HU> am S. Chandler Insurance Georgia CscwalSf, J MUTUAL FIRE AND CASUALTY'' INSfRANre*| Th Be8; TEat You Caa Buy Telepfewg 3T% Murphey, Taylor & Ellis Inc. REAL ESTATE SALES--LEASES--LOANS PROPERTY MANAGEMENT ' INSURANCE--ALL LINES SURETY BONDS aad Third Maeesi. Ga. Phoaea 267-2SS q R, COKE C ON N ALLY UNERAL DIRECTORS Efficient --Courteous -- Prompt 24 Hoar Ambulance; Service : AST PHONE 1627 \ FACTORY DISTRIBUTORS ARM 24-HOUR Pfaftlfe mom EteiS_ i 2 1 Georgia's A Good Place To Live The fact that citizens of Georgia served by the Georgia Power Company use more electricity in their homes, on an average, than the people of any state east of the Rocky mountains, is worth a passing comment. But that record, translated into terms of comfort, of convenience, of added leisure for greater enjoyment, means a great deal more. It means that Georgia is a good place to live and that Georgia's towns, from the largest city down to the smallest crossroads rural community, are good towns. The Georgia Power Company, by providing abundant, dependable electric service at low rates, has had a part in establishing Georgia's position as a state where life is enjoyed to the fullest. Georgia Power Company (1937) K. L. POLK & CO.'S 3 Oldest chartered college for women in the world. (CHARTERED -J 8 36) ; Macon, Georgia Wesleyan is a standard college, holding approved membership in the following associations: 1--Association of Georgia Colleges; 2--Association of Colleges and Secondary Schools of the Southern States; 3-- American Council on Education; 4--American Association of Colleges; 5--American Association of University Women, and is on the accredited list of the Association of American Universities. Wesleyan offers thorough courses leading to the A. B. degree. The college plant consists of 1 3 beautiful and imposing buildings finished in brick and marble on a campus of 132 acres. The buildings are modern, fire proof and beautifully furnished. Special advantages in Physical Education are offered through the magnificent Gymnasium building. Golf, tennis, soccer, horseback riding and other outdoor sports are enjoyed by the students. Special advantages in music and fine arts are offered by the Conservatory of Music and School of Fine Arts which occupies the plant formerly used by the College in the center of Macon. Wesleyan is rich in the traditions of the past--but is alive to the needs of the present. Officers and Teachers (Highly Trained) Students (Carefully Selected) For Catalog and View Book, Write D. R. Anderson, President Wesleyan College, Macon, Georgia MACON CITY DIKiECTOKY 01937) 4 HOW MANY IN YOUR FAMILY? All will enjoy reading The Macon Telegraph and Macon Evening News--they are family newspapers. News of the world--business, political and financial for Dad . . . News of fashions, society and store news for Mother . . . Sports and serial stories, too, for older sons and daughters. Special features for the youngsters, with daily comic strips to delight both young and old . . . and 1 6 pages of colored comics every Sunday . . . Yes, we believe that you will agree-- Every Member of the family will enjoy The Telegraph and Evening News --They Are Truly Family NEWSpapers Macon Evening News & The Macon Telegraph TELEPHONE 6500 (1937) B. L. POLK & CO.'S POLK'S MACON (BIBB COUNTY, GA.) CITY DIRECTORY 1937 Containing an Alphabetical Directory of Business Concerns and Pri vate Citizens, a Directory of Householders, Occupants of Office Buildings and Other Business Places, Including a Complete Street and Avenue Guide; also a BUYERS' GUIDE and a Complete Classified Business Directory FOR DETAILED CONTENTS SEE GENERAL INDEX R. L. POLK & CO., Publishers BIRMINGHAM, ALABAMA DIRECTORY LIBRARY FOR FREE USE OF PUBLIC AT CHAMBER OF COMMERCE Member Association of North American Directory Publislhers Copyright, 1937, by R. L. Polk & Co. 2 Section 28, Copyright Law In Force July 7, 1909 That any person who wilfully and for profit shall infringe any copyright secured by this act, or who shall knowingly or wilfully aid or abet such infringement, shall be deemed guilty of a misdemeanor, and upon conviction thereof shall be punished by imprisonment for not exceeding one year, or by a fine of not less than one hundred dollars nor more than one thousand dollars, or both, in the discretion of the court. PUBLISHERS NOTE The information in this Directory is gathered by an actual canvass and is compiled in a way to insure maximum accuracy. The publishers cannot and do not guarantee the correctness of all information furnished them nor the complete absence of errors or omissions, hence no responsibility for same can be or is assumed. The publishers earnestly request the bringing to their attention of any inaccuracy so that it may be corrected in the next edition of the directory. R. L. POLK & CO., Publishers GENERAL INDEX Abbreviations Alphabetical List of Names Apartment Buildings Associations and Clubs--Commercial Banks and Trust Companies Buildings--Office and Public Bus and Coach Lines--Motor * Buyers' Guide Cemeteries - Churches City Government ' Classified Business Directory ... . .- -Clergymen Clubs Convents County Government ' Courts Fire Department Balls Homes alnd Asylums Hospitals and Dispensaries Labor Organizations Libraries Newspapers Parks and Playgrounds Police Department Post Office Railroads Schools--Parochial Schools--Public Schools, Colleges and Academies Societies--Benevolent and Fraternal Societies--Miscellaneous Societies--Patriotic State Government Street and Avenue Guide United States Government Page 24 25 545 546 548 550 550 opp 544 550 551 239 545 552 553 554 '50> 51 239 561 562 562 566 567 569 571 239 367 573 575 575 575 576 577 577 145 405 367 INDEX TO ADVERTISERS PAGE NUMBERS BELOW REFER TO THE BUYERS' GUIDE Adams D H Motor Co. .left side lines andPag2e Macon Chamber of Commerce Page Y Arlington Hotel left top lines and 16 Macon Coca-Cola Bottling Co BBiibbbb PBrrionkteinraggCe oCorp 2273 Burghard-Connally front cover and 14 Burke J W Co left side lines and 27 left side lines and 7 Macon Credit Bureau Macon Federal Savinrgigsh&t Lsiodaen lAinsessn and 11 Central City Funeral Home 15 Central Hotel left side lines and 17 Central Sash & Door Co.. back cover and 23 right side lines - and 9 iMacon Memorial Park 10 Macon Telegraph Publishing Co Chandler Sam S Insurance Agency front cover opp title page Macon Trading & Investment Co Chapman's Garage right side lines and 8 front cover, right side lines and 2 Macon Transfer Co... .right top lines and 31 Citizens & Southern National Bank Maxwell Bros Furniture Co Collins Baking Co leffrtonsitdecolivneers aanndd 54 right top lines and 15 McCord R A Motor Co Community Savings & Loan Co left top lines and 4 left top lines and 23 McKenney & Adams Service Station.... 2 Co-Operative Fire Insurance Co 19 McNair Lumber & Supply Co Courts & Co left side lines and 5 back cover and 9 Crescent Laundry Co front cover and 21 Merritt B F Coal Co Dannenberg's 112 right side lines and 11 Davis Edwin S left top lines Millirons Plumbing & Heating Co Dessau Realty & Insurance Co 29 right top lines and 26 Dixie Cycle Co right side lines and 7 Morgan & Morgan left top lines Dunlap Chevrolet Co.. right side lines and 3 Dunlap-Peeler Hardware Co Motor Parts Corp.... Muecke & Sons Co right left top side lines lines aanndd1 4 10 right top lines and 16 Mulberry Market... .left side lines and 13 Dunlap Roofing Co back cover and 8 Murphey, Taylor & Ellis Inc Equitable Life Assurance Society of the front cover and 28 US 19 Penn Mutual Life Insurance Co 20 Finance Service of Macon . Pitt's Mortuary right top lines and 14 left top lines and 23 Rhodes A G & Son left top lines and 15 First National Bank & Trust Co Robertson-Walker Inc .backbone, back cover and 6 right side lines and 29 Friedman's Jewelers left side lines and 21 Schall Paint Co Inc.... front cover and 25 GAB School of Commerce Schwartz & Phaul Inc. .back cover and 30 front cover and 10: Sears, Roebuck & Co. .right top lines and .11 Georgia Power Co inside front cover Snow's Laundry & Dry Cleaning Co Georgia Roofing & Supply Co right side lines and 22 right side lines and 29 Solomon .Steve M Jr.. right side lines and 4 Guarantee Mutual Life Co. .left top lines Southern Flooring Co. .left side lines and 13 Hancock John Mutual Life Insurance Co Southern Paint & Varnish Co 24 left top lines Sterchi Bros Stores Inc Harrold Edward B Co back cover and 20 left top lines and 16 Hart's Mortuary right top lines and; ,14 Strickland E H & Co back cover and 19 Hatcher & McCrary Inc. .back cover and 19 Taylor Iron Works & Supply Co 24 Holt A T Co right top lines and 28 Taylor Transfer Co... .left top lines and 32 Hotel Lanier left side lines and 17 Thomas Robert O right top lines and 29 Hotel Macon right side lines and 17 Thorpe R S & Sons 11 Hotel Southland... .right side lines and 17 Washburn Storage Co.. front edge, 30 and 33 Huckabee Auto Co....left top lines and 3 Wesleyan College, .opp inside front cover Hutching's Funeral Home Williams Luther & Son left top lines and 15 right top lines and 7 Idle Hour Nurseries top edge and 13 Williams Wm Worth Insurance Agency.. Independent Laundry Co. left top lines and 20 right side lines and 22 Willingham Sash & Door Co Jackson J Guy left too lines right top lines and 24 Jarrett Paint & Glass Co Wilson John E & Son... .bottom edge and 18 right side lines and 25 Wood-Peavv Furniture Co Jones & Coney 27 left top lines and 16 Lee A B Plumbing & Heating Co Wood T L Plumbing & Heating left top lines and 27 left side lines and 26 Lewis Logan & Co... .right side lines and 20 Yates Motor Co left top lines and 3 INTRODUCTION R. L. POLK & CO., publishers of more than 750 city, county, state and national Directories, present to subscribers and the general public, this, the 1937 edition of the Macon City Directory. A new feature, the designation of homes having telephones, marks this edition. Confidence in the continued growth of Macon's industry, population and wealth, and in the advancement of its civic and social activities, will be maintained as sections of this Directory are consulted, for the Directory is a mirror truly reflecting Macon to the world. The enviable position occupied by R. L. POLK & CO.'S Directories in the estimation of the public throughout the country, has been established by rendering the best in Directory service. With an unrivaled organization, and having had the courteous and hearty cooperation of the business and professional men and residents, the publishers feel that the result of their labors will meet with the approval of every user, and that the Macon Directory will fulfill its mission as a source of authentic information pertaining to the city. Four Major Departments The four major departments axe arranged in the following order:-- THE ALPHABETICAL LIST OF NAMES of residents and business and professional concerns is included in pages 25 to 403. This is the only record in existence that aims to show the name, marital status, occupation and address of each adult resident of Macon, and the name, official personnel, nature and address of each firm and corporation in the city. THE DIRECTORY OF HOUSEHOLDERS, INCLUDING STREET AND AVENUE GUIDE, covers pages 405 to 544. In this section the names of the streets are arranged in alphabetical order; the numbers of the residences and business concerns are arranged in numerical order under the name of each street, and the names of the householders and concerns are placed opposite the numbers. The names of the intersecting streets appear at their respective crossing points on each street. A feature of this section is the designation of tenant-owned homes. A new feature is the designation of homes having telephones. THE BUYERS' GUIDE, beginning opposite page 544, printed on tinted paper, contains the advertisements of leading manufacturing, business and professional interests of Macon. The advertisements are indexed under headings descriptive of the business represented. This is reference advertising at its best, and merits a survey by all buyers eager to familiarize themselves with sources of supply. In a large commercial and industrial center like Macon, the necessity of having this kind of information immediately available, is obvious. General appreciation of this fact is evidenced by the many reference users of this City Directory service. THE CLASSIFIED BUSINESS DIRECTORY is included in pages 545 to 579. This department lists the names of all business and professional concerns in alphabetical order under appropriate headings. This feature constitutes an invaluable and indispensable catalog of the numerous interests of the community. The Directory is the common intermediary between buyer and seller. As such it plays an important part in the daily activities of the commercial and professional world. More buyers and sellers meet through the Classified Business Directory than through any other medium. Municipal Publicity The Directory reflects the achievements and ambitions of the city, depicting in unbiased terms what it has to offer as a place of residence, as a business location, as a manufacturing site and as an educational center. To broadcast this information, the publishers have placed copies of this issue of the Directory in Directory Libraries, where they are readily available for free public reference, and serve as perpetual and reliable advertisements of Macon. 10 INTRODUCTION The Macon Directory Library Through the courtesy of the publishers of the Macon City Directory, a Directory Library is maintained in the offices of the Macon Chamber of Commerce, for free reference by the general public. This is one of more than 450 Directory Libraries installed in the chief cities of the U. S. and Canada by members of the Association of North American Directory Publishers, under Whose supervision the system is operated. The publishers appreciatively acknowledge the recognition by those progressive business and professional men Who have demonstrated their confidence in the City Directory as an advertising medium, with assurance that it will bring a commensurate return. R. L. POLK & CO., Publishers. MACON "IN THE HEART OF GEORGIA" By Lee S. Trimble, Executive Vice-President and Manager, Macon Chamber of Commerce Statistical Review Form of'Government--Mayor and council. - ***< Population--Total, 53,829; males, 24,767; females, 29 062; white males of age, 14,236; white females of age, 15,973; total colored, 23,158 (1930 U. S Census for city proper). Greater Macon, or "Municipality of Macon," 64,045 (1930 U. S. Census). American-born, 99%. Area--8.16 square miles. Altitude--412 feet above sea level (average). Climate--Mean annual temperature, 64.3 degrees F.; average annual rainfall, 42.79 inches. Parks--19, with total of 500 acres, valued at $1,500,000. Assessed Valuation--$40,000,000, with $1.50 per $100 tax rate. Bonded Debt--$804,000. Financial Facts--3 banks, with total deposits of $15,357,808.20 (Nov. 1, 1936), and total debits of $16,972,688 (Nov. 1, 1936). 1 building and loan association, with assets of $450,000 (Nov. 1, 1936). Postal Receipts--$353,153.60 (year ended Sept. 30, 1936). Telephones in Service--10,276 (Sept. 30, 1936). Churches--115, representing all denominations. Industry--Chief industries of city and surrounding territory: Manufacturing and agriculture. 150 manufacturing establishments, having products valued at $19,783,200 annually (last report). Principal man- ufactured products: Textiles, lumber, ceramics, agricultural implements, brick, tile, fertilizers, cottonseed-oil products, feed and work garments. Trade Area--Retail area has radius of 60 miles, and population of 800,000; wholesale area, radius of 75 miles, and population of 1,000,000. Newspapers--2 daily and Sunday. Hotels--8, with total of 1,150 rooms. Railroads--4: Central of Georgia; Southern; Macon, Dublin & Savannah; Georgia. Highways---U. S. 41, 80 and 129. Airports--1, municipal. Amusements--Largest auditorium in city (Municipal Auditorium) seats 4,500 persons. 3 moving-picture theatres, with total seating capacity of 2,552 persons, 4 legitimate theatre, with seating capacity of 1,100 persons. 3 golf courses. Hospitals--4, with total of 300 beds. Education--'Mercer University (coeducational) and Wesleyan College (women). 48 public schools, including 2 senior high and 1 junior high. 1 parochial school. Number of pupils in public schools, 17,154; teachers, 405. Value of public school property, $2,469,185.46. Public Libraries--2, with total of 30,000 volumes. Also :2 college libraries, with total of 57,000 volumes. City Statistics--Total street mileage, 125, with 45 miles paved. Miles of gas mains, 146.7; sewers, 160; street bus lines, 22,5. Number of water meters, 13,896; light meters, 11,544; gas meters, 6,703. Capacity of water works, 22,000,000 gallons; daily average pumpage, 10,000,000 gallons; miles of mains, 195; value of plant, $250,000. Fire department has 83 men, with 5 stations and 12 pieces of motor equipment. Value of fire department equipment, $112,656.50. Police department has 75 men, with 1 station and 28 pieces of motor equipment. History The virtue of Macon's location as a center of activity, serving a large area, has been evident since prehistoric days. 12 INTRODUCTION The first settlement by white men was to set up a trading post to deal with the Indians already settled here. Proof that the Indian village was-of great age and extensive use, both as a capital and meeting place, is readily found in the evidences of occupation abounding about Macon, such as mounds, ceremonial house, burial places and relics in variety and quantity. Thus Macon is shown to occupy a "key site" as fixed by natural conditions. All races of men, as well as animals, travel along lines of least resistance, and the law of travel gave this location its strategic importance in prehistoric days, just as it does in this day. Maps of the early white traders show the trails that converged and branched here. It was in following these that DeSoto, Spanish explorer, first came to Macon's site in 1540, pausing to camp for a short time. Legend has it that the first cannon ever fired on American soil was fired during this encampment, this method being used by the Spanish commander to impress the Indians with his power. Another legend is that the first Christian baptism of a native occurred at the same time, when a priest of DeSoto's party baptized a dying Indian chief. As late as 1774 a trading road ran two miles through ancient Indian fields on the west bank of the Ocmulgee River, where Macon stands today. On the heights of these lowlands still remain the conspicuous and very remarkable evidence of the power and grandeur of the ancients of this part of America, These are known as Indian mounds, the remnants of a capital town and settlement of vast artificial hills and terraces. It is not known how many races inhabited this mound city, nor when they came, nor why nor how they departed. Excavation of the prehistoric Indian villages, extending several miles along the Ocmulgee River, is attracting nation-wide attention since investigations of the scientists of the Smithsonian Institution have declared these sites to be the most significant archaeological discovery in the Southeastern U. S. within 25 years. Digging into the mounds of the early inhabitants of this region has revealed bits of pottery and implements which, scientists claim, antedate the period of 1540 when DeSoto was known to have crossed through Georgia on his tour of the section. The site as a whole has been purchased and donated to the Government to be made into a national monument through which a parkway will be created and the significant mounds designated with appropriate markings. A winter council house used by the Indians, said to be the only thing like it discovered in recent times, has had a temporary cover placed upon it and great care has been exercised to preserve it from disintegration during the progress of the work. The council, or "hot house," as it was called among the Indians, was the Creek gathering place for winter meetings. Measuring about 41 feet in diameter, the circular structure had a raised platform modeled in the design of an eagle. After all the centuries that have passed since it was built, the outline of seats surrounding the interior and the form of the eagle are clearly distinguishable. It is estimated that the lodge was built from 500 to 1,000 years before DeSoto came to Georgia. Upon excavation into one of the largest mounds, it was discovered that one mound had been constructed on top of the other, each built after a period of many years. The archaeologists made this discovery by noticing the variety of colors of clay, each color denoting a different period of occupation. 'Here were built the Indian temples, public buildings and places for fetes. At this same mound a stairway with 14 steps has been uncovered. This in itself is an unusual discovery, for, quoting scientists, "true stairs, developed in perfect step formation, have not been found north of Mexico and 'Central America, Where we know the Middle American Mayan and kindred peoples built stone stairways and balustrades ascending to their temples on tops of mounds." Another mound has caused unusual interest. It is the only spiral mound yet found. By starting at the base, and continuing to follow the path, one suddenly reaches the top without having realized he was climbing a steep structure. INTRODUCTION 13 Georgia as an ideal >8jX,Sd thfS?aangSsSbi "ties included the entire 5TM ^TeaeiSrSt Macon'hSd on! fo farmers of other states man, Xe inducements that duTckly drought farmers to this section. Fort Hawkins Beginning with the farmers of North Carolina, the exodus of people started toward the center of Georgia. It was not long before a little community had grown up, and the pioneers, sensing .thefnY the Tand of this fertile territory, turned their eyes and their efforts to the land beyond the west bank of the Ocmulgee. 