G 457 Virginia av Bollinger R A 756 Ridge (I) Briggs A R 3803 Houston av Cassini J B 255 Winship Cornell-Young Co 502 First Nat Bk Bldg Davis F A 1298 Ridge (I) Evans D F 310 Rocky Creek rd Goodrich F W 909 (923) Log Cabin blvd Griffin W D 210 Winship Hall G S 170 Virgini aav Humphries R S 145 Piedmont av Kendall J B 102 Madden av Leggett C A 538 Cotton av Pender J W 3205 Houston av (SM) Raines F G 294 Cherry av Shaw M E 346 Hardeman av Simmons T S 660 Elm Smalling's R H Sons 301 Bibb Bldg Smith J S 107 Toombs (Mikado pi) Stillwdll Construction Co 1216 Broadway Thames W F 401 Duncan av Turner W S 867 Cherry Walthall W W 812 Hillyer av Ware D B 127 (315) W Grenada ter (Concrete) Clark R A 311 (100) Ingleside (I) Bishop J P 616 Johnson av (Electrical) Evans Elec Co 713 Broadway EVES ELEC CO 260 2d Hurley Elec Co 452 Cotton av Ingleside Elec Co 1909 Vineville av LOWE ELEC CO 131 Cotton av Macon Elec Co 315 3d Putzel Morris Inc 519 Cherry Stewart-Goette Elec Co 558 2d (Floor Tile) SO FLOORING & INSULATING CO 306 Oglethorpe (Flooring) So Hardwood Flooring Co 616 Poplar (Hauling) Campbell H L 504 Mikado av Campbell I J 212 Davi3 (SM) (Heating) MILLER BROS 222 Cotton av MILLIRONS FLMBG A HEATING CO 107 Cotton av Taylor-Quickel Engineering Co 308 2d Yetter Geo F Inc 107 Cotton av (Plumbing--See Also Plumbers) Irby Bros 569 Mulberry MILLER BROS 222 Cotton av Shelton T D 400 2d Hall G S 170 Virginia av Wood T L 512 1st Yetter Geo F Inc 451 Cotton av (Roofing) Andrews Tin Shop 509 Cotton av DUNLAP ROOFING CO 266 5th GA ROOFING & SUP CO 306 Oglethorpe COOPERS MACON COOPERAGE CO 614 Division Raible J R Cooperage Co 7th cor Poplar CORSETIERES Charis Corp 606 Grand Bldg 9C~CORSETS KABO--Dannenberg's 462 3d COSMETIC SHOPS Earle Nancy Cosmetic Co 201% Cotton av WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MUJLWORK Store; 467 3rd St. Factory: Cherry & 7' Phone 278 Phone 166 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 636 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. Grayson Dolly Cosmetic Co 307 Macon Sav Bk Bldg "COSMETICS COTV'S--Dannenberg's 163 3d MARINELLO--Vanity Beauty Shop 352% 2d MAX FACTOR--Dannenberg'a 462 3d BVDDMAB--Dannenberg's 462 3d COTTON Anderson Clayton A Co 350 Poplar Heard Bros 350 Poplar Kinney W O * Co 460 Pine COTTON COMPRESSING Southeastern Compress & Whse Co It Poplar "COTTON BUCK WILLINGHAM--A S Hatcher Co 596 Sd COTTON MILLS SUNSHINE CREAMERY MILK -- BUTTER ICE CREAM Phone 1181 510 Forsyth St. Swift & Co 575 5th CREDIT BUREAUS (See also Mercantile Agencies) DOCTOR'S BUSINESS BUREAU A COLLECTION SERV 420 First Nat Bk Bldg DUN A BRADSTREET INC 709 Bibb Bldg MACON CREDIT BUREAU 514 Ga Casualty Bldg CREDIT CLOTHIERS BAY'S 406 3d CREDIT REPORTS MACON CREDIT BUREAU 514 Ga Casualty Bldg Atlantic Cotton Mills 300 Oak Haven av Bibb Mfg Co ofc & plant No 1 235 Main (EM) Willingham Cotton Mils Railroad av cor Holt CREOSOTE DEALERS SCHALL PAINT CO 307 Mulberry CURTAINS A DRAPERIES COTTON SEED OIL COMPANIES Buckeye Cotton Oil Co Division nr Edgewood av Central Cotton Oil Co 652% 3d * ft Poplar Proctor & Gamble MIg Co Hammond cor Hazel So Cotton Oil Co Waterville rd nr Stratton Swift & Co Waterville rd nr Elbert Cooper O G 431 (430) Log Cabin dr EPOSIT your funds with our bank. D The First National CREAMERIES (See also Dairies) Macon Butter Co 619 Linden av SUNSHINE CREAMERY 510 Forsyth Bank & Trust Co, IN MACON Member of Trust Company of Georgia Associ&tes 602 CHERRY ST. PHONE 2834 Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate McCLURE OFFICE EQUIPMENT CO. Mimeographs and Supplies 560 Mulberry St. Phone 903 Phone 5036 McNair Lumber & Supply Co.. 266 Fifth St. Phone 1400 Macon City Directory 137 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. MUECKE & SONS CO Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures DAIRIES (See also Milk Dealers) Cranford J E 340 Grenada ter Marshall H D 302 Mercer (B) Smith J T 1242 College SUNSHINE CREAMERY 510 Forsyth DANCING TEACHERS & SCHOOES Baber-Blackshear Birdie 856 Walnut Baher-Blackshear Mary 856 Walnut Kelly Gertrude 232 Georgia Smith Virginia 133 Summit av Yoman Dance Studio 652 Mulberry DELICATESSENS Canter's Delicatessen 208 Cotton av Yelin Benj 458 Cotton av DELIVERY SERVICE PARCEL DEL CO Schatzman al bet Cotton & 2d DENTAL LABORATORIES Anderson W G 408 Macon Sav Bk Bldg Dixie Dental Lab 2 Jaques Bldg Macon Dental Depot 556 Mulberry DENTISTS Anderson O C 569% Cherry Bell J J (c) 226% Cotton av Brown C H 1002 Ga Casuaty Bldg CHILDS W B 701-03 Ga Casualty Bldg Clark Gilliam 711 Bibb Bldg Craddock H W 567 Walnut Farmer F W 315 Doctors Bldg Gates P G 1005 Ga Casualty Bldg Gleason O M 723 Bibb Bldg Gregorie C H 161 Cotton av Harden Timothy 511 Bibb Bldg HOLLEY 3 C (c) 300-02 Knights of Pythias Bldg Holmes W B 556 Mulberry Jenkins W A 608 Ga Casualty Bldg Joanis W C 208 Grand Bldg Jordan J R 803 Ga Casualty Bldg Lovelace J W 605% Cherry Mabry R H 510 First Nat Bk Bldg Mason R H 405 First Nat Bk Bldg Murphy RH 919 Ga Casualty Bldg Perdue C H 303 Macon Sav Bk Bldg RESPESS E R 606 Ga Casualty Bldg SCHUSTER M RICIID 612-13 Grand Bldg Slade T J 607 Bibb Bldg SPURLOCK B H 507-09 Bibb Bldg Stukes J T 908 Ga Casualty Bldg Toole C L 720 Bibb Bldg Valentine E H 1002 Ga Casualty Bldg Walton D T (c) 419 Knights of Pythias Bldg Watson O O 567 Walnut Wells W D 301 Macon Sav Bk Bldg Woodwward T L 304% 3d Yarbrough C A 713 Bibb Bldg DEODORANT BLOCKS & CRYSTALS KUHN MFG CO 314 Broadway DEPARTMENT STORES Burden-Smith & Co 350 3d DANNENBERG'S 462 3d McCommon Bros 456 3d Penney J C Co 362 3d SEARS-ROEBUCK & CO 552 3d UNION DRY GDS CO 417 Cherry DEPARTMENT STORES (Five Cents to One Dollar) Dime Store The 330 Main (EM) Grant W T Co 408 3d Green H L Co 450 3d Kress S H & Co 610 Cherry Newberry J J Co 502 Cherry Woolworth F W Co 514 Cherry Kff~DESKS GUNN--McClure Ofc Equipment Co 560 Muberry STANDARD--McClure Ofc Equipment Co 560 Mulberry McCLURE OFFICE EQUIPMENT CO. OFFICE OUTFITTERS Phone 903 560 Mulberry St. DIAMONDS KERNAGHAN-GOODMAN INC 411 Cherry MATTHEWS R H INC 409 Broadway JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 638 Baldwin's and Telegraph'* LOOK TO STERCHPS for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 DIRECT MAILING SERVICE MACON TYPEWRITER & OFC SUP CO 664 Mulberry DIRECTORY PUBLISHERS BALDWIN DIRECTORY CO INC Home Office 126 Meeting, Charleston, South Carolina POLK R L & CO Home Office, 4SI Howard, Detroit, Michigan DOOR MANUFACTURERS WILLINGHAM SASH & DOOR CO 457 3d DOORS--OVERHEAD & GARAGE DUNLAP ROOFING CO 266 6th DRESSMAKERS Averill Orva R Mrs 750 2d Beebe Eliz 817 Mulberry Butler Mamie E (c) 20 Spring Calhoun Emma Mrs 812 2d Card Pleasant (c) 301 Green Chester Alberta 742 College Dewberry Victorine Mrs 718 2d Forsyth Estelle (c) 164 5th av (V) Fowler Sophronia (c) 953 Ocmulgee Freeman Drucilla Mrs 712 2d Goodman Annie (c) 260 2d (V) Holmes Lizzie (c) 405 (508) Prince (SM) Jackson Leila (c) 104 (4) Orchard av Lynch Julia F 556 Pine Meadows Nettie B Mrs 765 Walnut McGill Lilly 452 Spring Mitchell Mary (c) 110 (162) Virgin (V) Monroe Anna (c) 101 Rose Crest av Newsom Minnie Mrs 717 Cherry Sanford Willie (c) 238 Jefferson Small Mary (c) 306 Clark av (V) Stephens Mary E Mrs 168 Spring Sumner Katie M 100 Fulton (Lynmore) Sumner Lucille N 100 Fulton (Lynmore) Walton Eliz (c) 544 (540) 3d av (V) Ware Mary D Mrs 556 Pine Williams Miranda (c) 204 Madison (V) Willis Josephine 1242 Coliege dr Wilson Bessie (c) 207 4th av (V) DRUGGISTS (Retail) Balkcom's Pharm 340 Main (EM) BELL'S PHARM 400 Montpelier av CHAPMAN'S PHARM 574 Mulberry Cherokee Pharm 801 Montpeier av CHICHESTER'S TATNALL SQ DRUG STORE 601 Linden av Coleman's Pharm 124 Hardeman av College Hill Pharm 290 Washington av Exchange Pharm 502 2d Fisher's Drug Store 920 Napier av Fulford's Pharm 739 College Glass' Pharm 302 Broadway Highland Pharm 119 North av (NH) Ingleside Pharm 1919 Vineville av JACOBS' PHARM 602 Mulberry KYLES' DRUG STORE (c) 627 Cotton av L & N Drug Co 610 3d Liggett's Drug Store 512 Cherry Mack's Alf Pharm 401 Cherry Macon's Pharm 402 Cherry McCrary De Witt Drug Co 336 Main (EM) Mitchell & Williams Inc 656 Cherry & 376 2d Morris Drug Store 301 (302) Campbell av (SM) NIPPER'S PHARM 700 Spring Parks Pharm 3498 Houston av Peacock's Central Pharm 842 Vineville av Pitts Pharm 2902 Forsyth rd Settle J H 1932 2d Settle J H Jr 2600 2d Shelverton-Bayne Drug Co 103 Cotton av Simmons S T ()c) 251 5th Stevens W O 1040 2d Thomas L A Drug Co 1001 Broadway Triangle Pharm 2640 2d Vineville Drug Co 815 Vineville av Volunteer Pharm 472 1st Walgreen Co 518 Cherry Wesleyan Pharm RD 1 Forsyth rd Whitmans Pharm 179 Spring Winton's Pharm 1000 2d Wright Steve M Pharm 503 Broadway (Wholesale) Coleman-Meadows-Pate Drug Co 351 Cherry McKesson-Riley 418 Broadway Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE MACON TRANSFER COMPANY And Furniture Exchange PHONE 804 408 BROADWAY McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 639 Everybody Reads Macon Evening News, The Macon Telegraph LET US PLAN YOUR NEXT ADVERTIS- ING SALES CAMPAIGN FOR YOU USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston, S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. DRY CLEANERS (See also Clothes Cleaners) CRESCENT LDRY CO 519 2d ECONOMY SHOE REPRS & DRY CLNRS 664 Cherry INDEPENDENT LINEN SERV 452 2d Leaptrot's Dry Cleaning Co 108 Harde- DYERS CRESCENT LDRY CO 619 2d INDEPENDENT LDRY CO 452 2d SNOW'S LDRY & DRY CLEANING CO 770 Poplar LEAPTROT'S CLEANING AND DYEING "Leaptrot's Is Different" Cash and Carry 109 Hardeman Ave. Phones 78-79 Milady Cleaners 692 College MILADY CLEANERS Day Service on Men's and Women's Garments 692 College St. Phone 817 SNOW'S LDRY & DRY CLEANING CO 766 Popar Tatnall Sq Dry Cleaning Co 603 Linden av DRY GOODS (Retail) Berry's Dry Gds Co (c) 359 & 765 Broadway DANNENBERG'S 462 3d Dolinsky Leon 418 Poplar McCommon Bros 466 Mulberry Moore Dry Gds Co 502 Poplar So Dry Gds Store 468 Poplar UNION DRY GDS CO THE 417 Cherry United Dry Gds Co 312 3d (Wholesale) Dannenberg & Waxelbaum Co 468-70 3d Standard Whol Co 360 3d DUST MOPS KUHN MEG CO 814 Broadway U1 VERY banking facilHi ity. The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 ELECTRIC MOTORS & GENERATORS EVES ELEC CO 260 2d WILSON 3 W ELEC REPR SHOP hr Wall ELECTRIC WELDING WILSON 3 W ELEC REPR SHOP 23 WaU ELECTRICAL APPLIANCES SEARS-ROEBUCK & CO 552 3d ELECTRICAL CONTRACTORS (See also Contrs-Elec) EVES ELEC CO 260 2d LOWE ELEC CO 131 Cotton av ELECTRICAL ENGINEERS EVES ELEC CO 260 2d ELECTRICAL REFRIGERATOR DEALERS DANNENBERG'S 462 3d LOWE ELEC CO 131 Cotton av SEARS-ROEBUCK & CO 652 3d STERCHI BROS STORES INC Cherrjr sw cor Broadway BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 640 Baldwin's and Telegraph'* LOOK TO STERCHFS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway ELECTRICAL REFRIGERATOR PARTS (Wholesale) LOWE ELEC CO 131 Cotton av ELEVATOR BUILDERS AND REPAIRERS Otis Elev Co 602 Bibb Bldg ELOCUTION TEACHERS Harper Eunice 140 Georgia av Kuhr Dorothy (dramatics) 855 Mulberry Apt 400 EMBALMERS INDEPENDENT FUNERAL HOME (C) 457 Cotton av Macon fegHeta Bottling Co. PHONE ELECTRICAL REFRIGERATOR SERVICE If'ENAMEL 3266 EVES ELEC CO 260 2d WILSON 3 W ELEC REPR SHOP 3 Wall MTELECTRICAL REFRIGERATORS COLDSPOTS--Searg-Roebuck & Co 552 Sd CEOSLEY--Sterchl Bros Stores Inc Cherry tv cor Broadway GRAY SEAL--Schall Paint Co 367 Mulberry ENGRAVERS BURKE 3 W CO 406 Cherry COGGIN A MANN 618 Poplar ENGRAVERS--PHOTO QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway FRIGIDAIRE--Sterchl Bros Stores Inc Cherry sw cor Broadway NORGE--Dannenberg's 462 3d RICHARDSON ENGRAVING CO 461 Broadway EXCHANGES Griggs Swap Mkt 412 Poplar Woman's Exch 209 Cotton av EXPRESS COMPANIES (See also Motor Express) ELECTRICAL REPAIRING By Exp Agcy Terminal Sta Southeastern Exp Co Terminal Sta WILSON 3 W ELEC REPR SHOP 23 Wall ELECTRICAL SUPPLIES (Retal) Hurley Elec Co 452 Cotton av EXPRESSING, MOVING A HAULING (See also Express Co's) MACON TRANS CO 408 Broadway Pryor Otis (c) 338 Hammond TAYLOR TRANS CO 458 Plum Wiley Henry 252 Broad Signature Only SAME DAY M 0 H E For Reliable Salary People Macon (Wholesale) exterminators Trading LOWE ELEC CO 131 Cotton av BRUCE TERMINIX CO 506 Mulberry and Invest- HATCHER & McCRARY. IHC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 ment Co. 220 Ga. Gas Bldg. Phone 29S McNair Lumber & Supply Co., 266 Fifth St Phone 1400 1835 Macon City Directory 641 Everybody Reads Macon Evening News, The Macon Telegraph A ENGLAND THE To fcfm mm m* CHIROPRACTOR FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St Phone 326 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. Means a Start on the Road to Health |IRST National can act as your executor. FILLING STATIONS (See Service Stations) FINANCE COMPANIES Ga Mtr Finance Co 111 Ga Casualty Bldg The First National FIRE BRICK Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- dates 602 CHERRY ST. PHONE 2834 WILLINGHAM SASH & DOOR CO 457 3d FIRE EXTINGUISHER DEALERS DUNLAP ROOFING CO 266 5th family finish wash HF-fire EXTINGUISHERS INDEPENDENT LDKY CO 452 2d PYRENE--Dunlap Roofing Co 266 5th FEED MILES FIRE PLACE EQUIPMENT Barfield Feed Mills 248 5th fertilizer manufacturers Cotton States Fertilizer Co ofc 310 Ga Casualty Bldg plant ft Poplar Heard Bros plant 8th nr Cherry Royster F S Guano Co Milledgeville rd bey limits (EM) FILING CABINET DEALERS McClure ofc equipment co 560 Mulberry WILLINGHAM SASH & DOOR CO 457 3d FISH DEALERS (Retail) Acme Fish & Oyster Co 662 Poplar Florida Fish & Oyster Store 316 Main (EM) Macon Fish & Oyster Co 422 2d Momand O F 456 1st Vineville Fish Co 117 Hardeman av IW'FILING CABINETS ALL STEEL--McClure Ofc Equipment Co 560 Mulberry (Wholesale) Durden & Son 216 Lynmore Hub Fish & Oyster Co 349 7th JW-FLOOR COVERING McCLURE OFFICE EQUIPMENT CO. OFFICE OUTFITTERS Phone 903 560 Mulberry St. LIBERTY--3 W Burke Co 406 Cherry CONGOLEUM GOLD SEAL--Dannenberg's 462 3d MASTERPIECE--Dunlap Roofing Co 266 5th FLOOR OILS KUHN MFG CO 314 Broadway Defiling supplies Y-S-E--McClure Ofc Equipment Co 560 Mulberry iWFLOOR POLISHERS OLD ENGLISH ELEC--Kuhn Mfg Co 314 Broadway J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery 9o WWAATUUT hcrip. Motor Rewinding and Repairing PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 642 Baldwin's and Telegraph's LOOK TO STERCHPS for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 FLOOR SOAPS KUHN MFG CO 314 Broadway JJ^'FI.OOR TILE JOHNS-MANVILLE--So Flooring & Insulation Co 306 Oglethorpe FOUNDERS--IRON TAYLOR IRON WKS & SUP CO 1014 Broadway FOUNTAIN PEN DEALERS MATTHEWS R H INC 409 Broadway Jg^-FLOOR WAX JOHNSON'S--Dannenberg's 462 3d OLD ENGLISH--Kuhn Mfg Co 314 Broadway FLOORING--ASPHALT TILE CLARKE R L CO 1218 Broadway FLORISTS Idle Hour Nurseries 109 Cotton av greenhouses on Forsyth rd nr Rivoli Sta Kelley Lillie W Mrs 120 3d Nutting Floral Co 171 Cotton av Turner J W 1108 Main (EM) Woodruff H M 650 Forsyth fPfFOUNTAIN PENS PARKER--Kernaghan-Goodman Inc 411 Cherry PARKER--McClure Ofc Equipment Co SHE5A60FFMEuRlb--erKryernaghan-Goodman Inc 411 Cherry SHEAFFER--R H MATTHEWS INC 409 Broadway SCHAEFFER--McClure Ofc Equipment Co 560 Mulberry WAHL--Kernaghan-Goodman Inc 411 Cherry WATERMAN--Kernaghan-Goodman Inc 411 Cherry WATERMAN--R H Matthews Inc 409 Broadway c. w. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. FLOUR DEALERS FRUIT DEALERS (Retail) (Retail) Birdsey Four Mills, ret stores 2637 Broadway, 320 Main (EM), 802 Montpelier av, 462 Mulberry, 473 & 2648 2d (Wholesale & Millers) Arnold B F 200 Main (EM) Couch C A 1706 Vineville av Davis Joseph 306% 3d Hamburg Louise Mrs 1100 Oglethorpe Rich Dennis 2835 Houston av Roberts D M 607 2d Birdsey Flour Mills Poplar cor 8th Macon Milling Co 5th cor Oglethorpe FLY SCREEN MANUFACTURERS WILLINGHAM SASH & DOOR CO 457 3d (Wholesale) Bateman Co Inc 264 5th Ga Peach Growers Exeh ofc 313 First Nat Bk Bldg FUEL DEALERS JP*FLY SCREENS CINMANCO--Willingham Sash & Door Co 457 3d FLY SPRAY KUHN MFG CO 314 Broadway EMPIRE-DIXIE COAL CO 5th at Plum KINNETT-ODOM CO 154 Railroad av (V) FUNERAL DIRECTORS (See also Undertakers) BURGHARD-CONNALLY 718 Cherry PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices 9 BUR K E S 460 Cherry St. Phone 74 and 75 CASHS For Your Car $15 - $25 $75 OR MORE AUTO- BANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from Y. M. C. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 643 Everybody Reads Macon Evening News, The Macon Telegraph A. & Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 506-598 Third St CLAUDE TRAWICK COAL CO., INC. 201 !!EJd;]gI>ewCoAoRdDAINveA. L, SILVER STAR COALS AND COKE phone ,, BURGHARD-CONNALLY FUNERAL DIRECTOR 718 Cherry St. Phone 1627 CENTRAL CITY FUNERAL HOME (e) 530 Cotton av HUTCHINGS FUNERAL HOME (o) 518 New INDEPENDENT FUNERAL HOME (e) 457 Cotton av FUR CLEANING ^FURNITURE HONOR HILT--Sears-Roebuck A Co 552 3d KROEHLER--Sterchl Bros Store Inc Cherry sw cor Broadway QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway PULLMAN--Sterchl Bros Stores Inc Cherry sw cor Broadway CRESCENT LDRY CO 519 2d FURNISHED ROOMS Barnes Avey Mrs 821 Mulberry Butler Tommie W Mrs 253 Broadway Butt E Florence 224 Georgia av Caserio Lucretia 103 Washington av Dunn Myrtice H Mrs 110 Nisbet pi Fair Mary Mrs 1250 2d Fullington Annie Mrs 763 Cherry Ham Annie Mrs 233 Washington av Hollingsworth Emma C Mrs 767 Walnut Hunnlcutt Emma Mrs 754 Cherry Kea Emma Mrs 361 1st Lord Frances O Mrs 260 Washington av Martin J M 452% Mulberry Meadows Nettie B Mrs 765 Walnut Moore Mary Mrs 860 2d Nutting Sarah C Mrs 468 Walnut Pair Laura H 215 1st Parrish Sallie T 209 1st Roberts Lelia Mrs 619 1st Salters Mattie (c) 316 Walnut Scarborough Martha M Mrs 718 Cherry Sessions Mamie Mrs 821 2d Smith J H 619 2d Smith Ruth Mrs 515 Plum Smith Thelma Mrs 654 2d Stanley J H 407 Walnut Stevens Eliz Mrs 519 Walnut Stevens Vera Mrs 262 Broadway Taylor Fannie Mrs 860 Mulberry Waldorf Bertie E 224 Georgia av Washburn Hse 568 Walnut West Della Mrs 854 Cherry Whitehurst Eugenia J 258 1st Wimberly Wm A 238 Hardeman av Zetter Hse 518 Pine QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway SIMMONS--Johnson Bros 461 2d FURNITURE CRATING MACON TRANS CO 408 Broadway FURNITURE DEALERS (Retail) Backer Fum Co 460 Poplar DANNENBERG'S 462 3d EMPIRE FURN CO INC 522 Poplar Goldgar Fum Co 518 Poplar JOHNSON BROS 461 2d MACON TRANS CO 408 Broadway MARSHALL FURN CO 556 Poplar Maxwell Bros Fum Co 455 2d Mozo Furn Co 113 Cotton av Rhodes A G & Son 616 Cherry SEARS-ROEBUCK & CO 552 3d STERCHI BROS STORES INC Cherry w cor Broadway QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway. WILLINGHAM SASH & DOOR CO. Manufacturers SOmn 457 DOOES' ""WOIIK -- Phone 278 Factory: JCrnhoenrerylo&o 7th. Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 644 Baldwin's and Telegraph'* LOOK TO STERCHPS for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. Taylor Fum Co 159 Cotton av Toole Fum Co Inc 367 2d & 316 3d Union Fum Co 510 Poplar Wood-Peavy Fum Co 359 & 365 2d FURRIERS Barnes J G Fur Shop 316 Washington av (Second Hand) MACON TRAN CO 408 Broadway GIVE ns an opportunity to serve you. MACON TRANSFER CO. AND FURNITURE EXCHANGE Phone 304 408 Broadway Tabor H T 763 Broadway WASHBURN STORAGE CO 201 Poplar WASHBURN STORAGE COMPANY USED FURNITURE OF ALL KINDS 201 Poplar St. Phones 5376-5377 Williams F W 515 Oglethorpe FURNITURE MANUFACTURERS Art Fum Mfg Co 314 Fulton (Lynmore) FURNITURE REPAIRING Anderson M E 103 Pierce av (V) Blanchett J B 103 Wood Duval Paul & Son (c) 460 Cotton av Estes G P 112 Hardeman av Finney & Hudson Co 3021 Houston av (SM) Ford J W 1125 Broadway Gray J T (c) 441 Craft MACON CABINET WKS Poplar nr 8th Phone 471 Established 1886 MACON CABINET WORKS "We Know How" FURNITURE AND FIXTURES Macon, Ga. Muecke R J 514 1st MUECKE & SONS CO 614 New Odom Variety Wks 446 Oglethorpe Rachels A C 100 Bartlett The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 GARAGE BOOBS--OVERHEAD Dunlap Roofing Co 266 5th GARAGES (See also Automobile Service) CHAPMAN'S GARAGE 413 Mulberry FRIED'S GARAGE 352 Broadway McCORD R A MTR CO 215 2d MONK'S GARAGE 618 Broadway ROBERTS FRANK 711 3d SOLOMON S M JR 462 Broadway PfGARDEN HOSE FIRESTONE--Dannenberg's 462 3d g^TGARTERS PARIS--Dannenberg's 462 3d GAS COMPANIES MACON GAS CO 220 2d GAS RADIANT HEATERS WILLINGHAM SASH & DOOR CO 457 3d JJ^-GAS RANGES DETROIT JEWEL--Sterchl Bros Stores Inc Cherry sw cor Broadway ESTATE HEATROLA--Johnson Bros 461 2d Shop At SEARS and SAYE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate McCLURE OFFICE EQUIPMENT CO. Mimeographs and Supplies 560 Mulberry St. Phone 903 Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory E45 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. 