'Thus was built the city of Macon, named for Nathaniel Macon, a statesman of North Carolina, who, at the beginning of the 19th Century, was a prominent figure in the U. S. Senate. The city was incorporated in 1823. It was ruled by a commission form of government. That these first commissioners were extremely far-sighted is seen in Macon's streets of today, for their commodious width is a great advantage in traffic handling. They gave to this city one of the finest systems of parks in the South. In 1826 Macon had 800 residents and 32 stores, and was receiving cotton from 16 counties. The following year the first steamboat made its way up the Ocmulgee and docked at Macon, showing the possibilities in river navigation. By 1831 Macon had 200 homes and four banks. In 1832 an agricultural system was organized in Macon. This was a forerunner of the present Georgia State Agricultural Society. Macon was still a young city when Mercer University was chartered in 1833 at Penfield, -Georgia. This institution was to move to Macon m 18 a, and became one of the leading Baptist institutions of the South. Georgia's first great political convention was held in Macon, Aug. 13, 1840. It was for the purpose of ratifying Harrison for President and Tyler for Vice-President. The gathering was the largest ever held m the South up to that time. Fourteen thousand people are said to have attended this convention, coming to Macon on a few short lines of railroads, on horseback and in horse-drawn and ox-drawn vehicles, some from as far away as 8U miles. Macon's first railroad train, consisting of an engine and two passenger cars, made its initial run to Forsyth, Georgia, a distance of 25 miles, on Dec, 18, 1838. Up to 1836 women all, over the world had been taught at home by their mothers, or by private tutors, but in this year a plucky band of Macon pioneers, who had been discussing the matter for some time, succeeded in 14 INTRODUCTION wresting $25,000 and a charter from the State Legislature. Thus began the Georgia Female College, now Greater Wesleyan, which was the first chartered college in the world for women. The main building was completed in 1839, and immediately 100 eager, ambitious, industrious young ladies entered the portals of the new college. In 1840 twelve of them were graduated. Miss Catherine E. Brewer, who afterward became the mother of the late Admiral Wm. S. Benson, was the first on the alphabetical list, and has, therefore, been known as the first woman college graduate in the world. Sidney Lanier, the South's beloved poet, was born in Macon on Feb. 3, 1842. A graduate of Oglethorpe College, he worked for a year at the Macon Post Office and was for a time an instructor at his alma mater. He served in the Confederate Army. Following the war he plunged into his life's work of music and poetry. His fame has since spread until he is now considered the most celebrated man that Macon ever produced. The Georgia Academy for the Blind came into existence in 4851, the State Legislature appropriating $80,000 for erecting a building in Macon to house this institution. During the War Between the States the buildings were used as a Confederate hospital and the institution was moved to Fort Valley, Georgia, being re-established here in 1865. At noon on Dec. 1, 1860, the Ordinance of Secession was passed in South Carolina. Precisely at that hour 100 guns were fired in Macon. The people rejoiced, believing their political independence was heralded. Two companies of Macon soldiers were called to the defense of Virginia far Confederate service, arriving in Norfolk 31 hours later, and having the honor of being the first troops outside of Virginia to arrive in her defense. During the War Between the States the Confederate Government located an arsenal at Macon. Three hundred fifty workmen were constantly busy in the manufacture of shot and shell, sabers and harness. The Treasury Department of the Confederate Government established a depository here, and at one time $1,500,000 in gold was under its protection. During Sherman's march from Atlanta to the sea and through Mil- ledgeville, Georgia, the capital of the state was temporarily moved from Milledgeville to Macon. Macon witnessed the end of a tragedy as President Jefferson Davis passed through the state as a prisoner after his capture in south Georgia. Davis returned once more to Macon after his two-year ordeal of imprisonment, to receive a tumultuous ovation. Passing on, in the interest of brevity, over the progress of a growing city, one finds as a milestone the year 1917, when Macon was ordered to prepare a camp for 40,000 troops who had enlisted for World War service. The camp was named in honor of Gen. Joe Wheeler, a hero of the Civil War and the Spanish-American War. The Macon of Today Today, 114 years after its incorporation, Macon enjoys continuous progress. Cradled in the arms of the Indian fighters, the city became a hardy youngster and, although more than a centenarian, has not lived up to the abounding opportunities for expansion that exist in Central Georgia. Greater Macon's population was 64,045 according to the Government Census of 1930. It has over 100 manufacturing concerns, with an annual payroll in excess of six million dollars. Visitors who come to Macon today by rail arrive on one of 32 daily passenger trains, on five main line railroads which use the convenientlylocated $1,500,000 terminal station. Modern department stores serve the citizens of Macon and act as trading headquarters for the million people in the city's trade territory. Along the down-town streets are up-to-date hotels where thousands of convention visitors are entertained yearly. The visitors may attend their convention deliberations in a magnificent auditorium built in 1925 at a cost of $1,250,000, which has the largest copper-covered dome in the world. Its main hall seats 4,500 persons. A block from the auditorium is Macon's magnificent snow-white City Hall, where are housed the municipal offices. Macon is governed by a mayor and a board of aldermen. INTRODUCTION 15 The same wide streets are here--thoroughfares which evoke considerable praise from visiting motorists. By the same token, the parks which were incorporated into Macon's scheme of things, beautiful more than 100 years ago, still remain, only the sum total has grown materially. The generous outpouring of nature has been augmented by the hand of man. Truly Macon is as park-minded as it is home-conscious. From the old town pump, the city water facilities have progressed to a municipally-owned water plant with a daily capacity of 22,000,000 gallons of water, which is more than 99% pure. The water is pumped from the Ocmulgee River. From that day when the hardy pioneer had to use the lowly ox cart, Macon has progressed on the highway of progress to the point where some of the citizens meet their friends at the city's municipally-owned airport, rated as one of the finest in the South, and take an airplane flight to Atlanta, requiring some thirty-five or forty minutes, or to some other point. The old Georgia Female College has advanced from a paltry $25,000 structure to a pretentious plant known as Greater Wesleyan, completed recently at a cost of more than $3,000,000. The original Wesleyan building now houses the student body of Wesleyan Conservatory, which in itself is an important enterprise. Tall, impressive buildings are the daytime homes of thousands of office workers; modern, inviting stores beckon discriminating shoppers; automobiles and trucks form long, snaky lines of traffic; motorbuses thread their way lumberingly up and down the main streets; the throbbing of motors, great and small, indications of an industrious, thriving city--such is the picture of down-town Macon today. As for industrial Macon, a ride through the manufacturing district will show nine large textile mills manufacturing yarns, twines, duck and fabric; two plants producing work garments and boys' clothing; two big brickyards; a sewer-pipe plant and a tile plant; railroad repair shops; furniture factories; foundry and machine shops--the list is impressive. 16 INTRODUCTION View of Macon's Municipal Airport The visitor to Macon will see players on a municipally-owned golf course and on two private courses. The city also points proudly to its imposing new baseball plant, its fair grounds, its -Stadium, and other structures for sports diversification, making for a progressive city. Macon knows how to play--and does. To reach these points of interest one travels over a network of paved streets fifty miles they total. All the main highways are paved. Five railways operate nine lines out of Macon, with quick service to all parts of the country. Motor truck lines receive express shipments, with service of several highway express concerns represented. Commercially, Macon is the wholesale and jobbing center for this section of the Southeast. Practically all lines of business are represented, and the annual volume of business in the wholesale trade is estimated to be fifty million dollars. Macon is the cotton concentration point of this section of the Southeast, receiving, warehousing and distributing the staple throughout this territory. It is one of the largest inland cotton markets in the Southeast and is also the concentration point and distributing point for peaches and watermelons. This city is the headquarters for the Georgia Peach Exchange and all large buyers and concerns during the season. Surveys conducted by the Macon Chamber of Commerce have developed that Macon is a most logical place for ceramics manufacture. Another industry which is offered excellent opportunity in Macon is the manufacture of furniture, while the city is ideally situated for the hosiery industry and for paper-making. The thousands of acres of fertile soil in middle Georgia offer one of the greatest opportunities in the U. S. A powerful impetus has been given to dairy products by economic conditions. No state in the Union is so well adapted to such a variety of food crops as is Georgia. Both roughages and concentrates in abundance can be grown. Cottonseed meal is the chief source of protein for feeding dairy cattle. In addition to Wesleyan College, Wesleyan Conservatory and Mercer University, Macon offers Mount de Sales Academy, for girls; a Catholic parochial school for boys;_ 48 public schools in the county, and three splendid high schools in the city, to which high school pupils from the county, are transported free. This gives to all the same advantages. T!he educational system has made exceptional progress under the direction of a self-perpetuating board of education. There are thirteen religious denominations in Macon, with 115 different churches. Practically every creed known to the South has a house of worship in the city, making Macon a center of religious activity. Macon's fraternalism has descended from the powwows of the Indians in the mound city on the banks of the Ocmulgee to the distinction of having a representation of virtually every secret order in the U. S. It is justly proud of being designated as the headquarters of the Georgia Masons, who have built here a beautiful building. INTRODUCTION 17 The well-organized and efficient Chamber of Commerce is recognized as the community clearing house in Macon. Co-operating with this organi- zation in its progressive program for a greater Macon are civic clubs and other agencies, including Rotary, Kiwanis, Lions, Civitan, Masivic, Exchange, Pilot, Business and Professional Women's, Junior Chamber of Commerce, Macon Real Estate Board, Farm Bureau, Boy Scouts, Y. M. C. A., Y. W. C. A., and other trade and social groups. Weather Data Extremes of heat and oold are rarely known in Macon, and the winter season is uniformly mild. Prostrations from heat are unknown. The average year-'round temperature is 64 degrees, with a summer average of 84 and a winter average of 44. The percentage of sunshine is 63. General Facts Transportation: Nine railway lines, three bus lines, three motor truck lines, two express companies. Taxes: State, county and city taxes total $3.80 per $100 on 40% to 50% valuation. No school or water tax. Five-year exemption to new industries. Banks: Three, with $15,357,808 deposits. Theatres: Three movie, one legitimate. Golf: Country club 18-hole course; public 18-hole course and 9-hole course. Swimming, boating and fishing: Four lake-parks; numerous streams. Shooting: Gun club, fowl and small game season. Parks and playgrounds: 500 acres. Circus: Winter quarters at Central City Park. Baseball: College, schools. Football: Mercer University and Lanier High School. Basketball: Mercer University, Lanier High School League and City League. Sunday School Athletic classes: Y. M. C. A. and Y. W. C. A. Civic clubs: Rotary, Kiwanis, Civitan, Lions, Exchange Business and Professional Women's, Woman's Club. Masivic, Pilot, (morntag)aPerS: ;Macon Evening News (afternoon); Macon Telegraph Radio: WMAZ Broadcasting Station, 1,000 watts, 1,180 Kilocycles. 1900. 1905. 1910. 1915. 1920. 1925. 1928. 1934. 1935. Statistics SCHOOL ENROLLMENT 1900 POPULATION 1910 i92o 1930 (Municipality of Macon) 1924 1925. 1926. 1927. 1928. 1929. 1930. 1931. 1932. 1933. 1934. 1935. COTTON RECEIPTS . 7,346 . 8,082 . 9,397 .11,095 .13,562 . 14,543 .15,992 .17,143 .17,154 23,272 40,665 52,995 64,045 .46,387 bales .72,263 " .70,039 " .'83,616 " , .61,678 " .81,91:2 " 107,483 " .41,242 " .27,009 " .18,968 " .19,895 " .50,419 " 18 INTRODUCTION PUBLIC UTILITY STATISTICS 1926 1928 1930 19321 Electric Consumers 9,600 10,500 9,674 9,285 Number Telephones .. 9,084 10,216 10,624 8,784 Water Consumers 11,800 14,000 13,200 13,504 1934 10,200 9,257 13,764 1935 10,772 9,724 13,896 1920 1921 1922 1923 1924 1925 1926 1927 BUILDING PERMITS 1928 1929 1930 1931 1932 1933 1934 1935 $1,434,414.00 930,136.00 1,579,313.00 1,502,883.00 1,761,617.00 1,745,026.00 1,757,649.00 2,895,871.75 1925./ 1926 1927 AUTOS AND TRUCKS REGISTERED 7,400 1928 1933 1934 111,336 7,950 10,563 The Macon Junior Chamber of Commerce The Macon Junior Chamber of Commerce was organized in 1922, and the charter was granted in 1923. This organization was formed to promote good-will among the young business and professional men of Macon, broadening their acquaintance with one another, to strive to further business leadership in Macon by recognizing the necessity of industry and personal development, and to promote study and discussion of Macon's activities along lines of finance, commerce, industry, schools, churches and civic affairs. ACTIVITIES: Sponsors G. I. A. A. Basketball Tournament each year. 1924, pledged $500 to Greater Wesleyan College. Sponsors opening performace of Sparks Circus. Sponsors each year some of the football games of Mercer University. Each year entertains the honor roll student of Lanier High School for Boys. Was the first Junior Chamber of Commerce to own and operate its radio station. 1925, sponsored S. I. A. A. Tournament. 1925, equipped a room at Smithsonia Tubercular Sanatorium. 1925, sponsored Fire-Prevention Week. 1926, sponsored performance of Will Rogers. 1927, built nine-hole Lakeside Golf Course, now being operated by the organization. Donated books for the opening of Washington Memorial Library. 1927, sponsored performance of Mercer Glee Club. 1928, sponsored Southeastern Air Derby. Built hangar at Miller Field Airport. Sponsors City-Wide Golf Tournament each year. Sponsors City-Wide Tennis Tournament each year. Sponsored "Light-up" for Christmas project several years. 1929, sponsored Southeastern Aeronautical Exposition. 1929, sponsored new Cherokee Golf Course on Columbus Road. 1929, sponsored National Air Tour stop-over in Macon. 1930, sponsored concert Sousa's Band. 1930-31, sponsored Southeastern Sand Greens Tournament. 1932, sponsored performance "Smiling Ed" McConnell. 1932, sponsored opening game of Macon Baseball Association. 1932, donated dental chair to Dental Clinic of Macon Pilot Club. 1932, sponsored squadron of bombers brought down from Langley Field. 1932-33, sponsored testing brakes and lights of autos. 1932-33, sponsored selection outstanding citizen. Donated $25 to Goodfellows Club for Christmas several years. 1933, sent sponsor to the christening of dirigible "Macon." INTRODUCTION 19 1933, sponsored and operated "Curiosity Store" for unemployed. 1933, donated scholarship to Mercer. 1933, built double tennis court at Tatnall Square and donated to city. 1933, ' purchased tract of land up later deeded to the Government, and, with help of citizens, was able to secure National Park. 1934, joint sponsor for W. L. Stribling Memorial. 1934, entertained Mr. and Mrs. Jimmie Haizlip, noted pilots. 1934, sponsored City Marble Tournament. 1934, sponsored coaching school at Mercer University. 1934, sponsored Red Cross Roll Call. 1934-35, sponsored Macon Civic Diamond Ball League (owned by Junior Chamber). National Ocmulgee Monument (Written by Charles C. Harrold, M.D.) Ancient Indian mounds and village sites and buried pit houses of extremely early cultures exist for at least twenty miles below the city limits of Macon. Macon citizens have long desired that parts of this site be converted into a park. The Macon Junior Chamber of Commerce commenced in the fall of 1933 to try and convert this desire into an accomplished fact. Through the cooperation of the Smithsonian Institution, the Macon Historical Society, the Society for Georgia Archaeology, and city and county governments, lands have been acquired, and 650 acres are now being donated to the Federal Government for the creation of this national park at the gates of the city. A partly underground council house and neighboring extremely primitive underground pit houses exist in addition to the customary mounds. One tract of forty acres contains a typical "Ancient Creek Village" as described by Bartram, with its square mound and its truncated conical mound leaving a unique ascending spiral path. The circular council -house illustrated above is the only one of its kind yet round m the Southeast, and resembles t'he protokivas of the South- W6St>. has The had entire FERA tract is now the property labor constantly working of the U. S. on the site Government, which since Dec. 20, 1933. From 50 to 600 men have made here the most extensive archaeological ex- plorations ever undertaken in the country, yet the work to be done is ex- tensive. Work has been begun on the restoration of the Council House, cut of which appears above, which is to be reconstructed as nearly to its original state as possible. Visitors from all parts of the U. S. interested in the subject, come daily to view this extensive and most interesting archaeological project, making of it an asset of great value to Macon. ABBREVIATIONS aaaaaaAaaaAaadtcggplprssmnsccvmstrptsdlshttnrbttl...r.................AaaaagsadcpasaArpcasviaastpcmtoosrrseeucrtecsurmeenhmtliianrinaatsdigsiuetttblttcaiaeialenirlnoeacnnnanectgynnesttrlttt bacaabbCbbbbbbbccbbbbccccceccccccavltuogadellklikaloahlhlrooorlhorrtdvvkkkdsnkekbmttgprmmpmnbyfmalohgdsmprlrmtltdrunrnmmylpnkfndrntrrik.rt...hr...............c...c.o.bcab.mbobcabbbcaobobmgloouiomicccanmrlbgrmotoohocabpaeciboaeioakkcuCoctnamrcbrcutksmbaketmgtaokmkpbalmulsdalvuoitshreeleirbeemwelipleiosaucfcmeseirdumdaovnamaaeclrhflntsnblnhccnoekecirdiyandkeaipneiiitnttineaiccvauectioereuitereeeoeoeeleeaeyghnnhnngihdkeeknrrrrrrrrrrrfrrllr ddcccdcccddddddcddddioootoeretooeoiiiimrvrsscrplfnnrnpmrptttnrsfttsae.rrrsm.st.'.r.n..........d...c....idotc.etrododr.mccddneeiooicsrpfodsodaepnndtanpoadrcfeosditrcsampdvtrcitultneostcaisidtmhiseulropvdcmestorctaraaotrninihsueeeitumttloninvatoreeenentoecringyyneerecrrrrttrtrt deeeellrleeesoccmcrttnrkEor .......eldeercleeetslcresotcmrttiyEracipkicaaeeasnrrtl eeeeeeeeeeelmmmnsxxxsnetpgepcgvppbmhmrdprnalg.o.ey...y..m..eeemnxtepebeeaxeerrnneesmolcagexgsthgeipvsrdpisaeanmlsaertnnovieaetrgdcayoeeetsyneeeerrsrr fffffffffffgggghggeuolotnuutroeddrgarttrrrosrrnysvmsnwmnnnhfltrgntrnnrsfrum....r.s..n..ishhfgfuoeoorufdvrgnufsegfefaofigelwrafrisaarrhngennrrshdgcgoeoeonrififmieotmmmstoioliflenouttnghoodecmtrtgaaradreeeheoeneaynnnsesrsrrrrrtltt hhhddaairrdsrsr.. h. ehaadiqrduraehrsatsenerdsr hHhjhhhliiiiijiilkrbmnmnwnannsdonlptbpscrsetsswsglprppktprrrltrrrptres.rvi.n..t..e.rihnnioacmuiliohninpsirnlahsmHrselpjrslejehtoukaekdouhprempvasrueuwbermweieoeanpeganeecolcnenrgippanbthpittrttleuocooreeteeeeatee'deseersrrrrrrrlrrr lmlllllmmniinitnteddeddahoucrcsroytheshm..n........llmaituehlmlinrmoaecdlguauheilrncrntciayeamohhdnmnptiardiynhaetniapeinsesisndeecsrtt mmMeeecrthl... Mmetemrcoehpraocnlhiictaaannlt mmmpmmmmmmmmmmmnmnnnnPNppooopppppp(pppppPppplwespraksSpdhhkhaoilklOrurnnrufkkglsfstlsaumstopesidg)wrtrnoynlrasornshttertrtntfr.mssdrrrlrtsorrog..rbryotm..mrcnr.gmN.....h.pa....rem.s..r....c.m.Po.t.m...ph.ae....puhnrua.enbpousnrmmlmphitfpmnutonipcpoNmpypaocaaepohoosfomoopporgeprctslm rrsaptammpatmpyerprasnloeiaemSptcssmtrorpciuerttnoNttehsnspauaoslaoeeolhhhaokcaiorutadpmiiilcwrawitcnaooamptnpnrumdpahcsoudcfrsiewlattnedyliicghknsfdkgenhuehangiaurknoabiprsaenterlptlaadiiaeaeeeeeotaencreieaitaeeeeceoeeeenstassgnhencchnkeyrrerrrrrertrrerrllerrttrrlrrttlt pppprRrppppprRrrrredeeereurrutrurD'proospcsoasbbCrnmrfpvftlclrdmr.rhn.nrre.....e.kn...sR...,s.rt.....R.i.o....d.....r..m.up.....ee......rap.saaptprrnprtlprpreeueeoepppuerrarsrrCsDprosrurobeelncetosavcblpanehamfsifreiiletrltesuasroesihiiaishramemsvsvisoreototohkdiiasieitamlnnaaannvooeeenritnnggdcgyessrerrrrt RsrsRRsssssssssssssstssssssssstsstseeapeteeeacolshcmqttlowututtlueRywyseeslratanmscvhlrlchivlppesrwoMmrnpgsramtgrtgevtrctfitanneSroltrhgtswrn.imSr..og..a...s...nn.y..u....a.s...Mps.ra...tsye.lesRaae.ssrstnslisietseswtsstesluneomeoesaossroeRsesasepaiStgesallehmsuunoctwultveeessaameuseaonercrseitprgtlStotprngensiprqgshaorcvahshirtehaileeivfcegrtcohyvrpapdtmhuwewmcinmtetslrecatiaintieaougpiitioahheaeeiaeasttnicntoearapaogdrantoeneeosraotneeseeiyedsyhnygnnyhnnesselrerrtlrltrrrrrtt ttttttuttuemwmrnrrpnaaerdphdksvanrotptssrklrr ......tr..anuutsipnmpttthtdrrooeeoeaewtrakavtelrtemsneasrtetnareustlesaikidhprrtonceeeeieenpgerrrrrr UUwUUvvwwUeuSShSShUtlsAnoNMocneilrtmiCeteWdn.d.wUUMSanSnrtiateaitartvehvtietwedunoeedsltuhescesoSSareCAliNntWetmnaoarisaamzttraaeveerpelnsyyyssesrt wwwwywyddiskktdmcmsrhnsmtrn .. .. ywaryawdatwmcerwwdhsoaitmmodrsskriotaadkeewnnesrr ABBREVIATIONS OF GIVEN NAMES AAAllbefrrxaeahdnadmer .......*..3 AAAleblxfr Archibald Arch Arthur Arth August Aug Benjamin Benj CCahtahrelersine DEdawniaerld EEuligzeanbeeth Frederick .... CChaaths DEadnwl EEluigz Fredk George Geo James Jas JKoastehpehrine .... KaJoths MMiacrhgaaerlet .... MMaicrghlt Patrick Patk RWRTTSSSoathhioeicmleoblophlomemiuhadareeratmoodlnsnre RSSTTRtiWacehhSomhpeobordhoasitl SPECIAL ABBREVIATIONS B Bellevue p,\X CCCoPHfGaRy CentraClheoCrforkuGemeeoprHsgeiaPigahRrtkys EGX MS&FRR.. .Georgia Southern & FlorEidaastIRnagMillearsocioaddne PS SM SBT&TCo gSouRy LIMCDH&tsSRR ]SNthHts Macon, DubliLnoNg&NoCraStpahaibveiarnHninHgHaheehliiaggnRhhdttRsss yU ' * WH Payne Mills Public Schools South Macon Southern Bell Tel & Teleg Co SoutheSrntinRsoanilvwilalye Tybee UVniionnevviillllee Western Heights 25 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 POLK'S MACON CITY DIRECTORY 1937 Copyright, 1937, by R. L. Polk & Co. For List of Abbreviations see opposite page Alphabetical List of Names Aaron Casandra (c; Mary) lab h207 1st av (U) Aaron Hubbard (c) delmn John Timothy r361 Madison Aaron Ida M (c) student r361 Madison Aaron John (c; Annie M) porter hl024 Main (EM) Aaron Ralph S (Myrtle L) policemn 'th 748 Montpelier av , \ / \ fc. Aaron Thos W h740 Mbntpeflie# av , \ \ Aaron Walker (c) disfir.. wkshsr Hotei Laniar tr248 Powell ((DM)' Aaron Willie M (c) cook h361 Madison Abbott Chas C (Ada) sheet metal /wkr Bartlett Sheet .Metal Wksbr'.RD 4' Abbott Wm B (Aletha) tiifemtth Macon Neon Sign Co hl053 Walnut Abel Albert K (Rosa A) h763 Blackburn (NH) mach Co"f\G>R y Abel Albert K jr student r763 Blackburn Ab(eNl HA)lma R (wid Fred T) L724 Mont- pelier av Abel Annie A student rl059 Hazel Abel Carrie M (wid Lovick) hl57 3d Abel Crist W bill deliverer Ga Power Co r402 Montpelier av Abel Gladys I minute elk Superior Court r749 Blackburn t(NH) AlBJlacHkbaurrryn (bNH()Leola. T) carp h707 Abel Ice Co (Wm W Abel) 320 Mont- pelier av Aav Ida (WW L0Uls R) h772 MontPelier Abel Jas B mech Stroberg Body & Fender Works Abel Louie W mach CofGRy Abel Lula R sten Bateman' Co h615 Duncan av Abel Margt E slswn rl57 3d( Abrel6l 7M3ilddred E slswn Dannenberg Co Abre7l24SNidiMcnhoeoynltapWselRi(eEr t(hIlanevel zM) )mgarcoh97C0'oOfGgRley- thorpe hl0&9 Hazel Abel Wm W (Martha M; Abel Ice Co) h 402 Montpelier av Abercrombie Clyde H !r661 Elm Abercrombie Jas E (Laura M) trav slsmn hl014 Ash AAbbr5ee4rrcc3rrooOmmrbbaiineegWeMmaarpyCt A2jr0Brli6iv6e1 sEtolcmk 9531 3d Abernathey Beni (Martha) millwkr Wil- lingham Cotton Mill h rear 102 (10) Duncan av Able Georgia (c) cook hl27 (123) Williams la Abney Guyton G '(Josephine B) cash City Bank & Trust Co h3401 Houston rd (SM) Abney. M^ibts. .(Mae) asst bkpr Colem'to-Meidow^Pate Drug Co r739 Or- .