6 14 New St. MUECKt & SONS CO. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures Phone 636 U-GAS REFRIGERATORS ELECTROLUX--Sterchi Bros Stores Inc Cherry sw cor Broadway GASOLINE SERVICE STATIONS (See Service Stations) GENERAL MERCHANDISE Burg M R 308 3d Cohen Max 200 (302) Pio Nono Jackson-Wynn Co 301 Poplar Karesh Dept Store 115 Hardeman av Price L B Merc Co 650 2d Sands & Co Inc 573 Broadway Standard Stores Inc 360 3d Trading Post 462 lstt GIFT SHOPS Oak Art & Gift Shop 2514 Forsyth rd IWGLASS LIBBY-OWENS-FORD Middle Ga Lbr Co 214 Cotton av PENNVERNON--Jarrett Paint & Glass Co 320 3d GLASS & PAINT DEALERS JARRETT PAINT & GLASS CO 320 3d McMillan E C Paint & Glass Co 358 3d MIDDLE GA LBR CO 214 Cotton av if'GLASSWARE CAMBRIDGE--Kernaghan-Goodman Ine 411 Cherry FOSTORIA--Dannenberg's 462 3d FOSTORIA--Kernaghan-Goodman Inc 411 Cherry LIBBEY--Kernaghan-Goodman Ine 411 Cherry LOTUS--Kernaghan-Goodman Inc 411 Cherry STERLING--Kernaghan-Goodman Inc 411 Cherry WHEELING--Kernaghan-Goodman Inc 411 Cherry SHT GLOVES FOWNES--Jos N Neel Co 456 Cherry Hammond at So Ry TEXACO--Texas Co The 770 Division DEGREASE SINCLAIR--Sinclair Refining Co GRINDING & SHARPENING Delk Saw & Knife Wks 863 Broadway O K Grinding Co 356% 2d GROCERS (Retail) Abel S W 970 Oglethorpe Abraham Melham 2243 2d Alford's Gro 303 (304) Campbell av Alen J W 852 Hazel Anderson G R (c) 101 Morris (B) Andrews Mattie Mrs 933 Montpelier av Appling Irving (c) 521 (122) Elliott Ard Cash Gro 289 Washington av Ard T E 169 Spring Ard W F 126 (786) Nussbaum Ashley H G 819 Broadway Atwell Mary F Mrs 545 Telfair (SM) Baker Jas 1139 Milledgeville rd Barnes J B 200 Orange z Barnett Sami 514 Church (EM) Bay St Cash Gro 102 Bay Bellevue Cash Gro 201 American blvd Belson's Cash Mkt 1200 Broadway Bennett & Co 1540 Broadway Berg Joseph (c) 235 Middle Bill's Cash Gro 102 Hazel Birdsey Flour Mills, br stores 2637 Broadway, 320 Main, 802 Mont- pelier av, 462 Mulberry, 473 & 2648 2d Birrick E J 203 5th Bolton G S 100 Johnson's al Boone J D 514 Pine Bradley Oscar 454 Cotton av Bragg J R 1219 2d Bray P M 117 Hardeman av Broadway Fish Co 1301 Broadway Brown Alonza (c) 344 Middle (V) Brown L D 2015 Vineville av (V) Brown Wm W 802 3d Brown Wilson W 1083 Pio Nono av Bryant Ernest (c) 153 5th Butler W C 3011 Houston av Byrd Jennie Mrs 236 (102) Virgin la (V) Caldwell Mary A Mrs 133 Bellevue rd Cameriero M Frances 418 Mulberry Campbell C B 316 Plant (SM) Campbell Gro 322 Ward (V) Carswell V I 946 (935) Montpelier av Carter J W 308 Fulton (Lynmore) JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 646 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 Caserio Gro Co 251 Washington av Chambliss Mkt 300 (228) Pio Nono av Chancellor C L 1026 Main (EM) Chanin Barney 652 Poplar Chanin Eva Mrs 1072 Oglethorpe Childs Ellen Mrs 670 Ash Childs J D 1119 Ash Clemons J H (c) 107 Franklin Clinton Cash Mkt 467 (455) Clinton Clower Bessie (c) 210 Telfair Clowers R D (c) 503 Martha Clowers Sara L (c) 301 North Cobb C W 120 Edgewood av Coffee Gro 105 Hardeman av College St Gro 737 College Combrevi Lula N Mrs 228 Cotton av Comer Mattie (c) Cowan nr Lexington Gilman Lizzie Mrs 507 (415) Crisp Goins G W 204 (96) Holt av Goins W E & Son 200 (56) Holt av Goodson W M 500 Chappell (SM) Gordon Cash Gro 475 Douglas & 3d av cor Culver (V) Gordon Gro Co 940 Napier av Gordon R R 2120 Forsyth rd Grady Lester 2643 2d Gray Cora A (c) 100 Rock av Great Atlantic & Pacific Tea Co (For stores see Resident Directory) Green C A 990 Montpelier av Green L D 707 (1799) Log Cabin blvd Groceteria The 2998 Houston av Gruhn W J 302 Main (EM) Hall W T (c) 1010 Main (EM) Cooper Bertha Mrs 210 (99) Myrtle (EM) Hamlin W E 326 Maian (EM) Cooper's Cash Gro (c) 199 (205) Industrial Home rd Copeland S W 1301 3d Couch & Woodall 701 Main (EM) Darity F A 902 Hazel Davis B F 1005 Montpelier av Davis E C 2904 Forsyth rd Dean D E 1004 2d Dean M Otis Mrs 478 Cotton av Dean W G 1624 Broadway Di Venuto Enrico 2918 Houston av Duff Cash Gro 942 (940) Elbert Dukes J H 248 Main (EM) Dumas C M 704 Hawthorne Durden W O 670 Hazel Dyer B H 765 3d Dyes S L 202 Crisp Edwards J E 800 Elbert Edwards J W 442 Telfair (SM) Elder E W 1022 Clinton rd (EM) Elder W G 252 (234) Main (EM) Ellis Ida (c) Clinton rd extd (EM) Emilio Carlo 530 Flanders Epps G A 909 Elbert Etheridge Bros 3705 Houston av Evans Louis (c) 602 Hammond Everett N M (c) 309 Madison (Y) Everett Sami (c) 1001 Pio Nono av Exchange Store 938 (892) Montpelier av Farmer Edw (c) 127 (1) Rockhill la Farmers Trading Post 1033 Broadway Francis Antonio 518 2d Gates T G (c) 987 (978) Montpelier av Getson Carrie Mrs 300 (319) Log Cabin dr Gholson's Cash Gro 408 Main (EM) Gibson G W 327 (328) Dannenberg Gibson Van (c) 518 Pio Nono av Hammock W J 1101 Main (EM) Hampton Henry (c) 205 4th av (V) Handy Geo 268 Main (EM) Hardin G S 504 (424) Pio Nono av Hawes E H (c) 113 (121) Sycamore (V) Hawkins L R 559 Edgewood av Helton Eloise Mrs 826 Montpelier av Henderson-Turner Co 1000 Napier av Hendley W H 454 Clinton Hendley W T 33 Bellevue rd Hester R L 557 Telfair (SM) Hi Lo Gro 516 Montpelier av Hogue Sami 320 Dannenberg av Holt Jos (c) 310 Green Hubbard Edinburgh (c) 609 Fort Hill Hudson B G 3155 Houston av Hudson C D Cinton rd extd (EM) Hudson D E 802 Elm Huey's Mkt 25% (14) Bellevue rd Jabo Thos 670 Poplar Jackson D L 1001 Main (EM) Jarratt A J 303 Forest av (V) Johnson Ernest K Mrs 412 Montpelier av Johnson H L 299 1st av (V) Jones A D 1402 Broadway Jones E E 868 Hazel Jones G J 3481 Houston av Jones Lamar 600 Clinton Jones R T 406 Main (EM) Jones S Co 310 3d Jones V A 50 (45) White (SM) Jones W E 267 Oakland av Kendrick A A (c) 271 4th av (V) Kitchens C M 500 (603) Smith (EM) Kitchens Gro 104 Center (EM) Kitchens J W 1190 Milledgeville rd Knight J H 983 (1793) Montpelier av Lackay & Lackay 1502 Broadway Gilman Gro 315 Rutherford av (SM) Lassetter R L 907 Clinton Taylor Transfer Co. PHONE 3 8 8 moving LONG DISTANCE HAULING STORAGE This Directory Was Published By The Originators Of The ABCD Type MACON TRANSFER COMPANY PHONE 304 And Furniture Exchange . --------------40--8--BR--O--AD--W--AY-- McNair Lumber & Supply Co., 268 Fifth St. 1935 Macon City Directory 641 Of City Directory Phone 1400 Everybody Reads Macon Evening News, The Macon Telegraph Macon Bottling Phone 32 66 TELL THEM AND YOU WILL SELL THEM USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston. S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. Liles W C 803 Main (EM) Little Groceteria 3203 Houston av Log Cabin Serv Store 805 (1800) Log Cabin blvd Lowe Randall (c) 498 (28) Mitchell Lucas Chas (c) 216 (353) Elizabeth (SM) Mack's Place 120 Enterprise Mansfield W S 951 (901) Oglethorpe Marvins Gro 2105 Vineville av Mathis W L (c)~325 Monroe (V) McAfee R K 2101 Vineville av McConnell C A 317 Giles McConnell Willie M Mrs 607 Main (EM) McCrary G D 421 Monroe (V) McCreary W T 1002 Oglethorpe Meaders Gro Co 106 Emory av (SM) Meadows E H 4101 Houston av Meadows J C 1156 Edgewood av Meeks C M 801 (1801) Log Cabin blvd Melton A Gro 98 Clayton (V) MELTON GRO CO 200 Montpelier av Mercer C M 576 Cotton av Miller A T (c) 307 Patterson Mills Gro Co 153 Maple Miraglia Edw 404 Mulberry Mitchell M H 369 North (V) Mitchell Marion 414 (415) 3d av (V) Monroe Turner (c) 203 (788) Prince (SM) Moore J C 2348 2d Moore & Boone 107 Hardeman av Morgan Helen Mrs 2105 2d Morris Gro Store 869 Elm Munson Maggie (c) 207 (200) Charles New Deal Gro 511 Forsyth North Highland Gro 121 North av (NH) Paris C E 201 Linden av Paris Gro Co 600 3d av (V) Parker L F 501 e 2d (EM) Patterson C I 218 American blvd Patterson Jesse (e) 622 3d av (V) Pearson Claudia I Mrs 1243 2d Penny Profit Store 2402 Broadway Pel-Kins J T 13 Grand av (B) Perains W L (c) 821 Fort Hill Perry J C (c) 70 Spring Piggly-Wiggly (For Stores see Resident Directory) Piggly-Wiggly Macon Inc ofc 464 2d Pilcher Mary F Mrs 301 Duncan av Pleasant Hill Gro 425 (424) 3d av (V) Poppell Beulah M Mrs 1650 Broadway Pruett E L 601 Main (EM) Purser R S 651 Elm Quality Food Store 170 New Raines T M Gro Co 805 Montpelier av Reeves C R 1161 Milledgeville rd Richardson's Gro 343 (437) Alabama (SM) Riley O R 976 Riverside Cash MGorontp1e1l0ierGauvstin av Roberson L B 533 Forsyth Rogers Inc (For Stores see Resident Directory) Ross Bros (c) 159 Middle (V) Rowe Amanda (c) 312 2d av (U) Saloom Cash Gro 1239 Broadway Saloom S & Sons 1243 Broadway Sample H B 2001 2d Sanford J H (c) 1215 Broadway Sapp's Gro 229 Turpin Satterwhite W P 862 Hazel Sawyer Arth (c) 514 Fort Hill Scott Minnie G Mrs 1547 College & K# e Napier av Sherwood E L 1102 Napier av Shinholser W N 2822 Forsyth rd Shipman L H 336 Monroe (V) Shrem Abram 432 Flanders (EM) Simmons Gro Co 973 Hazel Smith Ed Gro 2636 Broadway Smith H M 102 Elm Smith M L 261% Madison (V) Smith W G Clinton rd extd (EM) Smith W G 872 Hazel Snyders Cora L Mrs Clinton rd extd (EM) Sowell O R 701 Broad & 95 Clayton (V) Standard Mkt & Gro 159 Frankin Star Mkt 636 Ross Tabor H L 143 Jones Taylor Granwell 161 (347) Nussbaum Thomas J W 103 Whitehead Thomas W P 229 Patterson Tidwell T J (c) 975 Pio Nono av Timothy John (c) 337 Madison (V) Union Toney 771 Broadway Vincent H P 505 (400) Crisp Volkens H W 788 Montpelier av Volunteer Stores 205 Hardeman av Waits T L 614 Telfair (SM) Wallace Karl 1066 Elm Ward N A 10 Elm Weems J C 237 Winship Weinberg Louis 517 (499) Hall (EM) Wellons A R 280 Columbus WHITE 3 B 617 Linden av Wiggins C L 478 Clinton Wilder C E 155 5th Wilder E C Bellevue rd cor Melrose Williams C H 101 Bellevue rd Williams R L (c) 217 (235) Williams la Willingham Gro Co 200 Forsyth BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 407-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 649 Baldwin's and Telegraph'* LOOK TO STERCHFS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 Wilson's 203 Hardeman av, 771 Hazel & 324 Main (EM) Worsham W B Gro 397 American blvd Worsham & Sherrill 523 Pine Wright's Gro 266 Main (EM) Young C T 944 (510) Montpelier av Younis David 120 Bay Zarks Mark 169 5th (Wholesale) Barden & Taylor 7 Terminal av Kent if Herin 9 Terminal av Kingman & Everett Inc 570 Broadway Loftin & New 250 5th Waldorf J S & Son 621 Poplar Werden W R Co 248A 5th Yates & Tabor Co 274 5th GUNS AND AMMUNITION SEARS-ROEBUCK & CO 552 3d S^THAMS PRIDE OF DIXIE--T & T Packing Co 750 Division HANDLE MANUFACTURERS Standard T'ool & Handle Co ft Elm ,f)^~HARDBOARD CELOTEX-McNair Lbr & Sup Co 266 5th ^HARDWARE CRAFTSMAN--Sears-Roebuck & Co 552 3d HARDWARE--BUILDING BUILDERS LBR CO INC 130 Cherry WILLINGHAM SASH & DOOR CO 457 3d HAVE you a checking account ? The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- ciates 602 CHERRY ST. PHONE 2834 HAIR TONIC MANUFACTURERS Sutton S W 625 Oglethorpe HALLS Knights of Pythias (c) 217 Garden (EM) Lackay 1502*4 Broadway Masonic 111 Cotton av Masonic (c) 411% Cotton av Sons & Daughters of Jerusalem (c) 1020 Coleman's la Union Bros & Sisters of Zion (c) 106% Concord Unionville (c) 934 Pio Nono av Woodmen of the World 408 Poplar HARDWARE DEALERS Carter Hdwe & Sup Co 533 Poplar DANNENBERG'S 462 3d Dunlap-Peeler Hdwe Co 357 Cherry Huhn C & Son 408 Mulberry McDaniel Hdwe Co 462 Poplar SEARS-ROEBUCK & CO 552 3d HARDWOOD FLOORS CLARKE R L CO 1218 Broadway HARDWOOD LUMBER SHERWOOD LBR CO 800 San Juan av HARNESS MANUFACTURERS Barnett Mfg Co 315 Poplar Otto Harness Co 355 Poplar HAT DEALERS NEEL J N CO 756 Cherry SMART HERBERT CLO CO INC 559 Cherry HAT RENOVATORS ECONOMY SHOE REPRS & DRY CLNRS 564 Cherry HATCHER i McCRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Macon Bottling Co. PHONE 3 2 6 6 Signature Only SAME DAY For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 649 Everybody Reads Macon Evening News, The Macon Telegraph # ENGLAND CHIROPRACTOR FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St Phone 836 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. Means a Start on the Road to Health Macon Hat Cleaning Co 416 Cherry New York Clnrs 557 Cherry Philadelphia Hat Cleaning Co 615 Cherry SNOW'S BDRY & DRY CENG CO INC 766 Poplar WHATS INTERWOVEN--Jos N Neel Co 458 Cherry PHOENIX--Dannenberg's 462 3d PHOENIX--R S Thorpe St Sons 515 Cherry WIBSON BROS--Herbert Smart Clo Co 559 Cherry DOBBS--R S Thorpe & Sons Ine 515 Cherry KNOX--Jos N Neel Co 456 Cherry SCHOBEE--Herbert Smart Clo Co 659 Cherry STETSON--Dannenberg's 462 3d STETSON--Jos N Neel Co 456 Cherry STETSON--Herbert Smart Clo Co 559 Cherry N7~heaters ESTATE HEATROEA--Johnson Bros 461 2d MOORE'S--Sterehl Bros Stores Ino Cherry iw cor Broadway HOSIERY DEABERS (RetaU) DANNENBERG'S 462 3d SMART HERBERT CBO CO 559 Cherry (Wholesale and Jobbers) So Textile Co 410 Cherry HOSIERY REPAIRING Silk Stocking Hosp 119 Cotton av HOSPITABS A CBINIC8 HEATING CONTRACTORS MIBBER BROS 222 Cotton av MIBBIRONS PBMBG St HEATING CO 107 Cotton av Taylor-Quickel Engineering Co 308 2d Yetter Geo F Inc 107 Cotton av HIDES * FURS Bernd G Co 468 Broadway Block Hide Co 348 Poplar HOG DEABERS T & T PACKING CO 750 Division HOMES & ORPHANAGES Appleton Ch Home 321 Forest Hill av Georgia Industrial Home Industrial Home rd extd Hephzigah Orphanage 3201 Forsyth rd Jones Julia Parkham Benevolent Home 512 Walnut MASONIC HOME OF GA Nottingham dr extd Methodist Orphans Home 201 Pierce av (V) Ciinic The 567 Walnut Macon Hosp 820 Pine Middle Ga Hosp 722 Spring OGBETHORPE PRIVATE INFIRM- ARY 1309 Oglethorpe Pilot Club Dental Clinic 1818 Broadway St Luke Hosp (c) 119 Tatnall Utility Club Clinic 1818 Broadway HOTEBS ARBINGTON HOTEB 511 Broadway Capitol Hotel 560 Plum CENTRAB HOTEB Broadway at Mnlberry Douglass Hotel (c) 363 Broadway Fickling Hotel 510 Mulberry Hotel Arcadia 663 Mulberry HOTEB DEMPSEY 363 3di Hotel Gordon 313 Cherry HOTEB BANIER 525 Mulberry Hote Macon 315 Mulberry Hotel Southland 569 Broadway Lane's Hotel 555 Broadway Richmond Hotel (c) 319% Broadway Terminal Hotel 301 Cherry HOUSE FURNISHINGS UPHOSIERY DANNENBERG'S 462 3d STERCHI BROS STORES INC Cherry HUMMING BIRD--Dannenberg's 462 3d sw eor Broadway J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 650 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 806 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 HOUSE MOVERS Groce A H (c) 121 Davis (NH) IT will pay you to name this bank as executor under your will. The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 ICE DEALERS & MANUFACTURERS Abel Ice Co 320 Montpeier av ATLANTIC ICE & COAL CO WatervUle rd nr Reid, branches 201 Fio Nono av and 212 Walnut, Ice stas 301 Elizabeth A 2905 Houston av BUCK ICE & COAL CO 2302 Forsyth rd East Macon Ice & Coal Co 112 Main (EM) KINNETT-ODOM CO 6th nr Cherry & 154 Railroad av (V) RIVERSIDE ICE A COAL CO 5th at Bridge Sawyer Coal & Ice Co, 6th at Mulberry, branches 1137 Broadway, 2723 Broadway, 403 Main & 277 Walnut ICE CREAM (Retail) Cheeseman's Ice Cream Shops 355 3d Durr's Creamery 800 Montpeier av FAIRYLAND DAIRIES 120 Hardeman av SUNSHINE CREAMERY 510 Forsyth VineviUe Ice Cream Depot 1890 Vine- ville av (Manufacturers) Dixie Dairies 658 Arch Ivey-Tumer Ice Cream Co 635 Oglethorpe ^-ICE CREAM FREEZERS ALASKA--Dannenberg's 462 3d INCINERATOR MFRS Nye Odorless Incinerator Co 218 3d INSPECTION BUREAUS So Weighing & Inspection Bur 5th at Pine ^-INSULATING BOARD CELOTEX--McNair Lbr & Sup Co 266 5th INSULATION CONTRACTORS ROCK WOOL INSULATING CO 306 Oglethorpe INSULATION DEALERS BUILDERS LBR CO INC 130 Cherry DUNLAP ROOFING CO 266 5th ROCK WOOL INSULATING CO 306 Oglethorpe ^-INSULATION MATERIAL GIMCO--Rock Wool Insulation Co 306 Oglethorpe INSURANCE (Accident) EMPLOYERS LIABILITY ASSURANCE--Edw B Harrold Co Agts London Guaranty & Accident Co-- Davis Ins Agcy agts Ocean Accident & Guaranty Corp-- Barnes & Barnes Inc agts PROVIDENT LIFE & ACCIDENT-- W D Griffith & Son agts (Automobile) Federal Ins Co--Hatcher & McCrary agts FIRE ASSN--Murphey, Taylor Sc Ellis Inc agts U S Guarantee Co--Hatcher & McCrary agts PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 75 c. w. Farmer RUBBER BELTING HOSE PACKING Phone 2X3 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OB MORE AUTOBAHX Cars Sold On Easty Terms 30-60-90 DAYS OB LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from V. M. C. A McNair Lumber & Supply Co., 266 Fifth St. Phone 140( W35 Macon City Directory 651 Everybody Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 396-598 Third St. Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 5779 CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Ave. Phone 59 (Casualty) Century Ins Co Ltd---Barnes & Barnes Inc agts AETNA CASUALTY & SURETY--W D COML UNION--Murphey, Taylor & Griffith & Son, Agts Am Motorists Ins Co--J S Lewis agt Am Surety Co--Schofield Ins Agcy agts AUTO MUT INDEMNITY CO-- Chandler & Strickland Co agts Ellis Inc agts COML UNION OF N Y--Roy W Crockett agt CO-OPERATIVE FIRE INS CO OF THE STATE OF GA--Mut Ins Agcy Factory Ins Assn--Willingham & Payne Inc agts Fidelity & Casualty--Dessau Realty & Ins Co agts Fidelity & Casualty--Wilingham & local agts FIDELITY & GUARANTY--Murphey, Taylor & Ellis Inc agts FIRE ASSN--Murphey, Taylor & Ellis Inc agts Payne Inc agts Firemens Fund Indemnity--Dure & Beeks Co agts FIREMAN'S FRIEND--Murphey, Taylor & Ellis Inc agts First Am--Dessau Realty & Ins Co agts GLENS FALLS INDEMNITY-- Morgan & Morgan Ins Agcy agts FRANKLIN FIRE OF PHILA--Luther Williams & Son agts Great Am Indemnity--Effie Dewberry Ga Home--Dure & Beeks Co agts agt LLOYDS AMERICA--Morgan & Morgan Ins Agcy agts LUMBERMENS MUT & CASUALTY CO--Chandler & Strickland Co agts N Y Casualty--Odom Realty & Ins Co agts GENL INS CO OF AM--Macon Ins Agcy agts Globe Republic Ins Co--Hatcher & McCrary agts Granite State--Willingham & Payne Inc agts Halifax Fire Ins Co--Hatcher & N Y Casualty--Schofield Ins Agcy agts SHELBY MUT PLATE GLASS & McCrary agts Hanover--Willingham & Payne Inc agts CASUALTY CO--Morgan & Morgan Home Fire & Marine--Dure & Beeks Ins Agcy agts SHELBY MUT PLATE GLASS & CAS- Co agts Indiana Lbrmn Mut Ins Co--J S Lewis UALTY CO--Mut Ins Agcy agts agt UNITED STATES FIDELITY & GUAR- London Assurance Co--Barnes & Barnes ANTY--Murphey, Taylor & Ells Inc Inc agts agts London & Lancashire--Dure & Beeks Co agts LONDON & PROVINCIAL--Edw B (Fire) Harrold Co agts Lumber Mut Fire Ins Co of Boston-- AETNA--Murphey, Taylor & Ellis Inc agts AGRL INS CO OF WATERTOWN N Y Barnes & Barnes Inc agts AM AUTO FIRE INS CO--Davis Ins Agcy agts AM EAGLE--Murphey, Taylor & Ellis J S Lewis agt LUMBERMENS MUT FIRE INS CO OF MANSFIELD OHIO--Chandler & Strickland Co agts LUMBERMENS UNDERWRITING ALLIANCE--Morgan & Morgan Ins Agcy agts Inc agts Merchants Fire Assurance Co of N Y-- AM EQUITABLE ASSURANCE CO-- B B Willingham agt Ga Underwriters Inc agts MERCHANTS FIRE ASSURANCE ATLANTIC MUT--W D Griffith & Son CORP--Macon Ihs Agcy agts agts Atlas--Willingham & Payne Inc agts Atlas Underwriters--Effie Dewberry agt Boston--Willingham & Payne Inc agts Buffalo--B B Willingham agt Merrimack Mut Fire Ins Co--Davis Ins Agcy agts MILL OWNERS MUT--Chandler & Strickland Co agts CAROLINA MUT--Chandler & Strick- Nat Liberty--Effie Dewberry agt land Co agts NAT UNION--W D Griffith & Son agts WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7th. Phone 278 Phone 159 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 03J Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. NEW HAMPSHIRE--Murphey, Taylor & Ellis Inc agts North River--Schofield Ins Agcy agts NORTHWESTERN MUT FIRE ASSN-- Morgan & Morgan Ins Agcy agts NORTHWESTERN MUT FIRE ASSN-- Mutual Ins Agcy agts OHIO HDWE MUT--Morgan & Morgan Ins Agcy agts PALATINE--Edw B Harrold Co agts PEARL ASSURANCE CO LTD--Morgan & Morgan Ins Agcy agts Penn--Schofield Ins Agcy agts PENNSYLVANIA LUMBERMEN'S MUT--Chandler & Strickland Co agts PHOENIX--Murphey, Taylor & Ellis Inc agts Reliance--Willingham & Payne Inc agts St Paul Fire & Marine Ins Co--So Mortgage Co agts Scottish Union & Nat--Davis Ins Agcy agts Sentinel--Willingham & Payne Inc agts SO MUT--W D Griffith & Son agts STANDARD FIRE--W D Griffith & Son agts SUN INS OFC--Edw B Harrold Co agts UNION ASSURANCE OF LONDON-- Luther Williams & Son agts Westchester--Dure & Beeks Co agts Western Assurance--Dessau Realty & Ins Co agts World Fire & Marine--Odom Realty & Ins Co agts YORKSHIRE--M urphey, Taylor & Ellis Inc agts (Inland Marine) PENNSYLVANIA LBRMN'S MUT-- Chandler & Strickland Co agts (Life) Guarantee Mut--J G Jackson agt John Hancock Mut--E S Davis agt MUT BENEFIT--Luther Williams & Son agts New England Mut--J G Jackson agt ACIFIC MUT--Morgan & Morgan Ins Agcy agts PACIFIC MUTUAL LIFE INSURANCE CO. 604-5-6 Grand Building Phones 1811-1812 MORGAN & MORGAN, District Managers PENN MUT LIFE INS CO--Guy E Paine genl agt STATE LIFE OF INDIANA--Morgan & Morgan Ins Agcy agts Union Central--W G Robarts agt (Surety Bonds) AM BONDING CO--Edw B Harrold Co agts Am Surety Co--Barnes & Barnes Inc agts GREAT AM INDEMNITY--Chandler & Strickland Co agts (Tornado) CAROLINA MUT INS CO--Strickland & Strickland Co agts LUMBERMAN'S MUT FIRE INS CO-- Chandler & Strickland agts INSURANCE AGENTS _ (Accident) LIFE & CASUALTY INS CO--315 Bibb Bldg NAT LIFE & ACCIDENT INS CO OF NASHVILLE TENN 705-06 Ga Casualty Bldg (Automobile) CHANDLER & STRICKLAND CO 206 Ga Casualty Bldg MURPHEY, TAYLOR & ELLIS INC 470 Cherry (Burglary) CHANDLER & STRICKLAND CO 206 Ga Casualty Bldg (Casualty) CHANDLER & STRICKLAND CO 206 Ga Casualty Bldg Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Saving's and Loan Assn. Loans On Ribb County Real Estate McCLIRE OFFICE EQUIPMENT CO. - --w S,Mime0graphS and Supplies Ptone 90 McNair Lumber & Supply Co., 266 Fifth St, *S5 Macon City Directory $53 Phone 5036 Phone 1400 Everybody Iteads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. 