-bmjoociVre F&annGieolsMan Mr'3rs79'ofOfircaengsee'c BazeSPO r3401 Hous- krtist r2241 12233) vauHa-odiuisswtonnfeafve)lh(aBmM)(Cahnadrlo2t2t4e3) 2gdroh22294918 , (22331` M' - Abraham Naseem student r224l (2233) 2d Abraham Philip student r2241 (2233) 2d Abram Andrew (c; Flora M) lab hl21 Walker la Abram Anna (c) lndrs rl23 Walker la Abram Beatrice (c) cook rl23 Walker la I Abram Daisy G '(c) tchr PS h328 2d av Auburn av Adams Lizzie (c) lndrs h227 Collins pi Adams Lizzie (c) maid Arlington Hotel 161 (162) Hazel Adams Louis (Katie L) hl914 Broadway Adams Louis D (Marv C) slsmn Builders Lbr Co rl35 Napier av Adams Lula- ismstrs rl016 2d Adams Lula P r99 Coleman av (CH) Adams Mamie (wid Beni T) rl23 Oak 'Haven av Adams Mamie M (wid Wm) h965 Walnut Adams Manufacturing Co Danl D Adams pres Ralph Adams v-pres J alder Bond sec-treas clo mfrs 7 Express West AAddaammss MMaanrtgat Mrl3s3tudPeanrkt wr4o2o1:dAadva1ms Adams Martha Cc) student r310 (210) Bay Adams Martha D Mrs tchr Wesleyan Conservatory h356 Hardeman av (V) Adams Mary (c) lndrs h40'2 Richard l(TJ) Adams Mary Mrs matron Methodist Orphans Home r201 Pierce av (V) Adams Mary A tchr r401 College apt 3G Adams Mattie (c) maid Riverside Cem- tery rl06 Wise av (V) Adams Merritt (Alma) farmer r315 Cut- ter's Green (EM) AdMamfgs CMoerhr2it0t6 APe'(aLcuhctyre)e m(iEllMwk) r Bibb Adams Minnie (c) maid rl621 Broadwhy Adams Nelle (c) millwkr Bibb Mfg Co hl24 Coleman al Adams Nora (c) cook r211 Middle (V) Adams Oscar C (Cora) slsmn Sou Shoe Shop h911 Orange Adams Railey J (Dorothy T) agt h322 Forsyth ' AdMamfgs CRoalph6h56'(ECliozlleRlg)e v-pres Adams Adams Realty Co (Chas M Adams jr, IHomer M Morris, Hansley T O'Neal) '504: Mulberry AAddaammss RRiicchhdd '(cW) lab(Drol0ri2s7) Csollslmegne dr!r66 MagnoliaAdams Robt (c; Louise) loco firemn rl05 (237) Elbert (SM) AdCaomshiR0o3btG(rEeestnelle(P) Mm)illwkr Bibb Mfg Adams Robt A (Alice) millwkr r58 (13) Roff Home pi Adams Robt B student r202 Buford pi Adams Rosa (c) h446 O'Hara la Adams Rose `(c) maid h30i9 (506) Plum- mer's al Adams Roy (c) r310 (210) Bay Adams Ruby (c) student r556 Broad (E AdMa)ms Ruby tel opr r873 Orange Adams Ruth (c) student r300 Bowman (EM) Adams Sadie M (c) maid rllO (295) Craft (V) ... Adams Sami (c; Lizzie) lab City hl41 (135) Hazel Adams Silas W (Leota K) millwkr Wil- lingham Cotton Mills hl4 (82) Mill Adams Sport bellmn Hotel Lanier rl21 New _ AdMam) s Susie (c) lndrs hl04 Cowan (E Adams Thos (c; Ella) lab h961 Hazel Adhaim23s%Th'oCsotMton(Haavttie) mach CofGaRy Adams Todd L (Clynton H) elk h801 Patterson (NHts) Adams V Jas (Ella) lawyer 516 Mulberry R501 h70'4 Date av Adams Virginia D student rl03 Cabaniss av (EM) Adams Warren E (c; Ida) h518 Clinton (EM) Adams Wesley E (Minnie) hlOl (100) Peachtree (EM) Adams Wm (Maxie) fctywkr Bibb Mfg Co hl3 Bellevue rd Adams Wm G student rll2 Plazai Adams Wm ;l (Ouida) slsmn Bailey Auto Parts r418 Walnut Adams Wm P (Maxie) millwkr Bibb Mfg Ad'Caomsholn3 BBeettlileevEue(wrdid Henry) h324 Pio Nono av (V) Adamson Clarence H (Sarah) hl25 Peachtree (EM) Adamson Louise r324 Pio Nono av (V) Adamson O'Gean sten Sou Mortgage Co Inc r763 2d Adamson Sarah Mrs mach opr Dixie Roll & Cot Co Inc rl25 Peachtree (E M) Addison Jas D (Martha E) trav frt agt CofGaRy r699 Anderson (SM) Addison Lola (wid Wm T) r610 Elm Addison Mildred V (wid Steph A) h.326 6th av (SM) Addison Oliver L (Nora F) slsmn Coleman-Meadows-Pate Drug Co h572 Hillyer av (CP) Addison Roger C elk CofGaRy r326 6th av (SM) Addleton Armond waiter Spiller's. Restr Addleton B Otha (Mattie) millwkr Wil- lingham 'Cotton Mill r212 (17) Holt av (NHts) Addleton Bennie L car repr CofGaRy Addleton Horace auto mech r757 Pine Adtodnletonnr JRoihvnerPrd(Fr(aEnMce)s) lab h ClinAddleton Lee (wid Jos) millwkr Wil- lingham Cotton Mill hl28 (16) Holt av ('NHts) Addleton Marv Mrs r208 Washington av Addleton Mary M (wid Robt E) r446 Vine (NlHts) Addleton Pearl M millwkr Willingham Cotton Mill rl28 (16) Holt av (NHts) Addleton Sami B (Willie B) baker Am Bakeries Co h'620 Plum apt 3 Addletop Seaborn J (Ola) millwkr Willingham Cotton Mill hl50 Carling av Addleton Victoria (wid Paul M) r212 (17') Holt av (NHts) Addy W Jason (Ada) rl29 Appleton Adelson Herman E (Ann B) dept mgr Darling Shop r909 Napier av Ad(e2r2h4o) ldLtoEg rnCeasbtinMdr(Fay) slsmn h225 Adkins see also Atkins and Linen Service DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of tiie Directories oil Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information yon are nnable to procure else- where, call on ns R. L. POLK & CO. DETROIT 28 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 Adkins Alice (wid H Giles) rl413 'Edge- wood iav AdSkipinrisngJeremiah (c; Addie) lab h67 Adkins John (c; Fannie) janitor FS h lOOd Oglethorpe Adkins Jos C (Margt M) driver h5'57 Oglethorpe Adkins Lula (c) maid hl04 (304) Mag- nolia Adkins la Luther hlpr Toole Furn Co rl;59 Broad (EM) Adkins Noah (c; Viola) millwkr Bibb Mfg Co hl48 Ballard (EM) Adkins Sally (c) lab hl'58 Broad (EM) AdMkifngs CSotevhe1n227(S2ardah) millwkr Bibb Adkins Thos millwkr Bibb Mfg Co r771 1st Adkins Thos C elk Central Sash & Door Co r371 1st AETNA CASUALTY & SURETY CO OF HARTFORD, CONN, John E Wilson & Son Agents, 702-703 Bibb Bldg 403 Cherry, Tel 214 (For further information see bottom stencil and page 18 Buyers' Guide) Afro-American Life Insurance Co (c) John H Hulin agt 556 New !R406 Ahern J Francis news service 553 Broad- way r do Aides Danl W (Minnie) h218 Reid (SM) AiHdsouFsrtoannkavR I(I(SNMa)ncy) h4009 (4099) Aids June C checker r4009 (4099) Houston av (SM) Aids Robt F bkpr r4009 (4099) Houston av (SM) AAiikdesnWEileCylamckae(hAdra lLl ) 2dagt Industrial Life & Health Ins Co hl30 Appleton Aiken Eula (c) rl97i Division St la Aiken Golden (c) porter r779 Reynolds al Aiken Ira P (Ola B) drapery hngr h322 (423) Log Cabin dr Aiken J C (Leila S) lino opr Macon Evening News h517 Log Cabin blvd Aiken Jas H rl20 Appleton av Aiken Jenny (c) h221 Carters al Aiken Josephine student rl20 Appleton Aiken Mary (wid J T) r322 (423) Log Cabin dr Aiken Ola B Mrs supvr Snow's Lndry & Dry ClngJCo h32:2 (423) Log Cabin dr Aiken Wm P (Mae) duirymn r3501 Houston av (SM) Aikens Will lab Taylor Iron Wks & AiSnuspwoCrtoh rWl2m4 WNycRheev (Mary) pastor iVineville M E 'Church (South) h401 College apt 6G Akeridge Wm (c; Della) lab CofGaRy h20O (413) Thompson al AKERMAN CHAS (Sara D), Lawyer 410 Ga Casualty Bldg, Tel 369, hl06 Cul- ver (V), Tel 1516-W Akers Sami l sec to faculty Wesleyan Coll r Rivoli dr Akers Wm D (Mary E) mfrs agt 403 Cherry R704 h Rivoli dr Akin Alice (wid Wallace) r415 Mont- pelier av Akin Robt (c) lab rl020 College dr Akin Rosa (c) lndrs hlO20 College dr Akin Sallie M librarian Washington Me- morial Library h401 College apt 6iH Akaivns David H electn rl25 Washington Akins Emma (c) maid rlOl (312) Craft (V) Akins Jas (c; Rachael) forkmn h414 Hazel Akins Otis (c; Willie M) lab Macon Gas Co) h527 Grant Chapel al (SM) Akins Otis jr (c) r52T Grant Chapel al (SM) Akins Wm (c) lab h'537 Grant Chapel al (SM) Akins Wm (c) porter United Cigar Stores Inc rl020 College dr Aki&insCWhaimllibser(sc; rA22d8dieJoLn)esporter Rivers Akridge Cleveland (wid Robt) smstrs r 216 Bright (SM) Akrrli3d4ge(5J5)RiHleyydrmoliilalw(kErMB)ibb Mfg Co Akridge Nunar (c) hlO'5 (504) Campbell av (SM) Akridge Sami N (Sicily) millwkr Bibb Mfg Co hl34 (55) Hydrolia ('EM) Akridge Wm (c; Willie M) lab rl05 (504) Campbell av (SM) Akridge Willie M (c) cook rl45 (504) Campbell av (SM) Albea Eva W (c) maid hl08 (512) Camp- bell av SM) Albea Robt (c; Lucy) lab hl016 College dr Albea Wm L (Arlis P) service rep SBT &TCo h!357 Oglethorpe AAllbbeerrtt HNeartmhaann r(lE2t2heFl)ortjuHnikll h(lE2M2 )Fort Hill '(EM) Albert Simon rl22 Fort Hill (EM) Alberts Virginia tchr Central City Coll Alrbl0in'35JoChlnintWon (rAd nn(EaMB)) rl328 3d Albion Apartments 920 College Albright Ferris L (Grace) mech Fire- stone Auto Sup & Serv Stores hl63 Spring apt 1 Alderman Rose (wid Wm B) r455 Carling av Aldermon Verletta checker r427 College Aldred Florence S (wid Robt S) hll4 Clayton (V) ALDRICH FRED N (Bernice), Physician, Eye, Ear, Nose and Throat 420 GTeelor3g3i8a7, Cha6s5u1alRtyidgBeldagv, 5T16el M13u5l4berry, Aldridge Mary (wid Geo) r39 Melrose (B) Alexander Albert (c; Lillie) h412 Peachtree (EM) Alexander Amos A (c; Pauline) lab h'954 Hazel Alexander Betty student rl27 Boulevard (NH) Alexander C W (c) restr 115 Telfair h do Alexander Carolyn (c) tchr PS hlOO Empire av (V) ALEXANDER CATHEY Y (Eliz W), VPres Willingham Sash & Door Co, h 127 Boulevard (NH), Tel 874 Alexander C!has B (Carolyn E) formn h 300 Hendley (NHts) Alexander Chas B jr student r300 Hendley (NHts) AlDexuanncdaenr aCvolister L (Alda P) elk h442 Alexander Della F Mrs h412-411 Ayers rd Alexander Dove r2604 2d Alexander Ethel L (wid John C) hl301 Montpelier av Alexander Eulalie elk Schofield Ins Agcy Inc rl301 Montpelier av' Alexander 'Eulalie T Mrs elk Union Dry Gds Co h'619' Forsyth Alexander Geo W (Josephine P) stores kpr CofGaRy h?50 CQrtland av Alaevxan(Vde)r Harold (c) student r264 4th Alexander Henry C slsmn A G Rhodes & Son rl40 Georgia av Alexander Jas (c) porter New York Clnrs r322: (312) Monroe av (V) Alexander John C slsmn X V Clothes Shop rl30'l Montpelier av' Alexander John F student r483 Orange Alexander Lois T student r619 Forsyth Alexander Louise (c) cook hl(J3 Pond (V) 29 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Alexander Lowell C (Ruth L) hi08 Napier av Alexander Martha E (wid Thos L) hl57 iWilliams (SM) Alexander Myrtle R Mrs instr City Play Grounds Supvr h483 Orange Alexander Pauline slswn Mrs Leah M Atkins rl50 Appleton av Alexander Penelope student r619 Forsyth Alexander Roht (c) student rl03 Pond (V) Alexander Robt J (Ruby) auto mech Am Bakeries Co hf>01 Orange Alexander Roosevelt (c; Willie) pntr r 412; Peachtree (EM) Alexander S Frances (wid John A) alteration wkr Burden Smith & Co r 130 Appleton av Alexander School No 1 670 2d Alexander School No 2 Mabel H Harris Alperxiannd8e3r6SCchoolloelgeNo 3 117 North av (N H) Alexander School No 4 1231 Ridge av (V) Alexander Viola (c) cook r330 Ward (V) Alexander Wm C loco eng r371 1st Alexander Wm H (c; Lenora) carrier US PO h264 4th av (V) Alexander Wm H (Susie) slsmn h261 Georgia av apt A2 Alexander Wm P (Sallie M) plmbr h415 Forsyth Alexander Winnie Cc) lndrs b.235 (110) Moore la Alford Beulah M rl25 Willingham (EM) Alford Elijah (Eliz) hl25 Willingham (E M) Alf1o08rd (H16e2n)ryVDirg(icn; L(Vuc)inda) elev opr h Alford Mattie Cc) lndrs h405 Chestnut Alford Robt (c; Mamie) lab h464 Chest- nut Al(fVri)end Foster (c; Clifford) h221 5tih av Alfriend Hath student r934 Vineville av (V) Alfriend Kyle T (Katie C) h934 Vineville av (V) Alfriend Kyle T jr (Esther R) slsmn Brown & Groover b636 Orangei Alfriend Louise Contract Co hS'63M91 rsFoorfsfyicthe sec Motor Alfriend Malcolm c (Louise S) bkpr First Natl Bank & Trust Co h639- For- syth Al(fVri)end Mary W tchr r934 Vineville av Aliphant Amelia M (wid Jas T) r2515 Forsyth rd (V) All States Life Insurance Co Collos R AlDleanvisA mOglirve5r69(yG2 laCdhyse)rrymillwkr Wil- AllliennghAadma C(co)ttro4n SMouiltlh hBio1u18ndAarsyh Allen Alf Cc) lab r488 Short al (V) Allen Aline sten r702 Holt av (NHts) AAlllleenn AAllolennzo(c()c;laRbohs2a1M8 )Falargbars2o2n1 ((V20)2) Pear (EM) Allen Anna (wid Thos) h327 Columbus Allen Annie Cc) cook hl03 Clemons la Allen Annie millwkr Bibb Mfg Co r457 New Allen Annie E (c) maid r500 (714) Campbell av (SM) Allen Annie M elk rl26 Lawton av Allen Aubrey M (R B Allen & Son) r'512: 2d Allen Benj Cc) lab rll Buckner al Allen Carl P (Ethel) mach hllO White- head (SM) Allen Carlos (Carrie B) carp h2085 3d Allen Carnell (c) porter x7'5 Schofield Allen Carrie (c) maid h401 Charles (S M) Allen Chas (c) delmn Wm T McCreary rl064 Oglethorpe Allen Chas R (Christine) slsmn r220' Bright (SM) Allen Clara (c) lab r655 Oglethorpe Allen Clara W (c) student r218 Fargason (V) Allen Clarence (Grace) lab rl21 Ell (S M) Allen Claudia Mrs waiter r718 Mulberry Allen Corinne Cc) r372 Monroe Allen Custus A (Corine F) h620 Plum apt Allen 1 Dotha elk rl06 Capitol av1 Allen E Angeline Mrs checker Snow's Lndry & Dry Clng Co r758 2d Allen Earl (Louise) meat ctr rll4 For- AlsleynthEdna cash Robt S Freeman r224 Georgia Allen Edna millwkr Bibb Mfg Co r507 Calhoun Allen Edw Cc) lab r500' (714) Campbell av i(8M) Allen Eliz Mrs elk Crescent Lndry Co r 723 1st i Allen Emily private sec h401 College apt 4H Allen Ernest C (E Angeline) barber 318% Dannenberg av r758; 2d Allen Eva student rl06 Capital av Allen Eva Cc; Mary) swtchmn h427 Lib- erty (SM) Allen Evelyn r860 2d Allen F Ruth tchr PS rl04 Rembert av Allen Floride fctywkr Bibb Mfg Co h8 Lake City (EM) Allen Frances (c) maid r221 Orange Allen Frank Cc; Sarah) lab r500 (714) Campbell av (SM) Allen Frank M (c; Gladys) hlpr Atkins Bakery r68 Forest av (V) Allen Garnell (Essie) millwkr Bibb Mfg Co rl222 2d Allen Geo auto mech r2014 2d Allen Hansel fctvwkr Bibb Mfg Co r8 Lake City (EM) Allen Harry L (Florence) dir Cynthia Weir Park h314 Cutters Green (EM) Allen Harry T (Martha) dir hl04 Berk- ley dr Allen Henrietta (wid Chas W) rl04 Berkley dr Allen Henry E pharm Highland Pharm- acy rl06 Capital av Allen Henry F (c) rl064 Hazel Allen Henry S (Zelda) pntr CofGaRy r 1641 3d Allen Hermie O (Leona) lab hl21 Gar- den (EM) Allen Ira O (Frances) h516; Montpelier av Allen Irving Cc; Johnnie) cook hl30 4th av (V) Allen J Sydney (Elnora) elk Rogers Stores h5Q7 Calhoun Allen J T elk T M Rainer Gro Co rl26 Lawton av Allen Jack rl21 Garden (EM) Allen Jas (c; Tempie) hl04 Empire av (V) Allen Jas E electn rll5 Jones av (EM) Allen Jas O (Thelma) slsmn Dannen- berg Co h91 Clayton CVI Allen Jas W (Lizzie) gro 852 Hazel h do Allen Jane (c) rl21 Penn av (V) Allen Jessie (c) r356 Monroe Allen Allen Jessie Joel C(1c)(Rcuoboyk) r519 Calhoun mach h614 Log Cabin blvd Allen John Cc; Ethel) lab hl20 Virgin (V) Allen John millwkr Bibb Mfg Co r270 Main (EM) Allen John A (Irenee) millwkr h201 Grand av Allen John D (Eliz) prof Mercer Univ h505 Adams Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? Is Answered By the Classified Business Lists In this Directory 30 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Allen John Q r201 Grand av Allen Jos (c) lab rll22 Broadway Allen Jos Cc; Louise) shademkr Union Dry Gds Co rllO (172) Bartlett AlTleunrpJiundg(eT)(c; Bertha) _lab _hi08,, (2_27) Allen Julius P bkpr Ga Roofing & Sup Co r371 1st ALWLoEoNd-KPeEaLvLyYFuPrnit(uArneniCeo, Sh)6,62TCreoals- lege, Tel 2127-J Allen Walter G (Leslie) acct hl07 Ingleside av Allen Wesley (c; Hattie) h228 Madison Allen West (c) shoe shiner Palm Barber Shop r228 Madison Allen Wm (c; Mary) r566 Chappell (SM) AlHleanwWkinms a(cv; Lillie) carp h205 (315) Allen Wm (c; Florence) lab CofGaRy h 324 2d av (V) Allen Wm ir (c) porter r324 2d av (V) Allen Wm C (Laura L) carp hl06 Capi- Allen Lela A Mrs slswn Day's r224 Geor- tal av , Algleian Laevmon (c) x956 Broad (EM_) Allen Wm J (c) lab h637 4th av (WH) Allen Wm L (Lummie) slsmn Exchange Allen Lena rl07 Ingleside av Furniture Co hll5 Jones av (EM) Allen Lillie (wid Amos B) r774 Mul- Allen Wm O rll5 Jones av (EM) berry Allen Willie J (c) r4 South Boundary. Allen Linnie R r201 Grand av Allen Lizzie millwkr Bibb Mfg Co h230 Allen Willie M Mrs millwkr Atlantic Cotton Mills h4 Atlantic Village (220) Clinton (EM) ^ Allen Lois picker Macon Peanut & Stge Allen Willie P (c) cook h353 Church al (SM) Co rll5 Jones av (EM) Allen Willis student rl355 Edgewood av Allen Lucy B asst cash City Board of AlWlenateLruClaomHnrs(whidl04LaRwermenbceert Ca)v rl26 AAllBlieeayvnAAklae&rxonKTrRu(sR(tRuCtuhothEh)El9)e8qbukBipprreanFttnwirdsottodSNBaaTtvl Aller^M*1 Everett (Harvey) hl37 Boule- vard ,, _ Allen Maggie (c) cook h221 Orange Allen Major (c) lab Ritchey (EM) Algleinn M(Va)lissa (c) cook hll6 (196) Vir- Allen Marie A r852 Hazel Allen Mary E r620 Plum apt .1 Allen Mattie slswn r614 Log Cabin blvd Allen Milly (c) maid h720 Hazel Allen Minnie (c) maid r202 (209) Astor '(EM) &TCo h2342 Forsyth rd Alley Cath tchr r613 Orange apt 4 Alley Chas R batterymn Power Oil Co h220 Bright (SM) Alley Gewinner tchr PS h613 Orange apt 4 Alley Jefferson D jr (Mamie) elk h208 (203) Burton av Aliev Molcev r613 Orange ^ apt 4 J Alley Ruth' E Mrs instr City Play Grounds Supvr rl98 Brentwood av Allied Trades & Railway Transportation Council meets 1st and 3d Thursday 8 Allen Minnie L (c) maid rS19 Calhoun Allen Mosie (c) maid rlO'64 Hazel Allen Myrick W (Annie) hlpr Brown ISign Co r457 New Allen Nannie (wid Lee) r614 Log Cabin blvd AlTleinndNalelalav(c;(SMMa)1ry L) lab r547 (41) Allen Nina elk Bibb Mfg Co r513 Hillyer av (CH) Allen Nora (c) cook hl064 Hazel Allen Ola Mae (c) maid r519 Calhoun Allen Oliver N rll5 American blvd Allen Ora (c) lndrs h488 Short al (V) Allen Otis G (Clifford D) lab hll9 American blvd ,, , Allen P Frank (Laura) barber 202 (95) Holt av (NHts) 112014 2d! Allen Pearle T (c) r218 Fargason (V) AlMle)n RsroBs &512So2nd (Robt B and Aubrey Allen Ridhd (c; Susie) lab h207 Thomp- son Allen al Robt (c) h322 Gilmer1 Allen Robt (c) delmn Wm T McCreary rlO'64 Hazel Allen Robt (c; Leola) fctywkr h233 Tel- fair Allen Robt B (Eunice; R B Allen & Son) Itx512 2d Allen Rosa L (c) maid r5O0 (714) Camp- bell av (SM) p m 408 Poplar , Allison Donald D tchr Lanier High Sch for Boys r Forest Hill av Allison ESsie (c) maid h853 Ash Allman J Gerald delmn Cliff Walker Co r290 Winship (WH) All(mWaHn) Jas D (Clara E) h290 Winship Allman Milton W delmn Cliff Walker Co r290 Winship (WH) Allman Nettie J r290 Winship (WH) Alloway Emma Mrs r664 Walnut AlSmoauntdherAnubCraottoAn (OLiul laCoRh)71m1 gMr oTnhte- pelier av Almand E Louise cash Walgreen Co r 185 Magnolia Almand Edw P student rl85 Magnolia Almand Grover C (Flora) slsmn hl86 Magnolia Almand Jos M associate prof Wesleyan Coll r High Point Well Almon Geo C (Era) sec-treas-mgr Stan- dleayradn Sdarvings & Loan Co r209 WesAlpha Lambda Tau Fraternity 1242 Edgewood av Alpha Tau Omega Fraternity 1401 Oglethorpe Al Sihah Temple AAQNMS Chas R Mc- Cord recorder meets on call 715 Pop- Allen Ruby (c) maid r914 Pio Nono av .'(V) Allen S W student r512 2d Allen Sadie (c) maid r233 Telfair Allen Sami (c) lab r221 Orange Allen Thearon student rll5 American blvd Allen Thos J (Nell) asst supt Ga Power Co hi 16 DeSoto pi (V) Allen Thos M (Mattie) h753 Plum Allen Verdelle P (c) tchr PS r519 (535) 'Maynard (EM) Allen W C carp r333 Clinton (EM) Allen W Marvin (Eliz) printer The Film Shop h72!3 1st Allen W O (Bernice) millwkr Bibb Mfg Co r'507 Calhoun Allen W R r52'5 Mulberry Alston Caroline office sec Grover C Jones r378 Orange Alston Elma Mrs slswn Dannenberg Co r218 Georgia av Alston Thos K auto mech Kmnett- Odom Co r620 Walnut Alston Wm (c; Arilla) driver h320 4th av (V) , _ Alsup Chas B (Sydney) watch repr The Watch Shop h55 Mulberry apt 205 Althern Edw' r Hotel Gordon Alton Claude (Lucille) del boy Mitchell & Williams Inc rl535 2d , Alton Ormond (Clara M) waiter h317 Dannenberg av ,,. _ , Alwood Wm E (Hath E) hll4 Oak Haven av 31 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Alwood Wm E jr rll4 Oak Haven av Amalgamated Association of Street & Electric Railway Employees of Amer- iacnad N4o:30898p mmee4ts08FPriodpalyar10:30 a m Amason Geo R (Nona E) h528 Mont- pelier av Amason Geo R jr student rS28 Mont- pelier av Amason Jas T (May E) slsmn rl728 3d American Bakeries Co IShirley McKee supt whol 451 Plum ' American District Telegrapli Co L Roy Dublin mgr 455 Cherry American National Fredk :H Ramer Life. supt I6n1s7u1 rManuclbeerCryo R404 American National Red Cross Macon Chapter Mrs Lavinia C Leath exec sec Cherry nw cor 1st American Oil Co Sami Guthman agt S(bpurlikngplant) 75 Poplar filling_ sta 170 American Optical Co Jas W Burnham mgr 516 Mulberry RIOO American Printing Co (E Clifton Olm- stead) 552 Mulberry Amerson Alwin L (Florence) slsmn Thom (McAn h901 Orange Amerson Andrew A (Inez) h303 Apple- wood (EM) Amerson Annie (wid -Ben) J) r332 Pio Nono av (V) Amerson Arth B (Agnes D; Amerson's Sandwich Shop) rll6 Summit av (N AmHe)rson Bernice rl233 2d Amerson Chas B (Hattie) carp rl504 2d Amerson Amerson Chas B jr formn rl504 2d Curtis D (Mildred, L) gro 3091 >(165) Bay hl633 3d Amerson Edgar millwkr r24 Blossfield (A M) Amerson Evelyn W r511 (507) E Napier av AAmmeerrssoonn FFrraannckes(Eeldknarl)07coCnatrrlihslleOlavLog Cabin way Amerson Geo (Willie) millwkr h24 Bloss- field (AM) Amerson Grover C (Pearl) bldg contr 107 Carlisle av h do Amerson Helen M r511 (507) E Napier av Amerson Irene E Mrs fctywkr Bibb Mfg Co r5G9 Hawthorne Amerson J C (Mary B) fctywkr Happ Bros Co 1556 Edgewood av (SM) Amerson Jas W (Annie) h214 Applewood (EM) Amerson Lester (Bill) millwkr h29 Bloss- field (AM) Amerson Margt student rl07 Carlisle av Amerson Maude millwkr Bibb Mfg Co r332 Pio Nono av (V) Amerson Nancy Mrs h423 Ross Amerson Roy T (Eddith E) millwkr Wil- lingham Cotton Mill hl7 (67) Mill Amerson S Royce elk r511 (507) E Na- pier av Amerson Steph H (Rosa L) slsmn Stan- dard Oil Co h511 (507) E Napier av Amerson T Fletcher millwkr Bibb Mfg Co r332 Pio Nono av (V) Amerson Thelma elk rl07 Carlisle av Amerson Warren R (Dosia) farmer h709 Main (EM) Amerson's Sandwich Shop (Arth B Amerson) 462 Cherry Ammons Frank M (c) student r806 3d av (V) Ammons Geo (Hessie) hl44 Williams (S M) Ammons Jas A (c; Sara) elk h805 3d av (V) Ammons Jas A ir (c) tchr County Training Sch r805 3d av (V) Amos Annie B (c) lndrs h421 North (V) AAmmooss CHaartittiae ((cc)) mlnadidrsr4r22166No(0r6th6) (VH)all Am(EoMs J)ennie Oc) rllO (452) Johnsons al Amos Lizzie (c) lndrs hl67 Hilliard av Amos Louise (c) cook r528 Calhoun Amos Martha G Mrs beauty opr Ge- non's Barber & Beauty Shop rl353 Columbus rd Amos Wm (c) lab rl37 Cemetery la Amspoker Frances J student r2l6 Chero- Amspoker Guy E (Jessie) h216 Cherokee Anacvhors Eliz r206 Georgia ter Anchors Robt G (Hazel P) millwkr Bibb Mfg Co r341 Calhoun Anchors Wm S carp h206 Georgia ter Anerim Benjeman jr (c) waiter rl34 Roosevelt av (V) Anerim Dorothy R (c) student rl34 Roosevelt av (V) Anders Nell sten r722 Mulberry Andersen Harry C (Louise) chf eng r301 Clayton (V) ,, , Anderson A Frank farmer r210 West AnEdnedrsoanv A(WLaHv)erne student rl814 3d Anderson Addie M (c) maid rlOOS Broad (EM) Anderson Alice (c) maid hl004 Main (E M) Anderson Alice Mrs fum repr 103 Pierce av (V) h do Anderson Annie (c) h305 (304) Crisp (S AnMd)erson Annie sten r325 Forsyth Anderson Belle (c) maid rl05 2d av (U) Anderson Belle (c) smstrs r305 (304) AnCdreisrspon(SBMen) j (c; Mary) lab h633 Peb- Anbdleers(oSnMB) enj E driver Power Oil C,,o r RD 6 Cross Keys Anderson Berda (c) lndrs r305 Lake Anderson Carl L (Mary) phys 700 Spring R310 h280 College Anderson Carolyn r217 Rogers av (V) AAnnddeerrssoonn CCaarthrie(c()c)coholk00r3ll4Bro(1a2d) (REaMil)- road av (V) Anderson Cecil millwkr Willingham Cot- ton Mill t62: Holt av (NHts) Anderson Chas (c; Evelyn) carp hl03 (107) 2d av (V) Anderson Chas G (Olive) formn CofGa Ry h206 Jeff Davis (SM) Anderson Chas H student r208 Jeff Davis (SM) Anderson Clara (c) maid t121Yz Rockhill la Anderson Clayton & Co Martin J Meath mgr cotton buyers 350 Poplar Ansdoenrson Cordelia (c) maid r266 Madi- Anderson Cullen E millwkr r202 Mercer Anderson Daisy (c) maid Burden Smith & Co r266 Madison Anderson Della (wid Walter A) h3 Randolph pi ANDERSON DICE R (Martha), PresTreas Wesleyan College, h Wesleyan College Forsyth rd, Tels 6371-6185 Anderson Dock (c; Pearl) lab h350 Flanders (EM) Anderson Edith M r3 Randolph pi Anderson Edw (c; Bessie) lab h618 Washington av Anderson Edw (c; Amanda) loco firernn hi 12 (533) Campbell av (SM) Anderson Edw (Eliz) meat ctr GtA&P TeaCo r359 New Anderson Eleanor (wid Chas B) r210 West Ehd av (WH) Anderson Eliz nurse r811 Poplar apt 12 Anderson Eliz (wid Christopher C) r213 Bond apt Cl Anderson Ellen (c) cook rll5 May Macon Federal Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 503$ Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 32 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 Anderson Erline (c) rl23 Ash Anderson Ernest (c) lab rl60 Coles al Anderson Eug (c) h7l2: Elbert (SM) Anderson Eug (Anne S) feature writer Macon Telegraph h933 Vineville av (V) Anderson Eugenia student rl06 Plaza! Anderson Evelyn N (wid C'has H) slswn Snyder's Ready-to-Wear h208 Jeff Davis (SM) Anderson Fannie (c) cook r600 4th av (WH) Anderson Frances rl45 Academy Anderson Frank Cc; Oree) lab r302 (303) Crisp (SM) Anderson Frank (Anna R) paperhngr John Ii Hainline r522 Ocmulgee Anderson Frank A (Mary R) slsmn h An4d15ersNonewFraeidpt s2tudent r62 Holt av (N Anderson Geo (c) 1231 Patterson (NHts) Anderson Geo (c) chauf r223 Orange Anderson Geo (c; Mary) gro 204 Indus- trial Home rd h do ,. . . , Anderson Geo jr (c) r204 Industrial Home rd ,, _ _ Anderson Geo A farm supvr U S Reset- Antldeemrseonnt GAedominE r(RBulotho)mfloieclod erndg h506 Flamingo dr Anders.on Geo R (The , , Watch Shop)s ,,, rill Napier av 'Anderson Geo R Cc; Mary) gro 101 Mor- ris hl03 do Anderson Geo R jr Cc) rl03 Morris Anderson Geo W (Ruth) elk First Natl Bank] & Trust Co r Bloomfield rd RD 0 Anderson Halstead T (Vivian H) v-pres Bankers Health & Life Ins Co h232 (Stanislaus cir Anderson Hazel bkpr r811 Poplar apt 12 Anderson Henry (c; Georgia) lab Taylor IMro) n Wks & Sup Co hl08 Johnson (S Anderson Homer jr (c) lab rl003 Broad '(EM) Anderson Ira Cc; Annie) lab h266 Madison Anderson Ira jr (c) lab r266 Madison Anderson Jas (c; Erma M) lab h505 Long St la (ISM) Anderson Jas Cc) lab rl21% Rockhill la Anderson Jas (Berta) millwkr Willingham Cotton Mill h'62 Holt av (NHts) Anderson Jas C (Annie) phys 516 Mul- berry R710 hl0'6 Plaza cir AnCdoe)rsohn!21J7asRLog(eCrsecialve C(;V)A; nderson Oil Anderson Jas T (Addie L) wtchmn hl814 3d Anderson Janie (wid Hans C) hill Na- pier av Anderson Jennie (c) h226 Collins pi Anderson John H (Bertha E) millwkr h 200 Mercer Anderson John H see-treas-mgr Macon Peanut & Storage Co r401 College apt 2F Anderson John R farmer r210 West End av (WH) Anderson John W paperhngr John L AnHdaeirnsloinneJorsl4e5phiAnecadCecm) yindrs h600 4th av (WH) Anderson Joshua Cc; Lettie) lab h715 An(d70e3rs)onElJbuelrita ((SwMid) Wm) r896 Winton Anderson Julia L asst County Tax Re- reiver h210 West End av Anderson Kankakee tchr Lanier High Sch for Boys r Wesleyman dr Anderson Laura Nelle exch teller First Natl Bank & Trust Co r Shirley Hills Anderson Lessie (c) Indrs rll5 Woodcliff Anderson Lizzie (c) Indrs r212 Mutual av (V) Anderson Lola M (c) cook r771 (770) Ocmulgee Anderson Louisa bkpr City Board of Water Comnrs r210 West End av (W HI) Anderson Louise (c) maid hll'5 Wood- cliff Anderson Louise C elk Macon Teleg Pub Co h!213 Bond apt Cl Anderson Lucile (c) hll48 Broad (EM) Anderson Lydia r503 Main (EM) Anderson M Louise student r210 West End av (WH) Anderson Mabel millwkr Southland Knitting Mills r202 Georgia ter Anderson Maggie (wid Wm) r426 Jack- son Anderson Mary Cc) cook r712 Elbert (S M) Anderson Mary (c) Indrs r219 Lexington (EM) Anderson Mary (c) Indrs hll6 Neal av (V) Anderson Mary (e) Indrs rll2 (850) Singleton's la Anderson Mary (c) . maid rl33n (135) Army Lot Anderson Mary B student r3604 Houston av (SM) Anderson Mary G (wid Wm M) r277 College Anderson May B (c) Indrs h210' Fretwell al Anderson Mildred (c) maid r223 Orange Anderson Nell student rl03 Pierce av (V) Anderson Nellie (c) Indrs h223 Orange Anderson Oil Co (Jas L Anderson) 155 5th Anderson Otis C (Martha) dentist 569% Cherry r Pine Forest dr RD 21 Anderson Paul R prin Lanier High Sch for Boys r280 College, Anderson Pearl (c) maid rll5 May ANDERSON PEYTON T (Nell G), V- Pres and Genl Mgr The Macon Tele- graph Publishing Co, Genl Mgr The Macon Telegraph and Macon Evening News, h Jackson Spring Road and Sunset Drive (Shirley Hills), Tel 1754 ANDERSON PEYTON T JR (Katherine M), Asst Bus Mgr The Macon Tele- graph and Macon Evening News, r Shirley Hills, Tel 5622 Anderson R Lanier jr (Helen W; Ryal Anderson & Anderson) hl55 Emily pi Anderson Robt (c; Lizzie) hlpr CofGaRy Anhd2e3r1soPnatRteorsbot n (c(;NHLtisl)lian) lab h703 Daisy (SM) . Anderson Robt C (Inez) driver hl38 Knott (SM) Anderson Robt L (Gertrude; Ryal An- derson & Anderson) h568 Orange Anderson Robt L (Essie L) millwkr Willingham Cotton Mill h53 Holt av (NHts) Anderson Robt M (Myra J) slsmn Ma- con Gas Co r218 Georgia av Anderson Roger (Ruby) slsmn r717 Courtland av Anderson Rosa L emp Snow's Lndry AnDdreyrsoCnlnSgallCyo Crc)ll3la2b rB43ro1ad(4w2a5y) Elliott '(EM) Anderson Sami P (Mary) cond h3604 Houston av (SM) _ , Anderson Sara L student r322 Coleman av (CH) . Anderson Sue (wid Edw) h503 Main (E Anderson T Ehiory student rl814 3d Anderson Thos (c; Ella) lab r330 (331) 2d av (U) Anderson Tillie M (c) maid r342 Long l(SM) 33 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Anderson Vashti r221 (220) Hydrolia (E AnMd)erson Virginia student r217 Rogers Anadvers(Von) W D agt Conn ,,Mu,t L,T ife In,,s AnCdoersronW! Wesalelkyearn C(co;lleRgeo!sa) lab hll32 Broadway AAnnddeerrssoonn WWmm B(c;F Lbiklap)r Mh7a7n0sfAiesltdi Dray Line hl45 Academy . Anderson Wm D (Linda M) chairmn of board Bibb Mfg So h945 Vineville av An(dVe)rson Wm D jr pres Bibb Mfg Co r An9d45ersVoninWevmilleGa(vc) auto meeh Hubbard ANCDo ErR46S8ONCoWttoMn aTv (Elizabe.t.h.), _Pres The Macon Telegraph Publishing Co, Editor The Macon Telegraph, h429 Nottingham dr nr Jackson Spring rd (Shirley Hills), Tel 505 Anderson al Willie M (c) lnd rs h!60 Coles , Andrew Emma (wid Clarence H) h342 Hardeman av Andrews Alex millwkr Willingham Mill r'7'64 Plum Andrews Ardis G (Gladys S) carp r422 Johnson av (HH) Andrews Azzie L (c) maid hl207 1st Andrews Bennett W mach CofGaRy r616 An1dsrtews Beulah (c) maid rl59 Nuss- baum (SM) Andrews Birda M .ir opr SBT&TCo r439 Duncan av Andrews C Fort jr student r239 Stanis- laus cir Andrews C Fort (Irene) h239 Stanislaus cir Andrews Cath checker r911 Walnut Andrews Chas H (c) restr 101 Hardeman av r507 Forsyth Andrews Chas W (Mildred) car repr C ofGaRy h255 (139) Heard (SM) Andrews Charlie M (c) lndrs rll2 Roff Home av (V) Andrews Ohesley B (Olive) cash MD&S RR h34T Hines ter (V) Andrews Clinton (c) r706 Hawthorne Andrews Clyde cash Capitol Theatre r 310 Washington av Andrews Clyde (c) maid r331 (332) 2d av (U) Andrews Conrad (Vera) fctywkr r205 Mikado av (SM) Andrews Corinne (c) lndrs rl31 Franklin St la Andrews Edgar jr (e) delmn Wm S Lyles r217 Jefferson Andrews Edw (c) carp :r433 Chestnut Andrews Edw C (Ruby) 14706 1st Andrews Elmer R (Laura; Andrews Sheet Metal Works) r Montpelier rd Andrews Estelle O slswn Dannenberg Co r7CS 1st Andrews Etlhel (c) student r315 (87) Plumtree (EM) Andrews Felton 'E (Mary L) elk Wilson Gro Co h314 Shamrock AnSdtrelwas Fred C (c) rl23 (13) Franklin Andrews Gertrude (c) h706 Hawthorne Andrews Gillie C (wid John) h911 Wal- nut Andrews Grover (Mattie) slsmn Wor- sham & Sherrill r Cochrane Short rd AnMdraeiwn s (GEMus)sie L (Ridley) formn h'614 Andrews Hazel presser Snow's Lndry & Dry Clng Co rl09 (9) Alabama (EM) Andrews Henry F (Eugenia) linemn hlpr Ga Power Co hll33 Walnut Andrews Hersdhel R driver Great Southern Trucking Co r Columbus rd Andrews J C (c) r559 Broad (EM) Andrews Jack student r925 (926) Cherry Andrews Jas (Mary; Palace of Sweets) h304 Cherry . , Andrews Jas (c; Hattie) lab hl02 (115) New Street al , Andrews Jas D (c) lab h303 Schaeffer Andrews Jefferson G (Josie) appr Cof GaRy rll5 Capital av (Mikado pi) Anwdaryews John R (Willie) hl534 Bro,,ad, - Andrews John T (Leila) elk hi 127 Wal- nut Andrews John T jr (Gladys) elk rll27 Walnut _ , __ Andrews John W (Marie) h817 Broad (E AnMd)rews John W jr 4371 1st Andrews Jos (c; Bessie) lab r809' (852) Cowan (EM) Andrews Jos E (Martha R) carp hl31 Daley (SM) Andrews Jos M r!31 Daley (SM) AnRdyrewEsXpJoAs gWcy (hC71h7a%rlie2dB) vehiclemn Andrews Julia (c) lndrs hill (543) Tins- ley la Andrews Lehman millwkr Bibb Mfg Co r925 (926) Cherry Andrews Lillie B (c) lndrs rl24 Jones Andrews Lily M (c) hl60 Madison Andrews Lula (c) rlOll Elbert (SM) Andrews Maegruder (Claudia) locksmith 572 Mulberry Ih802 Spring Andrews Mamie slswn Dannenberg Co r911 Walnut Andrews Marshall P (Eva L) formn Ry Exp Agcy hll5 3d AAnnddrreewwss MMaarrytha(c()c)cocookokCrlh0a3s NAenedlre(Uw)s h507 Forsyth Andrews Merritt N (Agnes T) fruits 1158 Oglethorpe hl03 Ross Andrews Milton C appr CofGaRy r255 (139) Heard (SM) Andrews Nannie (c) lndrs hll2 Roff Home av (V) Andrews Peyton (Sara) slsmn r760 Cherry Andrews Powell W (c) h433 Chestnut Andrews Red (c) cook Booth's Cafe r 453 Broadway AnEdmreowrys R(SeuMb)en A (Grace) plmbr rll8 Andrews Roosevelt A lab City Andrews Ruby Mrs r816 3d Andrews Ruby O Mrs slswn Dannenberg Co h706 1st Andrews Russell (c; Julia) lab h235 Nona (EM) Andrews Sallie R (wid Chas O) h439 Duncan av AnHdoreuwr s NSuarnsedryies Ar (FLoilrlsyy) thflorrdist Idle Andrews Sara Mrs elk r760 Cherry Andrews Sheet Metal Works (Elmer R Andrews) 507-09 Cotton av Andrews Timothy (c; Hazel) lab rl09 (9) Alabama (SM) Andrews Vera H Mrs elk Roy W Crockett r205 Mikado av (SM) Andrews Walter (c) lab r803 Ash Andrews Walter jr (c; Mary L) lab r300 (301) Crisp (SM) Andrews Walter L (c; Mattie C) mach AnhdlprerwshlOWOm(10(3M) yrCal)evrellla4ndFo(SrsMy)th Andrews Wm (c) delmn College Hill Pharmacy rl60 Madison Andrews Wm E (Nannie J) tmkpr WPA h925 (926) Cherry Andrews Wm E jr elk Ingleside Phar- macy r925 (926) Cherry Andrews Wm H (Annie) slsmn hl20 Lamar (V) Andrews Winifred student r325 Clinton (EM) Andros Geo (Nu Way Weiner Stand) r Southland Hotel MERRITT GOAL GO. 1414 FIRST Cor. Ash YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Life Of Your CITY 34 D. H. Adams Motor Go. Studebaker Willys Hupmobile Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D I R P C T O R Y MIRRORS the CIVIC Life Of Your CITY TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Andrus Edwin M (Grace W) engr Kernaghan-Goodman Inc hl75 Virginia av AAnnggiieerr AEddeiltahideMstMudresnth2r2l616 BBuuffoorrdd ppii Angles Clinton (Ellen A) lab Barfield Feed Mills r363 Walnut AAnngglleins JHimubmeyrt pEntr(Nr2in5a5) Cmliinlltwonkr (Er6M10) Elm Anglin Luther (Nina) lab h211 Roff Home av (I) Anis Dois (Exie) lab h521 Elm Ansell Augustus W rl60 English av (V) Ansley Robt E furn repr 767 3d h do Anthony Ada D tchr rl354 Edgewood av Anthony Bess nurse r533 Orange apt 11 Anthony Eleanor S student rl354 Edge- wood av Anthony Lynn E student rl354 Edge- wood av Anthony M Eliz tchr rl354 Edgewood av Anthony R Earl (Mary E) prof Mercer Univ hl354 Edgewood av Anthony Thos E rl354 Edgewood av ANTIMITE (Termite Treatment), See The Dunlap Roofing Co 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) Antioch School (c) Cora C Johnson prin 308 Charles Appleton Church Home (Episcopal Orphanage) Mrs Fannie B Duvall supt Ap3p21lewFhoirteestJoHs ilDl a(vEunice M) health officer County Board of Health hl08 Avon rd (B) Applewhite Josephine student rl08 Avon rd Appling Arabell (c) lndrs hl02 (2) Orchard av Appling Chas D (c) lab Willingham Sash & Door Co Plant rl029 Clinton (EM) Appling Edw E (c) mgr Trio Bargain Store r657 Willard Appling Eliza (c) h464 City Hall la Appling Frank (c) brklyr rl02 (2) Orchard av Appling Irving (c) gro 521 (122) Elliott Ap(pElMing) Ph Gdoeo (c; Gladys) prin Hudson Industrial Sch hl029 Clinton rd (EM) Appling Rose (c) h301 (308) E 1st (EM) Aramo Margt maid h445 American blvd Arcade Billiard Parlor (Edw C Asbell) 561 Cherry Archer Elmer (Inez) barber r400 Forsyth Archia Leo ice puller Kinnett-Odom Co r27 Wall al Archibald Arold r204 Plumtree (EM) Ard Cash Grocery (John D Ard, John A Tebeau) 289 Washington av Ard Fannie Mrs r812 3d Ard Janie r314 Flanders (EM) Ard John D (Marie; Ard Cash Grocery) h721 Date av Ard Pauline rll46 Milledgeville rd (EM) Ard Rebecca millwkr Bibb Mfg Co r409 Virginia av Ard Reuben millwkr Bibb Mfg Co rl3 Bibb av Ard T Edw (Verba) gro 167 Spring hl65 do apt 5 ArCdoTuhlllly46C M(Killaetdieg)evmilliellwrkdr B(EibMb) Mfg Ard Wm F (Ophelia) gro 126 (780) Nussbaum (SM) h do Arden Morgan R (Sara) mach inspr ColfGRy h206 Hill Crest av (CH) Argo Margt A r811 Poplar apt 6 Argo Thos V (Edna) cond h701 Burton av Argo Wm D (Bessie M) loco eng h811 Poplar apt 6 Argo Wm F rail Poplar apt 6 Arington Louise r327 Clinton (EM) Arline Ellen (c) cook hl42 Pecan av Arline Jas (c) janitor h906 Pio Nono av (V) Arllaine Mamie (c) lndrs hlOl Magnolia Arline Mary (c) r404 (309) Bartlett ARLINGTON HOTEL (Thomas O Mose- ley) , Modern and Reasonable, "A Good P(Flaocre ftuorthSelerepi"nfo51r1maBtriooandwseaey,leTftelto5p1 ArlliinnegstoanndHoptaegl eA1n6neBxuy50e7rs%' GBuroidaed)way ARMAND BANKS, Manager Wesleyan College Book Store and Bank, r WesArlmeyaanndCHolelengrey, F(oc)rsyr6th57rdE, lTmel a6l371 Armand Pearl (c) r657 Elm al Armfuss Caleb (c; Ethel M) lab r651 Elm st la Armond May (c) h3 Murray al Armour Aiken (c) elev opr rll6 Green AArrmmoouurr &VeCroa M(cil)o Bhl2M9edAlodcakmms gr whol meats 250 Broadway Armstead Arno (Lallie) linemn r750 2d Armstrong Annie (c) millwkr Bibb Mfg Co r229 Telfair Armstrong Annie L (c) lndrs Crescent Lndry Co rl20 Broadway Armstrong Bobbie L fctywkr McAfee Candy Co r653 Plum Armstrong Chas (Ruby) millwkr Bibb Mfg Co rl333 2d Armstrong Dorothy student r208 Clayton Ar(mVs)trong Ella (c) hill Neal av (V) Armstrong Ethel (wid Guy) h208 Clayton (V) Armstrong Guy elk First Natl Bank & Trust Co r208 Clayton (V) Armstrong H S Mrs elk WPA r483 Orange Armstrong Helen student r319 (361) ArCmhsetrrooknegeHauvgh G (Rosa M) mach Taylor Iron Works & Sup Co h414 Duncan av Armstrong Huling T asst county eng ArBmibstbroCngouJnWty erl3k00RyCMoSllerg3e15 Mulberry Armstrong Jas H (Minnie) lab hl33 Williams (SM) Armstrong Jas W (Nelle E) slsmn GaCarolina Oil Co hl08 Lawton av Armstrong Mae Mrs millwkr Bibb Mfg ArCmostrro66n0g MPlaurmy T r319 (361) Cherokee Armstrong May Mrs h2231 2d Armstrong N Bruce (Martha K) h319 (361) Cherokee av Armstrong Octavius A (Mary T) bkpr WPA whse h300 College Armstrong Robt A rl2l Lawton av Armstrong Robt I (Hattie L) carp h653 Plum Armstrong T Wallace student rl08 Lawton av Armstrong Victor E (Alma E) slsmn h 121 Lawton av Armstrong Willie (c) agt Guaranty Life Ins Co rill Neal av (V) Arnett Claude C (Laura K) mgr Halligan & McLellan Inc h202 Clayton (V) Arnett Creswill (c) lab CofGaRy Arnett Emory (c) lab CofGaRy rl81 (325) Nussbaum (SM) Arnett Fred L (Cath) millwkr Willingham Cotton Mills r22 (82) Randolph ArPniett Henry (Buford E) millwkr Willingham Cotton Mills h3 Grand av Arnett Jos (Fannie) millwkr r324 Dannenberg av Arnett Louis (Stella) millwkr Bibb Mfg Co h855 Hazel Arnett Lucius B (Ethel L) millwkr Willingham Cotton Mills hi Grand av Arnett Lucius B (Delena M) millwkr Willingham Cotton Mills rl Grand av Arnett Mable smstrs r748 Walnut Arnett Mattie (wid Jos) h21 Bellevue rd 35 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 Arnett Sidney O (Lena E) millwkr h8 Grand av ArNnuetstsbTahuoms ((cS;MA)nnie) pntr rl81 (325) Arnett Willie (wid Jas C) h748 Walnut Arnett Wlnsted sec-treas Williams Jwlry ArCnoettre34W9 inHniineesB te(wr id(VH) omer B) r349 Hines ter (V) ArPnoowlderAClboerthlM09 (OLirlmlieo)ndbutser opr Ga Arnold Albert M jr (Irene) driver rl09 Ormond ter ArCnooldr8A21nnHieemClosclskwn F W Woolworth Arnold Benj P (Robbie) gro 522 Ocmul- gee h do Arnold Beverly (Grace) millwkr Bibb Mfg Co h28 Brigham Arnold Carl B (Libby) cond h616 HemAmold Carl B jr atndt Jos W Slade r616 Hemlock Arnold D Lester rl08 Pearce (EM) Arnold Danl S (Queenie) sub sta opr Kinnett-Odom Co rl02 Center (EM) Arnold DeWitt (Minnie) h912 Ash Arnold E Madge millwkr Bibb Mfg Co r430 Winship (WH) Arnold E Ray elk Karsten & Denson Co Inc r703 Holt av (NH) Arnold Ellen rll5 Buena Vista av Arnold Emmett J (Myrtle W) carp h703 Holt av (NHts) Arnold Emmett J jr city firemn rl70 Virginia av Arnold Fannie (c) nurse Met Life Ins Co h421 Ward (V) Arnold Fred (Agnes C; Arnold's Shoe Parlor) r308 Buford pi ArEnlomld Geo M elk Danl E Hudson r863 Arnold Geo T lab h863 Elm Arnold Harrison (Leola) elk h3606 Hous- ton av (SM) Arnold Hoke S (Verna M) ftr Macon ArGnoalsd CJoasr2O Tahsosmt asstotorne mrdgrRDBir2dsey Flour Mills r RD 4 Arnold Jessie R r401 College apt 2H Arnold John (Belle) farmer hill Mill av Arnold John H (Maude) lumbermn hlOl Lee (SM) Arnold John H jr (Louise) trucker hl02 ArHnoalrdtleyKaatvhri(nLeyn)smstrs rl08 Pearce (EM) Arnold Louis C (Viola) slsmn r672 Hem- lock Arnold Maggie student rl26 Ponce de Leon av (SM) Arnold Malcolm E (Lillian) eng MD&S RR h305 North av (NH) Arnold Malcolm E jr (Frances) elk r305 North av (NH) Arnold Martha (wid Louis) r216 Cal- houn Arnold Mary A elk rl09 Ormond ter ArHnoillld CMreasrty aJv (w(CidH)Jos O) r304 (316) Arnold Minnie rl08 Pearce (EM) Arnold Mollie F Mrs h430 Winship (WH) Arnold Monroe (Pearl M) carp h319 ArMnoolndtpMeloierrrisav(Lillian) soda dispenser Walgreen Co r821 Cherry Arnold Ollie O (Lillie) hl09 College pi Arnold Patsy office sec D John I Hall h401 College apt 2H Arnold Respess elk Maxwell Bros Inc h415 Church (EM) Arnold Robt lab rill Mill av Arnold Robt T (Emma) bus opr Ga Power Co h233 Capitol av (Mikado PI) Arnold Rufus F r863 Elm Arnold Rufus J (Nelle) formn Central Savash(S&M)Door Co hl26 Ponce de Leon Arnold Thos W (Eva) yd formn h805 Pine Arnold Wilbur W (Cornelia) h912 2d Arnold Wm F r862 Hazel Arnold's Shoe Parlor (Fred Arnold) 418 3d Arrington Chester L student rl27 Win- ship (WH) Arrington Dudley H (Ernie) h966 Ogle- thorpe Arrington Eliz millwkr Bibb Mfg Co r966 Oglethorpe Arrington Jewel L Mrs rl02 Cedar (SM) Arrington N Wallace (Louise C) driver Great Southern Trucking Co r94 Lawton av Arrington Sami L (May B) printer Macon Evening News hl27 Winship (WH) Arrington Terrell F fctywkr Hopp Bros Co rl27 Winship (WH) Arrington Wm S (Kathleen) policemn h 112 Nelson (SM) Art Furniture Mfg Co The Frank R Happ pres Michl M Kaplan sec-treas 314 Fulton (SM) Arthur Alexandria elk r251 Appleton av Arthur Chas student r251 Appleton av Arthur Geo P (Stella) billiards 453 Broadway h251 Appleton av Artis Floyd janitor WUTelCo Artistic Beauty Shop (Mrs Myrtle Hambrick, Mrs Lucy B Thrasher, Mrs Edna Compton) 151 Cotton av Artope Leila r307 Orange Asbel Judith (c) r434 Chestnut Asbell Benj F (Mary) r854 Cherry Asbell Custis L (Ada) formn rll5 Gordon (SM) Asbell Dollie lab rl08 Yates av (EM) Asbell Edw B (Ethel R) store mgr Sou Gro Stores Inc h849 Hillyer av (CH) Asbell Edw C (S Frances; Arcade BilAslbiaerlld EPmarolroyr)Eh2(0L7ucOillaek MH)avpenntravhl5(V45) College Asbell Fred W student rl544 College Asbell Geo E (Eloise J) pntr hl544 College Asbell Horace B (Mary) elk Jas C Moore h524 ( 562) Oglethorpe Asbell J Andrew (Bessie L) elk Taylor Iron Works & Sup Co hl22 (153) Pierce av (V) Asbell Jas B (Eva H) slsmn Burden Smith & Co h473 Duncan av Asbell Johnnie B (wid Francis E) r204 Tatnall Asbell Martha E student rl544 College Asbell Mary V student r849 Hillyer av (CH) Asbell Walter W (Nellie) lab hl08 Yates av (EM) Asbury Mack (c; Adelaide) lab CofGa Ry h70 Forest av (V) Asbury Wilkes R (Frances) supt Buckeye Cotton Oil Co hlOO Rogers av (V) Ash Crawford student rll9 Emory av (SM) Ash Estelle M rll9 Emory av (SM) Ash Irene student rll9 Emory av (SM) Ash Jas (Jessie) millwkr hl23 Plant (SM) Ash Lewis M (Effie S) blksmith hlpr CofGaRy hll9 Emory av (SM) Ash Lula M rl23 Plant (SM) Ash Sami rll9 Emory av (SM) Ashford Annie (c) hll Parker av Ashkenazie Heime slsmn r653 Ross Ashkenazie Lula (wid Harry) gro 655 Ross h653 do Ashley Adrian (c) lab r307 Gilmer Ashley Ann (c) r307 Gilmer Ashley Arth (c) lab r94 Harris al AsFholeryesAt saavC (V(c); Ethel M) ins agt h88 Ashley C Raymond auto mech Ga Auto Co r914 Elm S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York COURTS & CO. MSteomckberEsxcNh.anYge. vN.ExYc.haCnogteton ChicagoTraBdoeard of AssNoEc. ixaYcteh. aMnCgeuemrbbers Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 Who Sells It? Is Answered By the Classified Business Lists In this Directory HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC THIRD AT PINE GMC TRUCKS PHONE 5100 Ashley Columbus H (Maggie L) auto mech r653 2d Ashley Eliz L Mrs elk Union Dry Gds Co r415 Calhoun Ashley Fannie (c) cook r:125 (117) WilAslhialemys Jloahn (c; Bessie M) lab Natl Handle Co h621 Division Ashley John H (Mary) r914 Elm Ashley Johnnie M (c) maid r717 Daisy As(hSlMey) Mamie (c) hl42 Bay Ashley Marshall (c; Vinie) elev opr hl23 4th av (V) Ashley Mary I (c) maid r612 Washing- ton av Ashley Mary K h&55 Mulberry apt 201 Ashley Mollie (c) lndrs hl25 (117) Wil- liams la Ashley Moses (e) lab r434 Chestnut Ashley Murdock L (Eliz L) mech Dunlap Chevrolet Co h415 Calhoun Ashley Orpheus K (c; Emma) lab h84 Forest av (V) Ashley Osie W (c) T243 3d av (V) Ashley Prince (c) lab r307 Gilmer Ashley Reynolds (c) janitor rl42 1st av (V) Ashley Sylmon (c) cook r434 Chestnut Ashley Webb (c; Pearl) driver Willing- ham Sash & Door Co plant h243 3d av (V) Ashley Wm bkpr Johnnie Johnson Beauty Supply Co h855 Mulberry apt 201 Ashley Willie M (c) cook rT25 (117) Williams la Ashmore Colson L student r591 Carling Ashmore Margt T Mrs slswn Berner Shops r854 Cherry Ashmore Mary L (wid Walter) hl21 American blvd Ashmore Robt E student r591 Carling av Ashmore Walter G student r591 Carling AsChamrolirneg Wamv T (Carrie G) slsmn h591 Ashmore Wm T jr r591 Carling av Ashton Frank (c) porter rl08 Spring Ashton Paul F (Daisy) mach hl'15 Piedmont av AsGhotoonclmTahnelImnca rFll5bkPpierdmKoenrnt aagvhanAshurst Eliz sten Dannenberg Co r516 Grange Ashurst Mamie student r51S Orange Ashurst Paul L (Mary E) slsmn Burney Bros Co h897 Hillyer av (CH) Askew Benj R (Mattie) slsmn Ga Power Co hl05 DeSoto av (V) Askew Bradley S (Dixie) millwkr h217 Melrose (B) Askew Chas E student r44 Marion pi (WH) Askew Felix R (Sara S) cond h615 Ogle- thorpe Askew Marie (c) lndrs h207 Roye la Askew Milton D (Dorothy) slsmn hl53 Lamont av Askew Newton G (Carolyn H) loco eng h44 Marion pi (WH) Askew Wm (c; Marie) lab hl40 (223) Royal (CH) Assembly of God Doreen Justeen pastor services 11 a m and 7:30 p m Sunday Sch 10 a m 145 Knott (SM) Associated Master Barbers Chapter No 284 Chas McBreartv pres 568 Mulberry Astin Elmer cond rl05 Appleton av Astin Elmer R (Ida) elk hl05 Appleton Astin Jas student rl05 Appleton av Aswell Hattie (c) r437 Middle (EM) Athon Annie M (wid Jos B) hsekpr 2814 Forsyth rd AtPksiinTks. Apnidrew H baker 204 Forsyth rll7 Atkins Bakery (Mrs Leah Atkins) whol 414 2d Atkins Edw (c; Lula) lab h223 Neal av (V) Atkins Eliz (c) midwife 74 Oliver av (SM) h do Atkins Henry (c; Martha) lab r708 (588) Maynard (EM) Atkins Jas (c; Mary) waiter Edw R Cole h505 (506) Elbert (SM) Atkins Joshua (c; Margt) prsr Hayes Clothing Co h508 Broad (EM) Atkins Leah M Mrs bakery 128 Hardeman av h414 2d Atkins Lise (Ida) millwkr Bibb Mfg Co h823 Hazel Atkins Missouri (c) h506 (457) Alabama (SM) Atkins Pearl M (c) r708 (588) Maynard (EM) Atkins Thos (c; Jennie) lab hl24 Wyche (SM) Atkinson Annie M emp Snow's Lndry & Dry Clng Co r521 Ross Atkinson Chas (c; Annie M) h521 Ross Atkinson Eva Mrs r557 1st Atkinson Harold C (Lilly E) phys 700 Spring R101 h206 Corbin av (V) Atkinson Harrv J (Pearl T) slsmn h772 Patterson (NHts) Atkinson Jerry (Irene) porter Maxwell AtBkirnossonFuJrenthrCooe rL79 (CSpasrsinieg) lab h312 Randolph (EM) Atkinson John F (Ruth) mach CofGa Ry h861 2d Atkinson L G (Eleanor) elk State Hwy Board Div No 2 rll7 2d Atkinson Lee (c) lab r452 Shoals al (EM) Atkinson Lot (Ann) loco eng h401 Col- lege apt 4B ATKINSON MALLORY C (Gertrude G), Lawyer 410 Georgia Casualty Bldg, Tel 369, h216 Corbin av (V), Tel 1280-J Atkinson Roy Mrs elk Union Dry Gds Co r RD 4 Atkinson Roy R mach CofGaRy r871 Cherry Atlanta Life Insurance Co (c) Walter C Lee agt 556 New R423 Atlanta-Macon Motor Express Chas D Hudson agt 350% Cherry Atlanta & West Point Railroad Co Robt F Wynne div frt agt 403 Cherry R605 Atlantic Community House 2 Atlantic Village Atlantic Cotton Mills G W McCommon pres-genl mgr Mrs R R McCommon AtsleacntcicottIocne g&dsCmoaflrsC3o00ChOaaskHHaGvoerndoanv mgr Waterville rd branches 210 (307) Elizabeth (SM) 301 Pio Nono av (V) and 214 Walnut Atlantic Refining Co Winship McLean mgr oils 571 Mulberry AtmwualtgeereEmma (c) maid r923 (953) OcAtwater Hilton (c; Bertha) lab h233 Jefferson Atwater Jas A (Ina M) bkpr Burden Smith & Co h424 Carling av Atwater Robt E (Floreed) h206 Ormond Atwell Geo D (Mary A) pdlr h549 Telfair Atwell J B (c; Dorothy) hi 15 Coles al Atwell Jas W (Henrietta) city flremn h221 (222) Maynard (EM) ' Atwell Mary F (wid Geo D) gro 545 Tel- fair h do Atwell Wm (Georgia M) h656 Pebble (SM) Atwood E Jay (Lula M) photog 210% Cotton av h do Atwood Lula M Mrs (Atwood Pleating Shop) r210% Cotton av Atwood Pleating Shop (Mrs Lula M At- wood) embdry 210% Cotton av Atwood Rebecca (c) lndrs hl214 3d Aubrey Florence (wid Frank) h551 Plum 37 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save August P Boyd (Bessie C) designer Idle Hour Nurseries h Forsyth rd Aultman Edna P elk Met Life Ins Co r860 Mulberry Aultman Ennis mach opr Abel Ice Co r RD 2 Aultman Eula L Mrs millwkr Bibb Mfg Co hl022 2d Aultman Eula M millwkr Bibb Mfg Co rl022 2d Aultman Prances r763 2d Aultman Harvey driver rl022 2d Aultman L B (Nora) asst miller Barfield Peed Mills r RD 3 Austin Alonzo (c) hll2 (113) Bowman (EM) Austin Annie (wid Clarence) smstrs r754 Plum Austin Bessie Mrs r763 Cherry Austin Christine r763 Cherry Austin Clarence r754 Plum Austin Prank (c; Hattie) lab h Lawton Auasvtin(BG)eorgia (c) maid rl032 Broadway Austin Hartwell M (Amy L) agt South- eastern Exp Co h912 Napier av Austin jas (c; Mary) lab hl06 (104) Adams Austin Jas R (Annie) baker American AuBsatikneriJeesteCr o(cr)668lab1strll22 Broadway Austin John W (Jammie) tel opr Ga Power Co h615 Spring Austin Josephine (c) r!23 Lexington (EM) Austin Kittie L (c) cook r412 Ward (V) Austin Lena (c) rl325 Broadway Austin Mary (c) r555 Broad (EM) Austin Mary Mrs r717 Cherry Austin Millie (c) Indrs hl032 Broadway Austin Minnie (c) Indrs rl032 Broadway Austin Odessa (c) rl032 Broadway Austin Wm (c; Lilian) lab hl77 Lawton av (B) Autry Wm H (Myrtle) cond MD&SRR h753 Pine Avant Alma Mrs fctywkr Happ Bros Co r858 New Avant Amanda (c) h223 (329) Fargason (V) Avant Annie (c) maid Ga Academy for the Blind h236 (244) Fargason (V) AvSapnrtingChas E (Bernice) mach h463 Avant Geo (c; Ida) lab r503 Pio Nono la Avant Henry J (Mary S) car repr CofGa Ry hll3 Plant (SM) Avant Ida M (c) cook hl03 Braswell la Avant Jesse E pntr r450 Giles (SM) Avant L Earl (Gladys) driver h315 Jen- kins (SM) Avant Luther (c; Gussie) lab r824 Elbert (SM) Avant Norman A (Helen) real est 105 Cotton av R1 hl404 Vineville av Avant Wm T Jr (Martha C) pipeftr r 1121 College dr Aveline Baptist Church (c) 223 (285) Moore la Aven Annie K (wid Roy E) r61 Arling- ton pi Aven Wm G (Pauline B) barber Union Dry Gds Co h811 Poplar apt 8 Avent Albert S rl08 College pi Avent Jas E cash rl08 College pi Avent John T (Margt) capt Police hl08 College pi Avent Lloyd (Anna M) opr Capitol The- atre rl53 Magnolia Avera Emmett C (Viola S) cond h337 Hanson (SM) Avera Emmett C jr elk Lester Grady r337 Hanson (SM) Avera Gordon A (Janie) mgr Royal Pea- nut Co h!17 School (SM) Avera John mach opr Dixie Roll & Cot Co Inc r915 Walnut apt 2 Avera Jos student r337 Hanson (SM) AvBearacoLneonard E (Ruby M) flagmn h236 Avera Mattie (wid John) smstrs h915 Walnut apt 2 Avera Milton J (Thelma C) gro 2402 Broadway h do Avera Susie M (wid Wm) rl28 Winship (WH) Avera Wm (Mollie) rll7 School (SM) Avera Wm H fctywkr rll7 School (SM) Avera Wm J appr Taylor Iron Works & Sup Co r915 Walnut apt 2 Averet Nathaniel T (Eliz) millwkr Bibb Mfg Co h26 Schell av (EM) Averett see also Everett Averett Ernest (Sadie) driver Middle Ga Lbr Co r205 Fulton (SM) Averett Inman D (Mary K) mgr Ga Beverage Supply Inc r336 American blvd Averhart Janie (c) h520 New Avery Andrew (c; Mamie) lab h314 2d av (V) Avery Annie M reporter r222 Ross Avery Chas (c) h931 Woolfolk (EM) Avery Chas (Leola) sheet metalwkr Andrews Sheet Metal Wks hlOO Pryor (SM) Avery Docie (wid Wm) rl419 3d Avery Eula (c) r4 Sparks al Avery Felix P (Ollie M) custodian USPO Avhelr3y30Gr3eden (c; Rosa) lab hl45 4th av Av(eVry) Jack D reporter Macon Telegraph r222 Ross Avery Jessie M (c) rl09 (8) Jordan (EM) Avery Leslie rep r Hotel Gordon Avery Ross opr SBT&TCo r222 Ross Avery Roxie E (wid John S) h222 Ross Avery Tolver (c; Wylene) porter Wofiford Oil Co rl45 4th av (V) Avrunin Louis (Sarah) pawnbroker 508 Poplar h54 Arlington pi Avrunin Sol elk Louis Avrunin r54 Arlington pi Axam Margt (c) h228 Jefferson Axam Susie M (c) student r228 Jefferson Axam Wm (c; Georgette) porter Shell Petroleum Co h99 Thomas (EM) Azbell Benj P (Mary) dept mgr Spiller's Restr r854 C'herry Babb Ada (wid Jas T) r724 Anderson (SM) Babb Alice K Mrs modiste hl37 Magnolia Babb Alton K (Frances) mach CofGaRy h422 Duncan av Babb Chas H (Virlie K) woodwkr Central Sash & Door Co h98 Harrold (SM) Babb Mamie J cash W T Grant Co r520 Linden av Babb Pearl smstrs Vincent Canipelli r98 Harrold (SM) Baber-Blackshear Birdie r85S Walnut Baber-Blackshear Mary h856 Walnut Backer Aaron mgr J Backer Purn Co r853 Walnut Backer Flora Mrs mgr h853 Walnut Backer J Furniture Co Aaron Backer mgr 460 Poplar Backer Sidney (Stella P) asst supvr WPA h853 Walnut Bacon