6 14 MUECKE & SONS CO i |J Phone New St. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures 6 3 6 MBBPHEY, TAYLOR & ELLIS INC 470 Cherry (Fire) CHANDLER & STRICKLAND CO 206 Oa Casualty Bldg CO-OPERATIVE FIRE INS CO OF THE STATE OF GA 608 Mulberry Dorsett J T 202 Bibb Bldg GA UNDERWRITERS INC 608 Mulberry MACON INS AGCY 508 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry WILLIAMS LUTHER & SON 665 Mulberry LUTHER WILLIAMS & SON Banking in AH Its Branches Insurance of All Kinds Luther Williams Frederick W. Williams 565 Mulberry St. Phone 1586 (General) Barnes & Barnes Inc 361 Cotton av CHANDLER & STRICKLAND CO 2806 Ga Casualty Bldg CROCKETT ROY W 610 Mulberry Davis Ins Agcy 203 Ga Casuaty Bldg Dessau Realty & Ins Co 101 Casualty Bldg Dewberry Effie 564 Mulberry Dure & Beeks Co 321 Mulberry GRIFFITH W D & SON 308 2d Hardeman G G Co 563 Mulberry Harris Morris Ins Agcy 210 Bibb Bldg HARROLD EDW B CO 321 First Nat Bk Bldg Hatcher, Turpin & Hogan 508 Mulberry HATCHER & McCRARY INC 608 Mulberry Lewis J S 210 Ga Casualty Bldg MORGAN & MORGAN INS AGCY 602 Grand Bldg MORGAN & MORGAN INSURANCE AGENCY 604-5-6 Brand Building FIRE AND CASUALTY INSURANCE SPECIALISTS Phone 1811-1812 for Rates MURPHEY, TAYLOR & ELLIS INC 470 Cherry MUT INS AGCY 508 Mulberry Odom Realty & Ins Co 620 Ga Casualty Bldg Schofield Ins Agcy 210 Ga Casualty Bldg WILLIAMS LUTHER & SON 565 Mulberry LUTHER WILLIAMS & SON Banking in All Its Branches Insurance of All Kinds Luther Williams Frederick W. Williams 565 Mulberry St. Phone 1586 Willingham B B 306 Macon Sav Bk Bldg Willingham & Payne Inc 350 2d Wilson J E & Son 702 Bibb Bldg (Health) LIFE & OASUALTY INS CO 315 Bibb Bldg NAT LIFE & ACCIDENT INS CO OF NASHVILLE TENN 705-06 Ga Casualty Bldg (Life) Davis E S 401 Macon Sav Bk Bldg Jackson J G 401 Macon Sav Bk Bldg LIBERTY NAT LIFE INS CO 521 First Nat Bk Bldg LIFE & CASUALTY INS CO 315 Bibb Bldg MORGAN & MORGAN INS AGCY 602 Grand Bldg NAT LIFE & ACCIDENT INS CO Or NASHVILLE TENN 705-06 Ga Casualty Bldg PAINE GUY E 306 Grand Bldg THE G. E. PAINE AGENCY General Agent THE PENN MUTUAL LIFE INSURANCE CO. 306-07-08 Grand Bldg. Phone 887 Robarts W G 406 Grand Bldg JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--PackarndU-- ...|nPLhnoninl e 1445 8 LOOK TO STERCHTS for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 INSURANCE AGENTS (Plate Glass) CHANDLER STRICKLAND CO 206 Ga Casualty Bide CO-OPERATIVE FIRE INS CO OF THE STATE OF GA 508 Mulberry MURPHEY, TAYLOR ELLIS INC 470 Cherry (Special Risks) MURPHEY, TAYLOR ELLIS INC 470 Cherry (Steam Boilers) CHANDLER STRICKLAND CO 206 Ga Casualty Bide Murphey Talyor & Ellis Inc, 470 Cherry (Surety Bonds) CHANDLER STRICKLAND CO 206 Ga Casualty Bide MURPHEY, TAYLOR ELLIS INC 470 Cherry (Tornado) CHANDLER STRICKLAND CO 206 Ga Casualty Bide CO-OPERATIVE FIRE INS CO OF THE STATE OF GA 508 Mulberry (Workmens Compensation) CHANDLER STRICKLAND CO MURPHEY, TAYLOR & ELLIS INC Guaranty Life Ins Co (c) 408 Knights of Pythias Bldg , Industrial Life & Health Ins Co 414 First Nat Bk Bldg t Interstate Life & Accident Ins Co 608 Grand Bldg , Jefferson Standard Life Ins Co 310 First Nat Bk Bldg , Kansas City Life Ins Co 204 Ga Casualty Bldg LIBERTY NAT LIFE INS CO 515 First Nat Bk Bldg Life Ins Co of Va 508 Grand Bldg LIFE CASUALTY INS CO 315 Bibb Bldg Maryland Casualty Co 310 Bibb Bldg Met Life Ins Co 504 Ga Casualty Bldg, farm loan div 410 Bibb Bldg Mut Benefit Life Ins Co 426 First Nat Bk Bldg Mut Life Ins Co of N Y 202 First Nat Bk Bldg NAT LIFE ACCIDENT INS CO OF NASHVILLE TENN 705-06 Ga Casualty Bldg New England Mut Life Ins Co 613 Ga Casualty Bldg New Hampshire Fire Ins Co 910 Ga Casualty Bldg NEW YORK LIFE INS CO 210-12 Grand Bide North Carolina Mut Life Ins Co (c) 412 Knights of Pythias Bldg Northwestern Mut Life Ins Co 470 Cherry Pan-Am Life Ins Co 425 First Nat Bk Bldg Peninsular Life Ins Co 502 Grand Bldg PENN MUT LIFE INS CO 306-08 Grand Bldg INSURANCE COMPANIES Afro-Am Life Ins Co (c) 429 Knights of Pythias Bldg Am Nat Ins Co 404 Grand Bldg Atlanta Life Ins Co (c) 423 Knights of Pythias Bldg Bankers Health & Life Ins Co 211 Cotton av Carolina Life Ins Co 504 Grand, Bldg Coml Casualty Ins Co 207 Grand Bldg Conn Mut Life Ins Co 411,2d Equitable Life Assurance Soc of U S 409 Grand Bldg Granite .State Fire Ins Co 910 Ga Casualty Bldg THE PENN MUTUAL LIFE INSURANCE CO. THE G. E. PAINE AGENCY General Agent 306-07-08 Grand Bldg. Phone 887 Pilgrim Health Life Ins Co (c) 527% Cotton av Progressive Life Ins Co 309 Grand Bldg Prudential Ins Co of Am 301 Ga Casualty Bldg INTERIOR DECORATORS Anderson W B F Jr 145 Academy MACON TRANSFER COMPANY And Furniture Exchange phone 304 408 BROADWAY Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE This Directory Was Published By The Originators Of The ABCD Type Of City Directory McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 l*S5 Macon City Directory 655 Everybody Reads Macon Evening News, The Macon Telegraph J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. DANNENBERG'S 462 3d Hainline J L 559 Mulberry Small Annie K Mrs 115 Rogers (V) Stallings W L 1127 Walnut INVESTMENTS Dure Leon S Co 321 Mulberry O'Neal B P Jr & Co 712 Ga Casualty Bldg J. H. DuBOSE & SON JUNK DEALERS USED AUTO PARTS 121-141 Poplar St. Phone 652 Macon Iron & Paper Stock Co 215 Walnut LET US PLAN YOUR NEXT advertis- ing SALES CAMPAIGN FOR YOU ue direct MAIL Consult Southern Printing and Pub. Company Charleston, S. C. UST a friendly bank. J The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 JANITORS' SUPPLIES KUHN MFG CO 314 Broadway KUHN MANUFACTURING COMPANY JANITORS' SUPPLIES 314 Broadway Phone 362S JEWELERS Brown's Watch Repair Shop 421 Broad- way DANNENBERG'S 462 3d Kernaghan-Goodman Inc 411 Cherry MATTHEWS R H INC 409 Broadway Pekor-Cook Jewelry Co 603 Cherry Regero & Regero 370 2d Sherwood J H 650 Cherry WILLIAMS JEWELRY CO 457 Cherry JUNK & SALVAGE DEALERS Coplan Junk Co Inc 186 Broadway DuBOSE J H & SON 121 Poplar EEP your funds with our bank. K The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- ciates 602 CHERRY ST. PHONE 2834 jpyKALSOMINE SOLARITE--Sehall Paint Co 307 Mulberry TAMM'S WASHABLE--Sehall Paint Co 307 Mulberry gB^KEROSENE REFRIGERATORS ELECTROLUX--Sterchi Bros Stores Co Cherry sw cor Broadway ggTKITCHEN CABINETS HOOSIER--Sterchi Bros Stores Inc Cherry sw cor Broadway SELLERS--Johnson Bros 461 2d KITCHEN FURNITURE DEALERS STERCHI BROS STORES INC Cherry sw cor Broadway KNIT GOODS MANUFACTURERS Southland Knitting Mills Inc 216 Holt av (V) BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 1,30 Cherry St.--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 656 Baldwin's and Telegraph & LOOK TO STERCHI'S for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 f*KODAKS International Assn of Machs 502% 2d International Assn of Theatrical Stage EASTMAN--Dannenbergs 462 3d Emps & Motion Picture Oprs 454% 1st International Brotherhood of Blksmths 502% 2d International Printing Prsmn & Assts ET us handle your es- Union No 124 408 Poplar tate. L Journeymen Barbers of Am 502% 2d Letter Carriers Assn Federal Bldg Macon Div 123 Order Ry Condrs 408 Poplar The First National Macon Federation of Trades 408 Poplar Master Plmbrs Assn of Macon 512 1st Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- Nat Federation of Postal Clks Federal Bldg Plmbrs & Stmftrs Union 1502% Broadway Printers Union 502% 2d ciates Sheet Metal Wkrs International Assn 602 CHERRY ST. PHONE 2834 1502% Broadway LABELS Typographical Union 502% 2d United Brotherhood of Carp & Joiners JONES & CONEY 411 Broadway No 144 408 Poplar United Garmen Wkrs of Am No 213 LABOR UNIONS 408 Poplar United Textile Wkrs of Am 410 Main Allied Trades & Ry Trans Council (EM) ; 408 Poplar Amalgamated Assn of St & Elec Ry LADIES READY-TO-WEAR Emps of Am No 898 408 Poplar Am Federation of Labor 408 Poplar Associated Master Barbers Chapter No NEEL JOS N CO 456 Cherry 284 568 Mulberry Boilermakers Union 1502% Broadway Brotherhood of Locomotive Engrs Ladies Auxiliary 408 Poplar ~LATH Brotherhood of Locomotive Engrs No 210 (C of Ga Div) 512 2d Brotherhood of Locomotive Engrs No 786 (So Ry Div) 515 2d Brotherhood of Locomotive Engrs & CELOTEX--McNair Lbr & Sup Co 266 5th U S GYPSUM ROCK--McNair Lbr & Sup Co 266 5th Firemn Ladies Auxiliary 408 Poplar Brotherhood of Locomotive Firemen LATH DEALERS--METAL & WOOD 1502% Broadway Brotherhood of Maintenance of Way BUILDERS LBR CO INC 130 Cherry Emps 502% 2d McNAIR LBR & SUP CO 266 5th Brotherhood of RR Carmen Central City Lodge No 226 408 Poplar Brotherhood of RR Trainmen No 376 LAUNDRIES 515 3d Brotherhood of Ry Clks 408 Poplar CRESCENT LDRY CO 519 2d Brotherhood of Ry Signalmen 502% 2d INDEPENDENT LDRY 452 2d Clark Edgar A Lodge No 174 Ladies Jung Frank 363 Cotton av Auxiliary Order Ry Condrs 408 Lee Sam 519 Mulberry Poplar Elec Wkrs Union No 84 408 Poplar SNOWS LDRY & DRY CLEANING CO 766 Poplar HATCHER & McCRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Macon (hum Bottling Co. PHONE 3 2 6 6 Signature Only SAME DAY M 0 N E Y For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 657 Everybody Reads Macon Evening News, The Macon Telegraph FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St Phone 326 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. A Trip To THE ENGLAND CHIROPRACTOR Means a Start on the Road to Health SNOW'S LAUNDRY & DRY CLEANING CO. "Clean With Snow" Poplar and New Sts. Phone 6000 LAW SCHOOLS MERCER UNIVERSITY Ash cor College LAWYERS Adams V J 601 Ga Casualty Bldk AKEBMAN CHAS 410-11 Ga Casualty Bldg ANDERSON R L 421-24 First Nat Bk Bldg ANDERSON R L JR 421-24 First Nat Bk Bldg ATKINSON M C 409-11 Ga Casualty Bldg Baldwin C A 408 Ga Casualty Bldg Barnett J W 305 Bibb Bldg Bartlett C L 812 Ga Casualty Bldg BELL H B 320 Ga Casualty Bldg BENTON E L 1007-20 Ga Casualty Bldg Bloch C J 614 Ga Casualty Bldg Bloodworth L U 4 Hardeman Bldg Bloodworth T C 4 Hardeman Bldg Bloodworth & Bloodworth 4 Hardeman Bldg BOOTLE W A 501-03 Macon Sav Bk Bldg Burnett J P 15 Washington Bldg Campbell R D C 15 Hardeman Bldg CARLISLE J D 501-03 Macon Sav Bk Bldg CARLISLE & BOOTLE 501-03 Macou Sav Bk Bldg Casson R H 215 Ga Casualty Bldg Churchwell D L 2 Washington Bldg Clements F L 15 Hardeman Bldg Conaway P M 308 Ga Casualty Bldg Cooper W O 204 Bibb Bldg CORK C D S 601 Ga Casualty Bldg CORK C M 601 Ga Casualty Bldg CORK Sc CORK 601 Ga Casualty Bldg Cunningham C A 362% 2d Currie Bralnerd 401 Ga Casualty Bldg CUSTER O C 705-06 Bibb Bldg DALY AUGUSTIN 3-4 Washington Bldg De Fore Walter 501 Ga Casualty Bldg De Fore A Estes 501 Ga Casualty Bldg EDWARDS M G JR 618-26 Bibb Bldg English N E 1 Washington Bldg Estes J C 501 Ga Casualty Bldg Fausett J A 14 Washington Bldg FEAGIN J E 1-2 Hardeman Bldg FEAGIN R D 1-2 Hardeman Bldg FEAGIN & FEAGIN 1-2 Hardeman Bldg Felder T S 906 Ga Casualty Bldg Fowler B J 415 Ga Casualty Bldg Freeman E N 564% Poplar GILLEN L THOS "PAT" 318-20 Bibb Bldg Gillon O G 5 Washington Bldg Gilmore A E Jr 215 Ga Casualty Bldg Grace W J 12 Washington Bldg Grice B M 716 Ga Casualty Bldg Grice Warren 716 Ga Casualty Bldg Grice & Grice 716 Ga Casualty Bldg Hall C H 619 Ga Casualty Bldg Hall J E 614 Ga Casualty Bldg Hall & Bloch 614 Ga Casualty Bldg Hancock J M 1 Washington Bldg HARRIS J B 914-18 Ga Casualty Bldg HARRIS, RUSSELL, POPPER St WEAVER, 914-18 Ga Casualty Bldg HARRIS W A 914-18 Ga Casualty Bldg Hatcher S W 525 Bibb Bldg Hirsch E J % Washington Bldg HORNE EUG 3-4 Washington Bldg Hunter S B 316% 2d JACKSON E L 201 Bibb Mfg JACKSON J M 201 Bibb Bldg JACKSON & JACKSON 201 Bibb Bldg Jacobs T A Jr 14 Washington Bldg Johnson W T 615 G Casualty Bldg JOHNSTON E P 1007-20 Ga Casualty Bldg JONES BRUCE C 1007-20 Ga Casualty Bldg JONES C BAXTER 1007-20 Ga Casualty Bldg JONES G S 1007-20 Ga Casualty Bldg JONES, JOHNSTON, BUSSELL Sc PARKS 1007-20 Ga Casualty Bldg JONES R B 1007-09 Ga Casualty Bldg Jones S G 403 Macon Sav Bk Bldg LANE McKIBBEN 353% 3d LEWIS ARTH 3-4 Washington Bldg Long O L 215 Ga Casualty Bldg LOWREY J A JR 353% 3d MARTIN F R 618-26 Bibb Mfg MARTIN, MARTIN Sc SNOW 618-24 Bib Bldg MARTIN T B 618-26 Bibb Bldg Martin W E 6 Washington Bldg Maynard E W 403 Macon Sav Bk Bldg J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Hinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 658 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 McClellan W A Jr 8 Washington Bldg McCowen K B 601 Grand Bdg McCreary J J 353% 3d MILLER WALLACE 353% Sd MILLER & LOWREI 353% 3d Moore L D 515 Ga Casualty Bldg Napier J H 614 Ga Casualty Bldg Nelson P J 308 Bibb Bldg Nottingham G M 409 Ga Casualty Bldg Nottingham H E 409 Ga Casualty Bldg NOTTINGHAM & NOTTINGHAM 409-10 Ga Casualty Bldg OLIVER C S 1007 Ga Casualty Bldg Oliver W H 308 2d Orr Oliver 709 Forsyth PARK O A 401-04 Ga Casualty Bldg PARK & STROZIER 401-04 Ga Casualty Bldg Perry T M 1 Hardeman Bldg PINDAR G A 705-06 Bibb Bldg PINDAR & CUSTER 705-06 Bibb Bldg Plunkett R G 408 Ga Casualty Bldg POPPER J W 914-18 Ga Casualty Bldg Renitz B B 216 2d Roberts Warren 208 Bibb Bldg ROGERS MARY B 705-06 Bibb Bldg RUSSELL H D 914-18 Ga Casualty Bldg BUSSELL SCOTT 1007-20 Ga Casualty Bldg BYALS, ANDERSON & ANDERSON 421-24 First Nat Bk Bldg RYALS T E 421-24 First Nat Bk Bldg Sanders W H 308 Ga Casualty Bldg Scarborough R F 408 Ga Casualty Bldg SMITH FURMAN 520-23 Bibb Bldg Smith J L 401 Ga Casualty Bldg SMITH J R L 520-23 Bibb Bldg SMITH JOS LE CONTE 520-23 Bibb Bldg Smith R L (c) 411% Cotton av SMITH & SMITH 520-23 Bibb Bldg SNOW CUBBEDGE 618-26 Bibb Bldg SPARKS A O B 1007-20 Ga Casualty Bldg STROZIER H S 401-04 Ga Casualty Bldg Taylor E F 403 Macon Sav Bk Bldg Thomas M C 421 First Nat Bk Bldg TURPIN W C 353% 3d TURPIN W C JR 353% 3d TURPIN Sc LANE 353% 3d Urquhart J F 13 Hardeman Bldg Vandiver W H 305 Macon Sav Bk Bldg Wallace M K 511 Grand Bldg Wallace T A 511 Grand Bldg Wallace & Wallace 511 Grand Bldg WEAVER A H S 914-18 Ga Casualty Bldg West J W 353% 3d West W M 8 Washington Bldg Wilson F G 305 Macon Sav Bk Bldg Wilson & Vandiver 305 Macon Sav Bk Bldg Wimberly J L 316% 2d LEATHER DEALERS Boston Leather Co 414 Poplar Wilensky Jake H Leather Co 514 Poplar 9^-LEATHER GOODS BUXTON--Kernaghan-Goodman Inc 411 Cherry CORDOVA--Kernaghan-Goodman Inc 411 Cherry HAGERSTOWN--Kernaghan-Goodman Inc 411 Cherry HUGO-BOSCA CO--Kernaghan-Good- man Inc 411 Cherry WALES--Kernaghan-Goodman Inc 411 Cherry LEATHER GOODS--DEALERS MATTHEWS R H INC 409 Broadway LETTER FOLDING LETTER SHOP INC THE 563% Mulberry LETTER SHOPS LETTER SHOP INC THE 563% Mulberry LETTERHEADS JONES Sc CONEY 411 Broadway JONES & CONEY COMMERCIAL PRINTERS "Your Work Delivered When Promised'' 411 Broadway Phone 3087 MURRAY PRINTING CO 471% 3d LIBRARIES County Law Library Court House PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 76 c. w. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OR MORE AUTOBANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential SO Minute Service Used Cars Bought and Sold 364 1st St across from V. M. C. A. McNair Lumber & Supply Co., 266 Fifth St, Phone 1400 Macon City Directory *59 Everybody Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Ave. Phone 59 Price S B Free Library 1st cor Orange Washington Memorial Library (c) 554 New Washington Memorial Library 320 Washington av LIGHT & POWER COMPANIES Ga Power Co 179 Cotton av MACON GAS CO 220 2d MT-lime KEYSTONE HYDRATE---McNair Lbr & Sup Co 266 5th KEYSTONE LUMP--McNair Lbr & Sup Co 266 5th LONGVIEW--Builders Lbr Co Inc 130 Cherry TIGER FINISH--McNair Lbr & Sup Co 266 5th LIME DEALERS BUILDERS LBR CO INC 130 Cherry McNAIR LBR & SUP CO 266 5th McNAIR LUMBER & SUPPLY CO. BUILDING MATERIAL. 