Albert H (Helen) millwkr Bibb Mfg Co h30 Bibb av Bacon Beatrice (c) Indrs r99 Alexander Bacon Harry (c; Martha) lab h99 Alexander Bacon Harry jr (c) lab r99 Alexander Bacon Jas A (Ollie) uphol Mrs Alice Anderson rl03 Pierce av (V) Bacon Wingfield (c; Addie) lab CofGa Ry h Thorpe (B) Baechtel Victor Rev asst pastor StPeter CUaver Catholic Church h430 Ward Baggarly Alva V rll3 Williams (SM) Baggarly Alvah (Verna) loco eng hll2 Laurel (NH) DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 38 bu M Si! os A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Baggarly Eliz tchr r417 Adams Baggarly Ernest M (Vivian L) inspr h779 Patterson (NHts) . Baggarly Henry J r779 Patterson (NHts) Baggarly Jas B rll3 Williams (SM) Baggarly Jas B (Mamie) formn h417 Adams Baggarly Jas B jr asst eng City Water Works Shop r417 Adams Baggarly Martha student rll2 Laurel (NH) Baggarly Wm V (Florence L) eng hi 13 Williams (SM) Baggarly Wm V jr appr Macon Teleg Pub Co rll3 Williams (SM) Baggett Kathleen fctywkr Happ Bros Co r415 Forsyth Baggett Scholey A (Lois) lab hl027 Clin- ton rd (EM) Baggett Scholey A jr sten Taylor Iron Wks & Sup Co rl027 Clinton rd (EM) Baggs L D & Co (Linton D Baggs jr) accts 303 2d Baggs Linton D jr (Leah; L D Baggs & Co) hl307 Vineville av (V) Bagley Leo V (Ruth) piano tuner h580 Boulevard (NH) Bagley M Ruth Mrs millwkr Willingham Cotton Mills h.336 Dannenberg av Bagwell Bernice L (wid Jos W) dental asst Dr Jos T Stukes h678 Courtland Bagwell Wm H (Sarah) h204 Hines ter Bailey F Roy elk R Carl Gregory r32 Progress Bailey Fannie (c) maid rlOl (100) 3d (U) Bailey Flemming W (Mary E) ftr Macon BaGilaesy. CFolorrriilel N(winidadeFllreddkr) elk r32 Progress Bailey Florrie jr student r32 Progress Bailey Frances rll03 Elm Bailey Frances D (wid Leonard C) office sec WPA whse h711 Orange Bailey Frank (c; Ida M) carp h331 ErBanielesyt F(CraHn)k (c) lab rl06 Key (U) Bailey Geo (c; Mary) lab hlOl (100) 3d Ba(iUle)y Geo B (Mary M) service mgr BaSilteeyve GMeoSoWlomo(Jnujlirah) l0c4uCstaoldloiawnayh(lV78) Magnolia Bailey H Woodfin (Annie M) gro 303 (304) Campbell av (SM) hl040% 2d Bailey Hattie (c) bottle washer Gibson Vinegar Works rl62 5th Bailey Hattie (c) lab r!19 Elm Bailey Henrietta (c) lndrs rl61 May av (U) Bailey Henry (c; Frankie) carp hlOO Ernest (CH) BaPileeeylerHeHndryw (CCoarrrile5)5 pMoratdeirsoDnunlapBailey Henry I (Martha I) elk hl541 Bailey Albert (c) steward Elks Club rlOO Ernest (CH) Bailey Alice (c) lab r426 THTIammondj Bailey Alwyn F mech r709 Anderson (SM) Bailey Andrew C (Louise) driver h453 New Bailey Andrew L (c) slsmn r307 Green Bailey Annie K (c) maid r307 Green Bailey Anthony (c) delmn Robt K McAfee rl20 Tindall av Bailey Arbut W elk Macon Evening News rl040y2 2d Bailey Arcelius (c; Irene) lab hill Elm Bailey Auto Parts (Wm J Bailey) 621 3d Bailey Avenue Mission 405 Bailey av (CH) Bailey Bertha (c) cook rll8 (18) Wise College Bailey Henry M custodian rl36 Log Cabin dr Bailey Hezekiah (c; Clara) lab Central Sash & Door Co h208 Hazel Bailey Hillman (c; Nellie) lab h343 4th av (U) Bailey Hollis (c; Emma) lab rl26 (240) Railroad av (V) . Bailey Howard elk College Hill Pharmacy rl78 Magnolia , Bailey Hugh R slsmn r Capitol Hotel Bailey Ida B (c) maid rll6 (230) Stew- art's al Bailey Ina (c) maid rl52 Hill Bailey Iola (c) barber 413 Cotton av rlOO Ernest (CH) Bailey Jacob B (c) lab h210 Moughon (V) Bailey City Barfield Robt M (Inez) restr 25% Belle- Barlow Robt (Ethel) millwkr Bibb Mfg RaCrOlnwh32V5irClelvinltaobn r3(E4M3 )Flanders (E]^/ vue rd h do Bamw B L (Sally B) lab r390 Clinton (Barfield Siandy (c) h03H Barfield al Barfield Thos W (Lena; Barfield's Dress ishidp) bias Culver (V)i Barfield Verdie Mrs r560 Arch Barfield W Toland slsmn rl025 Clinton iBarfieldHWm E (Maude C) carp W1O0B Clinton rd (EM) Barfield's Dress Shop (Thos W Bar- field) 451 3d Barge John A (Alva C) slsmn Steve M Solomon jr hll4 Napier av Barge John C student tl!4 Napier av Bargeron Jos G (Beatrice) mail elk Macon Evening News r611 Duncan av Bargeron W Heywood (Margt C) detec- Earne(Nr HP)earl (c) Indrs r rear 109 Wall's Ba&rnBesarAneEsmInmcehtt91(0EtNhealp)ievr-pres Barnes BaBrnaernsesA &EmBamrnetets jIrnc(Sha35ra0hVHis)ta pcriers Barnes Albert (c; Susie) lab rll9 (225) Elliott (EM) Barnes Alice C Mrs slswn r Columbus ra Barnes Annie R (c) maid r538 Jackson Barnes Apartments 356 New . . Bames Augustus (c; Geneva) millwkr Bibb Mfg Co h361 Hazel Barnes Avey Mrs h821 Mulberry Barnes Bennett (c; Rosa) b489 Long tive Police r200A Beech av Bargeron Wm h611 Duncan av Barineau Wm L ((Christine) eimp CoflGa Ry hl519 3d Barker Anna E smstrs r204 Hightower BaLrakmerarB(aVr)ney B (Lessie) co,,nd hl0, 5 Barker Bettie (wid Henry T) h2Q4 High- tower M^Beul^L (wid^ J Gardner) fur- irier 318 Wiasthington av n doi Barnes Barnes Bunk (c; Carolyn sMtuadreyn) tlarb10h55,2B7reFnotr^sSyt^h Barnes Cora (c) hl46 E Academy (EM) Barnes Dana R (wid Jas W) r525 Coll ege apt 3 Barnes David (c; Idalia) driver .hl16(!1i Barker Clifford C (Ruby M) formn h 100 Capitol av BMnesSDavid A jr (Eva) elk hl05 Brent- Barker E S Mrs r301 Cherry Barker Essie (c) h324 Dempsey av (U) Barker Florrie H (Lucy) policemn hl07 Nelson (SM) Barker Geo M (Eliz) bkpr Jeffreys-Mc- Elrath Mfg Co hl93 Laurel av (NH) Barker Geo T (Ola) hllO Florence av (S B^nes ^Jewey D (Garnet B) toll test bdmn SBT&TCo h207 Hines ter Barnes DeWitt (Gladys) carp hll20 College dr , . Barnes Donald W (Grace) h Rrvoli dr Barnes Dorothy student r207 Hines ter M) Barker Idell (c) Indrs rl2 Parker av (V) Barker Jos F waiter rl05 Park pi apt 2 Barker Mary E (wid Robt) h325 Ross Bames Dorothy C tchr PS r811 Walnut Barnes Elias L (Lula M) baker Ameri- can Bakeries Co hl823 Broadway 43 WILLINGHAM SASH & DOOR CO. Lime -- Roofing Cement -- Plaster 457 Thiird St. Phones 277-278-279 Barnes Ernest V (Sophie G) auditor h Ba3r2n8eBs eEetchhelav(c) maid r489 Long Street la (SM) (Barnes Eva (c) cook h22i8 MdClain la Barrientetsa E(SvMa ) (c) lndrs r422 (538) HenBBaarrnneess FEavnaniHe (sct)udceonotk rrll0l35 B(1r5e9n)twEoliozd- abeth (SM) Barnes Genie (c) maid h209 3d av (V) Barnes Genie administrator WPA r 211 Cherokee av BaLrontes Geo (c; Luretha) lab rl44 Army Barnes Geo L (Annie) slsmn hl25 Birch (NHts) Barnes Geo W (Sadie B) slsmn Taylor Iron Wks & Sup Co rl05 Semibole av Barnes Gertrude (c) cook rl29 Wood al Barnes Grace (c) r401 (300) Elizabeth (SM) Barnes Gussie (c) h469 Industrial Home Barnes Gussie (c) lndrs hl07 '7th av (M) BaUrnneivs Hh5e0n3r%y SAd(Mamasttie T) prof Mercer Barnes Jas (c; Nellie) lab hl03 (115) 3d av (V) Barnes Jas B (Lucille) gro 200 Orange Bahrln0e5s KJeansmoOre (pSiue) baker American Bakeries Co r203 Fort Hill (EM) Barnes Jefferson (c; Carrie) lab Cham- bers Lbr Co Inc h957 Pio Nona av (V) Barnes Jerry (Lois) millwkr Bibb Mfg CO hl21(2 Jackson Barnes John r210 Flamingo dr Barnes John (c: Mamie) carp h308 Ce- dar (U) Barnes John (c) lab rll3 (152) Cedar (U) Barnes John T (Nora) h915 Walnut apt 8 Barnes Kate (c) lndrs h706 (604) Hall (EM) Barnes LaVette r316 Washington av Barnes Louie M (Dorothy M) driver h 604% Forsyth (Barnes Maggie Mrs smstrs M Ros's Barnes Mandy (c) hll2 Concord (SM) Barhes Margt M bkpr Met Life Ins Co h525 College apt 3 Barnes Mary (c) h416 Oglethorpe Ba4r2n3esEMlliaortyt ((Ec)Mm) illwkr Bibb Mfg Co h Barnes Mary S (wid Geo W) r811 Wal- nut Barnes Mattie elk R C Cropper Co rl78 Magnolia Barnes Melvin (c) agt Guaranty Life Ins Co r957 Pio Nono av (V) Barnes Missouri hll5 Monroe (U) Barnes Moses (Victoria) sec-treas Bate- man Co Inc h649 Hillyer av (CH) Barnes Nell sten r649 Hillyer av (CH) Barnes Ophelia millwkr Bibb Mfg Co r rl28 Fort Hill (EM) Barnes Oscar (c; Laconia) lab h558 BaWMrn)aersd O(Vti)s (c) carp r706 (604) Hall (E Barnes Patsy (c) lndrs r523 Hazel Barnes Paul (c) lab rl081 Pio Nono av (V) Barnes R Caesar (c; Willie) h302 (406) Bowman (EM) Barnes Robt H (Eliz) hlpr Ga Power Co r322 Orange Barnes Rosa (c) r596 Fort Hill (EM) Barnes Rosa (c) maid h538 Jackson Barnes Ruth (wid John N) h356 New apt 1 Barnes Smith (c; Carrie B) lab h42G Telfair Barnes Stella (c) cook r207 (367) Rail- road av (V) Bahr2n0Oes (V21e3s)roCe la(rck; L(EaMur)a) lab CofGaRy Barnes Warren O (Maggie) h210 FlamBairnngeos dWr ilbur O asst mgr GtA&PTea Co r210 Flamingo dr IBairnes Wm B (c; Etlhel) lab rlilB Con- cord (SM) Barnes Wm T (c) dist mgr Guaranty Life Ins Co h309 Berry Barnes Willie (c) maid r538 Jackson Barnes Willie M (c) r308 Cedar (V) Barnes & Barnes Inc A Emmett Barnes jr pres A Emmett Barnes v-pres ins 361 Cotton av Barnett Dock (c) lab h238 Orange Street Balarnett Ferdinand F (c; Hattie E) blksmith 816 Montpelier av hilOS Ne'el 1(H)) BARNETT GEORGE. Manager Mulberry Market, h496 Forsyth, Tel 2454-J Barnett Jack S elk r514 Church (EM) Barnett John W (Mae B) lawyer 403 Cherry R305 r541 Georgia av Barnett Manufacturing Co (Wm O and Robt C Barnett) harness mfrs 315 Poplar Barnett Matthews elk r406 Forsyth Barnett Milton B elk r514 Church (EM) Barnett Morris (Esther) h406 Forsyth Barnett Robt C (Mildred; Barnett Mfg Co) r467 College apt 11 Barnett Sami elk r406 Forsyth Barnett Sami (Sarah) gro 514 Church (EM) h do Barnett Wm O (Barnett Mfg Co) r217 1st Barnette E Hartley (Lucille) stonewkr h460 Virginia av Barney Frank Rev (c; Forries) rl07 Douglas av (V) Barns Roberta (c) cook hill Main (S) BBaarrnnwweellll BCelaeraMrLs Mhl2rs2 bBdigrch533(NOHrtasn)ge !h d!o Barnwell Harry W (Mae C) slsmn Clark Memorials Inc r333 Hill Crest av (CH) Barnwell Nina (wid Geo R) h2335 Forsyth rd Barnwell Price slsmn r2335 Forsyth rd Barnwell Sguare Apartments 119-21 BaBrnirwchell(NWHmts) C (Minna) dispr h207 Hendley (NHts) Barnwell Wm C jr customer's mn FenBanreorn&LilByea(cn)er2r23037 (H12e4n) dElelylio(tNt H(EtsM) ) Barr Wm (c; Leana) lab h615 (15) Gilmer Barrentine Louise student Hephzebah Orphanage r Forsyth rd PO Box 222 Barrentine Ozie L (Maggie) elk r428 Main (EM) Barrentine Walter W car repr CofGaRy Barrett Benj (c; Ethel) lab h!69 (321) Nussbaum (SM) Barrett Bertha M (c) lndrs Crescent Lndry Co r441 Elbert (SM) Barrett Clyde (c; Mary) lab r859 3d BaHrirlelttCEreliszt Hav (w(CidH)John J) h302 (310) Badrarlel tatvJo(SsM()c; Mattie) lab h243 TinBa(rUr)ett Julia (c) lndrs rllO (122) Cedar Barrett Lucy sec to pres Mercer Univ r 305 Adams Barrett Margt student r421 Adams Barrett May B (c) maid r859 3d (:BRararieltrtoNadoaiahv(c;(VO)ia'milla) lab hilUI4 (12) Barrett Wm student r421 Adams Barrington John O (Ida M) wtchmn h 138 Concord (SM) Barrington Juanita rl38 Concord (SM) Baarlron Ceola (c) maid h320 Cheatham Barron Clara (c) maid rll Coleman al Barron Fannie (c) lndrs hill 4th av (V) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York GO .S' 44 FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Barron Haskill E (Katheryn V) reprmn SBT&TCo h337 Adams Barron Henry (c) lab r815 Ocmulgee BaBrtalrettltettS)hereetarM6e5t3al BWrooardkws a(yWalter E Bartlett Tressie (wid Willie E) rl02 BARRON HUGH C (Margaret; Dixie Cycle Co), hl240 Edgewood av Bartlett Walter E (Julia M; Bartlett Sheet Metal Works) h949 Elm Barron J Lee Mrs tchr r314 College Bartlett Walter L (Beulah) wtchmn Barron J Tindall elk Tinsley's Grocery Willingham Cotton Mill h251 Oakland & Mkt rl811 Broadway (ByairHrogn iJolhn (c; Albertla) hB4 (12) FordBarron Kathryn opr SBT&TCo r337 Bartlett Wm T (Susie) millwkr Willingham Cotton Mill h4 Randolph pi BaWrtlaesyhinFgrteodn a(vMay) aut,,o mech rl26 Adams Barron Martha nurse 272 College r do Bartley H A (Lillian) elk WPA r319 Duncan av BBaarrrroonn MSaynrctiisl M(wrisdtcJhasr PRS) rr381546 CPoilnleege Barron Schuyler (Alva L) lab rl811 Broadway ,_ _ Barron Wm (c; Tempie) lab hell Ross Barron Wm J (Mary M) bicycle mech Dixie Cycle Co h237 Winship (WH) Barton Cossie B (c; Pearl) lab hl63 Lyn- wood av (V) Barton David W (Nora) , cond , ,,,,,, h696 THT.i,,ll- yer av (CH) Barton Dixie W (Hazel N) hl20 Inver- ness av Barton Dixie W .ir student rl20 Inver- Barron Wm M (Omega M) sign pntr h ness av , 1412 Edgewood av Barton Earley H (Louise) millwkr At- Barrow Albert (c) hlpr r411 (410) 3d av lantic Cotton Mills h28 Atlantic Vil(V) Barrow Alma lndrs Crescent Lndry Co Barton Eliz Mrs lab r315 Rutherford av Barrow Andrew W (c; Independent Funeral Home) h411 (410) 3d av (V) (Barton Fannie L cash r-209 1st1 Barrow Ben (c; Cathrine) hl4 Harris al Barton Forest W (Minnie) millwkr Bibb Barrow Birtill T (Lucinda D) instr Bal- Mfg Co h88-89 Green (PM) lard Normal Sch r50 Forest av (V) Barrow Ethel (c) lndrs r855 (856) 3d av' Barton Luie (c) r237 (243) Fargason (V) Barton Mae (wid P J) h744 Walnut (V) BARTON MARY LOU, Bursar Wesleyan Barrow Fannie (c) lndrs h232 (23) Vir- ` Conservatory, Tel 4437, r451 College gin la (V) ^ Barrow Jessie (c) h855 (856) 3d,av (V) Barrow R Roy (Frances) sta mgr r99 Vinville av apt Al Barry Arth P (Texas) mgr Grand The- atre h305 Buford pi Barshow Frank (Nellie) slsmn rl32 Holt Barthlen Alfonsus Rev pastor StPeter Claver Catholic Church h430 Ward Barton Melba' L r696 Hillyer av (CH) Barton .Wallace carp r860 2d Barton Wm J Waiter. Greyhound SandBawshicihnsSkiho-Bpern2j92J1 H(oBuesrtnoince)av p(hSyMs ) 700 Spring R320 hl20 Buford pi Bashinski Sarah (wid Lewis) h800 BaCshheurkry Edw , (Tessie; Dixie J.ob,,bi.ng (V) House) h204: Napier aV Bartlett Blanton I (Addie M) batterymn Basin Frances (c) r609 Ross Jack Mann Battery Co hl43 Rose Park Bartlett Carrie Mrs checker r814 Hem- lock Basion Emma Cc) lndrs h301 (421) Eliz- abeth (SM) _ Baskett Dock M millwkr Bibb Mfg Co r Bartlett Chas L lawyer 1218 Ash h do Bartlett Chas R r308 (349) Log Cabin dr Bartlett Chas W (Kate M) millwkr Willingham Cotton Mills h28 (89) Mill Bartlett Clara (c) student r215 (433) Alabama (SM) Bartlett Frances E student r251 Oakland av Bartlett Geo W (c; Mary E) lab h9 Bartlett av Balertylaentt CHolellerndoR associate prof WesBartlett Holley W student r308 (349) Log Cabin dr 730 Oglethorpe , . . Baskett Raymond (Ida M) hlpr Sterchi Bros Stores Inc r251 Jeff Davis (SM) Baskin Wm H (Marion) pres Builders Lbr Co h317 Adams Baskin Wm H jr IFlrlances) v-pres Builders Lbr Co h5H7 Ridge av >(V) Baskins Gus (c) lab r952 Montpelier av (Blason Oath (c) cook h3SI8 Broad OEM) BaBsrsoaBduwsayLines Wm A Dix agt 320i Bass Chas rl80 Cedar (SM) Bass Chas lab r302 Water (EM) Bass Chas T (Eliz) pntr h317 Clinton (E Bartlett Horace (c; Odessa) porter rl21 Middle (V) Bartlett John (c) student r215 (433) Ala- bama (SM) , Bartlett John C (Sarah) ms agt r803 Pine Bartlett John W (Gladys) mgr Walter N Shinholser hll4 Highland av (LC Hts) Bartlett Jos W hlpr Bartlett Sheet Metal Wks r949 Elm Bartlett Mae Mrs furrier Mrs Beulah L Barnes rl26 Washington av (V) Bartlett Margt L student r251 Oakland Bartlett Mary L (wid Luke) h516 Ogle- thorpe Bartlett Mattie millwkr Bibb Mfg Co r 105 Willingham (EM) , Bartlett Paul A millwkr Willingham cotton Mill r251 Oakland av Bass Clarence (Nellie) hl80 Cedar (SM) Bass Cora (c) r303 Blount BatshsorEoleiz (wid Wm A) smstrs r516 Ogle- Bass Eva (c) lndrs hill Tindall av (SM) Bass Irene L (wid Jas M) h855 Mul- berry apt 302 Bass John L r371 1st -- Bass Louise waiter Wilmer M Cox r RD 3 Rutland BBaassss MMaWrcu(sLu(lcu)) lra5b25CJoafcGkasoRny Bass Marion beauty opr Luerec Beauty Shop r213 Bond apt A2 Bass Methodist Episcopal Chuich (South) 3102 Forsyth rd Bass Minnie (c) lndrs h519 Calhoun Bass Robt E (c) r303 Blount Bass Robt L (Nannie) pntr h367 (347) Bartlett Robt (lone) millwkr Bibo Mfg Lndry & Dry Clng Co r620 Walnut Bartlett Robt L (Toye) dry clnr Snow's Co r249 Church (EM) Bartlett Sami (c; Ellen) lab h215 (433) Alabama (SM) Bas^s RTohbots LHj?(cr3; 6O7de(3s4s7a)iWH.)ydjaronliitaor(EMMa>con Gas Co h2'10 (316) Blount Bass Thos H (c; Ophelia) porter The Kuhn Mfg Co r4 (315) Hanson (SM) 45 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Bass Wm j (Willie B) meatctr Marvin's Gro r508 Walnut Basser Bath restr Clinton (EM) nr River rd h do Bassett Bernard W (Johnnie P) driver Yellow Cab Trans & Bge Co r2227 (2281) 2d Bassett Carrie (wid Newton) fctywkr Happ Bros Co rl31 Knott (SM) Bassett Chas R (Viola) mech Central Sash & Door Co rll2 School (SM) Bassett Florence Mrs bkpr r507 Georgia BaSsassehtt &GeDooHor (CAonnhile2)6caSbtetmelekr(SCMen)tral Bassett Geo H jr rl26 Steele (SM) Bassett John driver rl26 Steele (SM) Bassett Mallory E (Mildred) lieut Fire Dept hll2 School (SM) BaDsasleyttCRoemrl3b1erKt Eno(tFt ra(SnMce)s) plmbr F X Bassett Robt E (Mabel) bkpr Central Ga Baking Co h2312 2d Bassett Tex (wid Benj) r868 2d Bateman Rebecca (c) maid h220 Pond Ba(tVe)man Robt L (Eliz) gro 1102 Napier av h217 Bond Bateman Robt N (Nell) ticket agt Ter- minal Ticket Office hll9 Inverness av Bateman Ross C (Eloise) meatctr GtA& PTeaCo hl94 (108) Crescent av (CH) Bateman Sophronia (wid Albert G) h906 Oglethorpe Bateman T F Mrs elk Union Dry Gds Co r560 Boulevard (NH) Bateman Terril M (Eula) eng Fire Dept h906 Oglethorpe Bateman W Chas (Eliz C) meatctr GtA &PTeaCo h70i3 Winton av Bateman's Barber Shop (Ernest E Bate- man) 318 Broadway Bates Mamie millwkr Atlantic Cotton Mills rl35 Roff Home la Bates Mary (c) cook h625 Chapman al Bates Olin B (Laura) asst formn r620 Pine Baston Chas E (Julia) emp C of G Ry h217 Jackson Baston Chas W millwkr r203 Hartley av (CP) Baston Wm M (Letha) lab h203 Hartley av (CP) Bates Roy C (Evie) h319 White (SM) Bates Sulina (c) hll9 (10) Braswell la Bates Thos H (Hazel R) millwkr Bibb Mfg Co r557 Oglethorpe Bates Vernon (Annie) pntr h325 White (SM) `Biatcihellar Wm r2603 Broadway Batchelor Albert L (Elva) appr CofGa Ry r659 2d Batchelor Alice student r23 Lake^Sity (EM) \ Batchelor Alonzo N (ClajwNHL- crit cJk Sou Ry System hl266k Rpd#e ay -(V) Batchelor Artis R-IJjfewea car r'epr C of IGa Ry hm lEmcfty iv (Sfif) Batchelor Atkins tNeilie V*)- millwks Willinghafp-Cotton Mill h209,Carling Batchelor Chas M (Margt) wtchmn''h23- Lake City (EM) ,, : \ J Batchelor Elva Mrs;TiOQr#n F W'wool- , worth Co r69K23\ X -vX Batchelor Mary 4 (wid Jas H> ^']5 Ru- therford ay (SM) " Bateman Belle checker Crescent Lndry Co r906 Oglethorpe Bateman Betty student rll07 Vineville av (V) Bateman Cecil M (Agnes) mach Taylor Iron Wks & Sup Co r605 Carling av Biateimlan Clara B slswn Dannenberg Co rl!2i3i W Grenada ter Bateman Clifford H (Louise) pres Bate- BamteamnaCnoCIondconholl0V7 (VwiindevJiallse) ahvl2(1V)Ell (SM) Bates Vernon jr lab r325 White (SM) UaBleesauVtyirgSianlioanMr5rs60beHaeumtyloocpkr Pucketts Bathae Robt F (Florence) mgr Swift & Co hl87 Laurel (EM) Bathe Markus (c; Mary L) lab h405 E ii4.(- r ,oy f (Willie) sprayer iSSOl in' av (SM) Batson Anna L smstrs r203 Hartley av CP) Ilatson Eug student r3214 (3198) HoustiAn av (SM) jBatfeon Irene L student r2803 Houston ' av (SM) Batson John L slsmn r2803 Houston av (SM) BaCtsoounntyJoThnax WColLlr (rM28a0e3 CH)oudsteopn ealvk (SM) Batson Jos H millwkr Willingham Cot- ton Mill r202 Duncan av Batson Lucile student r3214 (3198) Hous- ton av (SM) tBlatson Oscar M (Alice) oar relpr C of IGa Ry r32T4 (3198) Houston av (SM) Batson Walton G (Bertha) millwkr Wil- lingham Cotton Mill h202 Duncan av Bateman Co Inc Clifford H Bateman pres Dewey C Bateman v-pres Moses Battle Adolphus (c) lab r476 Lake Battle Annie (c) cook h257 White al Barnes sec-treas whol fruits 336 Pop- (SM) Balaterman Cora E rll7 Grand av (Bateman Dewey C v-pres Batetoan Co Inc r Walden Ga Bateterman Edith student rl23 W Grenada Bateman Emmett E (Clara) car inspr C of G Ry hl23 W Grenada ter Bateman Ernest E (Lilly; Bateman's Barber Shop) h560 Boulevard (NH) Bateman Gilbert C (Lyda E) dept mgr BaGtetAm&ajnPTHeaaCnsoelhRll7mGearatcntdr GavtA&PTea Co rll7 Grand av Baatvem(Van) Helen student rl`107 Vineville Bateman J Howard rl21 Ell (SM) Bateman Julian H (Ruth) meatctr GtA &PTeaCo rl94 (108) Crescent av (CH) Bateman Leila (wid Lee) r808 Orange Bateman Marie N sten The Letter Shop rl23 W Grenada ter Bateman Mary (c) maid r403 (404) Crisp (SM) (Bateman Milton E emp C of G Rv r'OOS Oglethorpe Bateman Peter (c) r222 Gilmer Battle Annie (c) lndry wkr rllO (10) Alabama (SM) Battle Annie (c) maid rll4 (12) Railroad av (V) Battle Annie M (wid Cullen) h597 College Battle Bertha (c) rl67 May av (U) Battle Boskie (c; Ella) lab h615 4th av (WH) Battle Carrie (c) h505 Maynard (EM) Battle Chas (c; Bertha) r224 Chappell la Battle Chas (c; Mamie C) firemn hl55 KS5I8) Fulton al Battle Chas B (c; Lillie) lab h822 Mont- pelier av Battle Clifford (c; Acee) lab h320 Green Battle Ella (c) lndrs h456 Chestnut Battle Eug (c; Elnora) hl51 (426) BaFtotlresyFthralnak (c; Betty) lab hill (10) Grant av (S) Battle Goldie (c) hl58 Glen (EM) Battle Gussie M (c) lndrs h9 (1) Moore al Battle Henry B (c; Mattie) janitor Cap- itol Theatre hll04S Pio Nono av (V) AN* U1 : 2 C/3 MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 46 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Battle Isaac V (c; Lula) rl02 (114) Battle^jas* (c; Eleanor) h203 Industrial Battle'John (c; Mary R) lab r702 (262) Charles (SM) ,,,, _ . Battle John (c) lab hl6 Park Hotel al Battle John H (c; Frances) lab r224 Ernest (CH) Battle Lee janitor Mercer TUTm.v, r207 (252) Prince (SM) Battle Leonard (c; Minnie) lab h7 (134) Malloy's al Battle Lillian M r597 College Battle Lucinda (c) lndrs hlllO (340) j?ock av Battle Lucy (c) lndrs H227 Moughon (V) Battle Lulu (c) r330 Jackson Battle Mary (c) maid r325 5th av (V) Battle Mary L (c) maid rl55 Walker la Battle Mattie (c) maid hl73 1st av (V) BaMtt)le Mazie (c) lndrs hllO Short la (E Battle Minnie (c) lndrs hlOO (1225) Bow- Battle Mkmie (c) lndrs h240 (213) Plant Battle Minnie L (c) lndrs hl06 (540) Tinsley la , , Battle Mollie (c) cook r473 Douglas av Battle Mollie (c) maid hll5 (254) Railroad av (V) Battle Monroe (c; Rosa) swtchmn h203 Bartlett Battle Nellie (c) hl2 Parker av (V) Battle Nellie (c) cond rlOl Dure: (V) Battle Ola M (c) lndrs r257 White al BAYNE CHARLES 3 (Mary H), Editor Macon Evening News, h6 Glynn av, Tel 3135-J Bayne Louise office sec Ga Better Business Assn Inc r239 Bond Bayne Martha M (wid Marmaduke) r Anola pi (V) ^ Bayne Sami E prescriptionist Clark Drug Co r610 Holt av (NHts) Bazemore Birdie I r322 Linden av Bazemore Claude welder rl32 Cole Bazemore Crowell O (Ella M) eng hl32 Cole Bazemore Gordon W linemn rl32 Cole Bazemore Louis student rl32 Cole Bazemore Mollie (wid Chas E) r322 LinBadzeenmaovre Nettie H (wid Oscar C) h2642 Houston av (SM) Bazemore Wallace L (Jessie; Bazemore & Golsan) hl27 Beverly pi Bazemore Walter L (Talitha E) elk City Marshal h826 Orange Bazemore & Golsan (Wallace L Baze- more Willard R Golsan) phys 516 Mulberry R817 Bazzelle Richd carp r504 Hemlock Beach Albert O carp rll2 Branch (CH) Beach Donald D (Carrie) slsmn h208 Corbin av (V) ,,_,, . Beach Jas R (Anne) elk C of G Ry h416 Forest av (V) . ... BeBarcahnidRhuss(!eClHl )H (Lucy B) carp hll2 Beacham Jas O barber Stephens Barber BeachamWmC (Lucie) elk SoutheastBeSP3jSKl3 Heard Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R, L, Polk & Go. Publishers 431 Howard St. , Detroit 354 4th Ave. New York Battle^Robt (c; Lula) lab hl57 May av (V) Battle Sarah (c) maid rl04 Spring Battle Sim (c; Ollie) lab r321 Jefferson Battle Vilena (c) h401 (300) Elizabeth BatthP Wm (c) lab rl07 (345) Edison iBg ealge Arnsnixe K.'awasite'rM Kitcfhefnls& Kitacngen r220 New ,, . Beale Bruce r Clinton (EM) nr Hiver rd Beale Philip W tube bender Dixie Neon BeSa1lePPotomoc R (Lila) lab h205 Ponce Battle Wm C Batton Hardy (c) L (lBaebssri:6e1)5 4th av mach C (WH) of de Leon av (SM) nr Beale Wm (Julia) h Clinton (EM) nr BSto^RichdrHnstudeVnt rl37 Virginia av BeaU^Wm r Clinton (EM) nr River rd Batton Wimbrick L (Evelyn) appr C o BaGftsRyIdar32(1wiCdoWlemalakner)avr3(1O4HN) ew BBBfaacuulgsyhhccwuummSteLJroohvWenjkosMyS_Dh(h oTphehl6m4a7 FMo)rsmytehlc5h4 Genones Barber & Beauty Snop B^unoilien(c^ Hester M) janitor Bank- ers Hdalt'h 'Life Ins Co h43l3` MadBarMWm (c; Ida) carp hll7 Sycamore Be1aolfl Addie elk Union Dry Gds Co r357 Beall Anita tchr r311 Cherokee av Beall Birdie dept mgr Dannenberg Co Beall Claude (c; Fannie) firemn h703 Beal1lDorrothy Bell Jefferson (c) lab rll6 (215) Rail- road av (V) Bell Jessie (c) lndrs r216 Garden (EM) Bell John (c; Emma) carp h217 Linden Bell John (c; Alice) lab h701 (608) Crisp (SM) Bell John (c; Cora) lab hll6 (215) Rail- road av (V) ,, Bell John porter F W Woolworth Co Bell John student rl70 North av (NH) Bell John W (c) lab rl28 Sycamore (V) Bell Johnnie (c) lab C of G Ry Bell Julian (c) clnr C of G Ry Bell Julian O (c; Rosa) loco firemn h 700 (690) Hall (EM) Bell Julius (c) lab rl033 Pio Nono av (B) Bellevue School 864 American blvd Bellevue Service Station (Willis S Mansfield) 399 American blvd Bellflower Carrie L student rl03 Wash- ington av ,, ._ . BeWllfalsohwinergtEonddiaev M (wid Benj T) hl03 Bellflower Edw M waiter rl03 Washmg- BelhziaVAngelo (Josephine) shoe repr h 509 Main (EM) Bellizia Frank gro 21 5th r509 Main (E M) Bellview Baptist Church (c) 103 3d av (B) Belmont Apartments 615 Walnut Belmont Miriam jr opr SBT&TCo r423 Johnson av (HH) Consult the (V) Bell Junius J (c) dentist 226% Cotton av rll5 (531) Campbell av (SM) Bell Katie (c) lab rl09 Edgewood av Bell Leonard (c; Edith) lab h236 Edge- wood av (SM) Belmont Oscar B (Rosebud) emp Union Dry Gds Co h423 Johnson av (HH) Belor Louis restr 29 Wall r315 Mulberry Belote J Harold (Betty) stereo Macon Teleg Pub Co h671 Edgewood av Belote Jas H (Lydia) cond h208 Henry Classified Bell Lillie (c) maid h507 Coleman al Bell Louise (c) tchr P S r417 Ward (V) Belson Max (Jean) gro 1200 Broadway Business Lists In This Directory Bell Lula (c) cook h23 (11) Fordville la Bell Maggie (c) h542 Jackson Bell Mamie (c) lndrs h407 Forest av (V) Bell Mamie (c) lndrs h630 Monroe Bell Marguerite (c) lndrs h775 Edge- wood av Bell Mary student 1*402 (303) Suwanee Bell Mary I (c) lndrs rl27 Woodcliff Bell Minnie (c) h224 Plant (SM) Bell Nan L rll38 Milledgeville rd (EM) Bell Nona (c) hl9 (133) Witkowskis la Bell Obie (c; Lillie) millwkr h657 Hazel Bell Otis (c; Ada) lab hl311 1st Bell Otis (c; Mary D) millwkr Bibb Mfg Co r612 Fort Hill (EM) Belt^Wm (c: Marie) lab h'144 Army Lot Belvin Jeddie T (c; Ophelia) lab h723 (612) prince (SM) Bembry Ralph hlpr Taylor Iron Wks Si Sup Co r217 Calhoun Benedetto Annina student r827 Orange BENEDETTO ARISTIDE A (Gertrude), Pres-Treas Crescent Laundry Co, 1)827 Orange, Tel 4220 Benedetto Arnold S J student r827 Orange Benedetto Eliz student r827 Orange Benedetto Frank (S J) student r82 < Orange Benedetto Gertrude student r827 Orange 49 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 Benedetto Jos student r827 Orange Benedetto Mary student r827 Orange Benford see also Binford Benford Alberta (c) maid rl04 Tindall av (SM) Benford Alonzo B hl608 Vineville av (V) Benford Annie M (c) cook rl04 Tindall av (SM) BeMn)ford Carrie (c) hl04 Tindall av (S IBenford Oartdr G Mrs hOTl Napier av (CH) Benford Eddie J (c; Bessie) hl60 Broad (EM) Benford Felix (c) chauf rl04 Tindall av (SM) Benford Geo W (c; Minnie) carp hl65 (215) Duval (EM) Benford Jas (c; Mary) h513 Fort Hill (EM) Benford M Scott (c) ydmn rllO Walker la Benford Mary E (c) maid rl04 Tindall av (SM) Benford Mary E student r701 Napier av (CH) Beanvfo(rSdMR) osetta (c) maid rl04 Tindall Benford Rubv (c) student rllO 2d av (V) Benford Thos L (c; Elnora) h402 (504) BeMnfaoyrndarTdho(EsML) (c; Mary) carp h707 (800) Maynard (EM) Benford Willie (c) r616 Fort Hill (EM) Benjamin Emma (c) hl02 (1) Tracy's la Benjamin Warren (c) brkmn rl432 Broadway Benjamin Wm (c; Katie) lab hll9 (161) DeBorde (SM) Benn Harry (c; Mabelle) h307 Lincoln av (V) Benn John B (c: Sallie B) hill 3d av KU> Benn Mary L (c) maid rill 3d av (U) BeNnonretfhiel(dV)Allen (c; Claudie) lab h257 Bennefield Marvin (c) porter rl06 (554) Tinsley la Bennett Abr elk r261 Georgia av apt C3 Bennett Bertha G Mrs rl28 Rembert av BBeennnneetttt CBhesassie(BMert(hca)) r2h9l7947BlBouronatdway tBennett D Gerald (c) student rl3ll0' Pliant (SM) Bennett Dora (c) maid rl606 1st Bennett Dorothy office sec Timothy Harden rl27 High Bennett Edith office sec Dr Harry Moses rl27 High Bebnenrreytt Eloise R Mrs sten h871 MulBennett Geo (c; Lola) lab h rear 62 New Bennett Georgia (c) cook r307 2d a\ Bennett Gordon driver Wofford Oil C'c Plant Bennett Harry R, (Gladys) slsmn h711 Plum Bennett Hazel C cash WUTelCo r401( Houston av (SM) Bennett Irene (c) cook r360 Campbell Bea.vnn(eSttMJ)as C lather r4012 Houston ai (SM) Jas G (Ida F) emp Taylor Iron Wks&Sup Co r RD 2 Bloomfield rd B vhJ3V19?