266 Fifth St. Phone 1400 WILLINGHAM SASH & DOOR CO 457 3d LINEN DEALERS Art Linen Shop 464 Cherry LINEN SERVICE LINSEED OIL DEALERS SCHALL PAINT CO 307 Mulberry LIQUID SOAPS KUHN MFG CO 314 Broadway LITHOGRAPHERS Stecher-Traung Lithograph Corp 304 Bibb Bldg ^"LIVING ROOM FURNITURE ARTISTIC--Johnson Bros 461 2d KROEHLER--Sterchi Bros Stores Inc Cherry sw cor Broadway PULLMAN--Sterchi Bros Stores Inc Cherry sw cor Broadway LIVESTOCK DEALERS Abercrombie W C & Son 553 3d Kingman-Burnett Stables 460 Plum Lee & Smith Mule Co 557 Plum LOANS (General) BIBB BROKERAGE CORP 206 Bibb Bldg BIBB INVESTMENT CO 203 First Nat Bk Bldg BROADWAY TRADING CO 4 Jaques Bldg CALHOUN & THOMAS 569% Cherry CITIZENS & SOU NAT BK 461 Cherry Community Sav & Loan Co 201 Cotton av FIRST NAT BK & TRUST CO 602 Cherry INDEPENDENT LINEN SERV 452 2d 53(PHNGERIE LOOMCRAFT--Dannenberg's 462 3d IMrLINOLEUM SLOAN-BLABON--Sterchi Bros Stores Inc Cherry sw cor Broadway fjyLINSEED OIL SPENCER-KELLOGG--Willingham Sash & Door Co 457 3d THE FIRST NATIONAL BANK & TRUST CO. In Macon Member of Trust Company of Georgia Associates Industrial Loan & Investment Co 355 2d MACON TRADING & INVESTMENT CO 220 Ga Casualty Bldg PALM PURCHASING CO 3 Hardeman Bldg PERSONAL FINANCE CO 411 First Nat Bk Bldg WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7th. Phone 278 Phone 156 Plymouth--De Soto--Yates Motor Co--Packard--Phone 1445 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. UNITED PURCHASING CO INC 361 5th WILLIAMS LUTHER & SON 565 Mulberry LUTHER WILLIAMS & SON Banking in All Its Branches Insurance of All Kinds Luther Williams Frederick W. Williams 565 Mulberry St. Phone 1586 (Mortgage) CLEMONS SOL C (c) 465 Cotton av Cullen L J Co 418 First Nat Bk Bldg ELKINS H W 202-03 Bibb Bldg GA LOAN & TRUST CO 302-09 First Nat Bk Bldg Home Owners Loan Corp 206 First Nat Bk Bldg Lewis W L 1 Washington Bldg Mortgage Investment Co 470 Cherry Phoenix Mut Life Ins Co 203 Macon Sav Bk Bldg So Mortgage Co 354 1st (Real Estate) CROCKETT R W 610 Mulberry HOLT A T CO 569 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry Willingham Loan & Trust Co 350 2d (Salary and Collateral) BIBB BROKERAGE CORP 206 Bibb Bldg BIBB INVESTMENT CO 203 First Nat Bk Bldg BROADWAY TRADING CO 4 Jaques Bldg Citizens Loan Co 217 Bibb Bldg City Finance Co 406 Poplar Dixie Pur Co Pine ne cor 7th Harris Loan Co 352 2d Mack Purchasing Co Inc 612% Poplar MACON TRADING & INVESTMENT 220 Ga Casualty Bldg Mut Investment Co 406 2d Mut Purchasing Co 461 Broadway PALM PURCHASING CO 3 Hardeman Bldg PERSONAL FINANCE CO 411 First Nat Bk Bldg Southern Investment Co 10 Jaques Bldg UNITED PURCHASING CO INC 361 5th LOCKSMITHS Andrews Magruder 572 Mulberry Huhn H & H R 419 2d LOOSE LEAF LEDGERS BURGE J W CO 406 Cherry LUGGAGE DEALERS DANNENBERG'S 462 3d NEEL JOS N CO 756 Cherry LUMBER DEALERS (Retail) Bibb Lbr Co 736 Hillyer av BUILDERS LBR. CO INC ofc 355 Cherry, plant 130 Cherry Grinalds A S 614 Grand Bldg Macon Lbr Co 657 Broadway Maynard's Lbr & Sup 979 Montpelier av McCOOK J W LBR CO Ash nr Broadway McNAIR LBR & SUP CO 266 5th MIDDLE GA LBR CO 214 Cotton av Redding W C Lbr Co 17 Jaques Bldg SHERWOOD LBR CO 800 San Juan av WILLINGHAM SASH & DOOR CO 457 3d (Wholesale) BUILDERS LBR CO INC ofc 355 Cherry plant 130 Cherry Chambers Lbr Co 150 Railroad av Chapman H D & Co 203 Grand Bldg Fowler H C Lbr Co 1900 Vineville av Halligan & McLellan Inc 602 Bibb Bldg James & Kingman Lbr Co ft Poplar Moyar Lbr Co 779 Division Reid H M & Co 203 Grand Bldg Richardson Lbr Co 505 First Nat Bk Bldg Riverside Lbr Co ft Poplar Ross T L Lbr Co ofc 507 First Nat Bk Bldg WILLINGHAM SASH & DOOR CO 457 3d LUNCH ROOMS (See Restaurants) Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate McClure office equipment co. Mimeographs and Supplies 560 Mulberry St. Phone 903 Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory f $61 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. Flynn Printing Co. QUALITY SERVICE and PRICES SOS Broadway PHONE 5779 614 MUECKE & SONS CO. Phone New St. Beer 303 Bar Equipment--Cabinet Work Show Cases--Store Fixtures 636 ACON'S leading financial institution. The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 machinists ACME WELDING CO 619 Broadway Macon Mach Shop 451 Wall TAYLOK IRON WKS & SUP CO 1014 Broadway Wade & Sons 565 Plum MAILING SERVICE LETTER SHOP INC THE B63V4 Mulberry MANUFACTURERS KUHN MFG CO 314 Broadway KUHN MANUFACTURING COMPANY JANITORS' SUPPLIES 314 Broadway Phone 3628 MANUFACTURERS' AGENTS Blossom G L 813 Ga Casualty Bldg MATTRESS MANUFACTURERS BIBB MATTRESS CO 415 Pine Central Bedding Co 325 Oglethorpe MEADERS MATTRESS CO 453 Arch MEADERSS MATTRESS CO 453 Arch SNOW'S LDRY & DRY CLNG CO 766 Poplar fyMATTRESSES PERFECT SLEEPER--Sterchl Bros Stores Inc Cherry sw cor Broadway SIMMONS BEAUTY BEST--Johnson Bros 461 2d MEATS (Retail) Allen R B 512 2d Broadway Cash Mkt 410 Broadway Camerlero Louis 418 Mulberry Couch & Woodall 701 Main (EM) Daylight Cash Gro 209 Alabama (SM) Davis Wm (c) 275 Madison (V) Fort Hill Cash Mkt 641 Fort Hill Gunnels L W 802 Edgewood av Harris A L 167 5th Kash & Karry Mkt 412 2d Kennington's Mkt 338 Main (EM) King J R 1913 Vineville av Land ' J C 165 5th Leaptrot's Mkt 1003 Broadway MELTON GRO CO 200 Montpelier av Mulberry Mkt 414 Mulberry Powell E E 202 Forsyth Rushin W C 818 Vineville av Trawick J C 1007 2d Warren's Mkt 203% Hardeman av Woodall W A Clinton rd extd (EM) Woods Mkt 828 Main (EM) Wynn J E 954 (937) Montpelier av (Wholesale and Packers) Armour & Co 250 Broadway Cudahy Packing Co The 336 Poplar Swift & Co 361 Plum T & T PACKING CO INC 750 Division MEMORIAL CEMETERIES MACON MEMORIAL PARK INC ofe 163 Cotton av, Cemetery Columbn* rd extd MATTRESS RENOVATORS BIBB MATTRESS CO 415 Pine Macon Mattress Co 325 Oglethorpe memorials CLARK MEMORIALS INC 2200 Forsyth rd JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 LOOK TO STERCHI'S for BETTER FURNITURE VALUES Jl t. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 MEN'S CLOTHIERS DANNENBERG'S 462 3d NEEL JOS N CO 766 Cherry RELIABLE OUTFITTERS THE 672 Cherry SEARS-ROEBUCK & CO 662 3d SMART HERBERT CLO CO INC 659 Cherry MERCANTILE AGENCIES (See also Credit Bureaus) DUN ft BRADSTREET INC 709 Bibb Bldg MACON CREDIT BUREAU 614 Ga Casualty Bldg MILK DEALERS (See also Dairies) Dixie Dairies 6S8 Arch SUNSHINE CREAMERY 610 Forsyth and 2039 2d MILL SUPPLIES Corbin Supply Co 464 Broadway Macon Sup Co 25 5th McCOOK J D LBR CO Ash nr Broadway TAYLOR IRON WES ft SUP CO 1014 Broadway MIMEOGRAPHING LETTER SHOP INC THE 563>A Mulberry MACON TYPEWRITER ft OFC SUP CO 664 Mulberry MIMEOGRAPHING SUPPLIES McCLURE OFC EQUIPMENT CO 560 Mulberry McCLURE OFFICE EQUIPMENT CO. OFFICE OUTFITTERS Phone 903 560 Mulberry St. MPMIMEOGRAPHS A B DICK--McClure Ole Equipment Co 860 Mulberry MIRROR MANUFACTURERS Macon Mirror Wks 1127 Broadway MTmirrors NURRE--Sterchi Bros Stores Inc Cherry sw cor Broadway MILLINERS (Retail) HDAatNBNoExNBTEhRe G4'6S6 4C6h2er3rdy NEEL JOS N CO 756 Cherry Suzanne Hat Shop 568 Cherry (Wholesale) Belle Millinery Co 360 Broadway MILLW ORK WILLINGHAM SASH ft DOOR CO 457 3d MIMEOGRAPH DEALERS McClure ofc equipment co 560 Mulberry MONEY BROKERS BIBB BROKERAGE CORP 206 Bibb Bldg MONUMENTS CLARK MEMORIALS INC 2200 Forsyth rd McNeel Marble Co ofc 308 Cherry av MOPS KUHN MFG CO 314 Broadway MORTGAGE LOANS CLEMONS SOL C (c) 465 Cotton av ELKINS H W 202-03 Bibb Bldg GA LOAN ft TRUST CO 302 First Nat Bk Bldg MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY Taylor Transfer Co. PHONE 3 8 8 MOVING LONG PISTANCE HAULING STORAGE This Directory Was Published By The Originators Of The ABCD Type Of City Directory McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1035 Macon City Directory 663 Everybody Reads Macon Evening' News, The Macon Telegraph TELL THEM AND YOU WILL SELL THEM USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston. S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. MORTICIANS (See also Undertakers & Funeral Directors) BURGHARD-CONNALLY 718 Cherry CENTRAL CITY FUNERAL HOME (c) 530 Cotton av HUTCHINGS FUNERAL HOME (c) 518 New INDEPENDENT FUNERAL HOME (c) 457 Cotton av MOSAIC FLOORS CLARKE R L CO 1218 Broadway MOTION PICTURE THEATRES (See Theatres) MOTOR DELIVERY SERVICE PARCEL DEL CO Schatzman al bet Cotton & 2d MOTOR EXPRESS LINES (See also Expressing & Moving) Gamble Mtr Exp 756 Broadway Ga Highway Exp 103 Cherry Moffett Transit Lines 350 Cherry MOTOR REPAIRING & REWINDING WILSON J W ELEC REPR SHOP 23 Wall MOTORCYCLE DEALERS & SERVICE WALKER CLIFF CO 515 Poplar ^^MOTORCYCLES HARLEY-DAVIDSON--Cli Walker Co 515 Poplar MOULDINGS & MOULDING PLASTER WILLINGHAM SASH & DOOR CO 457 3d MOVING & HAULING--LONG DISTANCE MACON TRANS CO 408 Broadway TAYLOR TRANSFER CO 458 Plum WASHBURN STORAGE CO INC 201 Poplar MULTGRAPHING (See also Letter Shops) LETTER SHOP INC THE 563% Mulberry Phone 4521 for Multigraphing, Addressing, Sealing, Mimeographing, Folding, Stamping, Mailing. THE LETTER SHOP, Inc. Complete Direct Mail Adv. Service 563% Mulberry St. Macon, Ga, MACON TYPEWRITER & OFC SUP CO 564 Mulberry MUSIC STORES Guttenberger Mus Shop 404 Cherry Williams Mus Co 419 3d MUSIC TEACHERS (Clarionet) Grechi Pirro 125 Beech av efPIano) Becker Ida Mrs 310 Cherokee av Boone Eliz 652 Pine Charles Sourie Mrs 520 Orange Apt 2 Clemons Mamie (c) 104 Spring Colquitt Mary 105 Clayton (V) Drake Irene Mrs 210 Berkley dr (I) Glover Eliz V H 520 Orange Apt 2 Holliman Annie L 153 Summit av Hunt Annie B 709 Adams Jones Lucille Mrs 554% Mulberry Jones Marion M 494 Orange Latimer Florine r 111 Cleveland av (V) Martin Haidee 702 Napier av Mays Rachel 1155 Ash Moran W C 317 Ross Reece Irene Mrs 124 Hines ter (V) Walker Robt 506 Orange Williams Mary r 107 Virginia av (String) Grechi Guiseppi 125 Beech av (Violin) Edenfield Margt W r 500 Holt av Reynolds Nellie M 216 Magnolia BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 467*468 Plymouth--De Soto--Yates Motor Co--Packard--Phone 1445 664 Baldwin's and Telegraph's LOOK TO STERGHI'S for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 (Voice) Johnson Clebie Mrs 554% Mulberry OW is the time to open an account. N The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- ciates 602 CHERRY ST. PHONE 2834 SRTNECKWEAR RESILIO--Jos N Neel Co 456 Cherry NEWS DEALERS Bibb News Co 563 Broadway Hotel Lanier News Stand 525 Mulberry Union News Co Terminal Sta NEWSPAPERS MACON EVENING NEWS 450-52 Cherry MACON TELEGRAPH THE 450-52 Cherry Macon Telegraph The (colored dept) 558 New NOVELTIES Edwells Trick & Novelty Co 320 2d NURSES (Graduate) Anderson Eliz 811 Poplar Apt 17 Atkins Eliz (c) 200 Douglas (SM) Banks Mattie L 701 Forsyth Barfield Dorothy L 105 Ingleside av (I) Birdsong Dovie 810 Spring Black Virginia 216 (159) Grant av (V) Blount Mattie 130 High Burton Sara 233 Bond Apt 2 Calk Ellen C Mrs 1510 3d Canuett Mary 521 College Carey Aurie 722 Walnut Carter Eloise 168 High Cauthen Carolyn 129 Rembert av Comer Mattie (c) 219 Fulton (EM) Cone Arsolene J Mrs 206 Rutherford Copeland Mary E 865 Orange Cotton Linda 516 Orange Darby Janet Mrs 523 Linden av Davis Lemuel 401 Napier av Devlin Sara E 236 High Ellison Alice M 168 High Emerson Martha 125 Inverness av Farmer May A 121 Buford pi (V) Fountain Myrtle 185 Magnolia Fryer Rose L 260 Winship Fulwood Lucy 467 Monroe (V) Garcia Lillian (c) 161 College Gardner Ella (c) 120 Green Halsey Edna W Mrs 128 Grady Hartley Rubye 533 Orange Apt 9B Hartley Ruth P (c) 612 Spring Hurst Eliz Mrs 1322 2d Jackson Blanche 808 Spring Jackson Eliz 669 New Joanis Marion Mrs 125 Curry pi Johnson Lilia (c) 609 3d av (V) Johnson Mabel 91 Lawton av Johnstono Mary 197 Belmont av Jones Bessie L 149 Lincoln av (V) Joyce Anne Mrs Kennington Claude D 201 Villa Esta Kerry May 761 Courtland Lifsey Hewlitte 215 Clisby pi Locket Mamie G (c) 215 (303) Mutual (V) Maddox Mary 216 Adams Mathews Erma 436 Carling av McDuffie Ella 321 Orange McGee Erith 862 New McKenna Ruth M 563 College Nash Kath (c) 230 Jordan's al Newell Alice 233 Bond Apt 2 Newman Florida 34 Arlington pi Newton Frances r 286 Winship Norris Ethel 335 College Palmer Sarah F 223 Adams Penn Tessie M Mrs r 865 Orange Perry Barbara 335 College Powell Mary A 335 College Pressley Julia 669 New Redding Mattie M 280 College Reese Eliz (c) r 313 Forest (V) Regin Marie (c) 269 Madison (V) Renfroe Lucille 378 Orange Robertson Margt Mrs 203 Edna pi (LCHts) Rogers Anne r 147 Rose pk Slappey Virginia R 865 Orange hatcher & mccrary. ihc. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Signature Only SAME DAY M 0 N E Y For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 W35 Macon City Directory 665 Everybody Reads Macon Evening News, The Macon Telegraph FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 326 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 MACON, GA. A Trip To THE ENGLAND CHIROPRACTOR Means a Start on the Road to Health Smith Lovia T 116 Ward (V) Smith Ruth 186 English av Speer Jewel 1018 Vineville av Taylor Bessie 514 Orange Trapp Grace 143 Rose pk Tucker Willene 321 Orange Waldorf Leila 104 Ayers blvd (B) Ward Helen G 736 College West Mary (c) 117 Opera Hse al Wheeler Julia 711 Orange Wilder Hattie E 121 Stonewall pi (V) Williams Doris 862 Orange (Practical) Blount Frances Mrs 3809 Houston av Charleston Equilla (c) 243 Jones Donaldson Annie (c) 164 Lynwood av (V) Harper Nora B Mrs 300 Mikado av Maynard Alice (c) 110 Middle (V) Robinson Julia (c) 107 2d av (V) Sanders Louise (c) 104 (156) Virgin (V) NURSES REGISTRY Nurses Official Registry 130 High NUT DEALERS (See also Peanut Dealers) Nat Pecan Marketing Assn Mulberry cor 7th F course you should bank with us. o The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Asso- ciates 602 CHERRY ST. PHONE 2834 OFFICE BUILDINGS (See Buildings) OFFICE FIXTURES MACON CABINET WKS INC Poplar nr 8th U^-OFFICE FURNITURE ART METAL--3 W Burke Co 406 Cherry OFC FURNITURE & EQUIPMENT DEALERS BURKE 3 W CO 406 Cherry J. W. BURKE COMPANY OFFICE EQUIPMENT PRINTERS Phone 74 and 75 406 Cherry St. McCLURE OFC EQUIPMENT CO 560 Mulberry McCLURE OFFICE EQUIPMENT CO. OFFICE OUTFITTERS Phone 903 560 Mulberry St. PF^OIL CROSS COUNTRY--Sears-Roebuck Ss CO 552 3d PENNZOIL--Dannenberg's 462-70 3d SINCLAIR--Sinclair Refining Co Hammond at So Ry TEXACO--Texas Co The 770 Division OIL COMPANIES Am Oil Co Poplar at 7th Atlantic Refining Co plant Division nr Edgewood av Ga-Carolina Oil Co 603 Hammond Ga Oil Corp 100 Walnut Gulf Refining Co 210 Edgewood av Power Oil Co 1053 5th Shell Petroleum Corp plant 1368 Broadway SINCLAIR REFINING CO Hammond at So Ry Standard Oil Co plant 307 (119) Bay TEXAS CO THE 770 Division Wofford Oil Co 101 Walnut OIL DEALERS SEARS-ROEBUCK & CO 552 3d J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 666 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 806 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 99~OrL RANGES & STOVES BOSS--Marshall Furn Co 556 Poplar FLORENCE--Sterchi Bros Stores Ine Cherry w cor Broadway PERFECTION--Sterchi Bros Stores Inc Cherry gw cor Broadway ARTICULAR people like our banking P service. OPTICAL SUPPLIES Am Optical Co 108 Ga Casualty Bldg Southeastern Optical Co 358 2d OPTICIANS DANNENBERG'S 462 3d ! HILBCN'S 620 Cherry Kelly W B 505 Cherry Macon Optical Co 453 Cherry Rex Optical Co 504 Mulberry OPTOMETRISTS BELL W L 620 Cherry Ethridge R A 366 2d HILBUN'S 620 Cherry Kalieh Optical Co 563 Cherry Spratling J H 652 Cherry The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Associates 602 CHERRY ST. PHONE 2834 PACKING COMPANIES (See Meats--Wholesale) S^PAINT BOATWRIGHT'S--Willingham Sash & Door Co 457 3d DU PONT--Willingham Sash A Door Co 457 3d EAGLE WHITE LEAD--Jarrett Paint A Glass Co 320 3d GRAY SEAL--SchaU Paint Co 907 Mulberry ORTHODONTISTS (See also Dentists) CHILDS W B 701-04 Ga Casualty Bldg Factory Distributors PAINTS -- VARNISHES WALLPAPER SCHALL PAINT CO., Inc. Phone 326 307 Mulberry St. OSTEOPATHIC PHYSICIANS Chaplin A W 219 Bibb Bldg Jelks A A 708 Ga Casualty Bldg JONES FRANK F 406 First Nat Bk Bldg Jones G C 609 Bibb Bldg OUTDOOR ADVERTISING PACKER ADV OORP 452 Plum LELAND MOORE--Builders Lbr Co Inc 130 Cherry MASTER MIXED--Sears-Roebnck & Co 552 2d Nu Enamel--Wood Peavy Furn Co 365 2d PEE-GEE--Willingham Sash A Door Co 457 3d PITTSBURGH PAINT PRODUCTS-- Jarrett Paint A Glass Co 320 3d SHERWIN-WILLIAMS--Middle Ga Lbr Co 214 Cotton av SOUTHERN COTTON OIL--Jarrett Paint A Glass Co 320 3d ffl^OVERALLS OSHKOSH--Dannenberg's 462 3d PAINT BRUSHES SCHALL PAINT CO 307 Mulberry PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices 9 BURKE 8 460 Cherry St. Phone 74 and 75 c. w. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OR MORE AUTOBAHX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across frem V. M. O. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 Macon City Directory 667 Everybody Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 5779 CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Ave. Phone 59 Factory Distributors PAINTS -- VARNISHES WALLPAPER SCHALL PAINT CO., Inc. Phone 326 307 Mulberry St. PAINT & VARNISH DEALERS BUILDERS LBR CO INC 130 Cherry Central- Sash & Door Co 354 2d DANNENBERG'S 462 3d JARRETT PAINT * GLASS CO 320 3d McMillan E C Paint & Glass Co 358 3d MIDDLE GA LBR CO 214 Cotton av SCHALL PAINT CO 307 Mulberry PARKS Central City Pk 7th at river Tatnall Square Park College at Hazel Washington Park College at Magnolia Weir Synthia Playground 2d at Edge- wood av PAWN BROKERS Avrunin Louis 508 Poplar Goldman Pawn Shop 318 3d Kaplan Henry 516 Broadway PEANUT DEALERS Dixie Peanut Co 617 Poplar Macon Peanut & Storage Co 23 5th Royal Peanut Co 422 Mulberry Factory Distributors PAINTS -- VARNISHES WALLPAPER SCHALL PAINT CO., Inc. Phone 326 307 Mulberry St. SEARS-ROEBCCK & CO 552 Sd Sheridan C F 415 3d Sheridan L D 103 Ga Casualty Blgd So Paint & Varnish Co 561 Mulberry WILLINGHAM SASH & DOOR CO 457 3d PAINTERS & DECORATORS (See Interior Decorators) SPP'PAJAMAS MANHATTAN--Jos N Neel Co 456 Cherry PAPER BOX MANUFACTURERS MACON PAPER CO 511 5th TOMLINSON PAPER BOX CO 513 Oglethorpe PAPER DEALERS Hirsch Jacob 352 Plum MACON PAPER CO INC 511 5th Standard Paper Co 518 Broadway. PABCEL DELIVERY PARCEL DEL CO Schatzman al bet Cotton & 2d U^T-PERFUMES LUCIEN LE LONG--Kernaghan-Good- man Inc 411 Cherry ^PERMANENT WAVES EUGENE--Vanity Beauty Shop 352% 2d FREDERICKS--Dannenberg's 462 3d PHONOGRAPH REPAIRING WALKER CLIFF CO 515 Poplar PHOTOGRAPHERS Allen's Studio 161 Cotton av Atwoods Photo Studio 212% Cotton av BON ART STUDIO 362 2d DANNENBERGS 462 3d Film Shop The 123 Cotton av METRO STUDIO 572% Cherry Mize C S 620% Cherry Warlick H C 117 Cotton av PHYSICIANS & SURGEONS Abel J F 309 Bibb Bldg Adams J H 805 Ga Casualty Bldg Anderson C L 310 Doctors Bldg Anderson J C 718 Ga Casualty Bldg Atkinson H C 220 Doctors Bldg Bashinskl B J 320 Doctors Bldg Bazemore W L 817 Ga Casualty Bldg Boswell W C 709 Ga Casualty Bldg Chrisman W W 210 Doctors Bldg Clay J E 567 Walnut Coppage J M 472 2d WILLINGHAM SASH & DOOR CO. SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7th. Phone 278 Phone 156 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. Corn Ernest 301 Doctors Bldg Daniel Orman 514 First Nat Bk Bldg Davis F C 504 Mulberry Dove W B 208 Grand Bldg Dyer C W (c) 117 Tatnall EVANS A F 1309 Oglethorpe Farmer C H 567 Walnut FOUNTAIN J A 417 Ga Casualty Bldg Frayser W N (c) 400 Knights of Pythias Bldg Gewinner N G 1205 Vineville av (V) Gibson O C 362% 2d Golsan W R Jr 811 Ga Casualty Bldg Goolsby R C Jr 320 Doctors Bldg Hall J I 818 Ga Casualty Bldg HALL T H 413 Grand Bldg Harrell S B 605% Cherry Harrold C C 210 Doctors Bldg Harrold Thos Jr 210 Doctors Bldg Hinton C C 210 Doctors Bldg Holmes J P 101 Doctors Bldg Hurley T A 567 Walnut Jenkins W E 207 Ridge av (I) KEEN O F 1309 Oglethorpe Keiser J M 18 Jaques Bldg KEMP A F 511 Walnut King J L 418 Ga Casualty Bldg Lundy J W (c) 533% Forsyth Martin J W 718 Bibb Bldg Massenburg G Y 567 Walnut McAfee L C 567 Walnut Meriwether W W 520 Ga Casualty Bldg Miller G T 513 First Nat Bk Bldg Mitchell F B 567 Walnut Mitchell M C (c) 552 New Mobley W E 220 Doctors Bldg Moses Harry 515 Bibb Bldg Newman W A 310 Doctors Bldg Newton R G 805 Ga Casualty Bldg Palmer S B 723 Bibb Bldg Phillips A M 818 Ga Casualty Bldg Porch L D 810 Ga Casualty Bldg Powers J B 168 Riley av (CP) Rawls L L 710 Ga Casualty Bldg Richardson C H Jr 330 Doctors Bldg Richardson R W 805 Ga Casualty Bldg Rogers J W 201% Cotton av Rogers T E 330 Doctors Bldg Ross J T 509 Bibb Bldg Ross T L 330 Doctors Bldg Royster Floyd 507% Broadway ROZAR A R 1309 Oglethorpe Rubin S N 403 Grand Bldg Selden J A 801 Ga Casualty Bldg Siegel A E 609 Ga Casualty Bldg Sigman J M 406 Grand Bldg Smith J A 230 Doctors Bldg Smith R s (c) 319% Broadway Suarez Raymond 715 Ga Casualty Bldg Swilling Evelyn 715 Ga Casualty Bldg Thomas W H (c) 266% Main (EM) Thompson O R 201 Doctors Bldg Walker C H 418 Ga Casuatly Bldg Walker D D 201 Doctors Bldg Ware Ford 310 Doctors Bldg Wasden C N 818 Ga Casualty Bldg Weaver H G 230 Doctors Bldg Weaver O H 230 Doctors Bldg Williams J S (c) 404 Knights of Pythian Bldg Williams W A 719 Ga Casualty Bldg Wright J E 324 College PHYSIO - THERAPISTS McArthur Lueilo Mrs 353 1st PIANO TUNERS Anderson J R 310 West End av PICTURE FRAMING JARRETT PAINT & GLASS CO 320 3d METRO STUDIO 572% Cherry PIES GILL'S BAKERY 813 Vineville av PINE LUMBER SHERWOOD LBR CO 800 San Juan av i^*PLASTER CERTAIN-TEED--Builders Lbr Co Inc 130 Cherry U S GYPSUM RED TOP--McNair Lbr & Sup Co 266 5th PLASTER DEALERS BUILDERS LBR CO INC 130 Cherry McNAIR LBR & SUP CO 266 5th McNAIR LUMBER & SUPPLY CO. BUILDING MATERIAL 266 Fifth St. Phone 1400 PLEATING Atwood's Pleating Plant 210% Cotton av Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate Mcclure office equipment co. _ Mimeographs and Supplies 560 Mulberry St. Phone 90! Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1^35 Macon City Directory 69 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. PUILDING SUPPLIES CELOTEX WALL BOAK5? 266 5th St. Phone 1400 MACON, GA. 6 14 MUECKE & SONS CO New St. Beer and Bar Equipment--Cabinet Work Show Cases--Stflre Fixtures Phone 636 CRESCENT LDEY CO 518 2d INDEPENDENT LDEY CO 452 2d Macon Pleating Co 620% Cherry PLUMBERS (See also Contrs-Plmbg) Britt J T 815 America blvd Criswell H W & A F Co 509 Cotton av Daly F X Co 613 Poplar Davis Durwood 25 Wall Lee A B Plmbg & Heating Co 258 2d MILLER BROS 222 Cotton av MILLER BROTHERS PLUMBING AND HEATING Expert Installations Prompt Repair Service 222 Cotton Phone 474 Nights and Holidays 639 MILLIRONS PLMBG & HEATING CO 107 Cotton av MILLIRONS PLUMBING & HEATING CO. Steam--Hot Water--Air Conditioning 107 Cotton Ave. Phone 3176 Newby L R 124 Log Cabin blvd Rice K K 153 Bailey av Shropshire J T 617 Cotton av VETTER GEO F INC 451 Cotton av (Wholesale) Crane Co 500 Broadway Noland Co Inc 550 Broadway gVPORCH FURNITURE BUNTING--Sterchl Bros Stores Ino Cherry sw eor Broadway POTATO CHIPS Stansell Potato Chip & Sandwich Co 508 1st POULTRY DEALERS Bibb Poultry Co 421 Cotton av Smith T E 422 2d POULTRY SUPPLIES Karsten & Denson Co Inc 517 3d POWER COMPANIES Ga Power Co 179 Cotton av S^PRINT GOODS PEPPERELL--Dannenberg'g 462 3d PRINTERS Am Printing Co 552 Mulberry Bibb Printing Co 365 Cotton av BURKE J W CO 406 Cherry "When Did You Write Your Mother?" GEORGE F. YETTER, Inc. PLUMBING AND HEATING Office Phone 331 451 Cotton Ave. Res. Phone 2435-J Macon, Ga. fUff'PLUMBING FIXTURES CRANE--Miller Bros 222 Cotton av STANDARB--Miller Bros 222 Cotton av PLUMBING SUPPLIES (Retail) SEARS-ROEBUCK & CO 552 3d J. W. BURKE COMPANY OFFICE EQUIPMENT PRINTERS Phone 74 and 75 406 Cherry St COGGIN & MANN 618 Poplar FLYNN PRINTING CO 505 Broadway HOLT & HANBEBRY 367 Broadway JONES & CONEY 411 Broadway JONES & CONEY COMMERCIAL PRINTERS "Your Work Delivered When Promised" 411 Broadway Phone 3087 JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 670 Baldwin's and Telegraph's LOOK TO STERCHTS for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 Lyon, Harris & Brooks 560 Mulkerry MURRAY PRINTING CO 47144 3d SMITH & WATSON 817 Poplar PRODUCE (Retail) Country Mkt 471 3d Crawford C E 500 Oglethorpe Donovan Prod Co 659 Poplar Ga Mkt House 460 2d Grant A L (c) 403 (414) Womack Richardson L N 655 Poplar (Wholesale) Burney Bros Co 453 8th Freeman-Dent-Sullivan Co 451 5th Macon Banana & Prod Co Inc 11 Terminal av Middle Ga Prod Mkt 430 Oglethorpe ELIABLE banking service. R The First National Bank & Trust Co. IN MACON Member of Trust Company of Georgia Assoelates 602 CHERRY ST. PHONE 2834 RADIATOR REPAIRING Ga Radiator Co 614 3d Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 671 Everybody Heads Macon Evening News, The Macon Telegraph Macon Bottling Co. Phone 32 6 6 LET US PLAN YOUR NEXT ADVERTIS- ING SALES CAMPAIGN FOR YOU USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston, S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. U9~RADIO TUBES RCA RADIATRON--A S Hatcher Co 596 3d MT-RADIOS BOSCH--A S Hatcher Co 596-98 3d PHILCO--Empire Furn Co Inc 522 Poplar PHILCO--Sterchi Bros Stores Inc Cherry sw cor Broadway QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway RCA-VICTOR--Sterchi Bros Stores Inc Cherry sw cor Broadway SIEVERTONE--Sears-Roebuck & Co 552 3d RAILROAD COMPANIES Atlantic & West Point R R Co ofc 605 Bibb Bldg Central of Ga Ry main ofc Terminal Sta frt depot 5th at Pine Ga R R ofc 605 Bibb Bldg frt depot 5th at Pine Ga So & Fla Ry Co frt depot Plum at 5th Louisville & Nashville R R Co Terminal Sta Macon Dublin & Savannah R R Co frt & traffic dept 106 Broadway Nashville, Chattanooga & St Louis Ry ofc 209 Bibb Bldg Seaboard Air Line Ry ofc 302 Bibb Bldg So Ry System ofc Terminal Sta frt depot Plum at 5th South Western R R Co ofc 808 Ga Casualty Bldg Western Ry of Alabama ofc 605 Bibb Bldg RAILROAD PASSENGER STATIONS Terminal Sta 5th at Cherry STRANGES ATLANTA--Sterchi Bros Stores Inc Cherry sw cor Broadway QUALITY FURNITURE AT LOWEST PRICES STERCHI BROS. STORES, Inc. Phone 3100 Cherry and Broadway READING & STUDY ROOMS Christian Science Reading Rm 314 Ga Casualty Bldg REAL ESTATE (Agents & Companies) Avant N A 569% Cherry Bloch Carl 472 Broadway Burns Kenmore Inc 157 Cotton av CALHOUN & THOMAS 569% Cherry City Investment Co 470 Cherry CLEMONS SOL C (c) 465 Cotton av Cullen L J Co 418 First Nat Bk Bldg Damour Hypolite 421 Walnut Damour Paul 421 Walnut Davis J L 557 Mulberry Dessau Realty & Ins Co 101 Ga Casualty Bldg Hall T H III 169 Cotton av Hardeman G G Co 563 Mulberry HATCHER & McCRARY 508 Mulberry HOLT A T & CO 569 Mulberry Jefferson Mortgage Co 415 2d Johnson A M 15 Hardeman Bldg Mikado Realty Co 470 Cherry MURPHEY, TAYLOR & ELLIS CO 470 Cherry Napier E Tris Co 421 2d Nash C E 205 Ga Casualty Bldg Odom Realty & Ins Co 620 Ga Casualty Bldg Realty Investment Co 321 Mulberry Roberson Realty Co 361 Cotton av Robertson-Walker Inc 415 2d Stokes T W 156 Cotton av Third Street Properties Inc 470 Cherry Vincent F T Realty Co 154 Cotton av VINEVILLE IMPROVEMENT CO 321 First Nat Bk Bldg (City Property) HATCHER & McCRARY 508 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 430 Cherry St.--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 672 Baldwin's and Telegraph'! LOOK TO STERCHI'S for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 (Farm Land) HATCHER & McCRARY 508 Mulberry MURPHEY, TAYLOR & ELLIS 410 Cherry (Loans Calhoun & Thomas 569% Cherry CROCKETT ROY W 610 Mulberry HATCHER & McCRARY 508 Mulberry HOLT A T CO 569 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry WILLIAMS LUTHER & SON 565 Mulberry LUTHER WILLIAMS & SON Banking in All Its Branches Insurance of A11 Kinds Luther WiUiams Frederick W. Williams 565 Mulberry St. Phone 1586 (Rentals) HATCHER & McCRARY 508 Mulberry HOLT A T CO 660 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry (Realtors) HATCHER & McCRARY 508 Mulberry HOLT A T CO 569 Mulberry MURPHEY, TAYLOR & ELLIS INC 470 Cherry REFRIGERATOR DEALERS EMPIRE FURN CO INC 528 Popar LOWE ELEC CO 131 Cotton av MARSHALL FURN CO 556 Poplar STERCHI BROS STORES INC Cherry sw cor Broadway (SeeSaVlsRo EEFleRcItGricERRAefTriOgeRraStors) FRIGIDAIRE--Lowe Elec Co 131 Cotton av NORTH STAR--Marshall Furn Co 556 Poplar WHITE MOUNTAIN--Marshall Furn Co 556 Poplar REPAIR SHOPS Lackay E D 501 Giles Apt 3 WALKER CLIFF CO 515 Walker RESTAURANTS, CAFES & LUNCH ROOMS Am Restr 514 Mulberry Ann's Cafe 1303 Broadway Bankston J E 508 3d Berg Len Chil Parlor 449 Wall BETSY ROSS COFFEE SHOP 513 Cherry Bloodworth's Cafe 515 Broadway Blue Front Lunch Hoorn 416 Mulberry Bob's Bar-B-Q Pit 981 Montpelier av Brass Rail The 311 3d Broadway Lunch (c) 361A Broadway Buddy's Place 3135 Houston av Buffalo Cafe 464 Poplar Bullock W B 317 Cherry Busy Bee Lunch 1007 Broadway Busy Corner (c) 206 Industrial Home rd Busy Corner Lunch Rm 865 Broadway Clements D F 450 Giles Cobb I L (c) 707 Broadway Coffee Cup Cafe 304 Main (EM) Cozy Corner Cafe 400 Mulberry Crawford's Barbecue Lunch 677 Broadway Cricket The 620 Poplar DANNENBERG'S 462 3d De Luxe Cafe 555 Cherry Dempsey C R (c) 506 Clinton Dixie Cafe & Commissary Pine nr cor 7th Douglass Hotel Grill (c) 563 Broadway Dumas H H ft Poplar Ellis Cafe 456 Poplar Field M E 26 Wall Fitzgerald Jessie (c) 309 Hammond Ga Cafe 2998 Houston av Ga Casualty Sandwich Shop 102 Ga Casualty Bldg Gibson Thos (c) 934 Montpelier av Green F S (c) 527 Waterville rd Greyhound Sandwich Shop 320 Broadway Harris Mattie Mrs 201 Poplar Harry's Cafe 311 Cherry Henderson Louise (c) 212 (307) Elizabeth (SM) HICKEY'S COFFEE SHOP 312 Broadway Higgison Leila Mrs 226 Forsyth rd Hill Viola (c) 348 Monroe (V) Holloway Porter (c) 87 (128) Forest av (V) HATCHER & McCRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Macon (bs&jfcfc Bottling Co. PHONE 3 2 6 6 Signature Only SAME DAY For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 673 Everybody Reads Macon Evening News, The Macon Telegraph FactoryDistributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 320 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 45jM. MACON, GA. A Trip To THE ENGLAND CHIROPRACTOR Means a Start on the Road to Health Honea Dock (c) 115 Telfair HOTEL, LANIER CAFE 625 Mulberry Ingram Sami (c) 429 Cotton av Jacks Place Clinton rd extd (EM) Joe's Crescent Cafe 623 3d Johnson Mark 652 Pine Jones D J (c) 613% Broadway Jones Wm (c) 202 (310) -Elizabeth (SM) Thornton Mary J 1020 Broad Tommie's Place 21 Bellevue rd Tyler M F 726 Hawthorne Underwood Pearl (c) 415 Cotton av Vickers Arnetta (c) 207 Division Vineville Lunch Rm (c) 101 Hardeman av Walker Idabel (c) 646 3d av Jordan Thos (c) 301 Edgewood Kitchen's Kitchen 574 Mulberry Knight J H 989 (1791) Montpelier av Leary Robt (c) 101 Franklin Lyles B F 554 Mulberry Ward's Bar-B-Q PI 469 2d Warren J H (e) 217 5th Warren's Quick Lunch 410 2d White House Weiner Stand 226 Cotton av Macon Cafeteria 415 Cherry Matherson Edw (c) 302 Telfair Minute Lunch 320 2d Moore's Dinty Lunch Boom 224 Cotton av Williams Henry (c) 658 Poplar Williams PI 2635 Broadway Williams Willis (c) 701 Elbert Wisteria Cafe 42* Cherry Murrow G P 726 Broadway Mutt & Jeff Lunch 2002 Vineville av RIDING ACADEMIES My Own Restr 1221 Broadway HIVOLI RIDING CLUB Forsyth rd New Yorker The 212 2d extd, Rlvoli Ga North Pole 3447 Houston av Nu-Way Weiner Stand 218 Cotton av Our Place (c) 353 Broadway ROLLS Pig-In-Sax 2005 Vineville av GILL'S BAKERY 813 Vineville av Pig-N-Whistle Sandwich Shop 605 Georgia av Plaza Cafe 310 2d ROOFERS (See also Contrg--Roofing) Polar Bear The 2915 Forsyth rd Popular Cafe 512 Mulberry Poulos Geo 314 3d Pythian Lunch Room (c) 455 Cotton av Rankin C M 38 Wall DUNLAP ROOFING CO 266 5th GA ROOFING & SUP CO 306 Oglethorpe Pittman M C Roofing Co 559 Mulberry Schwartz & Phaul Inc 514 Plum Rex The 453 Broadway Reynolds R D 909 Clinton (Retail) Roberts Cafeteria 666 Cherry Robertson Zaeh (c) 315 Telfair Robinson Anna (c) 129 Middle (V) Ruff Montroy (c) 119 Lexington (EM) Sawdust Trail Barbecue 2116 Forsyth rd STBRCHI BROS STORES INC Cherry sw cor Broadway SEARS-ROEBUCK & CO 662 3d WILLINGHAM SASH & DOOR CO 467 3d Searcy Henry (c) 103 Bay Sid's Place 414 2d fUTROOFING Silver Moon Cafe (c) 311 Broadway Six Point Weiner Stand 471 Cotton av Slim's Lunch Room 364 Pine Smith Albert (c) 1124 Breadway BARRETT--Ga Roofing & Sup Co 306 Oglethorpe CEBTAIN-TBED,--BUILDERS Lbr Co Ine 130 Cherry Smith Susie (c) Clinton rd extd (EM) Smith Wm (c) 323 Broadway CERTAIN-TEED--J W McCook Lbr Co Ash nr Broadway Smitty's Barbecue Lunch 121 3d Southland Coffee Shop 667 Broadway Splllers Restr 470 Mulberry JOHNS-MANVILLE--Willingham Sash A Door Co 437 3d TEXACO--Tfexas Co The 770 Division Station JOY Barbecue RD 1 Forsyth VULCANITE--J W McCook Lbr Co rd Ash nr Broadway Tavern The (c) 417 Cotton av Thomas Lee (c) 411 Crisp ROOFING CONTRACTORS Thomas Virgin (c) 219 5th GA ROOFING & SUP CO 306 Oglethorpe J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 23 WALL ST. * S PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 74 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 C. W. Farmer RUBBER belting HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15-$25 $75 OR MORE AUT0- BANX Cars Sold On Easty Terms PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices 9 BUR K E S 460 Cherry St. Phone 74 and 75 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across frem V. M. O. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 DSC Macon City Directory STS Everybody Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Ave. Phone 59 PALM PURCHASING CO 3 Hardeman Bldg UNITED PURCHASING CO INC 361 5th SCHOOLS, ACADEMIES AND COLLEGES (Academies) SALARY LOANS BIBB BROKERAGE CORP 206 Bibb Bldg BIBB INVESTMENT CO 203 First Nat Bk Bldg ROADWAY TRADING CO 4 Jaques Bldg PALM PURCHASING CO 3 Hardeman Bidg PERSONAL FINANCE CO 411 First Nat Bk Bldg Ga Acad for the Blind 1501 Vineville Mt de Sales Acad 665 Orange (Business Colleges) GAB Sch of Com 565(4-67 Mulberry Kaigler's Business College 3r fir Wash- ington Bldg MERRIMAN SCH OF BUSINESS THE 158 Cotton (Colleges) SAND AND GRAVEL DEALERS McNAIR LBB & SUP CO 266 5th SASH AND DOORS Ballard Normal (c) 50 Forest (V) CENTRAL CITY COLLEGE (c) 1035 Clinton rd Wesleyan Conservatory 500 College WESLEYAN COLLEGE Forsyth rd extd at Wesleyan Sta BUILDERS LBR CO INC 130 Cherry WILLINGHAM SASH & DOOR CO 457 3d SAUSAGE PRIDE OF DIXIE--T&T Packing Co 750 Division (Kindergartens) Arlington Place Kindergarten 82 Arling- ton pi Hill Winnie M 106 Courtland Vineville Av Kindergarten 425 Vineville (Parochial) SAVINGS AND LOAN ASSOCIATIONS (See Also Building and Loan Assns) MACON FEDERAL SAVINGS & LOAN ASSN 417 Broadway St Joseph Sch 201 High St Peter Claver Catholic Sch 428 Ward (V) (Public) SAVINGS ACCOUNTS CITIZENS & SO NAT BK 461 Cherry CITY BANK A TRUST CO 617 Cherry FIRST NAT BK & TRUST CO 602 Cherry SAW MILLS James R L ft Poplar SCHOOL SUPPLIES BURKE J W CO 406 Cherry MACON PAPER CO INC 511 5th Alexander No 2 836 College Alexander No 3 117 North (NH) Alexander No 4 Ridge nr Roycrest dr Antioch (c) 309 Charles Atlantic Cotton Mill 211 Roff Homo Bellevue 864 American blvd Brooks J A (c) 103 Main (S) Bruce Chas H Houston nr Villa Esta Burke John W 2123 2d Clisby Joseph 570 Vineville Cressville (c) 109 6th (B) East Macon (c) 724 Fort Hill Fort Hawkins 450 Fort Hill Green St (c) 111 Green Gresham 102 Forsyth Hazel St (c) 652 Hazel Hudson Industrial (c) 419 Monroe (V) WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7th. Phone 278 Phone 156 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 676 Baldwin's and Telegraph's LOOK TO STERCHPS for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. Ingram B S (c) 425 Telfair h\.o45n7e 278 Factory: PChhoenrery15&6 7th. Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 692 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY Shop At "WE FURNISH YOUR HOME COMPLETE" SEARS Phone 402 522 Poplar St. and 111111311111999999999999999990000090000000889899989989900008999009000000460735269012417355793449561885------------WADMSWBARJJKIIIHJJHFWCFJSJnnnpiiaipHrdhiaHJuWedddxShbRMBnntruAaaafuabEobeeeaiaadogefurlmctdribnppptFnrrekmkieldmlcMkrlesvamsaeeeydsihBunshdsrnoenyCernanneeWssrwicosrdengyncdCddnrAaJoEtnrsekrWCMeeedmWklolEWJnRnnMrPFlMHeFEOnPaatttHruCgrtfDHaDTLhygnDPeLLGLBCgTJeineddnJCBLrrrreaWyoyyCMnl oW CW CCW W rpooo 111111111111111111111111111111000000000000000000000000000000444544555546564466566655656666568034779415032945679244866466-----------------MMC-KMGMABJJMWGMBAWMNBRJRRXCooaiHlulnBeJacWeCnopHuHhzKBJowrMAdKnWBrOlnoahcgaeiukAineateuecthnaerrvdamc'dctlrrCoemanlohrNryceydwkatCslosninlaidwaeMeloTnlsCsmesraronsdasyrWnoAfautMHnarirtfcefeTlCnkcmeWtguARleNmrWhTkreCbCsDGJOICsLFeyOEMHLRLAJrCNEoLFEmtABJHLPfABWrKLRoBLWneoaurgnnlrsraeiienttedoherenettRREEC1111111111111111111111111B111111J1111111111111111111111111D11111100000001100111012021222222111124356778093412089327861245258852-------------------BLMPWBWSKRBKWWWBBWRJWaaweeoroeuaCincroOrWnpnvSalrWDBEkCnokswlgelinaamioedlinalauuynihlninntlenlrwyileirlaglantalspgiLstilhsrSHHosauHLsleJGdoiamngpEEnMaeenLmJGFGphgunFsnlMWoAoeRrrrWRuriAyJyaFlWAsiiecsFMHJReeHErJrRiBanHMnR J J nciees RML5W SoSS5SaACTAee2oattrroCnrhbagVoeld3reOderue.eEr'sstNdsct k 1010 Powers J H 1014 Bradley Oscar 106T Calhoun & Thomas 1128 Boone Annie M 1069 Broadway Cash Mkt 1129 Walden C G GA. 1015 Holmes Minnie R 11001167--RJ HKuebabtianrgd ESleiznie 10171018- MW J 1111000077771423-BWAIWnudcoraCodmdelarsnurkfIfSmSHWiEthWAC&eolldsCinoAgltiocne1111111111E3333324053-B-MNMCJ aeRaCmabelrrpieydeRtlelRWirI LVHTiPncent 1018-R Turner James 1075 Bishop F J 1018-W Rust Margt 1076 Adams I H 11002118-MXWasoMniceltHonomDeurowf oGoda 11007778 MKiutct hPenusr CJ oT 1022 Brooks O L 1079 Stokes O R 11002243-DWr HPiellpapredr SBustlige MCo 11008800--RJ HZaarrrkesll MCaexila 11002257-MR oYoroeumHanLs F M 11008513 GGeoerdsloinn PGeroarlCoL 1135-R Coursey W L 1135-W Smith Mattie L 1138 Finison E H 11114309 ADvaveirsa WE CJ 11114421-DJ aCvaisssiEni SLouis 1144-R Rodgers T F 1146 White J B Macon Federal Savings 1027-W Peeler T B 11902289-SJ eCttrloeomJ HR J 11002393--RJ HRaelelveCsoWra TH 11003333--MR JHouhrnlseoyn RB WR 11008843-CJ oFulnatnvdeTrsaxWReRceiver 1085 J McKay C A 11008867 DMDeeOaFwcfoocbnreeSrurT&ypyECpEesoffwtieersiter & 1147 Nottingham & Nottingham 1148-J Blount W C Jr 1151-J Greer A E 11115534-HJ iSnptoenir CLeCwis 1154-M Myers Minnie B and Loan 11003343-HWarBriasteWmanA R L 1035-R Sheridan E A 111000333675-CSWtaorHnoelairnAraidsodLiniefeJCIEns 1038-J Sutton T W 1038-W Hunt W G 1039 Daly F X Co 1041 Hinton C C Co 1088 Bank G W 1089 Harris P T 1090 Roughton Lavinia 111000999122--PWJ oRrPtoeagrrekrJss HWEllaS M 11009934-KJ aLpelaonnarHd HD N 1094-M Hale J S 1094-W Mercer D H 1154-R Greene Mamie I 11541155115511561157 St Luke Hosp 1158115911601160-R Carlisle W A Assn. JLoans On 1042-CJ hLreisamptarnotWJ LW 11004422--MR WAsableklel rHWBF 1042-W Self L S 1044-J Eubanks C E 1095 Brady Estelle 1097 Central City Bag Co 11009989-AWndJeornseosn WS VR 1100 Bells Pharm 11102-J White Hattie 11111166G120-BTWoiboHblearAFtnuuetronss CWJorWeIcnkcing Co 1163-W Brumback A B 1164 Martin J W Bibb County Real Estate McCLURE OFFICE EQUIPMENT CO. Mimeographs and Supplies 560 Mulberry St. Phone 903 Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory *93 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 5779 6 14 New St. MUECKE & SONS CO. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures Phone 636 1111111111111111111111111122112211121111112222111112212221211222121122112212211113321122221112211119111112111222111211121211111111111111001011121010601189410111991099291999833809389978690483588981267853977717707866667777231722994467-6-5---430021--09-7L68446-AWC2B967WT-3WR-X0-0W--J-5RRGMF-J-IBNI-HJN-WTRCJMWKSRNA--HNJWAe-CJL-vrvoHCFJeSnMMJAHCSLHuWJBaJJroaTeuaaoRtCeuoCoernMeMWaLeidoneoueeZhonowtlaCBBSswBaeaDamtnDypiarriotpsAlMycagKVytOedePavrTmdrrnldaocrpndHgtlauikshtMmdsogltrcrllaeCceentCeuhnetsmre-luTcenrieksohyperwaelddseoheeathseulhWreBysmaeEaTnnsleesnteoruhhrmhJrrrrondanaepcraeelolrholalTooymtmmtetnwaaetJdxsealsDLeaaiutmniegClenyrmJAtlLanreikinrnHs'noslonlHlurdteeacynOJcnBldJrereNesnAJsi'ePstscyaBtClsenBntnrhnnenIrWKderuiAiCDiTCMlhueAwCnJLJgarTHmnsgeWdleaSMCMJWEPJTOCSnGsARaiusoMRoEBCnCHCeNrhAnSardhenNtorsHPooalaknlmnWVDssrfealraiDCoelaCruotnCMkpnreahcWeCoaPJRWfCEIneJDerfMuntHHltnaiecnafsLrCIhalEaBsJnNodderkECrcderdmnioeiCyumeeaMaLnCaCJCFalneSnEgGGraIorSortlnealayrhrircooneCovop11111111111111111111111111111121121122112211122221121112221112211122111221222111222112222119221921119921189228288822222822882777222772772262226766272227622722666621222512029054558675556351552597845614244494744464454443-02314444039-333-38---4567-413290667699931699266-5-43367-36--DC--2SHGCMRP-HC---J-MMJ-WGCJW-L---SGJ-CJ--B-W--HP-JMRT-JBMRWMatJRaJoBWRoRHCJWoaoSSJLruyhheuaeoBoaarcehcMRelaaonwlnGcwMucaspeoiurEarlePhldlCGlHaeBoBomeroHrLSofeniHseAllnoemnTPkuPmEailalrHsmndeweriferiianlbbTogmhttkreaonmrsauypnnlierabdpheireeadhforltuarxrslonnesseimetevluekeaaileeflsbMsessyirakatetanlholxdiepsewerCfznGrnerehtrytBlJlhennetcOlreOsigammoSHwlokWhPlgPArWnilreaSoHnninWtCiPrSotTJnJHIrASLtJrIChlslohaJai&CRceH'CieJuW'JmAHdlrogdEsJAchusAsnknLanaWgtaGalFEiCBtM RauTDW BMaoFpoAvraraernWecJnGyMMLuSRAPrrMMmGLmoMtminHLJeharylCdRnmottteoMahPlnolMoJCiayTatiaynaekTzaaoEnsnEtraILroMsMrnyzatnnrgCnhniriCmMimeadtctdieeoseomBWPI&Ganc 1111111111111111111111111111111111331111333311333133113311131133311311133331131111333311331113333535133553433534434353344343344446343333334433322433223222322322562232100221982141271914125052693010090006040059922027899999643999-939306-9241359--0350-6--4123-0894-R45-88F-MMR--28-JH-JR-M-4--JDBM-G-7---WSSJOTN--WDRJSKM---SSJWM-C-WSJEB--JMLGH-oLLWoLMR-JWGtlFJtaaMmuaIahIoiEe'HiaaJrurYGaeGSovabNrrLeeFCtencntaCJvotnneeeawuwevrcaMccwgWnAvvvvaieevALoCairzcclGirorBMCwuiSbdoerskethlRCthigkFtoesrfsendiiriatioinyhphBanshscaaalcyerueesoenffoeeoeitsgiasrliwneasaioyd!e'ahnsiflselwzreaanlaooilCndotnlnJBnssEnxFirohsltrrolSeDlhdsEdaacsOOreJlxnuOyorodJgneyoWBBRnaJraoolesnWesurordsluesSJnslCnRrJ&ouy&stpnAsHFnSRdamsHeDHWTCETrehGCPCPHSdnssRToPewnRDpyWGtJrSOoThoDdReHCooAaJSJAoBnWhW&eoeVeoenECrwFJHlroACoooJiFRHARrWoePlaniBllirebPdvroEKlS&RcdlRCLoelrlitiohiixMetno&ELtaaShobtplaFJmmSytepMaessCLo WMocCodo JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--] Sotor--Yates Motor Co.