^TMPlJaenrtry,(BSM<)-0: Armie C) swtchmn Mfg Co h734 O(SgaleBtvhoMrp)emillwkr Bibb oSethorpl*1 millwkr Bibb MfS Co r734 Be(WH)t JS (C' Ruby) lab r645 4th av Bennett Leon (Bennett & Co) r261 Georgia av apt C3 Bennett Lloyd E linemn rllO Pearce (E M) Bennett Louise (c) h867 Edgewood av Bennett Marian waiter r912 Walnut Bennett Ollie (wid Wm F) hl27 High Bennett Otis P fctywkr Bibb Mill r4012 Houston av (SM) Bennett Paul H rllO Pearce (EM) Bennett Richd S (c) student r319 Plant (SM) Bennett Richmond (Jewell; Tatnall Square BaJrlber Shop) r ILizella. Ga RD Bennett Rose ih201 Georgia av apt C3 Bennett Sara student ,r73(4i Oglethorpe Bennett Thos W student r368 College Bennett Co i3 Timothy (c) Park Hotel alal1 b Builders Ltor Bennett Walter IL (Doris ,T) welder Tay- lor Iron Wks & Sup Co M44 Nlapier av Bennett Walter W (Mathilda) bkpr Batemian Co h:38 College Bennett Walter W jr oik Crescent Lndrv Co r368 College Bennett Wm D (Eliz) Hah r10 Pearce l(EM) Bennett Wm J (Celeiste) hlilS Walnut Bennett Wm iM i(Mae) auto mech U102 Pursley (V) Bennett Willie I (wid Wm C) hl4O10 Houston av (SM) Bennett & Co '(Leon Bennett) gros 1940 BeBnrnooardwJoasy (Bmtaa (M) blrmkr CofflGRy hJll30 Rogers av (V) 903 Jos N Napier a'(vEMiel) supvr CofIGRy h BeRroy,noih,ESJO}OJld^CehiehrrIDy (a1W v1 s E> electn OofIG Benns Eula M (c) student ni08 (100) Thomas (EM) Benns John B (c; Clara) atnidt Standard Oil Co rl09' Spring Benns Lloyd (c; Mlaxy) lato h!03 (100) Thomas (EM) BeMnsfogn CCohahs2L04 (WPliullrinetrLe)e ml(iEllMw)k1r Bibb Benson Edna millwkr Atlantic Cotton Mills rsi () Raff Home pi Benson Prank c (Lucy) tax assessor Bibb County h63 Napier av' Benson Benson LJilDlie(B(wesisdi1eT) hloasb hlH8l7 Palace av A) r979 Orange apt 2 Benson W;m (Mohalia) millwkr Atlantic BeCnotltetoynAMnniilelsKh&:(lc) (m6)aidRorlfOf BHPoemaceocpki l(SM) Bentley Borie B (c; Katie) bOrmkr hlpr ICOfiGRy MSI Gantt City rd (SM) Bentley Chlarlotte (c) iMi 3d av (V) Bentley Cherry (c) h203 Wood al Bentley Herbert Cc; Maria) lab CotflGRy h05 Pio Nono av (V) Bentley Jas A .'(Martha) lab h19 (1OT9) ILog Cabin blvtd' Bentley Jeff L (c; Willie L) pntr r341 3d av Bentley Jdhn i(c; RoSie) hS03 5th av Bentley John H (Ada) r460 Carling av Bentley Julian R student r40O Carling av Bentley Lonnie (c) lab afflBIl Gantt City rd (SM) Bentley Ricihd (c) lab flise Middle (V) Bentley Ruby M student r4B0 Carling av Bentley bama T(hSoMs )1 Cc; Ida) lab h:108 (8) Ala- Benton Bennett H (Beatrice) mill wkr Bilbb Mfg Co blSO Comer ter (PM) Benton C B lab r76il Poplar Benton Danl M (Emma J) printer Flvnn Printing Co h`41i6 Ross Benton Edw L lawyer 910 Mulberry 10th SI ri08 Cleveland av (V)' We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R, L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 50 T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank: Bldg. ~^e'- L. W 0 0 D Plumbing and Heating Benton Estelle (c) cash North Carolina Mut Life Ins Co .5242 Middle (V) Benton Henry P XSebana) loco eng h 4126% Johnson av (HH) Benton Lois (c) 152412 Middle (c; Rosa) lab h210 (213) Neal av (V) Bi'lNlienwgslea Victoria K'wi'd Louis C) h8(20 Billingslee Harry Kc; Lillie) orderly h 1070 Hazel Billingsley (Ethel Mrs lh!304 Carling (av Billingsley Sami F Vjsr student trl304 Carling av Billingsly Arth (c; Emma N) porter h 2817 White al Billingsly Calvin KBM) (c; Hattie) h`21801 White al `(SM) Billingworth Burrell 'driver Noland' Co Billins Robt (c; Lilly) lab 11224 Forest av KV) Bi3l'l7s!2; Robt KMargt) Orange dental technician r Biltmore Alpartments 8111 Poplar Bimberley Isabelle (c) h510 '(4517) Mar- tha KtEM) Bimble Ralph Kc) lab r21(7 Calhoun Bines H (Mary) driver Buck Ice i& Coal Co rlSHS First' Biniford see also Benford Binford J lErie (Myrtie) collr Reliable Outfitters 'h.109 Stonewall pi i(V)> 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 52 CS| 111 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Catties of the Directories of practically Every City in the UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 Bingham Lee Demnsev av (U) 53 ROBERT O. THOMAS 569^2 Cherry St. REALTOR Telephone 1067 aofowa > Bivins Primus (c; Rosa) Co h'104 (704) Haynes lab al (MSMa'c):on Gas Bivins Rachel (0) h20 (366) Railroad av < V) Bivins Tabernacle Sanctified Church (c) 821 E 2d OEM) Bivins Thos i(c; Lillie) lab r323 Du're Bivins IhS'OO Thos (100) VCh(ca;rleMsam(SieM) )1loco firemn Bivins Willie (c) cook rl'64 5th av l(V) Bizzell Frank meat ctir r56 1st' Bizzell Henry ID (Ohrispina A) maoh h Bi(8zHoz4eillllyHeMremaarlvyockL'(`O(Hw)1id1 David) nurse 710 Black Annie E Cwid Jas H) rl2!2!4 Adams Black Chester B (Pearl) mil'lwkr Will- Blackwell Thelma ri3i49ia Houston av (B M) BLACKWELL WM G (Mary A), Mgr Maxwell Bros Fum Co, h885 Hillyer av, Tel 3725-J Blackwell Wm T serv mgr Firestone Auto Sup & Serv Stores r204 Georgia Blair Alex A jt (Dorothy) hl4H3 Duncan Blair Benj F ri7 (4) Kinnett (V) Blair Florence tchr Winship Sclh r5I6 'Napier av Blair John D (Lueile) dir of athletics Mercer Univ h'175 (207) Boulevard (IN H) Blair John D jr student rl75 (207) Boulevard (NH) Blair Lester L (Zud'ie V) millwkr Willingham Cotton Mill h7 (4) Kinnett O >gsO >O z 5=5=5 -3" O 55 Z a) m S.Q KMHte)1 Cotton Mil1 141015 l(48> Holt av Black Clarence jr student r300 College Black Clarence E (Leonard F) mgr Carolina Life Ins Co r300 College BlCacekntrEarlneCsot ttDon (HOailrriCeott)hlvli-lporePsl-abzreaas Black Eva G '(c) tchr PSi r20 Sipring BI|0m)GUS C' Mattie) 11500 E Black Harriett student rllO pAlacazdae1 my Black Hattie (c) rl 1st av (V)< B13tfo?1n5k MulberrsyuPt Orescent LndryJ Co r Mill r?l05mi'(l4lw8)krIHWolitllainvgh(aiNmHtCs)ot- Black L C (c) rSO E Academy '(EM) Black Laura E (wid Martin L) r084 College Black Leonard F clash Carolina idle 'Ins Co ri300 College Black Lydie (wid Benj B) hUOS Park Black M rile (The Plrado (I)' Black Nancy (c) r2iP6 (169) Grant av Black Osie (c) ln'dlrs rtSOB 1st Blair Madge R (wid Alex) hll6 Napier Blair Siaml M (RutJh) pntr h'1'08 Ross Blake Annie Oc) cook r!34!4 Patterson (N H'ts) Blake (Frank (c) student r'5!20 Monroe Blakely Wallace (Ruby) millwkr Bibb Mfg Co r724 Oglethorpe Blalock Willie (c; Annie K) liaib hl4'2 '(224) Roye OOH) Bland Arth (c; Ethel F) lab iT213 Fret- well al B1,and Arth (c) lab hl05 Rose Crest av l(ISM) BBllaanndd FCellatorna (Oc) rr3l60'55 RCoosleumCbruess't av (S Bla(Bn)d Francis i('c) student rl'16 5th av Bland Langster (c) h'956 Broad OEM) Bland Leon Cc) shoe shiner Macon Hat Cleaning co Bland Mary (c) cook hll6 5th av (V) Bland Mittie (c) Indrs riC6 Rose Orest av (SM)i Bl1a31 nd Nannie '(wid EdW) r23l2 High apt 5 s $ <6 3 *0 H m o w e 5) w 0o0o m > Mlg 'bCo101(h10l8:121l7 (GHeaozregl'ia) millwkr Bibb Black Virginia Oc) hails (169) Grant av Black Virginia tchr r745 Ridge av WW?m1 pF(Jjersser)7'4e5ngRWidMgeS Ravid' ge av BlcaocnkbuiSr'n16AMJuKlbMerirldyred) elk Hotel MaBlackburn A J jr Mrs elk Hotel Macon ri3H5 Mulberry Blackburn Roy M IMonetious) ins agt hl616 Carling av' Bland Thos Cc; Emma) lab r410 Monroe Bliaensd r0V3i0rgiHniiaghbkapprt Id3le Hour NurserBlIa3rnl 'ford Jesse (c) h'3'14 (63) Pium'mers Blankenship T Wesley (Clara) elk Ard Cash Grocery hl2Ui0 Blsan'k0 inSshhoipe Glenn Shop) C(266()BeCrhthuar-chIn(EgMle)h'1'9,20 Vineville av Blanks Blanche student rSOl' Ridge av Consult the CLASSIFIED Blackford Thos W (Louise) elk Spiller's Restr r6'60 Plum Blackshear C Albert (Kate) gro 222 Bl'a(2c2k0s)heHarydErdo;wliaOc';(ELMe)viah) do lab h708 El- taefct (SM)! Blackshear das .(c; Louise) h3'20 -(301) Short '(EM) Blackshear Jas millwkr iBibb Mfe Co E2I1 (2130) Center (EM) Blackshear Janet tchr PS r249 Boule- vaird' t(NIH) Blackshear Julia (c) hd'69 May av (U) Blackdhear Lemon (c; Hattie) hll03i3 Broadway Blackshear Louise Indrs Crescent Lndlrv Co r332 (301) Short (EM)' * Blackshear Maria (wid Wm) r347 Han- son (SM) Blackshear Thos 4c; Sarah) firemn h30O Blackshear Tommie L (c) K30O Elm iCEM>ea!r Wm (C' Rena) 11,11,317 BTOad Blcaicektyshear Wm Cc; Lauda) lab h'100 SoB1Wvd,el`1 Leila sfewn r512 Log cabin Blanks phans Edith Home mr2a0tHronPieMrceethaovdist(V)O1 r- Blanks Frances student radl Ridge av Blanks Leon (c) porter rl'23 Roekhill la Blanks Louis student r20H Ridge av (V) BlCainrks Louise (wid Orrey) rl21'5 Vista Blanks Otis L (Norine) elk h!201 Ridge av i(V)' Blanks Phillip student r201 Ridge av Blanton Forrest A (Eura L) washer Crescent Lndry Co hlO0 Washington Blanton Geo W (Martha R) slstnn h63H Forsyth Blanton Kath fotywkir Carstaphen r21 Bid! Blanton May r82'l 2d Blanton Nellie (wid Wm) jab h9'19 New apt 2i Blanton Wm bkpr r555 2d Blash Alex (c) lab Macon 'Neon Sign ;Co rlO (4) Fulton la Blash Jackson (c) lab ri2HIT Madison Blash Mattie (c) maid h40 (45) Green's la Blash Sami (c; Lilia) lab h Moore al LISTS of the DIRECTORY If You Would Find What You Wish to Buy 54 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Blash Sarah Oc) cook r49 (45) Green's la Blash Veal (c; Sam) lab Central Sash & Door Co h8 (11) Henry (SM) Blasher LaUra (c) maid r20O 1(210) Clark (EM) Blasher OUie M Cc) maid r'li27 Park Hotel al Blashingame Odessa Cc) lab rl03 2d av (B) Blasingame Geo (c; Epsie) h705 (706) Ellbert (SM) Blasingame John W (Ina) driver Dixie (Dairies hilOl North av (JSUH)' Blasingame Woodrow emp McKesson- Riley Div r RD 2 Blassagin Florence Cc) Indrs rill Main Blfa(Su)r' Ina Mrs rl427 2id Bledsoe Annie M (c) maid rl07 Park Hotel al Bledsoe Ervin R Oc; Mary) shoe repr 3a4v3 ((S43M7)) Alabama (SM) h400 Tindall Bledsoe Fannie Oc) indrs rl07 Park Ho- tel al Bledsoe Sally Oc) h4i20 Ash Bledsoe Ih'ISIT Walter Orescent Cav(BCeCrHth)a1 V) ydmstr Bletcher Fannie Cc) lndrts rli2lT Park (Hotel al Bliss D LalRue (Gladys W) cash Snow's L-ndry & Dry Clng Co irt4 High! Bliss Eliz E bindery wkr Lyon Harris & Brooks rl29 Lawton av Bliss Gladys W Mrs dash Burden Smith Blli&ss CJoohrnl!64WHrilg2h!9' Lawton av Bliss Oliver R (iBertie G) cond h!09 Lawton aV Bliss OJiver R jr mgr United Cigar ISitores Inc epI'29 Lawton av* BlBocuhck'Cinagrhl armealpiest(V4)7` 3 Broadway rl'10 Bloch Chas J (Marie; Hale & Bloch) h 300 Hill Orest av (OH)' Bloch Eleanor student r!30!3 Hill Crest av (OH) Blooh Hide Co (Michel Bloch) 3'48 Pop- lar Bloch Michel (Blooh Hide Co) rid The BlockdAlexI)(Lenora) hSIO Mulberry apt 1 Block Alex jr student jffllO Mullberry apt 1 Block Apartments 810 Mulberry Block Earle H 2d v-pres Hotel Dempsey r do , , Block Herbert M (Eliz F) list v-pres and managing dir Hotel Dempsey r Shir- ley. Hills Block Nicholas M pres Hotel Dempsey r tld Blocker Albert (c) student r04O (213) pliant Row Blocker Jos P (Annie B) gro 1117 Plant l(BIM) h do Blockler Gus (c) porter r240 (210) Plant row Bloodson John (c) lalb rl435ia Broadway B' l'o(EoidMw)1ood Wm H (Hazel) lab h2!70 Astor iBloodworth Alonzo (c) lab 1005 (466) Alabama (SIM) Bloodworth Clarence M driver r2!l!70 2d Bloodworth , ICo r'T50 2Cd1 larence P hlpr Ga Power Bloodworth Edna r6l Hillyer av CCH) Bloodworth 'Eliz Mrs rOTS 2d Bloodworth Frances restr 311 Mulberry lr315 do Bloodworth Geo T.30'2: (010) Log Cabin dr Bloodworth Geo T (Leah) elk U1SIBO h 020 College Bloodworth Grace Mrs beauty opr R S Thorpe & Sons r RD Miller Field! rd Bloodworth H Otis (Ruth) carrier h07 Mikado av BLOODWORTH HARVEY B (OUie R; United Purchasing Co and Right Way Finance Co), h5Q() Beech av, Tel 1515 BlMooldwoArtnhdeJrsonErn(eSsMt )1(Chicken Grill) Bloodworth John slsmn Nu Icy Bottling Co r02O 1st Bloodworth John M (Sallie) driver City W21T 2d Bloodworth Julia (wid J P) r(750 2d Bloodworth Julian r760 2d Bloodworth Leona elk Happ Biros Co r 620 Anderson (SM) Bloodworth Lillian tdhr PS riTl'8 Ander- . son (SM) Bloodworth Lonnie (c; Leila) lab h'100 , (Grant av (Sj Bloodworth Winton E Louie A (Evelyn) Bloodworth M.0I2I8 p2ldia1 rm Bloodworth Louise beautician Dannen- berg Co r513 Hillyer av (CH) Bloodworth worth & BLluotohdewr oUrth()Rahc:5hHe3l P; BloodHillyer av (COH> Bloodworth Minnie L h'214 Knott (SM) Bloodworth Nathaniel Cc) fctywkr rlOO Lynmore av Bloodworth Otis carrier UBPO r807 Mikado av Bloodworth Plrentis E (Pansy M) lab (City r'2173 2d Bloodworth Rheibia student r807 Mikado Bloodworth Robt r225 Knott (ISM) Bloodworth Robt H (Agnes S) carp h Bl7o1o18dwAonrtdhersoTn C(SoMle)man (Grace H; iBloodworth & Bloodworth) r RD 5 Bloodworth Winton E drugs 1002 2d r 71 Anderson (SM): Bloodworth & Bloodworth (Lu'ther U land T Coleman) lawyers 105 Cotton hv R 4 (Bloom Bessie Cc) h7(49 Ash Bloom Ira Cc; Fannie M) lab h40o (501) Henrietta (SM) Bloom Jos B (c; Ida) lab r 11133 Blro&d- iwiay Bloom Philip (c; Julia) 111230 Murray al Blossom Geo L (Helen) m!frs agt 559% (Mulberry h2700 Forsyth rd Blount Annie K Cc) h'937 Fort Hill (E M) Blount Bernice Cc) r3`7 Fort Hill OEM) Blount Bessie fctywkr Bapp Bros Co lr(83S Main (EM) . . Blount Ella M (c) miaid hi Elbert la Blount Ernest F carp COfGRy ro20 Wal- Blount Essie Cc) rl9 Elbert la (SIM) Blount der's Eunice (wid John Ready-To-Wealr rlE;5)l7 tokipr SnyWilliams l(SM> Blount Fannie 'hl34 Orange' Blount Frances (wid Wm H) nurse 38w (Houston av (SM) r do Blount Geo jr Cc; Annie) lab hS'lb Edi- son ('EM) ,, . Blount Geo W (Alma N) elk 11836 Mam ,(EM) Blount Herman (c) r6'37 Fort Hill (EM) Blount Irene fctywkr Happ Bros Co r 82 Main (EM) Blount Janie Cc) r425' Ward (V) (Blount John (c) janitor Jones Johnston IRussell & Sparks h'204 ( 254) North ((!V)i Blount [North Jo(Vhn)1 jr Cc) delmn r224 (264) , Blount Julia (wid J M) rl2:0 Knott (S M) 55 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 (Blount Lennie Mrs hlOO Highland av i KXJCJHts) Blount Lois pickers Macon Peanut & Btge Co r'2'10 Willingham (EM) Blount Martha Cc) cook h5E6 3d av (V) Blount Mary (c) waiter Douglas Hotel Grill rlOl Calhoun Blount Mattie P registrar Nurses Offi- cial Register rl30 High Blount Paul J (c) lab r505 3d av (V) Blount Queen (c) r5l25 3d av (V)' Blount Queenie (c) maid i86I4 5th av i(V)` Blount Sarah Indrs (c) h425 Ward (V) Blount Wm C [Vineville av jr(V)(1Eulta L) slsmn hH303 Blount Wm H (c) student r2!24 (291) North (V> Blow John B (Bessie) milTwkr Willingham Cotton Mill r209 Cairling av Blow Lula M Owid John) h22 (82) Randolph pli Blow Roy (c) lah P8 Buckner al Blowe Bennie (wid Sami) i<2'o2 Washington av BHOwe Emily Mrs rl525 Broadway Blowe Maysie r252 Washington av Blowworth Cuirtis M Willingham Cotton M(Eisllsierl!1B0) millwkr (5) Holt av (N'Hts)' Bludgin Jas (c) lab hl8 Harris row Blue Edw i(c; Hattie) M h'1'11 Drews qtrs Blum Arie I (Madeline) mgr Macon Bl(uMmattCrelsasreCnoceh2SI7SlCsmornbinDuanvla(pV)Chev- rolet Co r!3IS5 Orange' Blum Herbert B student rII8 Bucking- ham pi (V> Blum Leo J pres Southeastern Battery 'Co Ine tol'309 Vineville av CV)' Blum Leo J (Freda B) slsmn hlllB (198) Buckingham pi (V) Blum Leo J jr student rI18 Buicking- Iham pi (V)i Blum Maidie (c) rTl'54 Edgelwood av Blum Moie's A (Stella C) artist h'802 Cherry Blum Rhoda (c) rlT54 Edgewood av Blumberg Mary (wid Alex W) r5'33 Or- ange apt 6 Blunt Annie B (c) maid h'I38 Taylor 0E M) Blunt Eliza (c) maid 3)949 Elm St la Blunt Mary (c) waiter r'lOl Calhoun Blunt Mary L (c) h'45'1 Martha (EM) Blunt Ula (c) maid T2'54 Garden (EM) Blunton Clarence brkmn r5S5 2d Blythewood Edw (c) lialb h3'5 Cheatham . al Boatman Ruth J (c) r4l Ward CV) Boatright Rosa (c) indrs r209 (207) Ocmulgee Boatwright Jennie h'102 Yates av (IBM) Boatwright Mollie r'102 Yates av (EM) Bobbitt Emma B (wid W C) r'lOSl Ash Bobo J Ebb (Lois H) auto mech rl0'4 > West End av (WH) Bobo Ralph (Sallie; Standard Market) hl59 Franklin IBoddie Frances (c) h'582 Monroe' Bogdgdgiford Thus M (Lucille) r520 Ocmul- Boggorly Earnest M (Vivian) inspr County Bd of Health' Boggs Wm A (Eliz) trav slsmn r343 Co- lumbus Boilermakers Union 1502% Broadwiay Boinest Maggie (wid Eug) h2'I3 Reid U'SM)- Boland Andrew D (Annie L) pton'br A B Lee Flm'bg & Htg Co hlOO (104) Thomas Boland Annie L r209 Mikado av '(SIM) Boland Hattie (c) maid hBtt'l Coleman ai Boland Ida (c) maid hlOO TeMair Boland J Lee (Mattie K) auto repr 419 Pine hl'0'9 (112) Crisp (SIM) Boland Jas W formn Taylor Iron W;ks & Sup Co h209 Mikado av (SIM) Boland Walter E (Fannie M) steelwkir Taylor Iron Wks & Sup Co hl501 2d Bolden Adolphus (c) driver r402 Gil- mer Bolden David (c; Annie) brkmn hlT8 (150) LeBorde (SM) Bolden Gussie W (c) rll'8 (1600 DeBorde i(SM) Bolden Mack (c; Rachel) loco firemn h 1402 Gilmer 1 B" oIlCdhear s Carrie (c)' maild (c; Carrie) hl42ll r401 Bay Biay Boles S P garage supt Ga Power Co Bolling Walter H tiiav slsmn r40'l Col- lege apt 2 F Bollingen Ethel office sec H B Chap- man & Co r RD Edna Place rd Bollinger Alton rl05 Edna pi Bollinger Bartow A (Minnie C) bkpr Home Furnishing Co h871 Orange Bollinger Elwyn slswn r6TO Orange apt Bollinger John mails USPO Whi05(MEadrynaL)pi1asst supt Bollinger Hath bkpr r411 Hill Crest av '(C1H) Bollinger RObt A (J Alma) carp h'4U Hill Orest av (ICtH) Bolton Annie Mrs gro 100 Johnsons al h620 Elm Bolton Geo S (Annie) gro 520 Elm h do BoTton Geo T (Mildred) mach h'3805 Houston av Bolton Grace (SM) r520 Elm1 Bolton Lila T elk Union Dry Gds Co r5l20 Eton Bolton. Walter E elk W R Werden & Co n5l20 Elm Bon Ton Cafe (Mitchell G Ellis) 30(1 Cherry Bond Arth B carp Packers Adv Corn lr14) 2d Bond Bessie Mrs h617 Adams Bond Chias (Thei'mia) millwfcr Bibb Mifg iCo h204 American blvd Bond David (c) driver Crane Co Bond Ethel beauty opr College Beauty iSalon r Cochran Short Route Bond J Oalder sec-treas Adam's Mfg Co r Marion rd Bond Jerome (c; Ellen) lab h'402 (463) Alabama (SM) Bond Jos (c) lab Otto Leather Goods Co r3SS Poplar Bond Mary (c) maid r402 (4613) Alabama '(SIM) Bond Randolph H (Mattie): r2!50 Washington aV Bond Rayme nulrse 2172 College h do Bond's Randolph (c; Louiza) porter Southeastern Exp Co h2l7'5 Balllard (E M) Bonds Wiley 0c) h'248 Powell (EIM) B'on'foy John E (Minnie W) slsmn h440 New Bonnell A H Mrs r Hotel Flckling Bonner Alice (c) r!3'l'9 (340)' Tindall av l(BIM)' Bonner Alma slswn r821 Mulberry Bonner Bessie (wid Emmet) h'41'7 Ridge av (V) Bonner Oath fetywkr Hopp B'ros Co r813 (Main OEM) Bonner Cleveland H (Hate) carp h'160 'Nelson (SIM) Bonner D'avid (c; Emma) lalb h'5'74' Chappell (SM) BoKnVn)e1 r Eariene (c) waiter rSTO 3d av Bonner Ed elk Orescent Lridry Co r<41!3 IRidge (V)' Bonner Edgar student K41I7 Ridge CV) w ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT, EM. gr. "YOUR CITY D I R E C T O R Y MIRRORS the Industrial LIFE Of Your CITY 56 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St, MACON ARLINGTON HOTEL FREE STORAGE BMRoOdeArDn WaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. Bonner Eliz (c) cook 1x1119 (11) Tinsley la Booker Raymond1 (c) lab to smith l(EM) Bonner Eliz Cc) student r967 Ocmulgee Booker Ruth nurse 860 New r do Bonner Bonner Emma (e) Emmalee 1(Xc)198hPahsillip3ds1 al (SIM) av (V) Bookeir Sim Oc; Annie L) fctywkr h'88 Wilder (SIM) Bonner Evelema (c) cook 1X269 3d av (V) Bonneir Griffin (c; Mattie) lab r!31S Booker Sylvester IPio Nono av (V(c);! Laura) lab rl052 U340) Tindall av (BM)` Booker Ted W student r421 American Bonneir Idell (c) maid 13119 (349) Tindall av (SMI Iblvdi Booker ThelnXa (c) r-1435 Broadway Bonneir Isaac (c; Mary) 1105 (16) Franklin St la Booker Theo (c) cook xi2)22 Berkley dr Bookeir Wm J (c) r83i Wilder (SM) Bonner Jos B (Edith L) lab City MOl Booker Willie M Mrs elk Miacon Teleg 3d Pub Co h!104 Oak av' Bonner Bonner Lizzie Louis Wr612(cO) ghle40th3-orpAepplewood1 KEIM) Bonner Louise bkpr Brown Starr Elec- tric Co r'209 list Bonner Mae Mrs rg2'l Mulberry Bonner Mamie (c) lndrs h'10i8 (3)t Davis al (EM) Bonner May ri39 1st Booker Wilmer maid Ritz Theatre Booker Wilson (c) lab 1X300 Williams /(EM) Boon Lois s-ten hlOl SitJlames av (SM) Boone Ada (c) rl07 Rose Crest av (SM) Boone Annie M (wi'd Jas A) 1X314 New Boone Beatrice (c) 1x20 Hall (SM) Boone Buster (c) lab h303 Elbert (SM) Boone Edith student r852 Pine Bonner Midhl (c) lab rl08 (2199) draft Boone Eliz mus tchr 662 Pine r do Boone Geo A (Dora E) collr 1X830 Grange Bonner Moses (c) r374 aiXappell (SIM) Bonner Ohrin (c; Evelyn) waiter r!05 ((6) Jordan (E!M) Bonner Bat (c) r441 Gilmer Bonner Ralph (c) student r3S9 3d av idvji Boone Henry C (Moore & Boone) hl0714 Hardeman av 'Boone J Buford- (Frances H) reporter Macon Telegraph h409 Hill Crest av ICCHF Boone John paper hngr r555 2d Bonner Raymond (Ruth) carp r248 Williams (SIM) Bonner Reese carp r!60 Nelson (SM) Boone John D (Ira M) gro 514 Pine h 862: do Boone Jos P Rev (Leona R) pastor First Bol(nSn!M), Robt (c; Maty) lab h409 Charles BoBoanpetisJtohCnhuWrch (ch;'12N1 eHttiieg)h lab h756 Bonner RObt (c; Ethel M) liato hill'6 Reid1 f(SM> Bonner Robt (Pearl) slsmn hi73'l Ridge av (V) Bonner Ruby (c) cook r29 3d av (V) Bonner Bailie (c) h44il Gilmer Bonner sallie M (c) maid rll9- (11) Tinsley la Chappell la Boone King (c; Irene) lab hl05 Harris Boon-e R Poy (Merle) h001 Nottingham dr (NH) Boone Sallie G librarian Mercer Univ h>7!19 2d Boone Sylvia (c) cook 1X188 (2174) Roye KOH) Bonner Sihelton (c; Annie: L) driver h 110 Ruby 0V> Boone T Harrold (Jennie M) pres-genl mgr Ga Loan & Trust Co h531 College Bonner Vista (c) hl06 (6) Jordan ('EM) Boone Toof A (Mozelle D) dentist 5'1'S Bonner Wm (c; Beulah S). bakeir Col- Mulberry R803 h301 Buford pi lins Baking Co h997 Ocmulgee Boone Walter L (c) lab r303 Elbert (S Bonner Wm (c; Tissue) lab hlOil (43) M) PINeal'S al (EM) I Boone Walter S treas Ga Loan & Trust Book Matau (c) driver r5l40 smith (E Co 1X36B College M)' Boone Willie R (c) r303 Elbert (SM) Booker Albert (c) potter rl'13 (9)- Frank al Booker Artlh (c; Alrneta) h'549 Smith !(EM)' Booker Arth P (Mary R) elk 1X137 Remfoart av Booker Belle (c) 1x111317 Cemetery la Booker Chas J (Willie M) custodian US PO hi04 Oak av Booker Daisy (cl rlSilO Woolfolk (EM) Booker Eliz '(c) lndrs hll3 (9) Frank al Booker Ella (c) cook rll4o Broadway Booker Ella (c) cook rl'486 Broadway Booker Horace (c; Ella) lab 1x1688 1st Booker Horace (c) lab rll3 (9) Frank al Booth Andrew L car inspr CofiGRy Booth Barlar E wrapper Odom Candy Co rl2l2 Yhites av (EM) Booth Carl student r30O Cherry av Booth Christine student r42:l Adams Booth E Sidney mach H & H R Huhn r840 College Booth Booth Early lab Florehee hl'02 rll34 (1F13a1i)rmMoanyt naavrd1 (B) (E M) Booth J E slsmn Collins Baking Co r 1134 (131) Maynard (E/M) Booth Jesse (Linda) aplpr Taylor Iron Bo(Wotkhs Jo&hnSuCp (RCuobyr I)RD1X30&0 Ohelnry av Booth John C jr student r3O0 Cherry av Booket J Raby elk r3!7'l 1st Booker J Register Wilmer Co r40tl elAkmNeraitciaonnalblvC'da1 sh Booker Jas C (c) millwkr Bibb Mfg Co Booth Leonard R (Kate) slsmn Ga Power Co 1x200 Nottingham dr (NH) Booth Lillian (Booth's Cafe) r30Q Cherry -av ffS',18 E 2d CF3M) Booker Jerry M (Mairy E) mach h421 Booth Merritt E (Callie) pnt'r CdfGRy h3:il Cutter's Green (7M)' American blvd Booth Nettie (wi'd Thos) l:ab r804 Wool- Booker Josephine (c) mlaid ri30O Wil- folk 0F3M) liams (EM) Booker Lee (e; Josephine) lab hl01O Booth Newton I (Myra) h'134 (131) Maynard (EM) 1(305) Woolfolk (EM) Booth Rome r311 Cutter's Green (-EM) Booker Mamie (c) hl07 Tindall av (SM) Booker Mary J (c) r!2l40 Broad (EIM) Booker Mattie (c) rl08 (7) Jordan OEM) Booker Morris P slsmn 3)1405- 3d Booth Wm (c; Susie) lia'b 1X70B (205) Colquitt Booth Wm milllwkr Bibb Mfg Co rl34 l(13ll)i Maynard (EM)' Booker Otis H (Josephine) sta eng h 11405- 3d Booth's Cafe (Lillian Booth) 440 Oglethorpe MILLIONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Bootle Wpi A (Virginia C; Carlisle & Bootle) hT20 (200) Buckingham pi l(V) Booze Clhias (e) lab h521 Chappell (S M)' Booze Sarah (c) r52!l Chappell (SM) Borah Lillie Oc) lndrs h6i7!7 (206) Dun- lap a! Borom Sami T (Mildred) eng WPA h6 Drury av (I)' Borum Douglas millwkr r8 Melrose (B) Borurh J Edw detain Capitol Cycle CoBorum Julius C (Willie) millwkr h8 (Melrose (B)` Borum Julius C jr (Aileen) millwkr h45 (Lake Boseman Chas L (Margt) lab h10 Log Cabin blvd Boss Preston carp r668 Walnut Bossom Wm (c) i412 E 2d (EM) Bost Cora rffiS Orange Bost Euline student rlOOl Walnut Bast Dannie (wid Henry) h14 Eltmi Bost Geo L mach CofGRy Bost Varly Mrs fctywkr Hopp Bros Co h 1001 Walnut Bost Walker student rlOOl Walnut Bost Wm student rlOOl Walnut Bostic Dillie (c) r70!3 Hammond (SM)` Bostic Edgar (c) r7G3 Hammond (SM) Bostic Plemmie (c) r900 (901) Ballard l(iEM) Boswell Jos W millwkr Bibb Mfg Co r71 (Arlington pi Boswell Wm slsmn r900 Orange Boswell Wm L (Laura A) cond h900 Orange Bourne JOs D (c) r6l3& Port Hill (EM) Boutne Leila (c) WS3I5 Port Hill (EM) Bourne Paul (c) student r35 Port Hill (EM) Boutwell Clarence E (Alice) stmftsr appr Millirons Plmbg & Htg Co h614 Telfair Boutwell Cleveland1 S bkpr OarstJaiphen r Lizella Ga Boutwell Earl J (Willie B)' elk Chlals B (Campbell rlo'to College Boutwell Emma fctywkr Hopp Bros Co (010317 College Boutwell Geo B (Lizzie H) mlaeh h2105 Biroadway Boutwell Harlow r274 Willingham (EM) Boutwell Jas H r208 Washington av Boutwell Jas R (Mary L) millwkr Bibb Mfg Co r420 Eton' (Boutwell Julian (Odessa) carp Packer Adv Corp h(448 Edgewood av (SM) Boutwell (Rosa B r208 Washington av Bouyer Rose (c) lndrs h7i5 Ross Bowden Aldine H (Ouida) mgr Tip Top Service Station h533 Orange apt 19 Bowden Birdie (wid Henry) millwkr h 242 Roff Home av (V) Bostic Thos (c; Emma)- lalb h404 Monroe Bostick Edmund (c) student r302 (303) Short (EM) Bostick Danny (c) r302 ( 303) Slhort (E M)1 Bowden Chas L genl mgr Wofford Oil 'Co plant h36C 2dl Bowiden Clifford (c; Melissa) lab h'225 (Cedar (U) Bowden Clyde M (wid Thos) hl01 Willingham (EM) SoI(sEtiMck) Gussie (c) maid r302 ( 303) Short (Bostick Jos (c) lab CofGRy Bosjick Mamie (c) h'304 (430) Alabama Bostick Mamie (c) hS02 (303)> Slhort (E Bostick Marion B (Amanda) mach Centoai Cotton oil Co hOlS Walnut apt 4 Bfoamh ^(SM^ (C) maid r302 (48) ^la` Bostick Mattie (wid W J) r:108 Log Cabin dr Bostick Okile r915 Walnut apt 4 BiKtock Victoria (c) lndrs ho24 3d av Wm (c) r302 (303) Short (EM) Boston Drank D (Bc)aypmonrtneravCMhapYmoaunn'iss (Parmacy Boston Geo r20 (c) laNboirrtlhl:8 (V)' (83) Bay Boston Gordon W (c) del boy Chap- man's Pharmacy r20S North (V) Boston Leather Co (Slaul Schwartz) 414 Poplar Boston Lettie Oc) r Coy Button Boston Lewis (c) lab r82l2 Montpelier Boston Major (c) lab r20S North (V) Boston Martha (c) lndrs hilOl Hicks al Boston Mary L (c) hl206 North (V) Boston Mattie (c) lndrs i2 Montpelier Bostwick Twiggs (c) porter Kingman & (Everett Inc h312 Gteeni Boswei Oassie (c) maid rl02 (85) Craft Boswell Chas (Dora) sub sta opr Kinnett-Odom Co r54!3 Raillro&d av MulberrCySllRas70W9 hl(fDlSorBisufoGr)d pphi ys 916 Boswell Edmond U13A r900 Orange h71 Arlingt(oMnynpai) collr Ga Power Co Boswell Bug jr bkpr r7!l Arlington pi Boswell Jasper (c) clnr MM&HRIR r RjD B1 John Y slsmn h3808 Houston av Bowden Cullen (Clara) rl09 3d Bowtden Edw C lab City Bowden Eloise supt PS r2303 2d Bowden Henry (c; Annie L) hlOQ Adams Bowden Homer J (Iva) sergt Police hll4 1(9) Myrtle (EM) Bowden Jas (c; Mia) lab rl324 1st Bowden Jas H (c; Ella) lab blOS Cedar IttDi Bowden John O (c) h40!2 Ward (V) Bowden Lizzie (c) maid iWl Edgewood Bowden Marie Mrs millwkr Bibb Mfg ICO 1409 Elm Boliwadmesn M(SIaMtt)ie (wid Chias S) hl48 WilBowden Millie (c) W4H6 Gilmeirf Bowden Rosa (c> maid rl05 Cedar (U) Bowden Sarah student r2l304 2d Bowden Verna fctywkr Hopp Bros Co r (101 Willinghlam (EM) Bowden W Herman (Lillie O) sheriff County Sheriff h2604 2d Bohwlld8en Nwmmadcell (Edlroise) detective Police Bowden Wm O rl43 Williams (SM) Bowdom Raleigh (Florence) driver h771 Spring BSBSiSbSbilMi^fgto> 3O 4O--o0) 2 o m Q -343 "C3tC MH 0 -3 H 4-J i-i33o) 4!(h03 --&0313 4003333 03 30OO6330 ID 3 CQ 3433 U HVVc3Oii 0 3 s _ 0 E 3 -343 E .Ju0C) >Cct>i =1 201 COTTON AVE. LOANS TEL. 6130 Brown Annylow fctywkr Happ Bros Co r224 (124) Balkcom av (EM) Brown Arceloius (c; Rosa) lab h608 Broad (EM) Brown Arlene E rl28 Rembert ay Brown Arline (c) fctywkr r527 Gilmer Brown Ashley (c; Luvina) lob CofGRy hl22 (92) Bay ,, , Brown Bernard (Nellie) city firemn hl32 Ell (SM) Brown Bertha (c) r320 Hammond Brown Bertha (c) r209 (210) 3d (0) Brown Bertha (c) lndrs hll Cheatham al Brown Bertha mgr Macon Pleating Shop r620% Cherry _ , Brown Bessie Mrs r764 Anderson (SM) Brown Bessie (wid B Oscar) h963 Cherry Brown Bessie (wid John G) h472 Beech Brown Blanche (c) cook hl02 Rockhill la Brown Bruce slsmn L N Jordan rll6 Summit av _ , Brown Blanche student r341 Columbus Brown Calvin (c) prsr r608 New Brown Carlton (c) h4 Bay al Brown Carlton H (Lois) driver h341 Col- umbus Brown Carrie (c) r804 Edgewood av Brown Carrie (wid Chas T) hl26 Log Cabin blvcl Brown Carrie (c) h222 Madison Brown Carrie (c) lndrs hlO Cheatham al Brown Carrie L tchr PS r822 Orange Brown Carrie L (wid John J) hl535 2d Brown Cecil stock elk McKesson-Riley Div r3401 Houston av (SM) Brown Chancey (c) lab CofGRy Brown Chas (c) h408 Ash . Brown Chas (c; Katie M) delmn Marion H Mitchell r354 5th av (V) Brown Chas (c; Mattie) driver Atlantic Ice & Coal Co (br) h804 Edgewood av Brown Chas (c) lab Taylor Iron Wks & Supply Co rl403 Ardvines al Brown Chas (c) lab rl42 (126) Army Lot Brown Chas (e; Mary) lab r445 (505) Middle (EM) Brown Chas (c; Annie) lab CofGRy h3 Waterville rd Brown Chas (Evelyn) millwkr Bibb Mfg Co rll7 Lee (EM) Brown Chas B (c; Eva M) lab hllO (109) Br3odwnavChOaJs) B (Jewel) servicemn The Storage Battery Co rl02 Nelson (SM) Brown Chas P (Susie) loco eng hl29 Parkwood av Brown Chas N (Irene) elk Happ Bros Co hll8 Jenkins (SM) Brown Chas S r555 Hemlock Brown Chas T (Nell) scalesmn Arth J Kelley hl52 Lamont av Brown Clara (c) h539' Monroe Brown Classic (c) r448 Curd (SM) Brown Claude (c; Mary E) lab hl05 (107) Brief (V) Brown Claude (c; Sallie) millwkr Bibb Mfg Co h606 Center (EM) Brown Clement (c; Rebecca) h959 Ogle- thorpe Brown Cletia W tchr PS r Bloomfield rd Brown Cleveland (c) lab r595 (501) Smith (EM) Brown Clifford (c) r315 Division (T) Brown Clyde (c) r3 5th av (V) Brown Cora M r865 3d Brown D A Mrs elk Union Dry Gds Co r314 New Brown Daisy (c) cook r204 Green Brown Dave (Ida) glazier Central Sash & Door Co rll5 Johnson (SM) Brown David (Annie L) millwkr Bibb Mfg Co rl5 Bibb av Brown David L officemn Jack Mann Battery Co r2908 Forsyth rd Brown Dempsey S (Kathryn L) mgr L N Jordan hll6 Summit av (NH) Brown Dena (c) maid r237 Middle (V) Brown Dennis F (Marion B) pres South- land Coffee Co h240 Riverdale dr Brown Dock (c; Beulah) lab h807 Charles (SM) Brown Donald F (Lottie D) driver h326 Hanson (SM) . _ Brown Dora (wid Jos W) r91 Clayton (V) Brown Dora (c) lndrs h206 (110) 2d av (U) Brown Doris cash r963 Cherry Brown Drewie (Lenora F) millwkr Wil- lingham Mfg Co h338 Calhoun Brown Duncan (c; Ruby) lab h595 (501) Smith (EM) Brown E C hlpr Ga Power Co Brown Edgar elk r314 Georgia av Brown Edith (c) h388 3d av (U) Brown Edw (c; Jessie; Brown's Barber Shop) h404 Broad (EM) Brown Edw (c) lab h701 (362) Charles Brown Edw (c; Lizzie) lab h234 Jeffer- Brown Edw (c) lab r242 Waterville rd Brown Edwin E student r2001 Broadway Brown Eleanor student r815 Cherry Brown Eliz sten Hatcher & McCrary Inc r963 Cherry Brown Ella (c) h232 0136) Cowan (EM) Browp Elvira (c) h276 Madison Brown Emma (c) maid rl239 Dempsey av (U) Brown Emmett (c; Penny M) lab hl3 (131) Malloy's al Brown Ernest W (Ruth) pntr h302 Jen- kins (SM) Brown Essie M (c) h533 (415) Grant Chapel al (SM) Brown Ethel r619 Walnut apt 6 Brown Ethel (c) lndrs hl03 (19) Kahn's al Brown Ethel Mrs millwkr Bibb Mfg Co rll9 (7) Myrtle (EM) Brown Ethel M (c) cook hl52 Moore al BBrroowwnn EEuugg DC c(Cigoarras) 4c5o3nd2dh2h04331RCidagrelinavg (V) Brown Eug J (c; Mary) bus boy Jas A Smith rllO Franklin Brown Eunice rl219 Vineville av (V) Brown Evelina sten r341 Calhoun Brown Evelyn office sec Alvin E Siegel r93 Cherry Brown Evelyn Mrs h310 Reid (SM) Brown Evelyn Mrs picker Macon Peanut & Stge Co rll7 Lee (EM) Brown Evie C Mrs r3043 Houston av (SM) Brown Fannie (wid Emby) hll9 Plant (SM) Brown Fleetwood r822 Orange Brown Fleming D (Beulah) r246 Wash- ington av Brown Florence lndrs Crescent Lndry Co Brown Florine (c) lndrs rl218 3d Brown Francis (c) millwkr Bibb Mfg Co r447 (707) Middle (EM) Brown Frank (c) lab r520 Broad (EM) Brown Frank (c) lab r51I (105) Camp- bell av (SM) Brown Frank (c) lab r539 Monroe Brown Frank (c) porter Southeastern Optical Co rl53 College Brown Fred r203 Ridge av (V) Brown Fred (c) lab r205 (358) Craft (V) Brown Fred porter rll7 Williams la Brown Freman (c; Elnora) b.616 (16) Gilmer BROWN G WRIGHT (Mattie S), Mgr Sterchi Bros Stores Inc, h26 Drury av, Tel 2059 Brown Gassie R elk Weldon W Brown r 802 3d Brown Geo (c) r952 Broad (EM) Brown Geo (c) hll4 Middle (V) MACON TRANSFER CO. Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Brown Geo (Georgia B) elk First Natl Bank & Trust Co r768 Mulberry Brown Geo (c) lab rl234 Broadway Brown Geo (c) lab hl21 (16) Frank al Brown Geo (c) lab rl256 2d Brown Geo student r315 Coleman av (CH) BBrroowwnn GGeeoo TT(Jcarnainee)mhnl25CoDfGalaeRy v(SM) Brown Geo T (Valentine B) physio- therapist 412 Walnut h do Brown Georgia (c) lndrs hl256 2d Brown Georgia B Mrs slswn Suzanne Hat Shop r768 Mulberry Brown Gordon (Julia I) fctywkr hl26 Grady (SM) Brown Grace student r345 North av (NH) Brown Gwendolyn P (wid Carl H) hlOS Florida av Brown H Elmo (Beatrice) mach h666 Hemlock Brown H Lamar (Clara V; Brown-Starr BrEolwecntriHc aCrdoy) Khl02(La(1u0ra1)) LmagwrtoGntAa&v P TeaCo h345 North av (NH) Brown Harry (Alice) millwkr h306 Pio Nono av (V) Brown Harry B (Fay N) Brown Sign Co) hl04 Beuna Vista dr Brown Harry T (Della) millwkr hl58- 59 Comer ter Brown Hartridere B (Ella K) carp h307 (308) Log Cabin dr Brown Harvie (c) r354 Bay Brown Hattie (c) hl52 1st av (V) Brown Hattie lndrs Crescent Lndry Co r453 Bay Brown Hazel (c) r703 Clinton (EM) Brown Henry (c; Carlis) lab h329 Divi- sion (T) Brown Henry (c; Essie M) lab h525 Gil- mer Brown Henry (c; Jessie) lab h3 South Boundary Brown Henry E mach CofGaRy Brown Henry G (Ethel) lab h310 Cen- tral (EM) Brown Hoyt (Mary W) slsmn J W Burke Co r736 College Brown Ida (c) h242 Garden (EM) Brown Ida (c) hl50 (213) Phillips la (EM) BBrroowwnn IdIma oMge(nce) tcsthurdPenStrlr439142dCauvtte(Vr's) Green (EM) BBrroowwnn IInnaezC(c()wimdaPidittr2M5 )Oh'H31a5raBloand Brown Inez opr SBT&TCo r764 Hemlock Brown Irene (c) cook hl49 Sycamore (V) Brown Isaac (c; Nellie) janitor h365 Rob- inson rd Brown J B (Pearl) lab rl39 Rose pk Brown J Cajor (c) lather hl07 Elizabeth (SM) Brown J E dean Central City Coll Brown j Frank (Frances; Ideal Storage & Garage) rl07 Rogers av (V) Brown J Frank phys 722 Spring h do Brown J H (Eliz) r754 Broad (EM) Brown J Henry r324 Jenkins (SM) Brown J Holland (Mary C) sec-treas Piggly-Wiggly Macon Co h208 Clisby pi Brown J Robt millwkr h871 3d Brown J Walter (Corinne) mach h250 Jeff Davis (SM) Brown Jacob (c; Hattie) delmn KinnettBrowOndoJmas C(oc; hG45e3orBgiaayM) h824 Elbert (SM) Brown Jas (c; Sarah) r533 (415) Grant Chapel al (SM) BrMow) n Jas (c; Mattie) h30 (27) Reid (S BrMow) n Jas civ eng r3043 Houston av (S Brown Jas (c; Eliza) lab hl41 Sycamore Bro(Vw)n Jas (c: Jessie) lab h209 (210) 3d (U) Brown Jas (c; Sarah) porter h6 Spring Brown Jas C (Paralee) fctywkr Carsta- phen r227 Reid (SM) Brown Jas E (c: Gertrude) lab CofGRy h531 E 1st (EM) Brown Jas F (c) student r407 Ward (V) Brown Jas F jr (Emily M; Brown & Groover) h575 Orange apt 1 Brown Jas R student rl54 Oakland av Brown Jas S (Irene) lab h227 Reid (SM) Brown Jas W blrmkr CofGRy Brown Janie (c) hll3 Jones Brown Janie (c) maid rll8 (114) Gibson av (SM) Brown Jerry N (Lois) millwkr Bibb Mfg Co h214 Jackson Brown Jesse (c) h216 Garden (EM) Brown Jesse (c) supvr PWA Homemaking Center r404 Broad (EM) Brown Jesse G (Frances M) atndt Gulf Oil Corp hl24 Cole Brown John (c) r601 (208) Colquitt Brown John (c; Hattie) h437 Gilmer Brown John (c: Oralee) lab Miller Bros h703 Clinton (EM) Brown John (c; Georgia) lab hllO Edge- wood av Brown John (c: Cath) lab hl08 Lynwood av (V) Brown John (c; Mary) lab Willingham Sash & Door Co h305 E 2d (EM) Brown John (c) lab rl09 (541) Tinsley la Brown John (c: Nettie) millwkr Bibb Mfg Co rl55 Coles al Brown John (c: Ula) millwkr rll6 (134) Holt la (V) Brown John (c) millwkr Atlantic Cotton Mills r3 5th av (V) Brown John student r254 New Brown John A agey mgr Investor's Syndi- cate r Dempsey Hotel Brown John D (Margt M) mgr S H Kress & Co h533 Orange apt 17 Brown John F (Rachel A) mach hl70 (140) Oakland av t Brown John H (Mabel) steelwkr Taylor Iron Wks & Sup Co hl917 2d Brown John L (c; Cora L) lab h453 Mon- roe Brown John W (c: Pearlie) lab hll3 4th av (U) Brown Jordon (c; Mary) lab City h726 Daisy (SM) Brown Jos hlpr Buck Ice & Coal Co Brown Jos (c; Bertha) lab City h527 Gilmer BBrroowwnn JJooss ((cc:; ERmembeac)cal)ablahbl2h5l3L3ynJwoonoeds av (V) Brown Jos (c) lab rl09 ( 678) Stripling al (EM) Brown Jos (c; Gertrude) porter hll2 Wyche (SM) Brown Jos H (Maude K) pntr Ga Power Co hl36 Piedmont av Brown Josie J student rl235 College Brown Jug The (Frank C Lyles) beer 153 5 th Brown Julia Mrs sten Dunlap-Peeler Hdw Co h296 College Brown Julia K (wid Fredk) h526 Edge- wood av (SM) Brown Juliette A (c) tchr PS rl52 1st av (V) Brown Julius S (Ninadell) r757 Montpe- lier av Brown Kate (c) h43 Harris Brown Kate Mrs r555 1st Brown Kath (c) r309 Strayers al (SM) Brown Kath (c) student r513 E 2d (E M) Brown Kathryn L Mrs beauty opr Bur- den Smith & Co hll6 Summit av MERRITT COIL CO. 1414 FIRST Cor. Ash YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Life Of Your CITY 66 D. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Go. Studebaker Willys Hupmobile Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Of Your CITY BrSotwonreLral0m'2ar(1e0lk1) TLaatnwatlolnSqavuare Drug Brown Laura (c) lndrs h24 (3) Buckner al Brown Laura M (c) rl67 Hilliard al Brown Lawrence (c) driver r203 (265) Craft (V) Brown Lawrence (c) lab Mansfield Dray Line r Pleasant Hill Brown Lee A (Cletia W) optician Am Op- tical Co r Bloomfield rd Brown Lemon T (c: Jennie) h227 Roose- velt av (V) Brown Leo (c: Bertha) lab Bibb Mfg Co Brrol0w'0n3i LBeroolaad(c)(EcMoo) k r400 Broad (EM) Brown Leola (c) smstrs r309 Strayers al (SM) Brown Leon C (Eliz) sec Birdsey Flour BrMowilnlsLhelo2n01D R(MidignenieavL) gro 2015 Vine- ville av (V) hlOl Marshall av Brown Lessie (c) h406 Mitchell al Brown Lessie (c) cook r508 (526) May- nard (EM) Brown Lewis M (Inez: Macon Plating Shop) rl47 Rose Park Brown Lewis M blrmkr CofGRy Brown Lillian lndrs Crescent Lndry Co Brown Lillie (c) h311 Edgewood av (S M) Brown Lillie (c) cook rll2 (282) Amos (V) Brown Lillie L Mrs tchr Central City Coll Brown Lillie P (c) r242 Waterville rd Brown Lincoln (c) lab CofGRy Brown Lizzie (c) lab h506 Martha (E M) Brown Lizzie (c) lndrs h507 Martha (E M) Brown Lois beauty opr Marinello Beauty Shop Brown Lois (c) student r262 Madison Brown Lois H Mrs office sec Dr Jas C Anderson r Woodrow pi Brown Lonnie (Thelma) hl325 3d Brown Louis (c: Luella) porter Goodyear Service Stores h725 Ocmulgee Brown Louisa (c) rlOl (22) Elizabeth (S M) Brown Loula (wid Chas T) rl26 Log Cabin dr Brown Lucas (c; Florence) lab r201 Holmes av (V) Brown Lucile (c) h522 E 2d (EM) Brown Lucile (c) cook r826 3d av (V) Brown Ludie (c; Magnola) lab hllO Lin- den av Brown Luella h822 Orange Brown Lula D (c) student r340 Madison Brown M Evelyn sten Bankers Health & Life Ins Co rl70 (140) Oakland av Brown M M linemn Ga Power Co Brown Mabel (wid Roy) nurse County Bd' of Health r2908 Forsyth rd Brown Mack (c) h819 (844) Fort Hill (EM) Brown Mack (c: Lena) lab rl08 (131) Elizabeth (SM) Brown Mada student r472 Beech av Brown Maggie (c) maid r2 Woodcliff Brown Malcolm H slsmn Texas Co r203 Ridge av (V) Brown Mandie maid Hotel Macon r22S Orange Brown Margt (c) maid rll6 4th av (V) Brown Margt student r815 Cherry Brown Margt Mrs collr Macon Teleg Pub Co r815 Cherry Brown Marie (c) maid h317 Jackson Brown Mark (c) lab Ralph A Lovelace h 408 Plummers al Brown Marshall (c; Corine) lab h220 Hazel Brown Martha R treas Mercer Univ r472 Beech av Brown Marvin (Louise W) pipeftr CofG Ry h360 New Brown Marvin F solr Hill Dry Clng Co r 129 Parkwood av Brown Marvin W slsmn Dannenberg Co r705 Pio Nono av (V) Brown Mary (c) rl22 (92) Bay Brown Mary (c) h354 Bay Brown Mary (c) r506 Charles (SM) Brown Mary (c) cook h416 Bay Brown Mary (c) lndrs hl53 College Brown Mary (c) lndrs rl78 5th av (V) BrCowo nhlM60aryCo(llce)gem1 aid Union Dry Gds Brown Mary (c) maid h262 Madison Brown Mary (c) maid r422 Northern av (EM) Brown Mary (c) maid r2 White al (SM) Brown Mary student rl917 2d Brown Mary Mrs h3 Parkers la Brawn Mary (wid John H) h9 Dessau pi Brown Mary B sten New York Life Ins Co r281 Orange Brown Mary E (c) cook r232 Collins pi Brown Mary E Mrs fctywkr Happ Bros . Co r40O Forsyth Brown Mary E (wid Robt B) rl02 (101) Lawton av Brown Mary F millwkr rlOll 1st Brown Mary I (wid Francis M) h872 Hill- yer av (CH) Brown Mary J student r421 Adams Brown Mary W (c) drsmkr h407 Ward (V) Brown Mary W Mrs supvr Homemaking Center r736 College Brown Mattie (c) cook rl65 Hazel Brown Mattie (wid Chas) r23i23 2d Brown Maude E Mrs sec Macon Type- writer & Office Sup Co rl27 High Brown Max C (c) elk r595 (501) Smith (EM) Brown Maynard W (Maude E) slsmn Steve M Solomon Jr rl27 High Brown Milton (e: Mabel) millwkr Bibb Mfg Co h366 Bay Brown Mingle B (c; Fannie) blksmith hlpr Taylor Iron Wks & Sup Co hl070 (1071) Coleman's la Brown Minnie (c) cook rl31 (12) Park Hotel al Brown Minnie (c) lndrs h5O0 Martha (E M) Brown Minnie L (c) maid r343 Bookers al Brown Missouri (c) lndrs r99 Forest av (V) Brown Mittie (c) h818 Ash Brown Monroe (c: Fannie) h217 Calhoun Brown Myrtice Mrs smstrs r224 Chappell (SM) Brown Nannie (c) lndrs r509 Martha (E M) Brown Napoleon (c) lab rl239 Dempsey av (U) Brown Ola (wid Chas S) 1162014 Cherry Brown Olin (c) driver Macon Transfer Co r289 1st av (S) Brown Oliver (c) hllO Ash Brown Ora (c) maid h249 5th av (V) Brown Oscar E (Mary) h281 Orange Brown Ossie (c: Mattie) lab CofGRy r 110 Harris la Brown Pat slsmn Texas Co r203 Ridge av (V) Brown Patricia Mrs hl017 1st Brown Pauline (c) cook h209 (116) Moore la Brown Pearl (c) dishwasher r rear 255 Broadway Brown Pearl (c) maid r317 Jackson Brown Pearlie (c) maid h5 Graham's Lot Brown Perry L (c) lndrs h422 Northern av (EM) Brown Pope M (Mildred A) mach Taylor Iron Wks & Sup Co h538 Log Cabin blvd Brown R L hlpr Ga Power Co Brown R Lawson (Vonciel) slsmn Packard Macon Co h341 College Brown Ralph student r202 Fort Hill (E M) 67 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 Brown Randall (c; Amanda) lab h226 Orange Brown Rebecca (c) rl65 (237) Elbert (S BrJoVCw) n Reese (c: Winnie) pdlr rll2 Ash Brown Richd rl06 Grand av Brown Robt (c) r75 Ernest (CH) Brown Robt (c; Pinky) lab Macon Gas Co HS1G (511) Crisp (SM) Brown Robt (c) lab MD&SRR r416 (415) Phillip Brown Robt (c) student rl60 College Brown Roberta (c) r2Q3 (118) Bowman (EM) Brown Roberta student rlOll 1st BBrroowwnn RRoossaa M(c) (crl)23m9aiDdemr7p2s6eyDaaivsy(U(S) M) Brown Rosa M (c) restr 207 5th r603 Broad (EM) Brown Rosalee (c) lndrs Crescent Lndry Co h803 Willow Brown Roscoe (Flora) lab b612 Haw- thorne Brown Ruby fctywkr Happ Bros Co r224 (124) Balkcom av (EM) Brown Ruby (c) student rl05 (107) Brief Br(oVw)n Ruby Mrs smstrs hl315 2d Brown Rufus (c: Lillie) lab r205 (358) Craft (V) Brown Ruth fctywkr Happ Bros Co r 224 (124) Balkcom av (EM) Brown Ruth (c) lndrs r411 Elizabeth (S M) Brown Sami (c: Emma) lab r239 Wood- cliff Brown Sami F (Lula) lab h233 Roff Home av (V) Brown Sara (c) hll6 Moccasin Slide Brown Sara (wid Dvkes A) elk r314 New Brown Sarah (c) r233 Gilmer Brown Sarah (c) r7 (134) Malloy's a! Brown Sarah (c) lndrs h336 Maple BROWN SIGN CO (Harry B Brown), Commercial and Outdoor Advertising, 511 Mulberry, Tel 1781 Brown-Starr Electric Co H Lamar Brown, John H Starr) contrs 113 Cotton av Brown Sudie (wid J W) r619 Walnut apt 6 Brown Sylvester (c; Geneva) lab hll6 5th Brown Thos (c) h830 (826) 3d av (V) Brown Thos (c) lab City r301 Elbert (S M) Brown Thos (e: Margt) lab r301 Plant (SM) Brown Thos (c: Addie) lab h707 (605) BrPorwinnceTh(oSsM()c) porter Cook's Beer Co BrNowornthTwheosst EB(oMunauddareyM) mach CofGRy Brho3w0n38THuronuesrto(nc: aRvob(SeMrta)) janitor r531 Grant Chapel al (SM) Brown Turner (c; Maggie) lab hl059 Pio BrNowonnoTJavIve(rVso) n (Effie) hl05 (4) BalkBrcoowmn Uavnd(inEeMs)ten Ga Loan & Trust Co rl219 Vineville av (V) Brown Valor H (c) maid hl07 (599) BrSoiwngnleVtoans'hstila(c) cook rll2 (555) Magnolia la Brown Vtiola (c) lab h609 Division Brown Virginia (c) cook r527 (528) Middle BroOwEMn )W Eug (Louise) elk Morris Putzel h356 New apt 8 Brown W Jesse elk The Southern Cotton Oil Co r472 Beech av Brown W L carp Willingham Sash & Door Co rll9 (7) Myrtle Brown w Lamar bkpr The Power Oil Co r720 Mulberry Brown W Morris (Sarah) hill Florida av Brown W Ralph (Ethel K) elk PO h321 1st Brown W T (c) lab r317 Jackson' Brown Walter (c; Josephine) r616 (16) Gilmer Brown Walter (c; Hattie) lab h515 (115) BrEolwlinottW(aElMter) (c) lab h216 Gilmer Brown Walter G (Mary E) elk Adams Mfg Co r4Q0 Forsyth Brown Walter R (Ruby) elk Sou Gro Stores Inc rl25 Rutherford av (SM) Brown Walter V H (Julia) h296 College Brown Weldon W gro 802 3d h do Brown Wildon W (Ruby) gro 1083 Pio Nono av (V) h do Brown Wiley C (Lillie B) swtchmn h2001 Broadway Brown Wm (c) r556 Chappell (SM) Brown Wm (Ethel) rll9 (7) Myrtle (SM) Brown Wm (c) lab hl42 (126) Army Lot Brown Wm (c; Pearline) lab CofGRy h 414 Bay Brown Wm (c) lab rlO Cheatham al Brown Wm (c; Louise) lab h857 Edge- wood av Brown Wm (c) lab hlO Fulton al Brown Wm (c) lab rllO (452) Johnsons al Brown Wm (c; Maggie) lab hlOl Neal av (V) Brown Wm (c: Willie L) lab h545 Plant al Brown Wm (c; Irene) lab rll7 Telfair Brown Wm (c: Willie L) lab hl222 3d Brown Wm porter Ry Exp Agcy r361 Flanders (EM) Brown Wm (c: Pearline) porter h712 Hazel Brown Wm jr (c) r712 Hazel Brown Wm A hlpr Ga Power Co rl36 Piedmont av Brown Wm A (Annie T) millwkr Bibb Mfg Co hlOll 1st Brown Wm B (c; Mattie J) hl07 Johnson (SM) Brown Wm E (c: Lizzie) lab hl020 Main (EM) Brown Wm E (c; Cath) lab rll4 (7) Spring la Brown Wm E (c; Willie M) janitor Macon Teleg Pub Co r232 (136) Cowan (EM) Brown Wm L (Mary H) rl821 Broadway Brown Wm M (Delores W) meter tester Ga Power Co hl20 Lawton av Brown Wm N (Mattie) pdlr h926 Mont- pelier av Brown Wm O Rev (Maude) hl235 College Brown Wm R (Marguerite) formn USPO h'202 Fort Hill (EM) Brown Wm W (Pearl) hl21 Nottingham dr (NH) Brown Willie (c) lab Idle Hour Nurseries r Forsyth rd Brown Willie (c) maid h48 Franklin Brown Willie L (c) maid r301 Blount Brown Willie M (c) maid rl059 Pio Nono av (V) Brown Worthy D (c) r416 Bay BROWN & GROOVER (James F Brown Jr, Thos D Groover), Local and General Market Securities, U S Government Bonds, State and Municipal Bonds 503 Cherry, Tels 3009 and 3001 Brown's Barber Shop (c; Edw and Andrew W Brown) 315 Broadway Br2odwn's Book Store (Grant P Fuller) 416 Brown's Chapel Baptist Church (c) 119 N Tatnall la Browne Chas pres Kappa Alpha Fraternity r315 Coleman av (CH) Browning Wayne F (Leila) asst mgr W T Grant Co r821 Mulberry Brownlow Jas E (Mae) h664 Walnut Browns Martha (c) h952 Broad (EM) Broxton Herschel R (Eloise) emp CofG Ry Ih300 Bailey av (CH) Broxton Isaac B r267 Washington av S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 68 COURTS & CO. SMtoemckberEsxcNh.anYge. N.ExYc.haCnogteton ChicagTo raBdoeard of AssNoEc. ixaYcteh. aMnCgeuemrbbers Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 Who Sells It? is Answered By the Classified Business Lists In this Directory HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC THIRD AT PINE GMC TRUCKS PHONE 5100 Broxton Lennie Mrs smstrs r461 New Bryan Nellie (c) Indrs hl33 (202) Rail- Broy Clio B elk r308 Pio Nono av (V) Broyles Evelyn (c) maid r358 Robinson rd Brryoaand Saavra(Vjr) opr SBT&TCo r614 Holt av (NHts) Brubaker Leonard H (Frances) tehr PS Bryant Alberta (c) maid Virginia Smith h205 Brentwood av r407 (450) Womack (EM) Bruce Chas H School Houston av se cor Bryant Alice (c) h34 Macon av (EM) Ormond ter Bryant Andrew (c; Ada) hlpr CofGRy Bruce Claude W (Myrtle) prof Wesleyan h704 (118) Cowan (EM) Coll hll8 Clayton (V) Bruce David F (Mattie) county agt U S Agrl Extension rl45 Wesleyan dr Bruce John H (Lessie) slsmn hl68 Spring Bruce Mildred r275 Ell (SM) Bryant Anna (c) Indrs h209 (155) Center (EM) Bryant Annie (c) r337 Boardman's al Bryant Annie (c) rl05 Edgewood av Bryant Annie (c) cook r rear 1218 3d Bruce Terminix Co Heinrich VonMuller Bryant Annie C (c) maid r624 Monroe mgr exterminators 506 Mulberry Brumback Alf B (Martha G) mgr C D Bryant Arth (c) lab h700 (620) Cowan (EM) Kenny Co Inc rllO Buford pi Brumby Lawrence R (Amelia) asst genl supt Bibb Mfg Co h207 Albermarle pi Bryant Bessie rl04 Magnolia Bryant Betty beauty opr Dannenberg Co r257 Hardeman av apt 1 Brundage A Jas eng MD&SRR Bryant Buff A Mrs rl40 Knott (SM) Br1u1n2da(g1e34J)esCsehaLrle(Ms a(uSdMe)) loco firemn h Bryant Buford. C (Martha) mach MD&S RR r322 Orange Brundage Luke M (Alma M) elk Hotel Bryant Carrie (c) Indrs h rear 1218 3d Gordon h651 Plum Bryant Chas (c) lab rl25 (19) Frank al Brundage Ocie B (c) maid r411 Madison Brundage !Saml (c) lab r411 Peachtree (E M) Bruner Carrie (c) Indrs h524 Coleman al Bruner Eliz r757 Pine Bruner Geo H (Myrtie V) swtchmn h296 Belmont av Bruner Jos B (Juanita) city firemn r440 Beech av Bruner Moncrief (Gertrude) filling sta Safety Cab Co h!256 Washington av . Bruner Nathaniel A elk r824 Montpelier av Bryant Chas J (Sue) mkt agt US Agrl Extn h263 Georgia av apt 1 Bryant Chas T (Carrol) millwkr h304 Fairmont av (B) Bryant Christine (c) maid r624 Monroe Bryant Clayborn (c) h306 Ward (V) Bryant Daisy (c) rl09 May av (U) Bryant Easter (c) rl25 (19) Frank al Bryant Ed (c) hostler CofGRy Bryant Eddie (Lizzie) driver Freeman- Demt-Sullivan Co r234 Jefferson Bryant Edw (Mamie) elk r760 New BBrryyaanntt'EElliizz (w(ci)d rL6ewWisoHod)clhif6f16 Walnut Bruner Sulinda (wid Frank) nttrse 2129 Broadway h do , Bryant Elmer L well driller rllO Mill av Bryant Erriest (c) r700 ( 620) 'Cowan (E Brunson Essie (c) Indrs rl40 Jones . M) ' . Brunson Jos (c) chauf rl40 Jones /> Bryant. Ethel (c) maid rl Gunn's la (V) Brunson Lizzie (c) Indrs rll6 (16)' Wise Bryant Eva Tc.)' cook r325 Maple av (V) .. V. Bi-ya.pt Eva (c) Indrs h516 Coleman al Brunson Pearl (c) tchr r535 3d av (V) BBrruunnssoonn SWaraalte(cr) (mc)aidjahn2it2o0r 5hth'11a6v ((1V6)).