--Packard--Phone 1445 Baldwin's and Telegraph'* LOOK TO STERCHFS for BETTER FURNITURE VALUES A. T. HOLT CO. Taylor REAL ESTATE AND RENTING AGENTS Transfer 569 Mulberry St. Phones 946 and 947 Co. 111111111111111111111111111111333333333333333333333333333333566565665676766777778887777778914796107703547585150204029294--------------M--GEM-RJJJ-EMTMWJBMAJHWMJLWPDJJoxlraLHleiScCAoJyekuSaACoOfcRyNKamCeoWSapewoRnySrahachllorliaopnnermoanekieorleadctayklumesihxdIeimwWrrpnbeylrsntninc-yssaEydghtWCebSQpbAenoSshnTreeamMMbeDnCeHtduFERrNlerAhreJTtClCEteimolrtWSelcdRrRyHSolFrCk&tCHOeiaPWBoenMeRtorLHSntlgJ W GeWflyaSeEESglirCVlyftTrnitlooeeahgeR 11111111111111111111111111111111444444444444444444444444444444441112222222222332322333333334434478901241789015323575545689043124--------------KO-PCMWBJMJRWSHMWBMMMHWRSMo'eohohaaoNcJuaaiRlrSiDpeasieDUyLHllolDSBfccclrrleytrllmoefeeahhiooeroawhydauaormuahbyansrnnnnnqialnlnrmorJaiytieaLwhscnuGnhneWonBYWntMMshaMsLlheedoeHEJoomlDtFaoMenliiEJntPPnGEWllrGaCJDllBtPaiCiLtNCnnCCTAJhHrReJEggyreMtJerBAH&FCCrooCCRooev 111333888456-- Freeman-DentW J -Sul- 111444444564-YYWaattGBeeBssurranaMMnntaltterrHnyCCMEooCaIIhrnneyccney livan Co 1387 Freeman-Dent-Sul- 1447 StTanildeaCrdo Brick & livan Co 1389 Sutton W L 1448-J Langford Hattie 1448-W Davis W J 11339901-DJ eCwubnenrirnyghAamnnieC FS 1449 Burke Leila G 1451-J Hawkins W M 11339931-PWerMduiellsCJ HA 1394-J Meek W F 1451-M Van Landingham 1451- C H 11339954-HMuDntavJis RH J 14521452-R Jordan W H 1396 Sowell O R 1397-J Mitchum J E 1453 Armstrong Octavius 1454 Chappell C J 11339989-AJ cSrmeeithMJMR 1400 Dunlap Roofing Co 1455 Reynolds E E 1456 OdCoom Realty & Ins 111111111111111111444444444444444444000000001010101111236457098244468313----------MNJGGRKWFMJFJJWooarruecRnCheMiCrnmNCCeWegmnahndshaoaphysMeemeaitoarierlrtSliripsnrrhudeLatyLmsetsnCALLwCbPaLBHAErnSshHiWlHfCa&lCeJTCeLrmJ nJ SW J IWFnusp JCCroo 111111111111111111444444444444444444565665666667766666719209680013579777-----------MMMMWAMWWMPRJFMNWhimiooWnulDPiooYKlSWDNlKMTdteGlrrraamOilrleeohMuulnimpasLraalropiieehesyGltwlrctiJbmiJrtethfipaKhitenoeCOepmpCeTlCRgoaCsoJJsbwydstAtIoKFionHesnFQEunOCHesGrnSJCtFPErCHMyaoTAnnoife 1472 Flowers A J 1473-J McCommon R L 11111111444444447777788783564129-----LCSJ aarWatstnseheeraftltiCeeenlordNSW W R DaEnelnlieBE PH3 O8 N8E Gard SHceortnt 1482- 1483- 11448843-SWheHpaarrddinC EDH 1485 Campbell Edw 1487- MOVING 1488- 1490 USMC Recruiting Sta 1491 Dick T A 11449934-GJ aJnetstsuJp TW B 1494-M McTyier Ruby LONG 1494-R 1494-W 14971498- KBerlildgAelsexW M C J DISTANCE HAULING Sla Atk 11449999--M McBride B G 11449999--R 11550000--M Harrington R F J Yea Walton WW F STORAGE Go 1502-J Smith J T 1502-WYanBcreaynaTn BE W 1503 DiMxiiessCarayfe & Com- 1504-M Beniamin Wm 1505 Webb J R 1506-J Crawley Chas 1507 Miller Wallace 1508-R Flynt H G 1508- 11550190-1514-J Connolly MM W L This Fl M 1514-M Murdock E A 1515 Bloodworth H B Directory 1516-W Ackerman C A 1517 Armour & Co 11551198 AArrmmoouurr && CCoo Was 1522 Anderson J L 1523 1524 Strickland AtPwloaondt 's PElR J eHating Published M St 1525-W Byrd Ida M 1526 DiaxtioeryDental Labor- By The 1527-R Green W A 1527-W Sheridan A E 11552298 RHouztcahrinAgsRC H Originators 1530-J Meeks Beulah L 11553300--RW LRieviinnegfsetlodn WWHC Of The 11553312-ZRemMliizceh WKaErl ABCD 1532- 1533- Type MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY Of City Directory McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1035 Macon City Directory 95 Everybody Reads Macon Evening News, The Macon Telegraph Macon (he&la Bottling Co. Phone 32 6 6 TELL THEM AND YOU WILL SELL THEM USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston. S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St 11553353--MR BMibalye HG BA 153511553376-Progressive Life Ins Co 1539-J Sheehan R E 11554319-LWewWisillJiawSs Kath Schofield Ins Agcy 154215431543-W Fuss Leroy 1543-XM Grant M E 1543154411554457 WOraladnedo& VCioncent 1549-W Avant C E 1550 So Ry (car repr dept) 1551155211555534-RJ aSgmsditahleL BO D 1554-M Shipp B R 1554-R Abel H B 1556 Jenkins H A 1558-J Johnson F N 1558-M Deadwyler Ida 11555588--R Clark J H 1557-J Long B L 11555597--W Fuss J P 15611562156215631564 Weaver O H 11556656-Ries Irma W 15671568 Baird J E 1569 Miles Mary E 11557701 JDoanveiss GWmC 1572 Stanford T B 11557745-MFarMmaerrtinF IWL 1580-J Mallary N D 1581 Bashinski B J 158315841585 Beall O P 1586 WSilolinams Luther & 1587 Baggs L D & Co 1588-J Amerson Nancy 1588-R Ashley M L 1588158911559912-Brown J H 15931594159411559955--R Hamlin J W 1595-W Hubbard R B 1596 Jennings R G 111111111111111111111111111111111111111111111111111111111111111116666666666666666666666S6666666666666666666666656666666666666656565455554222333344422330142911111111200144510100353300223341229001978345672341896716946112095672389943940068537724405505573204587682--------------------------------------LCMGMHWMBFDIPBGHCTITBWWJRWCBDBMJJWRRJWPSRJWBRJJJnn&ulaiheiaaeioaroraaaaucBlWcgScOBmuiCbTtDtCHselSaeWeiMrroRJlllmsMvCCrieNRiCrJflMHSBolbnolstnrvwzlnloedlxarkegtmmeeooyoorAaaloioonieoormneoekdmarelfmlaceaanisiythsroenhCiriwlwerrnoolcnnoaottyPCrcenldyDttipidWgroasiRTatyeonlnkenahesrndssalGGtent'onBlmaArrArlaGndHlnrtJseskstrisydsJnlEedoCcamuuenCeaPKbdCJLuiJIeaBA-veBrAoClngJCRgAnCJJWePSMCmytnELRJdtoSeaLLWoorWsrBARHhWTaotoCLyyFrTiCGLEGhNJTnaGWMMGyfiEnBPCWW J M J soeJ W W J W J M J J W J J rJ J M R X J JRJ J M neC'fACmoayARlCWoaAol&rrMlroitl&cisylAk-thce- 11111111111111111111111111111111111111111111111111111111111111777777777767777777777677776666676666666666667666666666666666662231223229000000111177091112399977896669996675789099565877895719147825650145781268192979902650246788120801913429995469354109----------------------------------MCBCJMCBTHMBMGGADCTBCJSCTMMBTSNDMSWRRRRTJJJJJJJJJaootlaoiatrauiriohurirleokaCtugciSOaudiaanboJFHKmGLenSouinWzoyBrsBJnrHtrnennDuRePocfetewnrokwabecetWydkeliolawdaoslitsfaaernrutogMmeenebionnsohcdaseeiaasiedtiinshtinveenewniwlnlhwenoinnlensllkhedsrvlraPhnmalwfrelieeaCliReeednlngrCrslClletooasflriiidTWsCrgiaslrryysellsnnheTGdFaooyCWtyJmcroeaMierohhWMJeHDElldgsynbBnmGkOntnaJWJydLaNnaehHaLTKWttdaanAWoBIDPTPrmAineuEHauWorJSaiWfaWAnnTMaCRGMaFOSrTRtgrndnlrAHihtgsrJJraMloRGeieeeonAFJESatPtaJrCrrBlrHsWsieeJdrrdCEHeaaaoEriWOCofnrCuLeRgEgo-ieHa- C 1658 Richardson Rhea Fausett J A BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 896 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 1733 FaPromset rs Trading 1735-J Thombley R L 1738 TSeritatlneglJe HPhaJrrm 1740 Washburn A C 1791179211779922--MW EBpattinsognJODM 1793 Shepherd L A 1794 Phillips C A 1839-MSanJdacekrssoWn MLW J P 1839-R Casey J W 1840 Moyar Lbr Co 11884412 HFionldmleeys JPohEn Macon 1741-J Davis C L 1795 Wingfield S B 1843-J McGee Marie 1742 Latham R S 1796 Daly J K Rainey Hight 11774434-CJ oWhnalSterAs Kate R 11774464-HWolMloowoarye JSimMon 11779978-VJ aPrnarekdeoresoLn LT M 1799 Johnson Robt 1800 Harden Timothy 1843184411884456-- 11774467-HJ oSlmpiellserJs PClarice 1801-J Jordan J C 1801-M Lane A E 18461847- ttGer Co Roebuck and 5884-J Rice G C 5884-W Thomas H G 5885 Bailey Sara A Co. 5889-R Marshall H D 55889912-5894 Rice Winnie K 5895 Doughtie C H The World's Largest 58985899- Store 55990042--MJ CSahlheoriudnanEmRmEa 5904-R Hatfield J W 55990077--WJ EDlmootyreHJ JG 5914-J Gilman T H 552 3rd 5914-W McClellan W A Jr 5915 Coley P N Street 5916 Mercer University 55991188--JW CMascsNideylisCPecilGe 5920-J Culpepper J A MACON GA. 5920-R Hobbs M Ella 5920-W Askew 5929 Hass A A F R R 5932 Newman W 5933-J Radford L J AS D 55993472-MMaCcoanrliCslreedT BHur 5942-R Abel Gladys Macon 5942-XW Souther Louise 5943 White M G 55994446 NSmapitiherREST Federal 5948-R Rogers Lester 55994489-- Savings 5949-M Taylor Martha 5949-W Smith Mattie and 5951 Roberts Frank 6957 Sterchi Bros Stores 55996548 MGhaodldsuoxn RJ RL Loan 5966 Wisteria Cafe 5967 S E Underwriters Assn. Assn Ga Inspection Rating Bur 5968 Thornton J G 55997704 SGteaoffrogrhdegWan BBrooks Loans 5975-J Robinson Wm 5975-W Tennie Carl On 5976 St&ansSeallndPwoictahtoCoChip Bibb County 55997779 AMrandedtotxCECL 55998834 DTeurnrwillodLy MD D Real Estate McClure office equipment co. 580 Mulberry St.Mimeographs and Supplies Phone 903 Phone 5036 McNair Lumber & Supply Co . 266 Fifth St. Phone 1400 W35 Macon City Directory n Everybody Reads Macon Evening News, The Macon Telegraph Macon chanan 66228802-MJ eCltootntonWMRattie M 6382-M Adams T L 6382-R Bradford F V 6382-W Goldstein Chas 66338835 CDouorkhaEm FE B 6387 Guttenberger Mus 6282-M Bailey M Z Shop 6283 Band W O 6288 Texas Co The 66229802-CJ hRaonsdsleJr FS S 66229932-SMtaMplceKtoinnneJy TB F 6390 Gates P G 6398-M Sager Irene 6398-R Miller J G 66430908-DWanKneennnbeeyrgHCCo The 6409-J Hardy R C 6295 Smith Lydia E 6409-M Resseau J S 6296 MCanon Jack Battery 6409-R Hays W C 6409-W Taylor H N 6298-J Raley R H 6411 U S Marshall 66320908-LWowBeatEtlleecACnnoie L 6306 Tanner S K 6413 Gates Rosa L 6416 PoCsotal(brT)eleg-Cable 6309-M Carmichael H G 6421 Williams W W 6309-R Sawyer A W 6432 Bailey S E 6309-W Parnell Lorena 6434 Barnes A E 66331101 TGaoSyotlodorrreicshH SNilvertown 6312 Goodrich 8ilvertown Stores 66444308 RJoynaelss CT BE 6442-R Asbell J B 6442-W Hardaway R G 6448-M Freeman Alma 66666666666666666666666606666666666636633333333333333333633333333333333333131113112231133423443445566464484675873648518990834901866075561422868718980-75---2------TU---RB--JTMFJJLFTT-JCNWMJMKTERJRJMWJAWMJaaEiaiehthHAllaeoDbaJCextBUimtcTiDPlySacerPeoRaMntwsbnowninbHKdenWMtoasrlsseiurmstelkeaksahnoArpammvpeBlelolDrlosadoryilessbneCirdntyJkarhCieomisWlyltdorncnyasdCeenslascairioehaaiHnnMLanrtptFyeaeGRCWhnScwauoneltSEWnntssWRCeokrdhrnnSisqAitEWaGsrGLElioqARhnLotJobusdnAEyCSHpSetfgsAHLearkCEWWeslocCMMrsrGRBAARrlhteDCLAvIGeagoW WnW J M lrorBSiBycefatfap- 66666666666666666666666666666666666666664446444444444444444444545555555555555454555554776774578857T97222899131233243338904440146486708985194259869489440041305--594499---------------RB--M--CBBWMMJJ-G-R-ASM-JBHMMJWWJJJWSRRTMWSWJRJimlh2urie'BLereevecoGBWKJW2ckHohBrawBmlSlHlCJaeiMseiASMDGMedtieeKRtoJarntrneosuanfroerlrhialhhtsetoaasrvrsofrdaseanneaoysiaiamgnaafntivadaethsgmeynlmg.uytisDkghetlltAPyldreTerenBFmhteeldogMJelsilgJsCbJJhAarAoCylTelWsennotoHnyodfoeaerJITeeGoHorVcnslJyMrEdnyEhlEPArsFwJeCArnCdRlAsGCGSoEanplFJABCaEdGSfJDLRWtnHsJRrreWECnWtnJoooALALienAeLBnMFGJELAiE.DOeToaHurHSHgistLe 6550 Shinholser W N 6553 Jarrett H K 6554-J Harrell E L 6556 Jones R C 66555578-CWraMwfoorrrdowH FF A Macon 6561 Macon Gas Co 6568 MacDonell A M 6570-R Dyald F L (sasSeta, 6574 Plunkett R G 6579 Hall L E 6580 Bollinger R A 66558859-WWalCl oJllieBr A J Bottling 6590 Sharpe Lila 68559852-HXYowWaridlliJs WR T Co. 99000303 SBoacBoenllHT T& T Co PHONE 9049 Smith G M 9050 So Bell T & T Co 9062 Carson C H 3266 9065 Horn E B 9066 Bartee Homer 9067 Hill G W 99006780 SKpirievresn CC KL 9071 Am Tel & Teleg Co 9080 Collins R M 9081 9083 99008865 Reddy T G Albea W L LCootmt mCanLder JrW EJ ula 9088 Hearin E R 99110034 ASttaknindsarLdeOahil SCo 9110 Bibb Shoe Shop 9113 Ward's Bar-B-Q PI Signature 9116 Stewart Oil Co 9117 Middle Ga Prod Mkt 9118 YoEuxncgh Bob Used Car 9119 SixStaPnodint Weiner Only SAME DAY 9120 Am Oil Co 9122 Lyles B F 9123 Richardson's Gro 9124 Wofford Oil Co 99112268 DElelaisn CWafeG 99113312 NCaeuwseYy oSrkBer The 9133 Wallace Karl 99113378 NBreowwnSeWrv WShoe Store 9139 Green Front The 9140 New Yorker The 9142 Glass Pharm 9151 Scott Filling Sta For 99115556 HSiolvgeure MSoaomni Cafe 9159 Cricket The 99116612 CTeoxuanstryCoMTkht e Reliable Salary People 9164 Macon Cafeteria 9165 Watson H C Macon 9169 Ard W F 99117753 PAllufmord'Sst GSreorv Sta 9182 Worsham W B Trading and Invest- HATCHER & M CRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 ment Co. 220 Ga. Gas Bldg. Phone 293 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 WS5 Macen City Directory 717 Everybody Reads Macon Evening: News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive | Equipment Replacements Tools Radios 696-598 Third St CLAUDE TRAWICK COAL CO., INC. RED CARDINAL, SILVER STAR COALS AND COKE 201 Edgewood Aye. Phone 59 99118834 PUintitosnCToNney 9185 Macon Auto Exch 9189 Plaza Cafe 9193 Busy Bee Lunch 9200 Schulte A Cigar Co 9203 White House Weiner 9206 HoSttealndGordon 99220174 BSmaliktchomH SMerv Sta 9216 Lueree Beauty Shop 9217 Clay's Garage 9218 Allen R B 9226 Crawford's Barbecue 9228 GoLiunsncWh E & Son 9229 Elks Club 9231 Federal Transient 9232 AmBuerrson Sandwich 99223334 MDoSauhthgoilpsasWs HLotel Grill 9237 Swift W O 9239 Cherrio The 9246 Spiller's Restr 9250 Morgan Helen Gro 99225512 DBruofwfynPJ AH 9254 Iddle Hour Billiard Parlor 9255 Nu-Way Weiner Stand 9257 Palm Barber Shop Rhodenhiser R B 99226643 TInegxlaessidCeo OTihleCo 9265 Saloom S & Sons 9268 Mansfield W S 9270 Morris Drug Store 99227717 PScahlaeclleingof GSwReets 99227798 WFleamgeingEaMrneLrs Shop 9280 Ideal Storage Garage 9317 Simpson Sara 9318 Gilman Lizzie 9319 Arcade Billard Par- lor 99332234 ALymlesRWestrC Gro 9326 Ft Hill Cash Mkt 9327 Corbin Ted 9328 Champion B J 9333 Bruce Chas H Sch 9335 Chappel Elmer 9337 Gulf Refining Co 9338 Kinney G R & Co Inc 99334389 SHhuidesroSnamBi G 9349 Radio Serv Sound Co 9351 Magnolia Inn 9353 Odom A E 9354 Aubery Florence 9356 Lassetter R L 9357 Avalon Beauty Shop 99335589 JSooneOsilLSatmoraers 9360 Saloom Cash Gro 9362 Salters Mattie 9363 Sportsman's PI 9365 Fickling Hotel 99337606 CAonldorreewd sTMaxaigCruoder 9374 Log Cabin Sinclair Sta 9376 Oliphant H N 9380 Flynts Barber Shop 99338815 GDoalvdiesnWEaHgle Co 9387 Barnett Sami 9389 Am Oil Co 9396 Webb's Place 9399 Wofford Oil Co 9400 Brady's Place 9408 Standard Oil Co 9409 Standard Oil Co 99441120 SSttaannddaarrdd OStiol reCso Inc Standard Whol Co 9422 Stanford J H 9281 Tatnal Square Serv 9430 Collins Thos Sta 9286 Nehi Bottling Co 9287 Scbwob Co The 9431 Watson L D 99443343 BKreonwnensaWw WThe 99229809 SSatapnpdaErdROil Co 99444420 HPoelnadrleByeWar TThe 99229941 BDeulrsro'ns'sCMreakmt ery 9443 Busy Cor Lunch Rffl 9444 McKinney * Adams 9296 Sawdust Trail Barbe9297 Bycrude Jennie 9299 Gibson's Gro 9450 Bums Boot Shoppe 99445512 BTirImannconthoyns JoShernv Sta 9300 Supreme Storage 9461 Weems J C Garage 9462 Johnson Ernest K 9302 Flanagan's Camp 9303 Williams Serv. Sta 9467 Red Front The 9468 Hudson D E 9304 Kyles Drug Store 9305 Millican F H 9307 Gulf Refining Co 99331019 GSmulifthRRefuinthing Co 9312 Rogers Serv Sta 9472 Cooper Bertha 9474 Rex The 9478 Scott Minnie G 9479 Vanity Beauty Shop 9480 Standard Oil Co 9481 Francis Antonio 9313 Pitts Pharm 9482 Jozef's Beauty 9315 Hunt's Tourist Camp Shoppe 9483 Thomas Funeral Home 9487 Huey's Mkt 9489 Bibb Body Sc Fender Wks 99449958 CBaartelimsleanBErosE 9500 Whitman's Pharm 9502 County Superior Ct 9503 Tatnall Sq Dry 9504 PoCplpeealnl inBgeuClaoh 9506 Coffee Gro 99551018 PBoepnunleatrt &CaCfeo 9512 Mitchell M H 9513 Caldwell J L 9515 Ga Mkt House 9521 Lucky Strike Bowl- ing Alley 9524 Smith Wm 99553310 BMualrliolcykn WSliBpper Shop 9532 Macon Mirror Wks 9535 Sawyer Coal A Ice Co 99553474 HMiagshsteoewAerp'sts Serv Sta 9553 Wilder E C 9556 Standard Mkt & Gro 9558 DeLuxe Cafe 9559 Gibson Vinegar Wks 9562 Wesleyan Pharm 9564 Paris C E 9567 Pleasant Hill Beer 9569 MPeaadrolowrs J C 9570 Parker L L 9571 Joe's Crescent Cafe 9572 Marinello Beauty 9575 StSahnodpaprde Oil Co 9576 Jones A D 9577 Brass Rail The 9579 Pilcher's Serv Sta 9582 Apex The 9586 Atlantic Serv Sta 99558898 PDaaryilsigGhtroCaCsoh Gro 99559923 MHoctCelrarAyrcGadDia 9595 Ross Bros 9600 Cassidy's Garage 9602 Broadway Fish Co 9604 Wesleyan Col (Jr fc 9607 GrSeeantioAr H&aPll) Tea Co 9609 Great A & P Tea Co 9611 Great A & P Tea Co 9614 Riley O R 9616 Young C T 9617 Henry I J 9618 Ingleside Pharm 9620 Liberty Serv Sta 99662268 CGhenenrroyneS'st BSearrvbeSr ta Beauty Shop 9632 Mercer C M 9638 Shell Petroleum Corp 9639 Goins G W WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St Factory: Cherry & 7th. Phone 278 Phone 156 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 718 Baldwin's and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. 999666455643 FBOadelioorrgrmylaLVnedanriDeCtayhiirlyWi Pksar9682 Gibson G W 9687 So Dry Gds Store 9690 Epps G A 9698 Empire Serv Sta 9700 Rogers 99770012 RRooggeerrss 99770034 RRooggeerrss 9705 Rogers 9706 Rogers 9707 Rogers Inc No 21 IInncc NNoo 21844 IInncc NNoo 117712 Inc No 173 Inc No 174 Inc No 175 9708 Rogers Inc No 176 99770190 RRooggeerrss IInncc NNoo 117797 9712 Rogers Inc No 181 99771143 RRooggeerrss IInncc NNoo 118842 9715 Rogers Inc No 185 9802 Mongomery P A Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate McCLURE OFFICE EQUIPMENT CO. Mimeographs and Supplies 580 Mulberry St. Phone 90S Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 719 HOW MANY IN YOUR FAMILY? ALL WILL ENJOY READING THE MACON TELEGRAPH AND MACON EVENING NEWS -- THEY ARE FAMILY NEWSPAPERS, NEWS OF THE WORLD--BUSINESS, POLITICAL AND FINANCIAL FOR DAD NEWS OF FASHIONS, SOCIETY AND STORE NEWS FOR MOTHER . . . SPORTS AND SERIAL STORIES, TOO, FOR OLDER SONS AND DAUGHTERS. SPECIAL FEATURES FOR THE YOUNGSTERS, WITH DAILY COMIC STRIPS TO DELIGHT BOTH YOUNG AND OLD ... AND 16 PAGES COLORED COMICS EVERY SUNDAY . . . YES, WE BELIEVE THAT YOU WILL AGREE ... Every Member of the Family Will Enjoy The Telegraph and Evening News They Are Truly Family NEWSpapers Macon Evening --AND-- News The Macon Telegraph Telephone 6500 m Baldwin'! and Telegraph'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 c. w. Farmer BALDWIN'S AND TELEGRAPH'S MACON GEORGIA RUBBER BELTING HOSE PACKING RURAL ROUTE DIRECTORY 1935 Phone 2 13 Containing the names of rural residents arranged by routes. Copyright 1935 by Baldwin Directory Co., Inc. Route i -- nw of city, reached via Forsyth rd Abrams Mamie AAAAkdddiaaanmmmssssWELMmlutaoleaLn MMMrrss Alexander J A AAAAAAAAAAAAllnnnrplnrlllmlmeendddpidesxxeneeleorooeaeatrrrnnnttssswnnodOdoooddnsLnnneeDJ'JrrGCMoGJJBMhnaJJeaMesaoRrHrczDreokylmlae AAAAArrrrrrnnntiooenClltgddttroaLMnBfjteaCWstSstihimeeopJ Mrs Aebell V L Mrs AAAAAAABBBBastaauuuauuhhcciisssssllooomttttteeiiiiinnnyynnnnnorJWWeHAAHRTChilolaDWalanofiobrnlfrgntrsfetnezfyModLiararehdrlsdMrs Baker Essie Lee BBBBBBBBBBBBBaaaaaaaaaaaaallrlrrkrnnlnkekelfffbekkkeaiiissceeeerssrrsorldlltdmBJddoRFJaDSneuraSGsaERraMylcnMrinmChaTaaRkhMMCrodEnJdMWr rs BBBBBBBBBBBBaaaaaaaaaaaassttrrrtrrrreetnrrstrrtnlooolmoosweeenwnwnWttaetLtBnlEWleCWPeEElwGtllGeHyslaiaiMysdEjHrMaeClWhae Mrs BBBBaaaaxtttttttolleeenr JJJMeanssioslteoLn Bayne C J BBBBBBeeeeeelcealalkkmrrdndaEaaomnlpnMeaODHanBroogrArGorttwennseC Bell Mary F Bellvue Sch Benson Mary Mrs BBBBBBBBBeiieiollolvraansonlccsiittknnhniklneeegHgrgyrssGBaKeEmGJPCoBieaenAotPSkhrMDigeerioraistnieaLee BBBoooooontkheerWAJnEnMie R Borum J C BBBBooooywywdkmminaMannJaMryCCchKGaisnMleyrs BBBBrrrraaaadnntcdttlhlyeeeyyrWBSAelELfnred BBBrrreeesnvwtalreedlyl WIBiLlNlis B BBrriicdegeWmanH T' C BBBBrrrriiiignttttgsosJWnYCilJoluiJrekdr sEon BBBBBrrrrroooooowowwkknnnss ACJJHoeBAGffnirey Mrs Brown Ross Bruce D F PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices B U 460 Cherry St. R K E '8 Phone 74 and 75 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OR MORE AUT0BANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from V. M. C. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 188 Macon City Directory 721 Everybody Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale Automotive Equipment Replacements Tools Radios 596-598 Third St. Flynn Printing Co. QUALITY SERVICE and PRICES 305 Broadway PHONE 5779 CLAUDE TRAWICK COAL Cfc, IRC. RED CARDINAL, SILVER STAR COALS AND COKE 204 Edgewood Ave. Phone 59 Brunson Nathl Bryan B C BBBrruyycaahnnattnaCJn TNG W Buford Mary Li BBBBBBBBBBBBCCCCCCCCCCCCCuuyuuuyyyuayyaaaaaaaaaaaarllmmbarrlrmraarrrsrrrrrrddhntgnoddrddonsrssittoowwppnopeeeeosfnenltbbrbueyrsHwWWeeGtTMJlsseetenllHCGHesllllaaHlBLimaClllWLbJlrhPeerJlieeEraJlBeyJloAaAnneayrlMFcrKGHrbeoruklyCGaLtieJVgteriFHMuetKsrtLnsaox Catron H S CCCCCCCCCCCCCCaahahhhhhhhhhhuuuaaeaaaeaaiecssmsepmmnnprakeeelkpedtmtbbbyyhyeoyellllseaalnAiiiltrmnJsssFTePdssserShaIrACJllreoaCiRCLKvdsxsMhitRTeiianozeabAtrznereesiMlceiecaae CChhiillddss MNoAra Mrs CCChhhiirlpiespsteiwaBna 'FMEleldaiciMnersCo CCCCCCCCCCCColoolooollloyaaaaklnolllydlrrrbbqenpikkyeneeueerrsWirlJttWtlCMRtMTCGiIHocWPJleWanhiEofrtdHffyoTMrdrsJr CCCCCCCCCCCCooooororrrrroauaoaxxxxrrbnbsfnmwtsiiffLoEOnndSpoonetrrrEeGdnrdJEIJvtreHahHeeRsEAslanteeuzenteftRLeiules F CCCCuruuulllpptbceerhpepftppiheeerlrdLCMoEuAidnwnide Mrs CCCuuullrlvtoiesmrhWoHusNeMG E Mrs DDDDDDDaaaaaaanvvnvvrbiiiiiiesdessyllssoFJECMnaBaWnCarnWrrNiyiee L E DDDDDDDaaaaaaavvvvwwviiiiisssssssooJnnRRLPnouoJArGlEatAreuJcryhiJer Day Frank A DDDDDDDDDDDDeiioeoeoeourxxaLnvnntvumooykneaneognnaerlriaaldseHsacrusFSsdCWhoPsxLilJdneiGiDLnzgACJtlzgRoahniyCednaicysVes HMrs Dumas Robt DDDDDDDEduuuyyuumnnpacvrdlkwwraoeeelFoonlensoodFddLsEWJoyynnBJoWWBNMWEoErsraJr EEEEEEEEEEEElnpldnrvvvvvmlwgpwgaaaaaislsnnnnnoliaeinrssssssrWehdTBEHMCOGshJMemoateHtiIorsMBtsmtrGiMieeMaFECrMLseres EFFFFFFFaeavaaaamarrrrerrrrrgrrbeaJrABNtnAotereJncAnlDJlhdinoireWBeoeuwgOMlBarss Jr Finch W R FFFFliiiensshhcnkeeeryCnlHsyMtdeueilGnberJtno C FFFFFFFlooooooersrsrsmdrtstteeeemrsrLHtFiieneEAzrrlgzeeidGnLeGWrAMFeielabneer FFFFoooosssstttteeeerrrr JGEFaeteshloteolDn FFFFFFFFFFFFFFFGGGGrrrrrrrrrrrruruaaaaaaaaaaeaeaeeantlrsrlnnnennetdnnslrycerswomanekkkkkekkeehywlerrlllelllltteJaiiiiiiiitytlacnnnnnnansnMlMSykGsEGuJCOETaEJHMSLsoSnrFloEldiaiEeamWieoaGaomwmvmyrtnoeteadMmirrsheeLarTs GGGGGGGGGeieeaieiabbgioososgsbntrrsrooeggsgeinlrneeitlateWLJOBaMnPiJtislnolialtGlgieGoriaeeliWnleoenWFarm GGGiiillleelesslaJLnduBcyGuMs rs Glover Lillian GGGGGGGGGGGGGloooooooooorroaaoolooogrrtzdcedcndcdddgnhwoehswwrtaeenioCnicriirnREnnshEehWMRamNMGRFrWMGalmLLeimoaerBoWsrsaiMSyveerlMMst rrss Green Ada GGGrrreeeeeennne SJHWCE GGGGHHGHHHHHHurraaruaaaaaaieolddlnllmlegllllslvddnrghlreooCisIJyaSrSnccdWmlaakkHiaHDnlmAOlmutiRaJnoiSTebnvFdneoeMBrHMrentwrpHrsosMrtrs Hammett Jas T HHHaaanrnddneamhOarWnrieCMallie M HHHHHaaaaarrrrrddddpeeyyennr AMJWErydtBhrmaHu' urInd WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MILLWORK Store: 457 3rd St. Factory: Cherry & 7W- Phbne 278 Phone 156 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445, 722 Baldwin's and Telegraph * LOOK TO STERCHPS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 Harper Janie Harper Payton HHHHHHHHHHHaaaaaaaaaaarrrtrrrrrrrcrrrrrrrtrtoiiieeiihssssslllLEeooodllrodnnAnsCDMuowRanvDJJordLoeulrLJsnBanJsMNieaCMMrLsrrss HHHeeennndddeeerrrsssooonnn SJHusHCie Mrs HHHHHHHHHHHiiiiiieeeeellgccgnllrrnnkkggrsdddosseTiWilrsennyehiorsJLcysonnkioESRslosJnWlJuiaHJebJsTyJTEPJr HHiislteonJ FCarm HHHHoooitllfcllfiyhmscJaoCnckSBPRMaJuorrlgser HHHHHHHHHHHHHHHooooooooooooooowolrwlrrlllllllttttttsstnttvoottaaeHooeWHGJADnnrrrnndadallaaLsafTDmnKtFFrJseCtBecwiiaraBdeloJeanttWiuoensnlnciaeiMhs rAs HHHHoooowwwwaaaarrrrdddd ECEDhliMaiJas HHHHHHoooooowwwwwwaaaaaarrrrrrdddddd GIHGJGneraeWOoCeBnlayLMrs HHHHHHHooooooowwwwwwweaaaaaalrrrrrrlddddddJRSWTTWHeooiasHamlblalitoeeLrrnee Pope HHHHuuuucbbbabbbbaaayrrrddd EWPRdwJMHd HHHHHHuuuuuudddgnnssshtnoooeiJnnncsuOJtONJtnloeMTRCnLrFs HHHuuunnrsttteerrWDAlaEivceid JJHIJJJIIrrnaaaaavvucccccgiitkkkkkrnncasssssheeoomoooinnnnnnWCgLMhLsAMJaunaSolsiloRbulsaleerioearbtntePy Jackson Pauline JJJJaaaammcrrkeeeslssol nHJPrWFiCnacleter JJJoaaerrrreeRttetteAWCratahlmtueprr JJJJJJoooooohhhhhhnnnnnnssssssoooooonnnnnn AFGEDCeeoaloTrRriixrsaieyJ Bell Johnson Isabelle JJJooohhhnnnsssooonnn RMJnaoErie Johnson W A JJJJJJJJJJJooooooooooonnnnnnnnniinneeeeeeeeeeessssssssssr HEALHCCSDEVdenolamamlHnlAvAeuFriminaoemdnabdLJus JJJJKJJuoouooennrrnrldddglegyaaa'snnnRRLSGoaJJayuaJremkiaoRsheoNnJdMrs Kemp Frederwick W KKLLKKKKKKKaaiiniiieennmnnmnmnniisgggagdnbbearhhrerydrWitteLdcHwykeGNBGaCvdaEKaaENEeLtrWndhloliwaHlaEayndnAMLrs LLLLLLaaaaaawtnntnstddicsomaonsnGoMtreeCeGaorhtrtTaJiaTesyJEMrs LLLLLeeeaewwwyfffiiilissseerlFdBRJreaMrHnTthcaaeuMsdres Mrs LLLiiivggihhnttgffoostooottnJEaKlnleainete R Mrs Mrs LLLLMMLLLLMMLuoyuuooouaaaanwrknnscknhdddtdekddenoddeeyyyyenoorJtexxJNCtGMLAWEhLRGNWneaRASllnraeVvWLlitniiehneMaMnDrsrs MMMMMMMMMMMMaaaaaaaaaaaaytststtrrrrrhhhhoottcssiieeiihhnunnnssCwwaasllaJsGsEllCRWrLrelhWHoJGooOloiaablulleslWtaiCyRsdeMMysMMrrss MMMMMccccaMCKIynnoeitlcanolhrunsdahmoenlHCAHWennRnriEyJe M Mrs MMMMMMMMMMMMMiiiiiiiiicccemmffddlllMMPrllllfddeeiirlsshnrillirruooneetelrtCnttErlJCrHooassilLRlnnsonaebWunrTnJeEeJcGnrLTrnisyotSlecteJoeaeOllLlliee Mrs MMiimngs IKlaatheryn Minor F L MMMMMMMMMMMMoooooooiiooottoooooodnnnccrrrrrrehhttteeeeeefffneeoooallArrrOVllCDNdddNmilJeaToiTedfnWJoSlfanJasWoanmornLeddtWyFte Morrell C W MMMMMMNNNNNNNNNNeeeeeaoiaoooooousllww-sslrssuurrssbSahrhelrpoolnbteeinimstohsnnstyoytsOneWniOJtCyMBLSWlMhLapiCNaleMNhaBailFSwhMinMrereVtayaniAlhsiarrioa!ealetMinhHeaa HATCHER Bl McCRARY. INC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Bhone 6186 McNair Lumber & Supply Co., 266 Fifth St. 1935 Macon City Directory 728 Macon Bottling Co. PHONE 3 2 6 6 Signature Only SAME DAY For Reliable Salary People Macon Trading and Investment Co. 220 Ga. Gas Bldg. Phone 298 Phone 1400 Everybody Reads Macon Evening News, The Macon Telegraph Factory Distributors Paints Varnishes Brushes Wallpaper Schall Paint Co. Inc. 307 Mulberry St. Phone 326 The Letter Shop, Inc. Complete Direct By Mail Advertising Service 563 1-2 Mulberry St. Phone 4521 A Trip To THE ENGLAND CHIROPRACTOR Means a Start on the Road to Health NNOO'auyCthteoaslHnleEirlJlCRTFhaasrmM Odell S L Odom N H OOOOO'gllsiNmblveoeestartrrneleaeePHdLRCTTu*OthC Mrs OOPPPPPPaaaaaaxwcrrrrtlnedtkrkeeyieeessrnrhsNWLWoEFnWElBrLlPaaAHnMnknrise Mrs Patterson C B Patterson C I Patterson R A Mrs PPPPaeaeeyyrkltteooirnnnsWCJAahHsnansie Mrs PFPPPPPPPeeeeeeeeerrrrrrrttksmtrrtrryiyyyoyisnemnnsELWsRWatienWlEWlrIHiJeGJGEMJLrs Philson Lula PPPiiiennrekcysetoRCneosuCtratClraraniemd p PPPPPPooooiittoopnttmslleteeiaaAJcnPLnioDCzJYzoaisiereyphine PPPPoooowsttttteselrMl JEuCDlvhiaaansMMrs Powers Blanche PPPPoooowwwweeeerrrrssss WJNN BFAA JMrrs Pratt C O PRRRPPPRRRPPPruurrrraaeeaaiiiiirnrddbhydmmttcscscddumeleouhahiineFlnnamselyeJlggnontBtGettSroJMJeCuWuWLaEMnieaoEcscaroskaeyleTtHrstiMpyeeoprnresB RReeeddmoMndackJ H RRRRReeeeeeeeeessssseeeee SHAASaaearmMsraothenr Mrs RRRRRReeehhiceeeoyhvvvdmaeeeersssesdssTAEEoEnnmdBlnimizJeaitMLt Mrs Riggins T C RRRiiilnvegeWyrskCEidsuegHeMneonumental RRRRRRRooooooobbbbbbbieiieeennnrrrrsssssttossoooonnnnnCJJEHoDLoWamiaslllthAmitCeieaLoJBr RRoodggeresrsTEdSwd RRRRRRRRSSSSSaooaoaaooooaumnnilnksuzssslnssssidddeesmeteenreeecrLElEorrrllsssWLaonWmCiuHsSaFrAEomiusrAnnPHaeMJrCignatohtilLyiealenLed SSSSaaaannnssdddeeeerrrrsssBWMSHaamLryi SSScccoootttttt EWCaCrCrieMrs Schelings J M SSSSSSSSSSSechhhhchhhhnhheeeaiieoentrlfnrrurelwrfihltensisileoenyltoohrHellgoniWdsrrdJSeenrToEMREJMolJWauWngRHVeeyNne SSiimmmmoonnss JFersesdie SSSSSSSSSSSiiiiilmimiimmmmnasnskptkaicmssmetlplhlraewDooLFiMynnSrAorssoaoFRREpndPDJMhkMniRMJaoMrEtstrHiSse Smith B B SSmmiitthh DDaannlnie C SSSSSSSnmmmmmmipiiiiiittttttehhhhhhs EJELMLPrieJnanwLLrekiiseiset SSnoloowmoAn WM MCrsMrs SSSSSSSSooptttttaaaaaruemllnrnetelohlisrypewnwbysguGeJsrlLePFylWoHWCHOCLMHL rsMrs SSSSSSSSSStwttwtwtuteaeieenrvaatwawwrisnienoenoaaa.nntnrnrrtsRdttGMMDWWJEuRoPaisadlrssustdyWtiidMieeiDeoeElapMMyhrrss TTaalnlnenetr CMoTllie L TTTTTTTTTTTaaaaaaaaaaapyyryyyyyyylllllllllllteooooooooooyrrrrrrrrrn AEGEGNCJJGDnallueremlsoeSlMyaolieCgWadJAhearMWMrsrs TTTTTTTTTTTahhhhehhhhhyreiooaooaogrlrmrmmmmyopppHreaaaaaeeensssssPTaASElhDJJJEQtCoeanntiCheolcoCsBedkCeloyotia TTTTThhhhhooooommmmmpppaasssssooonnnRMLGaGOtiutziyWzeJireMMrsrs Thompson Wm H Thomson S E Mrs Thorpe Emma TTThhhoorarrppshee STPahareuavlhdoAre TTTTTTTTTTTiooioiorrhrmnniaaowllrmlslkwwlemiilleevvpaeeiiroeeccsyltCetrnrkkHsWCREARJWCNloGLmJMbDCeMRrtellrMrs TTTuurocrntktaeegrreEBRdFwubdy Turner Amos Turner Mose TUVTyusasntnteedlreriyveEPKrlasauJitelieMBB MACON, GA. J. W. WILSON ELECTRICAL REPAIR SHOP Repairs of All Kinds--Electrical Machinery Motor Rewinding and Repairing 0 23 WALL ST. PHONE 373 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 724 Baldwin's and Telegraph LOOK TO STERCHI'S for BETTER FURNITURE VALUES A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 Mulberry St. Phones 946 and 947 VVVVWooiaarnnrgdnilLneeTryioeJbnLLeeilHlnliRRoeHlt GW Wadley R B WWWaaallldddeonJrfnoWJ SW WWWWWWWWWWWWaeaaeaaaaeaasllststlllstldsskkkllltheeeeoosreeeiryyyonnnrrrnHgAJ&JTCtHHCaWaoohlmFhsnsiCufiaAEpfeloFrGaliuey WWWWhhihliiibttteeuernBRReoJrLbtthTaDJMr ae WWWWWWWWWWWWiiiiiiiiiiiillllllllllllddldlkllllliiiiiiiiaweeiaaaaaaamnrrmmmommmmsosEoEsssssssdn,HBABLCKBHCPWeeinaolnrnHlHnJutyrihnleyVtaarhyMJrFsarm Williams Thos WWiilllliiaammss WW LC WWWWWWWWWWWWiiiiiiiiiiiilllllllmrmnnllsllllasiiiiiccobfsssbnbhhnouuguJeerWRCssshdsshhhMEaotteemyFHEFrraDQrrRvRoauPAJinriaoenniksbsrMcrtyPyrBs WWWWWWoiiiiinnnnnlfndndshohMlSnaJpmiamHrNMionuoAnlrretchthta WWWWWWWWWWWYaoooooyoroortiioomoocerrrggdssthltsdhhhfmehheronattaauJWarnmmHfkDcCGfEkeueRTIDAnSoWlsColJraeyMbrWMMhniStaaBWrrhsssMrs YYYYooooueuumnnnggganMJCs aAAmTllieen C Young W H Mrs YZZeaolculknnaegrryWFWKE CMrs ROUTE 2 -- w of city, reached via Columbus rd also Forsyth rd n of Bellevue AAAAAbbbddeeeaallrmmcLJrssomBEWHbrniPeesCt T AAAAAAAdddddddadaadddmmmlileenertssstghootonnOoJKlntlaaOBJJtAiWeDLRPG AAAAAAAiikklllkkdeeieeexnrxrinnasadnnIgWrDdJdeaeerrCOHDPJJEAC Alford W A AAAAlllllllleeeennnn AWCOlbWGeGrt AAAAlmmlllemabysraoonJnseAWDPaCuLl AAAAAmmmnncdeeeherrrorssiscoorosannnnWGFBNeoACnSv Wks F AAAnnndddeeerrrsssooonnn WMW GNGMrs Andrews C F AAAAnnnpdndprirlseeewwwMhss iatSOerytAiJsJ DD Argo T V Arnold C M AAAAAAAAArstuuuvvuhnhllsaatototlrtnnmmeiynlnttdyaaEMnnGJEIHuselgGaDoCiMrzaektrnceuWRMedrSes ABBaavbielbreyy AWHaKlLl BBaaiilleeyy JS EE Baltimore Jesse BBaannkkss RWilLl BBBBBaaaaarrnprfdaktieietsstnltatdonAJSCgtlRaynMnderEdsesard BBBBaaaarrrrktktlleheertutttrHsWCt TWRL C Mrs Barkley R T BBBBBBBBBBaaaaaeaaaarsrrrauttunnnnttkcgmlseeeeehehssssrgcHvRauMHLiCMrlmliteaaLeznHornmzserrLieiFrieyee S C D F Bell O B Bell Julius BBBBBBBBBBBBBBBeeeieeeeieeiiiibnlrrllgnnnrnnrillddbinkignsttnonsoooaneRMenognnElnreTJtnsstrlanoglZetHCVFreoaJmFcyJafiETvfCLGCAiFSEaoMEMnamrLs BBBiilvvaceinknss MME aEOtildMars Blassengame W B BBBBBBBBBBBBBBlollololllooooiooouoolgalslaglsoooeaulsngtaisnmddmnnsorWdwwEtgtOmfTaiedFooenLeEArdvrrlrRdBttGeiiWhhMelVJDdeoaSCDGWBcerhPyo BBBBooooosuwtktodwenerenlElNLueBagdeuennraeF BBBBBBBBBBoorrrrrrrrioaaawiiizdtttddoyetttlgflkmeeeoWssJJysaJrdnJiPElJMTeWCREyPAHliFLnor Brooks P W BBBBBBBBBBrrrrrrrrrroooooooooywwwwwwwwxatnnnnnnnnnonJLWICWEHMvHdyWimaFAliBrlttRhin Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY McNair Lumber & Supply O., 266 Fifth St. Phone 1400 WSS Macen City Directory 725 Everybody Beads Macon Evening News, The Macon Telegraph LEXUS PLAN TtoUR NEXT ADVERTIS- ING SALES campaign FOR YOU USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston, S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry St. BBurycahnatnaAnlicAe BBBBBBBuuuuuuucclrrrrlckknkkaheenerdttteItttcrJeeeoMSKWTsu&aasutiNRdeeCoal Co BBBBCuayuulrrtthldntesosruEnWCHaarCllHlyoFway Calhoun E J CCCCCCCCCCCCCCaaaaaaahhhhhhhmllunruaaaaeaallsnssoommpempppweeovwwppmbbbyybeeneeeaaeelalsllillyyErrnJlsGssAsWuRVHMLEPgETVWEeeodBeTnTJnRlEgrleriMnaeyarrs CCCCChllllaaaaeyrrrrkkkokCEOReeHHPEPharm CCCCCCCCCCCoollllloooooiaeiblnlfoneymueltbntpgiomdtneeeeenTslrnarTJntAWEsOECJWlEEbmaFGSdreCrdrMiLtieersB CCCCCCCCCCCoooourrrrrruaaaauxpprmpwwwnmtpeemseloTfffpalooociinkWunWrrrdEEdddsgsJATRHJWFMEoJJFtbEhMtel Cummings Tony CDDDuaaairiirrrryyyy RFARoonivusdesrrresLwOideaeeks Dame Sam J DDDDDDDDDDDDeeeeaaaaaeeanfanvvvvvnnnonnniiiiinnissssrseiiaaesslWrrsKLBWLddBJJuaiVtEcSlDFLSiBliCeilreEJginia Denson Gus Denton Martha DDDDDDDDoeiieooexlndswnolomsdtaronbalaundeRonrfJrGWnyWLFHoiCroGleGlpdeena DDDDDDoyruyuaererrwcdrsheEhnRJoJnrEWnoMRWO N Easley Florence Edwards E J EEEEdldidswwnereaarrrddJFss LRJLobRt C EEEEEEEEEEElllllllmnttzllllllhhiiiiidiiooososseeewoorrttrtyiinnaHWddLBJrggedDOoWeensyJTaWriciyWJRlsBeleyiweeJHMrerrly Evans C P Evans R R EFFFFFFFFaialallvaeeeeuuryelwttrlldrcckkaeeehhGrtlreetleWCeyrroMPneVWLRJRtJJueeCkrEset Flournoy R B France E H Franklin Laura FGGGGGGGreaeeeieyloteotrbseemrdreosggernaeirtManLdyJCOaoSemcesWJkJWaieetEfofnND GGGGGollloeoioesdvsdthteeweirnlilnTHSAeJMrEmCTan G GGGGGooorraaoroccdddeeowwniiAEnnWKBDRauFtteh T GGGGGGGrrrrrrreaeaaaaeehdhnnnryaatt mmCGAOCeoRHoAEGlqFJJuitt GGGGrrrreieiffesffhriinnaGmWAGREDOJr Griswold Ben Groce W T HHaaldeenJ JCA HHHHHHHHHHHHHaaaaaaaaaaaaallmnrrnnrrrrrledrprrrrdnneliiiiieissTsseamlJnrrWGaACEEHHCJMnOalheWlAELLaxkaCLrseier L H Harris H E Harris J A HHHHHHHHHHHaaaaaaaaaaarrsrrrtttttcrrcccctrtklniiihhhhhiesssneeeeeeoysrrrrrnLWsMToR*WTMGlJTaaGeCriaAoPjlrTloJyrEMie rs Hawkins Henrietta Hayes W E HHHHaeaazayyedenlseKsLZaWtiJDe R HHHHHHHHHHHHiieieeieoioolgxlgarnrdllgtoghrlrotrggiiihnitynJnnnenaogsrswCEGBdsEHHweWGrJBAOoHJuHrTEstOMhoJmrJrs W HHoolllmoemsanC ARV Holt W R HHHHHHHHHooooooouuprrwwrwgfnntfkhoaaaebienrrrnuBsdddscJkaMBEGBHGlseeeeaesorrHosAinoiiencPe HHHuuuntncttheenirngVHsiocwZtoearlrpdhia Huthrance F A Mrs Hysler Minnie IIIIIIJddvnrvavlleegceeiyykrnasHHmoRCWonoiucuRJrhArJudnNdCnguileuersbery JJJaaaccckkksssooonnn MRFuraefruyds A BUILDERS LUMBER COMPANY LUMBER AND BUILDING MATERIAL Office 357 Cherry St.--Factory 130 Cherry St.--Phones 467-468 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 <126 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMHLETE" Phone 402 522 Poplar St. JJJJJJJJJJaaaaoaaaaammmrmmcmhrrroneeeeeeeebslssslsssosnMWBJCJMMDaAHoaWaRLrJrsynieDle H JJJJJJJJJJJJJJJJJJJJJooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnsssssssssssssssssssssooooooooooooooooooooonnnnnnnnnnnnnnnnnnnnn EFEALLCECJJLJJMREJMEFmaeouuullrdlaasfHBeaClctTEaJamLfgnalrJrineayndaLakdyr aJL JJJooohhinnnessrotonnDZaJveW Mrs JJJJJJJJJJJJJJJJoooooooooooooooonnnnnnnnnnnnnnrreeddeeeeeeeeeeeessssssssassssassnnAAWJHWJEFFHOJSnaalnEmrEzuaosoasnissHdtMmerCnaittieHeiHekaelleM Jordan J A JJJJKKKKooooeeeerwsrlemlddelsleyayaeiprnnnysgSWCaWRMRLhmilaualsHSctHtiilOee KKKKeeeeynpnpdt WlreiEcrkAMAA D Mrs KKKiiilnnlgegn WRHeeCdF KKiinngseyWSilliMe LKLLKLaaaainntwmnicegihreayheerrntnCcLsGJeeHAMoEHliCMrs Lawrence J W LLLLLLLLLLLLLLLLeeeeeeaeieiaeeionnteewewwwowsaactdbtlrtnkiiiseeshEBysesssaAeoorerrtnngyEndtEBWAMJGJeneeWnrHiFBJfsCeMMnMSfBasHiinFeBrLreHssnGie LLLooopngegamn JaPn SAF P LLLLMMMMMuyuuaaaaaoncccnnrranalecsenesshuriynasWWRlRgMMlEuoDBbAaJmCsyyeomErLaa Marshall J B MMMMMMMMMMMMMMaaaaaaaaaaaaaarrrtrttttyyttythhhhstttttinnnhiihhhneiiinnssaasaeeesawrrrwwwldddslJWJCMNsssinmMaWDWoM.CBAMnLRacianvRlybLFCldeieerlew MMMMMcaaccAyyCCssfaleameJnWynaohiJlJal nCRG A MMMMMMMMMMMcccccccccceGCCCDECSKEanaooowlorlirwmselnmnnoalrnnulayiumyAneemlJrdlyorvlHynJJMaSACnRLoHJHFO MMMMMMMMMMMMMMMMeeeeeeiiiiiiioioddldmlneenaaerblankddcskdnnoetltseoeesllrselssreerenryJbbbRWBCCMFMRrrrWJMooDoraiaaaoooMrBnLrAeeTslnkkknylb.kssvsiWseMitKnAHeHirrs L H Molton H L MMMMMMMMMMooooooooooloonrrrrrntrgrrrnrsotiiiiegeaysnsssenoLsmJRJEPTioCleteDlhhRarMaAineyeirnFlliLsJ L Morris Vast! Mosely W R Jr MMMooosuulllettyoonnTLoEmdDw Moulton T M MMMMNauuyyslnerhlirnicsskJGJJToePohJEnRO NNNNeeeeewwadtbbleyeCrlrLBnygAHLCoorCeona NNNNNiiiooxcxlmhooaonnnalnsMECDJdladArWiWeence Noonan M B NNNNOOOOOOOOodoucd'ddu'gNQmewsuruultreltommmeuleiiutnaneilrlnllegAgneJAMeAGJB'esuJenaBLA,osuJnSPtdBieaeSelnled Co Orloff T J Owens E S PPPPPPPPPPPaaaaaaaaaaagnlrrrrrrrrmkkkkkkkekneeeeeeeeeCrrlrrrrJrrloeHBCWALeCTMPnhHPAFnoJLisSe L Parker W J Parrott Claudia PPPPPPPPPPPPPPPPaaaaaeeeeeeeeeeettyateteannanrrrttttdklrkrkntndeedeeecluiierrolrrenenessssAeHcrSsMtoosookJouCtnnnnOaOnaWgCTmLmSsuETDeAGcCcaesRilaMhelitnselElaruDaonasucriegdeiiiaa Shop At SEARS and SAVE Sears Roebuck and Co. The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate! McCLORE OFFICE EQUIPMENT CO. 860 Mulberry StMimeographs and Supplies Phone 903 Phone 5036 McNair Lumber & Supply Co.. 266 Fifth St. Phone 1400 W3S Macon City Directory 737 Everybody Reads Macon Evening News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. 614 MUECKf & SONS CO New St. Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures Phone 636 PPPPPeeeeetttrrtetrriyyyrgmrOeTJawnDMLJJ NT PPPPPPPPPPhhhhiiieiieeennietiirrrllltkhnmllcccyeiioieeeppxrolySsstsnoNJtJenAJCErTAANDPHHDDFH PPPPPPiiiiiiopnttttttpkmssiNenarJCotnonEhEnaavAsaGROLroACo PPPPPPPPPooooooloouwowpputrntlteereeeeenkllrrlGleeJHltelLtFCPeErortlBRiratHRsuhMrcadoeaiGregtlstleiaMer rs Powell Gladys Powell H W PPPPrrrreiaacsttetotornDPWoM!WliaeMry PPPPPPPPPyyuuuurruiillrrcccnceesvkkkhscslieeeeeestytttETttttASRFSOlCOPfTrteiDOLsMd rCs RQQauuciicnhkneellKDAaotciFeh RRRaaaciinnheeesslsTGArMo CCo RRRRRRRRRRRRRReeaeaeaaaaaeaedeewdlnwmlayayeedvkgmdllyyueseeosCTJossnsLlonpAJHLoApBFdEhWEiuagLiAylJeFsJAlWeseMasbnrsnmieer H Reeves H C RRRRRRRRReeeeeeeeeiyyniiemiddnsnnvfeeriooenorMfCsllegddlltAssdJJaoJurnRJaLlWiaJWDMC RRRRehheyyiimnnneoossllddSAssamWJSusLie RRRRRRRRRRRRRhiiiiiiiiiiiigcdcccccccccoeeeekgdkhhhhdslieaaaaeenCtrrrrKJCsssddddnGoLhssssHoAenoaooTKosennnGBHnJCEreJRVinreLetothWsetaateaC RRRiiilttecteyhniebOuMrRyLW H RRRRRRRRRRRoiooooooooovbbbbbbbbbboiiieeeeeeelnnnrrirrrrrssstttttttssssoosssoDoonnnFNannATWirBrWSlaJLyIleanJedRnlnkAalHileiJn RRRooogqgueerressmoLLrueeWlJla F Roquemore J W RRRRRRRRRRoooooooouosssssssssbssesssessimnnWWgWJREAaarSnoedmDbeaCMENWent sWVH J Rushin Sarah RRSSSSRRRRSSSSSaaaaaaaaayyyyuummmmmmmnindmmttllldooeuuspppfaaeeerloreellnnsssdfeerollRddusdMssJnFrBSFEKaElSSTaDFooJJnmucaiyadEsHhsBtImdyyWeieeMMsJrrrss SSSSaaaannnnddddeeeerrrrssss CCEElsisBfCife SSSSSSSSSSaaaaaaaaaappnnnnnrnngppdddddddefeeeeeeonrrrrrrHJsssssrstdWMMJERWHWeJlasiazsLlMRglLitereeMrnrs SScahrgaetznmt aWn CH SSSccchohnumylieedrrtsHJGMErady SSSSSSSSSSeeececceeeayarssrooavusswlrmttsiiettcgooeloyglnnlGLFulsssJrJurWaaHWlRTJmanTkeNVJFLs Mrs SSSSShhhhheeeealflfrllffpyyiieeellJdMdMamiClClCeioeslE SSSSSSSSSSSSihhiihhhhhhhmkleyieieuivueennrlpmifgsllweuhfpdyIaoosorosaArrnvClMortdsCsdidJenMFourDCAnMFlAirLSWaoNDieDTllie SSSSSSSSSSSSiiiiiiiiiikimsmmmsmssmnikkhsngssspmponlssFnWeDoeooOCFstrnrnnaelaasMrEidEnlvLylLBLneoLEreiwaEOenKuasortyreaalle SSSlllooapccuupmmy bbTGSJoLphia SSSmmmiaatrrhtt ARSraatlnhleiueer SSSSSSSSSSSSSmmmmmmmmmmmmmiiiiiiiiiiiiittttttttttttthhhhhhhhhhhhh FCLJCHTNCMJJF.liauoaaomaWrDMlBnFnrrmlaaicnnciyBieeee L SSSnmmeiilttlhhgroVWvievaMG W Soloman Sol SSSSSSoooooorruuuurrtttteehhhhlleeeell rrrrWnlJaMWnACdJGdFvSaSmeirv Speer Geo Speer O V JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 728 Baldwin's and Telegwp*'* LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 SSSSSSSSSSpppptttpttaaaaaliirrellllnnnoallelsefefufwyyooorrsbssAorrreeddMdrrJJtrJhMaByOOAEralRtrAlJhapieatAJLPeueb Co SSStttaaannrnlteoeyns IJC GNH Mrs SStteeepdhenW OT E SSSSSSSSSSSSSSSSttttttttttttttttroooeeereirruuorolooiokwwwkwkbbnlcnuwzueeeebbkgaaaaidsssdsseel:rrrralttttrSlCJTnJjEEWaJLEWdSPlmlCiiBFCSiamzzzmBEAzEFmieaG SSSuwwlaaliiivnnanCJ TCR Mrs TSTTTTTTTTTTTTwhhahahaheaeahlpmonoanoyooaibfslmmnmmnlmrpeitolpereeylaaaaardererysHssssSWWAIZAeOBFJAGneliolLuiIelebbrrrlenxHAoitseeheiretTurttaarl Home TTTTTTTTTTTTTTTTThhhhhiooiiiioooordddddoooooaoooooowwwwwmmmmmclllllleeeeeeyeeeeeppaaalllllsslsssllllJFFOLMJoolrALLnMnRTLToyaWWEAruarnaetJRCcuEVEkiJrnycryohceayaLeEs H TTrraawwiicckk FGreaonkVlin S TTrriicbebleRlJngBold TTTTTTuurrruioocccmnkukkcebteemerlrreaCtFn>GJ CWHMTWiMzars TTTTTTTTTTTTTuuuuuuuuuuuuucncccrcrrrrrrnnnnknnnkkknkeeeeeeeeeeeiesrrrrrrrrrrrronWARJTJRHJJLSoaGEMSEJWHmOMrHmdAMwMaMJrinrnssark TTTTVyyysnnnoeeenrrr WHCAnJOnMie A UUUUUUVVVVVVVVVnnntaaseaaariailnnqsdrinldrnuneoenesmcueedgydzonnroerrhihaiynwtwvnngnianLJetnrSoortiAreJJtoocfeMDofCHhJddJhEoHOEnMAsEFGtediPnrCinthie Vissage T B VVWWWWWWWWWWWWWWioasaaaaaaaaaaaaaltdddlllkcllllllledddkkkkkkkeelteleeerreleeeeeeroolynrrrrrrrrVJnnLMWJGWWTCMAEHDNJeHalvlRaoabrRMerHBMyrReylayrtMnaEJrs Wall H H Wall J R Mrs WWWWWWWWWWaaaaaaaaaarrrrrrrsrtddddderrrheeerimnnnnWHEGLgamWTtWnoWVEMmhnmoJAaMsGEerTNso WWWWWWWWWWWWWWeeeaeeaaeeeeeebbblstlllasttbcllcsekllbbbvssseoehhriteysnyneRrEMAJsrJaSORoLuCRamaPbgJiDTsrlmiyMeecelmWiAnraGsetriEaaMae WWWeehssitttcMhJoearhrngJtEGL WWWhhhiiittteeehMeAaaldircyeJiEm WWWWWWWWWWWiiiiiiiiiiillilllllllldkclllllllliiiiiiiihesaaaaaaaaremmmmmmmmrJsssssss.SsGiNCHmJGJJAIahsWonmPaDaEWnnsaeicesLHL WWWWWWWWWWWiiiiiiiiiiilllllllllllllllllllllliiiiiiiiiiiaaaaaaaaaafommmmmmmmmmrssdssssssssoRLRWnLMMVOHieisnoaaLAYCl'crkltrmtateihrAeaaS WWWWWiiiiillllmslssiooosbnnnuHsJJhNaWrJErCydSMrs Winn W M WWWWWWWWWWWWWWooiooooooyoyyrsoooioooooocnengddddddhldtnnhfesssseroAntooouMTlJEnnJnkfmPOfaCdaDrJCEPMOiJEyntWBhsWdaWWcaralirn YYaanrbcoyroRugAh C A Yates D T YYYYoaoatteeeemmssaannFZsreSDdSamR S YYYYYooooopuuuupnnnnggggSCHLaCmillaTlLirMaennce ROUTE 3 -- s of city, reached via Houston av AAddaammss GLuBy S AAAAAAAAldddkdlkdladaikrernimmnliidesndgtsssgRoeWeniSTBcTOhRPJhdMFaEEd PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 76 c. w. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASHS For Your Car $15 - $25 $75 OB MORE AUT0BANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from V. M. C. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 MS* Macon City Directory 729 Everybody, Reads Macon Evening News, The Macon Telegraph A. S. Hatcher Co. Wholesale jt Automotive " Equipment Replacements Tools Radios 596-598 Third St Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 6179 CLAUDE TRAWICK GOAL C0., INC. RED CARDINAL, SILVER OTAR COALS AND COKE 201 Edgewood Ave. Phone 59 AAAAnlnntddmdeeearrrsnssooonnnC GSFCrPaEnk Andrews C W AAAAAArrrrnrnnnnndooooorlllleldddddwsEAHAJ SHMAAJ C AAAAAAAABBrarrauturunnnwncilllloootttooeammmlllnlydtdddeaaarnnnJWMRRJRJLLATFTJHW'EBL BBBBBaaaaalilkkkrdeedcwrroimJnJJ JLJMSMMArs BBBBBBBBBBaaaaaaaaaartssstrtrreeeennssttommfmleeeinsseDDaataltnnndEJWREAlERLRlBaOLEECF BBBBBeaeeaaaxatsslclloelheynayPnJOCRWlWiMntCon BBBBBBBeeeeeeecnddcankktddnnyhiioennartJggHtmffJWiiFoeeFWellddCBWWMMrAs BBBBBeeeeenrrrrnkrksyohhnneaeJirrmdJHtEerGDLJaWck Mrs Betsill C N BBBBBBBBBBBBBoiooioooorrroslaaaloswwnlwlhdtiddntndooniemmllletcanpngeelkneaaJyysWnnydlGJPeCWJJyJGDJROTLADBLWDC>GMGrs Braswell Ernest Bray Thad E BBBBBrrrrriiiiiccggteteggi;csskMWMAWGOWRR Brooks A M BBrroooomkse EJ HJ BBrrooowmne BRettPie Brown C M Brown J R BBBBrrrroooowwwwnnnn NOJPimHFM BBBBBBBBruurrrrroyyyyyrrwgdaaaaaeennnnnnnttttt CTLLAWJJ EHMWHWWS'MMrrss BBuurrnnheattmARlbEertC Mrs BBBuuurrrnnnseettttJ CFCinIger Bush J Li BBBBBBBCBBauyuuuuuuulsrtsttsttdllldtthhheeewsseerrreeeGRGRlWRJlONHSEFDBLCEaMm CCCaaalllhhhooouuunnn JJL WCB CCaalllhoowuanyRWD AMrs CCCCCCCCCCCaaaaaaaaaaammlmmrmrrrrlrettpyopepepppyelrbrbbbnlHeeeeJEtFJlllleJlalllrArWWLJAJrSEyMTOBWG CCCCCCCCCCCCClhlhhhhhhhhhaaaaaaasaaaraanritmpnnnppppkcseccmcmmmmtelpieeelaiaCaaaaaoWnwnnnnnJJJnCJMWSALCFRTCGAuPCLMGBbEyrs CCClllaaarrrkkk HTJnoomH CCCCCCCCCoooooolllaeallglklyllveergeiikmmeeerielrrnJaaaHnnnAOJJPdTSBHLOMCei Myomlloyur CCoolllliieerr WWilLl Collins A J Collins C G CCCooolllllliiinnnsss JJC WTG Jr CCCCCCCCCoooooooooxoopmrwlwqnkpeaaaueWleanrrlirtiFttnotdGMBuJSTsSeaeEosmWCsAiWCeW Cranford J E DCCCDDDDDDDDDDCDDDrurraaaaeeaaaaaaaaiaavwwvaavvvlnvvvvsvwwnnpiiiiiidiiessssssssesslllnooreeeJptnnHJRJWyyyRHJJoJoneoErBWJKaWJnJAbPtEJLmlirtLtmGyeWNeCmowMruaiirsHss DDDDDDDDDDeeeeeeeeeelnnnfanannkrnnttttnnoaaeJFOLRrrMSaddruaJsrotmoMiLhEreDeeieaarSMlvidrs DDDDDiiiiixxxxnoooknnneLnsEMJAvHJaJ E Mrs Dodd Thelma DDDDDDDDDDDDouoouoouorouidwprrrrmrrnssosdmrsrknneeeaeoueeaayyyssennglwnlhCADMRJAaEJOayAadEsBBFJrwEyEEBdMMErsrs Durden D B DDDDyyuueerrddrreeCnnC JAHWLF DEEEEDadddyyrwwweelrryaaarrrSdJddMsssoEFHClTlieAJE Jr Elkins T W WILLINGHAM SASH & DOOR CO. Manufacturers SASH, DOORS, MOULDING AND MtLLWORK Store: 457 3rd St. Factory: Cherry Si 7th. Phone 278 Phone 156 Plymouth De Soto--Yates Motor Co.--Packard--Phone 1445 784 Baldwin's and Telegraph'? LOOK TO STERCHPS for BETTER FURNITURE VALUES TOMLINSON PAPER BOX COMPANY PAPER BOXES OF ALL DESCRIPTIONS 513 Oglethorpe Phone 4936 Ellington E D Elliott W C EEElmmliebsrrsyMonJaeJHaMs rs English B W EEEEEEEEEnptttvttvhhhhhgtaaieeeeennlnrrrrrissisgiiiidddddhggFggDgJeeeeeDWDFoCJRHJrlaaOELrCence EEvvaannss JFaOnnie Mae EEFFFFFFFFFFFFFFFFGGGGGGGGGGGGGGGaveeaaveoelloururraaoaaieieeiaieioeorealuyrrlaxalrlbbblltrrrntnlnnwwgnswreigedllbnnlsssseddslndeeskttdnttumiihoeososoeHoyrrsrnrnleTmnnieesrnayynayynrBrootFeeagtohyrsCntmLaRddLrrnistFrnoAdWJHnClFHCJorGaCWolWeHrreJFHnlenLCJxFenJaMroiDJcCLSgeidkJttLauyFiNeHotCLFPhhEElDnFidtBneehtWnopeMiGner rs GGGGGGGGGGGGGGGoooooooooorrrrrooaooaooaraarrrdddhddnondyldndsooowwwavrnrttbnuunnmitRyiiilammnnWAnlAJGeSJCWWTHneEIPaCAaodnRSmasia.CuTsCeTMileaMrsMskaeirs Grayer Woodley GGrreeeenn TJooem GGGGGGGrrrrrrriiiiiiifffffgfffffffgiiiiiinnnnnnerCsBHGSMRWCCFCEA GGGrrriiigsgwggssoldEJ JTAB GGGuuulnnletteedrrgeBAGlnanniAcehMR rs GGHHHHHHHHHHHHuauaaaaaaaaaaamlmdlnlmmmnmmmlllattmllllellellwWiiiiiiiiLrrnnnnannnnanLTyHAJJFHJMJReLLRsFLBAWHsGBrYMiaet nrsWk HHHHHHaaaaaammnnnnccddmmoolleeccooyykkcckkRWLMHoWaDuHrsyWiTa Mrs HHHHHHHHHaaaaaaaaarrrrrrrrrdpddpppppieyyeeeeesrrrrroJWnKWWAHJiWHnHHgDWGoHmer HHaarrrpeelrlt CFarreride Mrs HHHHaaaarrrrrrrriiiissssoonnJL JBTJ CF HHHHHHaaaaaerayywrttdssltehTyGoSJrnHRWKLe GW H HHHHHHHHHHHHHeeeeeeeeeeeeeganaannnnnrnrnnrrrmddddrrrddddydyyeleeaeoorrrnysWssJJnnJSJopooanWnFnHFHBWmsJreJJJTdnGHooLPrdon HHHHHHeeeiiegcrwrrnkgrreiidsentlroalgsRgnoAeanJWyWmMTJWoWnMd HHHHHHHHHiiiooiooolllnbdllldllellbggoosRCWseewmssRaHiaNRlCyTnol bGJGZtJ TC Holloway Mary Jane HHoollmmeess BJ eArnice HHoollmmeess ML MN Holsey E Holston Dallas HHoolltt MO amPie HHoooltkeTr GH C HHoooovkeerr WC AE Hopper C F Horne D W HHoormnee EEugBene Horne F H Horton) W C HHoouwsaerrd BHeaurlaryh Howard J C Howard J H HHoowwaarrdd VObiFe Mrs Howard W H HHoowweinllgtJonPL M HHuudbsboanrd ARJFH1 Hudson B G HHuuddssoonn JE MN HHuuddssoonn OR HB Huff L L HHuufmfphLriePs J C HHuunnnniiccuutttt EJ vFa Mrs Hunnicutt J W Hunnicutt W S HHuuntcthiLngsBV R Jackson Andrew Jackson C C JJaacckkssoonn JEdHgar Jackson Jessie Jackson Jno JJaacckkssoonn OSoMphie Jackson V L Jackson W J JJaemffeerssoPnauAl aron Jenkins H A JJeoshsnusponSHJ T Johnson J E JJoohhnnssoonn MJ aOck Johnson Mary Ann JJoohhnnssoonn RS AA JJoohhnnssoonn WW MF Johnson Willie JJoonneess EAugHene Jones G J JJoonneess GH LB Jones J B Jones J J Mrs HATCHER & McCRARY. IHC. Business Property--Sales & Leases--General Insurance Surety Bonds--Loans--Investments 508 Mulberry St. Phone 6186 Macon uMr rs SSSSSSSmmmmmmmiiiiiiittttttthhhhhhh GHHJJML EOTHMEF Mrs Smith Martha Mrs SSmmiitthh) WO FA SSSSSSSSSSSSSmnnopomtpttttaaaaaeyirurivhillnrnludtttelleelhhlhlcweyeleeyeelJryyosWrWOrRLTWEtWMHFhiilODcalWAkinCLHRRenieL Mae SSttaapplleestonHJGT SSSSSSSStttttttteaeeeeeemrrvvvvvkceeeeebhennnnnrisssssidJEgCLMSAeuTonMrMEDaiGceMLrs Stevens W T Mrs SSSSStttttoooookkkkkeeeeesssss CCGEH WWWYE Jr SSSSSSSSSSttttttttttooooorruruiiikkwvrbbpppyeeabbelllssliiislslnnnlEgHggJGJJAoHGJSTeFRJWPCAF Mrs SSSSSStuutuuuulllmlblcliiikbvvvmesaaaeynnnrTRJHJTPWWLEJ Mrs SSSTTTTTTTTTwwwaeaaahhhhmmyyyaaaaaeellmlmnmmeappooonstllrreereeoeiessnssKnyABWGaBMWerTJLHmttsehLsWTGuJiTFePr Tharpe L H TTThhheooimmssaassCADE LL Mrs TTTTTTTTTThhhhhhhhhhoooooooooommmmmmmmmmaaaappaaaassssssssssooOEnnWJEERJssdRitcHMLlgLeWlaelaraxlreuAde Thompson W A TTTioinnlleleeryy NJRoEEss TTTTTTTTTTorrrruuuuueeiiocrbbrrrgalnnnnkbbedleeeeeollweerrrrrnAeEGWJJAlCNlWmrCCaJIRmJdFyEanuel TTTTyyuyeetleenrWWTGhBBoHsJr Upchurch A L UVVVVVVVVVVpaaaeiiiaiinnnnsllrncleeessmssshaaooonnonbugnnnttntlriiieeDnncnBWCheeWeaSJnRFEFWHRBOLlauLvtEhis Vollenger W E Wade F H WWWaaadggenneeWrr WEHlizMMrs WWWaaalllkkkeeerrr JJWnuoliilsaon WWaanrdsleHv WJ F WWWWaaaarrrreerreennGD MDHBoocskMe rs WWWWWWWWWWWWWWaaaaaeeaaeeeeastetstsellttstscklksshthtkktslosoohiiieissnnnnnnnrGTssogAgKEJcttASlFooa-GiEGMSBkznatnesunBFLsGMnMsTiioeerHzsWeMll rMs rs WWWhhheeeeeellleeerrr ERJooegSer WWWhhhiiittteee STGaoumms WWWhhhiiittteeehhheuuarrdsstt JWC HAJ Whittier M E Mrs WWWWWWWiiiiiiilllllllccklllliiiiooiaaaanxxmmmmsoeossnssnn AAJBGHJleroHraDNntdHhzyCaaMrs Taylor Transfer Co. PHONE 3 8 8 MOVING LONG DISTANCE HAULING STORAGE This Directory Was Published By The Originators Of The ABCD Type MACON TRANSFER COMPANY And Furniture Exchange PHONE 304 408 BROADWAY Of City Directory McNair Lumber & Supply Co.. 266 Fifth St. Phone 1400 1835 Macon City Directory 333 Everybody Reads Macon Eveni ng News, The Macon Telegraph TELL THEM AND YOU WILL SELL THEM USE DIRECT MAIL Consult Southern Printing and Pub. Company Charleston. S. C. J. W. BURKE COMPANY OFFICE SUPPLIES--PRINTING--BOOKBINDING Phones 74 and 75. 406 Cherry gt WWWWiiiilllllllliiiiaaaammmmssss POJMfBNDg Co Williams Will Williamson C A Williamson R L WWiillslionnghHamMJ N Mrs WWWWiiiilllmsssooobnnnusMJhRoyPTbrtotlMemrMs rs WWWWWooooitoooohdddderiWHHBnge-rMGAtmonanT J Woodall J W Woods W N WWooortlhfoyrkArReboeblt L WWYWayyrtinengsnnhtHNHJoRrSMa YYYYYooooeuouurknmnngdgaJnJoZAssneWOBnpiheBine Hall E L HHHaaanrnbssioennn DHBeLrBnice HHHaaarrrdtt isEWonJHR C HKLLHaaiiintgnmcshehoateonrDnwasAWevrliHedxAREL A LLMeeawwrtiiissnWLJ LGL McCarty E A MMMicillCelesorwLJaenwCiRs F RRRRPPMPPhoeeaoiaogaybitbnoltgvytiklsrnoiieeipnsn.nyJEssoJnuGHTBRJgCJeoDJLnNbLet L Mrs RRSaoonssdss GRJ icWWh ROUTE 4 -- se of city, between-C of Ga Ry and M B 4 S Ry BAAervlneloralDd WWT ilAlie Roy i BCCBBBlaorueaolnrnyhwkdnoeneuStRnWtRHCCHMTLM DDCDioaaxvlvoeiimnsdsaoGDnn MMTA MMDrs Donaldson J H DDorenwaldTsonA JMTrs SSaapnpdeJrsWR G SSSShhaaewwelplyypeeaZrrrdAWDLiWllAie SSTithmeormmemoansasnAJJRWM TTThhuoornmmepprssooCnnlaJDreeEnwceitt WUpasthsoawn MLialuadce Watson W T WWWWWoheehosseettdedlloRoGWcckkiWEnnAAielllleeBnnell DDDuruinbgaagwretrasySuSRsieBT EFFEEEiavttdthhrazwreenorrasiiwRrdddggDseeEcJTJJCLAOlllienn FFuitlzlperatrWickMB S Jr Gear Pearl Mrs GGiildedsenJs ARobt Mrs Giles J E HGGGGGGororaoioiloodbmfbdfdenieearmnerntaGOtCnJTMHHHLBHoJla ROcreoUancThEed6by--Maein,ofE cMitva-, AAldldenletoEnsteBllaL AAAdllllaeemnn sOWJwaielmlniees BA BAAAAAAAAannnnldldeieddddaalxxyeememeaarrrrnssnssssZooooddannnnSeJecurrkPdRPWSMNsaoTlaTalnoiTreJimarJhir Balkcom T L BBBaaarrnffkiieeslltddonWGMirlEiDe Mrs BBBBBBBBBBBBBBBooooolorriiraaaolvaaawewwwhrrircinhynnrrarnleldkootagossnsnlennomosSnenWsnHennyioCmeLFniEBBaJlMJoaeMlJrAveienvnreDeinLatilnGisnselesniiyelieileea Lee Mae CBBCBBBBBBBaauruurrrrroomomoyirnttwlnwwaakteppicenlnnnrbnbhyeteegyJlMlMhBllJiCMamHalPmACEigOfaaCgfntuHinteliMieeArs CCCCCaaaaassrrrshmmhwiicceMJlhhnlaaaoeetBtllieHeCnRatJh CCeaunstreayl CGaMNurseries CCCCCClllhhhaaaiaayyylppdmsmJLEoaaadPnenmeaALarrelGeJr CCCCCCCooolllloooeoollwmwwkkineeeesrrRrnRssstaJsyBLGTmFAeoilnomfLnordd CCooosbpyer ONdaetlhlal CCrreiswsesyEmE ma DCDDDDCCuraaaraauumrnnrndrttiffccieeeoonhhlnrrsgffdRtiitheeoACllJnddBIrannirozeJrCAoaizencBBka DDaavviesnpBortRHillsman Davis Bertha DDDDDDeeaeaanvavvLvmiiisssoaaumSrFRrkusasrMSiWIeWI AMFMrsrs DDDeeenSnSihhsaazzWiieerr MRGoesoa DDDDuiirxxefoofwennryyTIdRBaoArboMtadaGucsk builders lumber company LUMBER AND BUILDING MATERIAL Office 857 Cherry St--Factory 130 Cherry St.--Phones 467-468 Plymouth--De Soto^r--Yates Motor Co.---Packard--Phone 1445 534 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES EMPIRE FURNITURE COMPANY "WE FURNISH YOUR HOME COMPLETE" Phone 402 522 Poplar St. EEDDlldduueevnrraclaElEntIhdWSaaelKiEnlalMisrs Ellis Classie EEEEEFFEFFFFlelomaoellitlllkthanrliriicdsmismsdegnnhsrieeeinJENSsdrLrSWiessgmaitoIesJelanPrnilneneicRKeonlyDeHeaythHPA Mrs FFoorrdestWViilol la FForesetemraRn MEllen FGGraaylllleoowwOaayyBHMoMarrarycseL GGGGGGGGGGaaaaheiiillllonnrrooemmddvrttlssgeeeaooFennTrnArneluemTOWTCitCClcezaliElahhHemlilHlaaeilessralCiHaooper GGGlllooovvveeerrr MLMeaoLclak Glover Sarah GGGGGGGGGGGGGGGoorrrrrrrrrrrrreeeeeeeaeeaeaoreedeeeeeeehehhdnnnnnnnonnnaaasnommmSRnCPWAPMAIedaJoirAWRrleFaauaisMoersrliilsncTtlyesletJJeaLeernrW GHHraaodbcaeewrsCahyamAJ LJacob HHHHHHHHHieiaaaaaalcaryrrrlrkgvrprrnelidrWeeieslonyrlsMvilJNelADMSaaeuumgeEaasdlnrlleiteasehsshealll HHoinbtboyn JAnGnie Bell HHHooollllmmemeessanCAEalorlnLtozan Holmes Hattie HHHHoooolllrmmtneeeBsseJnaJWimmaelster HHHHHHououuusdwmmmesappporhhhDndrrruiiieeeCLdsssloevDyAEIedaHT Humphries J S HHHHHHHHIIIJJJJvrraaaauuuvuvuuuuemccmmmmiitnnnnykknnceettttsspphpgessooLhhihrCMCJnnnerrrHRoJsioiiaseaSeesuDtrraAsetsseaaFrWbttpiomritmeieiTJMhunieMligalnaWnlBSrmaedssiae JJJJJJoooooohhhhhhnnnnnnssssssoooooonnnnnn MABFJReoenafsstrFfhstyeiloeernmyming JJJJKKJKKooooueiiinnnnsnnnneteeegggidssssc:aeRlJOBAPWlouAeeLfiuHWGlullFsaJh KLLaanmwigrphektnicnTe SPGerraednya LLLLLLLLLLLMeaoeieeeioiaanteswewwwwtbdleliiireeldebCWesseejoeonhMLxrMRLhcrHgeGienaoesiAiilrlHbtrldaiidWMRtanraGCeeordssHCDaolLeee MMMMaaaacccckkkk AIFNdadoandrniaeie Malone Frances MMMMMMMMMMMMaccacaccaacalCCGCsKrrsCtotttssllhuiihnraeeeennaleeyeynnnlrewoddbyHJHuRooWuTgnHnareWJhyyinWelrBlBrlJyMeGPoenneLanrFVtyiberCeoyl Mrs MMMMMMccooeoMKorrdciresieiennolrlzanaCineWHLWEaMuzDceaGklryia MMMNNNNNNeeooaooyollprrrrersswmrrrirooieiisosssnnaronHdEHCCLSouBieSzPHllgJzeaiFnme Owen W Roland PPPPPPPPPPaeaehiaaaecnrrtutterrkdttkrnlleieypueecrnsterksHtNAoCHEDenEnSdbeEncEdCrnioCWaentshtiksaKaralitee PPPPPiiiiipccttttpkksseeenttFtAt auEEWnsntmWiMine HJr PPPPPoiilottusrttnessteykreHLLtoJt nuCERoiseuMAbyrs PPRoraiuntcndhdoselptthLWaJunroPa RRRRRRieiiihdgvvsalgeepnerrieyensssyssAAJJIonnTarenneminieeCeesBell Roberts Algia RRoobbeerrttss CJ CP RRRRRRRRRRRooooooooooucssbdbbsbbmssskgeeeeemrrrrretttttCWrJSsssssesayaeOJsmAOJOMsteWlstsDefcaLbfarauyIrwErnnsnon SSSchaonenrdmyeerasrns JEeMssAaireie Simmerson W M Small A T Mrs SSSSmmmmiiiitttthhhh CECFhmleyalmidrxleiae SSSSSSmmmmmmiiiiiitttttthhhhhh PIJTNMdneaooWVllsieEeS Smith W G Smith Wesley SSSSonoollyloooemmmrsooonnnC LNSLepavinMinckyrss South Atlantic Press C B Shop At SEARS and SAVE Sears Roebuck and Co, The World's Largest Store 552 3rd Street MACON GA. Macon Federal Savings and Loan Assn. Loans On Bibb County Real Estate McClure office equipment co. Mimeographs and Supplies 506 Mulberry St. Phone 90S Phone 5036 McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 735 ~ Everybody Reads Macon Evening' News, The Macon Telegraph McNair Lumber & Supply Co. BUILDING SUPPLIES CELOTEX WALL BOARD 266 5th St. Phone 1400 MACON, GA. Flynn Printing Co. QUALITY SERVICE and PRICES 505 Broadway PHONE 5779 614 MUECKE & SONS CO. Phone New St. I Beer and Bar Equipment--Cabinet Work Show Cases--Store Fixtures 63 6 SSSSSSopppppueeaaaatarrrhkrkkrsemssrAaRLWTnuOEcRJBiBleEJMMr rs Spencer J D SSSSSSSSStttttttttaaaeeeeeellnvwwwwwlledwwaaaaanirrroofrrstttettrrrttJDMhhDGGFaeBueaaEvRlosninesfadnfiyeiSiee SSSSttttroieinnpweelianJrLgt-uRRlBaicehnMdrFs Strong W J Stubbs Albert TSSStuuautrtbttvoobennsr CRGAaorerbTretine TTTeaarrrrvvyeerrJiAVmritohla TTTTTTThhhhhhhoooaaaarmmrrmrppppaaaeeeesss FPELLMFreleeaiaraveznrnriayykniWe Thompson A T TTTihhdorwemaepltlsoLJnuLlVa iola Told Decy TTTTTTTTTTyyououuruuilmnmcrfrfaentntkenrppeeregskMrrJrolAiHaennRaWcJsrakoCyPOEmGbrMteeilCssbsert UWWpaacllhkkueerrrcMhIsaiAnanciLe Mrs Wall W L Walles Dave WWWWWWWWWaaaaaaaaatsssrrrrrshhdhrrdroeeeiiinnnnnnnHBgggaetttCJJEooorsrnnnsvWiiHeWeenGtAMteensarnrtirieaude Watts W M Mrs WWWWWWeeeeeelllblblldlbssbsonTMJCOATWFLEnnJire WWWhhhiieddebbleyyr AHWlabteLtiret WWhhiidtebyDOailsiyver White J W WWWWWiihhhlldiiibttteoeeterunrMWnAaSbazLorlitaioeelhuraisme Wilder J H WWWWWWWWWiiiiiiiiillllllllllllllllkliiiiiiiisaaaeaaaammmsmmmmGsssssssHolManMEERAdGumoaynRtlbsEniamtlidLeaMaHMrs rs Wimberly Clarice WWWWWWWWooiriiiissmmimooegeddbbbhaaeeeAtSllrrlrlallrlByyymyLAeoMrLlCiRutcohiaoaensatonetakidneolBLpehe ROreUaTchEed5 v--ia nCelinotof ncirtdy, AAAldblkreaninmsMPLaajuoucrlainse Mrs AAnnddeerrssoonn BEssTie Mrs Anderson U A Anderson W T BAAAABBBAAAAaaaasvvvrvnndlwlkkeeeeddkkrerrerrreccyyyyeerrGloolwwmmeWBHWFGssoJerarAiAalValnMAlHlnecniiekecnaEMitieteiresP Mrs BBBBBBBBBBBBBBiiieiaaaaaaaaavvrrcrllllltrtddikkkikkclckknnosschcchccssooswoooooedeLnnmmmmmllaWooggLlWrreRuHELaWMWLlMlPiaBtaCliaiAehBlluelaitkrlyetMnrriievlsaelsiins Blackman Fannie Mae BBloonondewr oDrthouWglasH BBBBBBBoooroooaosonnntwttnnnchheeeehrlrreAlArnPMHQnSLaeaeutnmLerCeiyenlaiCMrers BBBBBrrrrrooooowwwwwnnnnn KJMJJ aWaLTtcekMMFrrss BCBBCCBBBBBBBhahrrrrrrrrrryouyooyuyioeanewwwnawnaaapknnndndmnnnnHtattataWggWWRSnCLAJeeCoEERAJBoWHLJOppbheMMrrraihrasamm CCCClhhhaeeenssscttteeeerrrWHREeoarHsmrel an D CCCCCCCCroooooooalnoooooweepppppyeefeeeoHrrrrr rDadAEWVRraludioemiLogsysxluyaacyL Mae Crooms Frank M CCOCruuuorrrortrewmyyrsSigJiRndhaotbJurWn L DDDDEEEDEEldaldaaaarldasvwvewnvrtkniifiieadassodebrrrsgrrnddoLWdoAessniwdlAGlLLdniRRJeiieiilreulollJiMfMBieLieKCerCriassnMLteeee EElmlios ryMaHttoiewaMrdrs Ethridge D V Ethridge J N EEFatvhramrnidsegreJJnMoaurice GGGGFFGFFFFoioouoelaaanoorrrlisrtnvnldlddlrteiaegeeefrnrryefyMJBdiPHPWGmJRahJierrmuaoEtenhnteeArhbainyee GGGorraadyydaLMrdaBrWy illie HHGGGaarrreiilmsmlewnmeDosolFadciJuksolAytsHoenJpEhine HHHHaaaarrrrvrprieiessyoronnJReiJWrcrhyZd H JOHNSON BROTHERS THE FURNITURE MEN 461-463 Second St. Phone 2018 Plymouth--De Soto--Yates Motor Co.--Packard--Phone 1445 736 Baldwin's and Telegraph's LOOK TO STERCHI'S for BETTER FURNITURE VALUES GEORGIA ROOFING & SUPPLY CO. ROOFING CONTRACTORS AND DISTRIBUTORS 306 Oglethorpe St. Albert E. Sheridan, Manager Phone 3121 HHHHHHHHHHIHHHHruvooouiieueeeaintgnnglruirrrtnclsndcnnrvddhshitlihogmdseteenrecombioysyyrsognJansyncnngoWWRLRkoFSsnCJCoTJGWaSsAJHLRACsrJrBLiWe JJJJJIJJJJJJJJsoooaaoooaaeaoacccmnhhhnrhhnarkkknknennneeecssssssisssslsnoooooootlosWnnnnnCBnnFnEoeaaAWLGWJJrFlsnJnnlPudhluanioeocraEsilCiiriBlrneslleelgHonitsnMcoeennrCrsyamp KKKJKKKKKKKLLJJKLoouaaaeeiiiieiiiinnhtttnttntmiglleccccccllleenagrneehhhhhhbssaneeyyeeeeeWeiyrMnnznnnRnEGATeSssssssJoaLdlDsroAHgOGMCaKCyCsPJnanahzrRLEeoTaaWtrtleie MMMMMMMLLLMMMMMLLMMMMeeiouooicccacaaccanaaawwxwtooNDDcLllCDssrrgzoccttosrsriioatueaaiiooaenesseehnnniannlnllynEnelmmAlJiiioGGAgWreeReMnAuOlalllEbrAomMgMFlnaaGBeteNVhRlirWdnMelseiJCeieyRtoFMsJerFtManlDnsasriroyLeTrsCCnsMMrsrs NMMMMOPPPMOPPhaaaa'e'oooooNNttirrwoooootltkkleeeerrrrrtieeeeaeeearorpslrsrlnsooWRLOWOJJJnnBAobMMLeWTAPdbMMFaieimoollrsgean RPPRRRRPPPRRRPPiiriiiueeeiieiatttttivvvnienrgtttttcdeeesssssssffearrlerrrnessosoWPMRPOyLeeeRhLBMoHnayBysoFeWreaMtFaailyboneLrzelrlaeintnniiesonsnileneTk Jr RRRooobbbeeerrrtttsss AAC rrttYhh Jr RRoobbeerrttss MJ ilHton Lee RRRooogbbeeerrrsttss KWWenmilcshoenn RSSSSSSSSSSSSSiiemmmhhaaicmomnmannaoasagiiibsrrddsamtttllbphhhrlteeeowsoueFJrrtoossnreCoCEryknsJLsoaohdssTLdnariaiLTDoneAautkrLhmePgclrieoieeWtlihneylaatoMnrsE SSSSSSSSSSSSSSSSSommomtmmtotootmtteoaaeeluuuuoviinniiilwwitttttttttltmeelhhhhhhhhhwheaaneeeeoyrrosErrrrGMnttJJNHlrivatJlHWMTLioCahaenGnnCTnkdludnoylJceyMMlaiBOFnayesdTRyLCEosbt SSSSttttrrrriiiipppplllliiiinnnngggg RLLMuaFCcniddyy MMrrss TTTTTSSTTSSwtththhhahhuuutoiooooebbegbmmrmrebbpbnnnssaesaatHteoosnssyHnnEAHSGAClJrlAaeBFedsrwnhJSaaElineenyiMLeeres TThhorarpshe JFalockrence Upshaw Jas VVWVWWWWWWWeeeaaaaaaaaaaallrllrrslllllkkdddheeeeWbrrTFrrRMMuriiPmroCeAlManaoxdlhrnetliaytaaneairCresiyleMMieBrrss WWWWWWWeeeeaaalllltttllllettssssssrsGJTJSLeGeWnCCTieeloava WWWWWWWWWWWWWWWWoihhioeiiiihiiiilllllllllmosoiicelkklldllttiiiitiddoaiieeebsasaannxtrmmmelHssJJerDEERoossBsluyeMyannaidneBGlrnGHLsltlDrWlaWseoeeRyuyoaonmnoiMsbeJByttraiaeMrs Wood M Mrs WWWWWWoooorrioioorggdtddhhhaayttllPll GiNGnLAekeoirzrorttzahrMiuedMrsBers Yarborough Walter Yearwood John C Yearwood Vic Young Edw Young Pink Young Wm PRINTING -- BINDING -- RUBBER STAMPS The Best Work--Correct Prices BURKE'S 460 Cherry St. Phone 74 and 75 C. W. Farmer RUBBER BELTING HOSE PACKING Phone 2 13 4 19 POPLAR ST. CASH S For Your Car $15 - $25 $75 OR MORE AUT0IANX Cars Sold On Easty Terms 30-60-90 DAYS OR LONGER Confidential 30 Minute Service Used Cars Bought and Sold 364 1st St. across from V. M. C. A. McNair Lumber & Supply Co., 266 Fifth St. Phone 1400 1935 Macon City Directory 757 jS