> Wise av (V) Brunson Wm (c; Annie) lab hl714 (1516) Dempsey av (U) Brunson Zack A (c) lab h535 3d av (V) Bruskie Essie M Mrs opr SBT&TCo r815 Cherry Bruskie John D (Essie M; Bruskie's) r815 Cherry Bruskie Jos B bartndr Bruskie's r2210 2d Bruskie's (John D Bruskie jr) beer 508 2d Bryan Aldene student r348 American blvd Bryan Alma (c) r701 Hammond (SM) Bryan Annie (wid Jasper N) r348 Ameri- can blvd Bryant Eva Mrs smstrs r808 Spring Bryant Felix lab Natl Handle Co Bryant Francis, millwkr r96 Green (P rf M) / /'* . Bfysint FrankieMrs picker Macon Peanut & Stge- Co rl26 Edna pi Bryant Geo (c: Lizzie) lab h703 (445) Charles (SM) Bryant Geo (c) lab hl25 (19) Frank al . Bryant Georgia (c) hlOl 7th av (B) Bryant Ginna C (wid Jas A) hl506 Vine- ville av (V) Bryant Green (c; Naomi) prsr Crescent Lndry Co h624 Monroe Bryant Gus (c; Emma) millwkr h309 Womack (EM) Bryant Henrietta Indrs Crescent Lndry Co r316 Division Bryant Horace (c) r508 (526) Maynard (EM) Bryan Benj L (c) lab r701 Hammond (S Bryant Horace (c) lab h520 Clarks Hill M) (EM) Bryan Burl F fctywkr h312 (363) Log Cabin dr Bryant Isaiah (c; Estella) formn r628 Hammond Bryan Carl A (Annie L) slsmn Ga Roof- Bryant J Hubbard (Frankie) lab rl26 ing & Sup Co h614 Holt av (NHts) Edna pi Bryan Carl A jr elk r614 Holt av (NHts) Bryant Jas (c) lab hl05 Edgewood av Bryan Hazel rl427 2d Bryant Jas (c) lab h92 (4) Schofield (V) Bryan J Scott (Eunice) elk h211 Heard (S Bryant Jas A (c) asst funeral dir Hutch- M) ing's Funeral Home r325 Maple Bryan Jas B (Grace P; Pig'n Whistle Bryant Jas W (Bessie) slsmn h765 Pine Sandwich Shop) h312 Buford pi Bryant Jodie (Rosa) millwkr h96 Green Bryan Jas B jr (Virginia A) mgr Pig'n (PM) Whistle Sandwich Shop hl02 Holt av Bryant John (c: Matrie) lab h463 Vz Cot- (V) ton av Bryan Jesse P (Ruth) rl427 2d Bryant Jos (c) gro 315 (312) Stevens (S Bryan Jessie L (c) h701 Hammond (S M) h do M) Bryant Jos (c) lab r534 Flanders (EM) Bryan John L student r312 Buford pi Bryan Juanita rl427 2d Bryant Josephine r252 Broadway Bryant Julia (c) maid hll6 Opera House Bryan L Carlton (Kate) h.348 American al blvd Bryan Leila (wid Jas E) rlOO Toombs Bryan Louise nurse 845 Courtland av Bryant Julia (c) student rl Gunn's la (V) Bryant Laura (c) Indrs h952 Montpelier The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Bryant Louisa (c) r463% Cotton av Buckner Carlos (c) lab r207 Cedar (U) Bryant Lula (c) lndrs h403 Mitchell al Buckner Earl L (Nettie) driver h2027 3d Bryant Lula M (c) h.342 Gilmer Buckner Francis L (Ruby) waiter Craw- Bryant Lulu (c) lndrs r2 (355) Duffey's ford's Barbecue Lunch h917 New apt al 4 Bryant Mamie (c) student rll3 Pringle Buckner Freeman (Minnie) formn h440 (IBM) Edgewood av (SM) Bryant Mannie (c: Adele) hl09 Elm Buckner Geo (c) lab Lee & Smith Mule Bryant Maria (c) maid r552 Monroe Co r458 Bay Bryant Marie (c) cook r820 Ocmulgee Buckner Jas (c: Emma) hlOO Elkton pi Bryant Mary (c) lndrs hi Gunn's la (V) (SM) Bryant Mary E (c) cook DeLuxe Cafe r Buckner Jefferson (c; Ida) hlpr Macon 920' Ocmulgee Gas Co h911 Ash Bryant Mattie (c) lndrs h215 (12) Bay Buckner Julia (c) maid h207 Cedar (U) Bryant Naomi L (c) student r624 Monroe Buckner L Hugh (Marie S) waiter Craw- Bryant Ollie M (c) student r704 (118) ford's Barbecue Lunch hl922 3d Cowan (EM) Buckner Nathaniel (c) butler rl08 May Bryant Oscar D (Annie L) waiter Spel- Buckner Orf (c; Mary) lab hl409 Broad- ler's Restr r865 1st way Bryant Pauline (c) r534 Flanders (EM) Buckner Ruby Mrs elk r917 New apt 4 Bryant Pauline sten rl506 Vineville av Buckner W F lab r440 Edgewood av (S (V) M) Bryant Rebecca (c) Indry wkr rl642 1st Buckner Warren J (c) lab r207 Cedar Bryant Rosa B (c) lndrs h314 Jefferson (U) Bryant Rosalee (c) cook rl Gunn's la BUDWEISER BEER, Buck Ice & Coal Co, (V) Distributors 2302 Forsyth Road, Tel 6066 Bryant Rose (c) cook hll8 (18) Wise av Buff Dorothy P Mrs audit elk Dannen- CV!) berg Co r335 College Bryant Ruby (c) student rll3 Pringle (E Buff Hazel mgr Middle Georgia Tourist M) Cabins r40O5 (3917) Houston av (SM) Bryant Sandy (c; Lucille) brklyr hllO Buff J Felton (Dorothy P) projectionist (295) Craft (V) Ritz Theatre r335 College Bryant Sue sten Orkin Exterminating Buff Jos N (Hazel) elk Wm O Swift r4005 Co r257 Hardeman av apt 1 (391?) Houston av (SM) Bryant Tabernacle Baptist Church (c) Ruffinf Carrie (c) maid r611 4th av (WH) 217 (117) Disroon al Buford, Carl (c: Alice) lab h707 Elbert Bryant Terrell (c; Lora) lab r302 (31S) \(SM) Henrietta (SM) ^ Biiford Clyi Eleanor B) agt Carolina Bryant Vester (c) maid r534 Mid^te (R hl68 High Bryant Viola (c) h601 (208) Cblqilftt (c) driver rl37 (139) 4th Bryant Viola (c) cookhC Opefa H^use eahor opr SBT&TCo rl68 High Bryant Walter F (Srf&udb) optician An? lliz (c) r707 Elbert (SM) Emma (c) cook r250 (174) Plant Optical Co hl81 Pifedmont av t Bryant Wm (c: Lillie) lab h628 Ham-1 'ButeiS Osear (c) delmn Lackey & Lackey mond } Bryant Wm .ir (c) lab r628 'Hammond Elbert (SM) Bugg Chester (c; Charlie) lab r402 (724) Bryant Wm C (c) ported r624 Monjoft Campbell av (SM) Bryant Wm T (c>MaScy)\arp CofGRy hS08 (526) MayharcA(EM) Bryant Willie (c) 4(ib r534 Flanders (E Bugg Emmett (c; Lizzie) lab h924 Pio Nono av (V) Bugg Lee (c: Lena) brkmn r413 Haw- thorne BrDyrayntCWlniglliCe o(cr)36e0mCpaSmnpobwe'lsl Lavnd(rSvM&) Bryant Willie M maid Hotel Lanier Bryce Jas B (Bessie) r204 Washington av Buchanan Andrew (Malema) supt hi 14% Bugg Walter M (T Eliz) asst mgr Community Sav & Loan Co r322 Georgia av Buice R Lee Rev (Adelia J) hll27 College dr Rogers av (V) Buie Edgar J (Essie) sta opr h240 College Buchanan Clayton W (Mattie A) pres BUILDERS LUMBER CO, Wm H Baskin Avidllaemasv-B(uVc)hanan Motor Co h208 VineBuchanan Estella (c) cook rll2 (955) Pres, Wm H Baskin Jr V-Pres, Lumber and Building Supplies, Plant 130 Cherry cor 6th, Retail Store Office 355 Cherry, Ocmulgee la Teis 467-468 Buchanan Jas C elk Durr's Creamery Buchanan Jos D (Henri S) sec-treas Bulcken John B elk Lucius R Hawkins Jackson Abedrammasr-leBupcihanan Motor Co h205 AlBuchanan Mary L elk Met Life Ins Co ri89 Magnolia BuDclhvanan W T driver McKesson-Riley BUMCgKr, I2C3E02&FoCrOsyAtLh CrdO, aDtaOn aBkulalva,rdTJerl Bullard Berta (c) cook rl24 Broad (EM) Bullard Chas M (May) trav slsmn hl225 Vineville av (VO Bullard Chas M jr ship elk A S Hatcher Co rl225 Vineville av (V) Bullard Danl jr (Mayme D) mgr Buck Ice & Coal Co r Zebulon rd RD Bullard Elvira (c) lndrs h213 Green B-uck Mary (c) h414 Phillips la (EM) Buck Selby H (Duval) coach Lanier High Sch for Boys h Rivoli dr Buckeye Cotton Oil Co Chas I Motte mgr Bullard Evans E (Grace) mach MD&SRR h560 Hillyer av (CH) Bullard Margt student Ethel B Davis BuBlleaarudtyMSahuodep (rwBidaxElernyesGt)a elk Union Division (Tybee) Dry Gds Co r314 New Buckhalt J T (c) porter Standard Oil Co Bullard Mayme D Mrs bkpr Buck Ice & Bu1cskt haovlt E(Vrn)est (c: Corinne) chauf h318 Buckles Lela (c) cook r211 Middle (V) Buckles Mattie (c) millwkr hail Middle Coal Co r Zebulon rd RD Bu2ldlard Bullard Miles F Thelma. (Mary) policemn r2451 2d1 h2451 Bullet Lillie (c) h621% (622) Middle (E Buckles Ned (c; Annie) lab r316 (318) Monroe M) Bullington E Stevens (Alma D) city fire- mn hl29 Winship (WH) DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on u9 R. L. POLK & CO. DETROIT 70 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Bullington Edna smstrs r461 New BuBlluinrgghtoanrdE-Cmomnneattllvassrt71fu8neCrhalerdryirector Burden Richd F (Amelia M) pres Burden Smith & Co Inc hl009 Vineville av (V) BURDEN SMITH & CO INC, Richard F Bullington John J city firemn r254 New Bullington Ollie Mrs r821 Mulberry Bullington Roy (Carrie B) r212 Pierce Burden Pres, Claude S Cason V-Pres, Thomas J Stewart Sec-Treas, Department Store 350-356 3d, Tels 3441-4656- av (V) 2486, Second Floor Tels 690-803-864, Bullock Albert J (Nina) millwkr hlOS Third Floor Tels 1071-3722 Grand av Bullock Berta (c) cook rl23 Broad (EM) Bullock Cath (wid Wm B) beer 317 Cherry h421 Oak Bullock Prances (c) h.232 Plant al Bullock Herman (Octa) h747 Ridge av (V) Bullock Mariorie T dental asst Dr Paul G Gates r747 Ridge av (V) Bullock Veta O rl06 Grand av Bunch Amanda (wid Jas) r915 Walnut apt 8 Bunch Jamie r915 Walnut apt 8 Bunch John Bunkley Jesse E(c:h4S6a6ryah2 )Mlaublbre2r7ryWright al Bunkley Jos (c) lab r27 Wright al Bunkley Magnolia (c) r27 Wright al Bunkley Mary (c) cook h27 Wright al Bunkley Robt (c; Annie M) lab Natl Handle Co h349 Hawthorne Bunkley Robt (c) lab r27 Wright al Bunkley Sallie (c) r27 Wright al Bunn Carl E (Pauline J) elk Robt K McAfee r420 Ridge av (V) Bunn Mozelle Mrs fctywkr McAfee Candy Co Burden Wm (c: Violetta) lab r203 Moughon (V) Burdette Aaron L slsmn R C Cropper Co rl04 Calloway Burdge Claude I Mrs r865 1st Burdge Eliz fctywkr r865 1st Burdge Emmett L waiter Busy Bee Lunch r365 1st Burdge Essie Mrs slswn Belle Millinery Co r865 1st Burdge Leslie H fctywkr Happ Bros Co r Bu8r6d5ge1sMt innie (wid Wm R) rl24 Merrett av (I) Bunredrgye CWomhR865(E1sssite) slsmn Belle MilliBurdick Chas (c) lab rl032 Broadway Burdy Ada (c) cook rl57 5th Burg Michl R jr (Fannie) dry gds 308 Bu3rdgahm35y1MWaraslhnaullt E (Evie N) pntr h702 Holt av (NHts) Burgamy Raonel student r702 Holt av (N Hts) Burgamy Raymond E (Frances) waiter Plantation Lunch r317 Ross Bunn Murry (Winnie M) porter Southeastern Exp Co' Bunn Savannah (c) maid Hotel Grady h 454 City Hall la Burgany Frank (Lucille) elk hl22 2d Burgany Lucille Mrs nurse rl22 2d Burgay Leroy (c; Ella) h504 Harris Row Burgdorff Geo P (Janie S) slsmn Maya's Bunn Wm M (Jessie M) meat ctr hl07 Madden av Bunney Roberta (c) millwkr Bibb Mfg BuCnotinr3g22HaMzealpleelk r705 Walnut Bunting John B (Ola E) slsmn r765 Wal- nut Burch Eliz (wid Wm L) r865 Cherry Burch Prank N (Rosa) asst mstr mech h438 Carling av Burgdorff Janie S Mrs hsekpr r438 Carl- ing av Burgess Clem (c: Mitzie) lab r819 Ash BBuurrggeessss JJoehann (rA20n1n)Oha.2k01 HOaavkenHaavven av Burgess Malcolm (Wynelle) hl07 Corben av (V) CofGRy h716 Montpelier av Burch J W (Ruth) chf inspr Ga Power BuirnggesGs aMKoraroislinP C(Mo harl2y1WR)okgaeorslinavm(iVn)- Co hl31 Nottingham dr (NH) Burghard Annie rl018 Vineville av (V) Burch Jas B dep collr US Int Rev rl26 High BURGHARD-CONNALLY, R Coke Connally Pres, Mrs Hazel R Connally Sec- Burch Napoleon (c) barber Jas A Bras- Treas, Funeral Directors 718 Cherry, well r220 Fargason Burch Sampson (c; Maybelle) lab h22 Parker av (V) Burch Sampson .ir (c: Eliz) h22 Parker av (V) Burch Thos E (Jessie R) r312 Linden av Burch Wm E (Beulah) r865 Cherry Burdell Maryland M (c) tchr PS h900 Tel 1627 (For further information see front cover and page 14 Buyers' Guide) Burghard Frances M tchr r341 Hardeman Burghard Frances M (wid Aug) h341 Hardeman av Burghard Louise E (wid Louis) hll5 Hines ter (V) Port Hill (EM) Burk Thos (c: Mollie) h307 1st av (V) Burdell Ulysees (c: Waverly) farmer r Burke A Read (Eunice) swtchmn hl507 900 Fort Hill (EM) 3d tfl Burdell Ulysses S (c; Malinda) h226 Jones Burden Anna T (wid Chas) rl33 Rem- bert av Burden Annie G rl220 Montpelier av Burden Cora (c) cook r605 (221) Prince (:SM) Burden Eug B (Jane S) dept mgr Burden Smith & Co hi45 Hines ter (V) Burden H K (Margy) slsmn h222 RiverBudradleen dHrester (c) lndrs r529 (528) 3d av (V) Burke Alma r404 Pio Nono av (V) Burke Annie L (c) r702 Ash Burke Annie R (wid Ardis A) rl507 3d Burke Ardis A student rl514 3d Burke Cynthia rl709 3d BBuurrkkee DDoorraot(hwyid(Hc)arsvteuydeAn)t,r5rl1289N(a2p0i4e)r Bartlett's la BURKE EDW W JR (Lora), V-Pres The J W Burke Co, h575 Ingleside av, Tel 5068 Burden J Hubert (Allie) blksmith Cof Burke Effie B (wid Edw W) h3202 For- GRy h401 Franklin (SM) syth rd Burden Jas (c: Alma) r(307 (606) Crisp (SM) Burden Jas W (Capitola J) policemn hl07 (133) Colquitt . Burden Maggie (c) lndrs H505 (221) Prince (SM) BuMrd)en Ollie L (c) r605 (221) Prince (S Burden Oscar (c: Laura) labh729 Ocmul- gee Burke Ethel musician rl709 3d Burke Glenn W formn CofGRy r278 Col- lege Burke H A r301 Cherry Burke Henrietta (c) rl56 Bay Burke Henry (c: Martha) lab h5 Water- ville rd Burke J Earl (Lucile) millwkr Bibb Mfg Co hll3 Schell av (EM) 71 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 BURKE J W CO THE, Walter F Walton Prcs-Mgr, Edward W Burke Jr V-Pres, James S Walton Sec, Walter T Bragg Treas, Books, Stationery, Engraving, Office Supplies, Lithographing, Printing and Binding 406 Cherry, Tels 74-75 (For further information see left side lines and page 27 Buyers' Guide) Burke Jas student r854 Mulberry Burke Jesse (c) lab rl05 Park (U) Burke John (c) lab r402 Craft la (V) Burke John E (c; Daisy) firemn City Water Wks h329 (316) Corbin av (V) BBuurrkkee JJoohhnnEIWjr S(cc)hor3o2l9 2C1o33rbi2ndav (V) BBuurrkkee JLosC(cW: aPreeahrolu)selab112TFeorrmdivnilalle alva Burke Lee R (Lillian G) agt hl06 (109) Crisp (SM) Burke Mamie Mrs h757 Pine Burke Martini r265 Georgia av Burke Mary r265 Georgia av Burke Mary S (wid Thos) h265 Georgia av Burke Ola (c) maid h300 (301) Crisp (S M) Burke Olan A (Lucile) elk Lester Grady r 202 Rocky Creek rd Burke Ray (Montese) driver rll8 RichBumrkoendWm B Rev (Leila G) h854 Mul- berry Burke Wm L (c) r329 Corbin av (V) BBuurrkkee WWmillMie ((Scu) sier5GN) efwormn hl514 3d Burke Zenobie (c) rl29 (204) Bartlett's la Burkes Daisy (c) maid rl08 3d av (U) Burkes Louise (c) cook h367 Robinson rd Burkett Claire tchr Winship Sch r542 Ridge av (V) Burkett Ira E (Addie) resident eng hl94 English av (V) Burkett Kate tchr PS r542 Ridge av (V) Burkett Lallie (c) hSll (1004) Dempsey av (U) Burkett Louise elk WPA r209 1st Burkett Oscar (c) lab r609 Ross Burkett Sarah Mrs office sec Dennis & Dennis h425 College Burkett Susie (c) maid Hotel Lanier rl09 (205) Elliott (EM) Burkett Wm A (Sarah) auto mech Stan- dard Oil Co h.425 College BuArsksheaslstoerr rElRmivaolWi dMr rs elk City Tax Burkhalter Laris H (Elma W) agt New York Life Ins Co r Rivoli dr Burks Albert (c: Louise) driver FreemanBuDrkesntA-SnudlrleivwanJ Crlo02r3C1l0ev1eslatnadvav(V()V) Burks Thelma Mrs beauty opr Billie Tyler r240 Ell (SM) Burks Welborn T (Mamie) cond r203 Clisby pi (V) Burleigh Peter S (c) lab hl06 Key (U) Burleigh Robt (c: Della) lab hl09 Key Burley Lumpkin (c) lab hl24 E Ell Burman John H (c) lab hl024 College dr Bumam Fannie (c) cook hl04 (108) Amos Burnam Lola (c) cook r304 (605) Prince (SM) Burnes see also Burns Burnes Chas r257 Heard (ISM) Burnes Helen student r257 Heard (SM) Burnes J Chas (Lizzie) loco eng 1x257 Heard (SM) Burnes J Chas jr r257 Heard (SM) Burnes Ralph student r257 Heard (SM) BuSrhnoeptt Ar2n5i2taOI roapnrgEethel B Davis Beautv BudrinnegttCCoharls03(0VeBorrao)adlwabayCentral BedBurnett Chas I (Mollie) hl07 Shari Burnett Chas M (Alice M) slsmn hllfi Gordon (SM) Burnett Chas W (Lila W) prsmn LyonHarris & Brooks r RD 1 Dry Branch Burnett Erastus D (Bessie) barber Palm Barber Shop h281 Washington av Burnett Frances millwkr r23 Atlantic Village Burnett Gladys (c) maid r.1051 Pio Nono av (V) Burnett Gussie (c) rl41 (135) Hazel BuinrngetCt oHarr5r3y0 LCaoglltegGet Southern TruckBurnett Henry C jr elk r918 Walnut Burnett Ira (c) car greaser CofGRy Burnett Jas E (Willie B) slsmn Dixie Jobbing House h558 Elm Burnett John (c) delmn Floriede Snell Budrrnett Jos (Alice) slsmn h205 Ninadell Burnett Laura (c) lndrs r813 Elbert (SM) Burnett Mamie (c) lndrs hll (130) Mal- loy's al Burnett Pauline Mrs night chf opr SBT &TCo rl68 High Burnett Sadie (c) lab h205 Hazel Burnett Service Station (Wm D Burnett) 101 Montpelier av BuWrnaeltntuVt allie (wid Henry C) smstrs h918 Burnett Virgil M collr Idle Hour Nurseries r512 Church (EM) Burnett W Paul (Anita I) elk Chapman's Pharmacy r252 Orange Burnett Wm (c) r305 E 2d (EM) Burnett Wm beer 1602 Broadway hll4 Stratton (SM) Burnett Wm D (Hollie M: Burnett iServ Sta) hi 03 Montpelier av Burnette Annie L nurse 216 Adams r do Burnette Chester (Annie M) slsmn Ster- chi Bros Stores Inc h421 Johnson av (H H) Burnette Chester A (Eliz) h620 2d Burnette Helen student r620 2d Burnette Homer L blksmith CofGRy Burnette Ira (c) lab rll44 Broadway Bu1xr4n0e1tteCoJllHegeenraypt(M2Carietta) trav slsmn BuGrnraeytteGJaas A (Kingman Burnette) r Burnette Louise (c) r307 (260) Bowman (EM) Burnette Luke (c; Luella) lab h308 (260) Bowman (EM) Burney Andrew (c) lab rl08 (119) Cedar (U) BulernyeylaAndrew (c; Estella) lab rl20 TinsBubranuemy A(nSdMre)w L (c) lab rl09 (728) NussBBuurrnneeyy BBoeortkhear T(c)(cc)oolakbrrrle0a8r (515149)OCraendgaer Burney Booker T (c) lab rl09 (728) Nussbaum (SM) Burney Bros Co Louis P Burney pres-sectreas whol prod 451 5th Burney Claude (c; Flossie) barber Brown's Barber Shop h598 Fort Hill (E M) Burney Crawford (c: Pleasant) h230 Grant av (V) Burney Crawford G jr (c) janitor r230 Grant av (V) Buarvney(NEHl)la M (wid Robt E) hl45 North Burney Essie M (c) maid r337 Ernest (C H) Burney Geo (Ida) lab Taylor Iron Wks & Sup Co Burney Geo (c) lab h559 Cheatham al Burney Henrietta (c) lndrs rll3 Neal av (V) Burney Jas (c; Savannah) lab r86 Bay Burney Jas A r307 Napier av apt 3 Burney Jerome farmer rl45 North av (N H) Burney Johnny (c) lab r212% Fretwell al Snow's Laundry and Dry Gleaning Go. Licensed "Sanitone" Gleaner Phone 6000 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES BURKE'S 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 72 AUTHORIZED DEALER A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 Burney Junius (c) carp h231 (124) Grant av (V) Burney Linda M (wid Jas) store mgr Piggly-Wiggly Stores h307 Napier aV apt 3 Burney Louis P (Virg.ini. a)v pres-sec-treas Burney Bros Co iil70 Laurel av (N H) Burney Lucy (c) r501 Maynard (EM) Burney Lutlier (Estelle M) lab h.426 Jack- Burnev Magnolia (c) cook rl06 Ruby (V) Burney Mamie (c) lndrs h213 (14) Bay Burney Margt A tchr PS r307 Napier av apt 3 Burney Martha C (wid Jos H) hl016 Clinton rd (EM) Bumey Nathaniel (c) r'213 (14) Bay Burney Nell (wid Jean) rl04 Cleveland av (V)' Burney Peter (c) lab rl08 (119) Cedar (U)' Burney Walker (c; Mary) lab hi09 (728) Nussbaum (SM) . Bumey Wm (c) lab rl08 (119) Cedar (U) Bumey Wm (c; Mamie) lab h Forsyth rd Burnham Essie (c) maid r258 5th av (V) Burnham Geo (c: Alice) lab hl07 Elm Burnham Hilda E bkpr Kaybee Store r3034 Houston av (SM) Burnham J W (c) millwkr Bibb Mfg CO rl07 Elm ,, . Burnham Jas W (Myrtice) mgr Am Opti- cal Co h697 (607) Winton av Burnham Richd E C (Carrie) mach C BuorfnGhRamy rR30ic3h4dHWours3t0o3n4 aHvou(sStMon) av (S M) , , Burnley Geo H (Mary E) r212 Central av (SM) Burnley John L (Eulie E) mech Ga Power Co h212 Central av (SM) Burnley Thos (Bertha M) linemn Ga Power Co hl304 2d Burns see also Bumes Burns Annie L (wid Robt) r758 Plum Burns Bessie Mrs emp Snow's Lndry & Dry Clng Co r284 1st av (Pleasant Hill) Buprrness-tBreoaost MShrosppFelorIancFMunakreknsSteilivnervs- pres-sec 402 3d ,, Bums Chas F (c) student r239 Tindall av Burnsf Dollie O (wid Jack H) rl25 Piedmont av Bums Gladys Mrs lab r459 New Burns Harry B (Ludie) h406 Fort Hill (E M) Burns Helen K student r669 New Bums Henry elk Piggly Wiggly Stores r 459 New Burns J D (c; Ethel) waiter hl26 E Ell Burns J Harry (Mary) elk hl21 Fort Hill (EM) Burns Jack elk Swift & Co r371 1st Bums Jack millwkr r823 Main (EM) BuRmoosmJasr3B71ba1rsttndr Hotel D.empsey Tap Burns Jesse (c: Estelle) lab h633 4th av (WH) Burns John shoe repr r459 New Burns John G (c; Sallie) h601 (575) Chappell (SM) Burns Jos C ir (Herma; Parcel Delivery Co) h327 Boulevard (NH) Burns Kenmore (Florence) pres-genl mgr Kenmore Burns Inc h431 Forest av (V) Burns Kenmore Inc Kenmore Bums pres- genl mgr Madge Sherling sec-treas real est 157 Cotton av , , BuKrnensmKoernemBourrensirIn(cMra4r3y1) Fmorgerstsiasvd(eVp)t Burns Leroy (c) rllO (360) Edison (E M) Burns Leroy (c) r235 (231) E 2d (EM) Burns Lilia (c) h403 (404) Crisp (SM) Bums Mamie L (c) r601 (575) Chappell (SM) Burns Mercer (Clara) atndt Brad Wall h 345 Central av (SM) Bums Murray (c; Winnie M) lab hlOS (177) DeBorde (SM) Burns Rachel (c) rl29 McKay's al Burns Raymond rl33 Steele (SM) Burns Raymond (c: Rosa B) lab h448 City Hall la Bums Robt B (Mattie) h823 Main (EM) Bums Robt L (Mabel) elk Ga Power Co h568 Boulevard (NH) Burns Sidney L (Loulie; Ga Motor Fi- nance Co) r Sunset dr (Shirley Hills) Burns Thos (c; Bessie) lab r284 1st av (V) Burns Ulysses (c) r403 (404) Crisp (SM) Burns Walter F r264 Main (EM) Burns Wm (c) lab r239 Tindall av (SW) Burns Wm C (Mamie C) cond h669 New Bumtley Wesley (c; Leola) h302 Charles Bu(SrrMC)' ora h307 Orange Burr Geo W (Hotel Lanier News Stand) r307 Orange Burrell Marion (c) h307 Clarks av (V) Eurrell Wm (c: Marie) lab h228 (213) Elliott (EM) Burri E R r Hotel Gordon Burris Emma L (wid Luther) h513 Tel- fair Burriss Calhoun C (Maude) elk Met Life Ins Co r254 New Burroughs Asa B (Mollie A) cond h403 Duncan av Burroughs Asa B ir student r403 Duncan Burroughs Mattie (c) r578 Monroe Bu3r2r4usCFarElidnwg inav(Gherdtroude J) bldg contr Burruss Claudia (wid Geo) h51 Arlington pi Burson Homer E (Irene: Vineville Drug Co) hlO'2 Callaway (V) BunretnPbeeargrl Bav(wid Howard H) r325 DanBurton Blanche (c) cook h.146 (145) Sy- camore (V) Burton Corine (c) r225 (204) Pear (EM) Burton Coy (c; Mattie) lab h 10th nr Burton Lois sten r354 College Burton Sarah nurse 233 Bond apt 1 h do Burton Wm R (c) clo prsr Harry A Spivey r203 Moughon Burts Albert W (Betty H) slsmn Dunlap Chev Co r305 College Burts Mildred A Mrs opr SBT&TCo rl09 Lamar (V) . _ Burts Milton E (Viola) slsmn hl09 Lamar (V) Busbee Ada (wid Kline D) h2838 Houston av (SM) Busbee Allen C (Sallie L)N lieut Police . h 2635 2d Busbee Beni O (Jessie) millwkr Willing- ham Cotton Mill h221 (22) Holt av (N Hts) Busbee Bernice Mrs r206 Jeff Davis (SM) Busbee Cullen student r2635 2d ,, Bu(sNbeHetsF) loyd student r221 (22) Holt av Busbee Geo S (Lenora A) h512 Telfair Busbee Lillie M tchr r4304 Houston av Busbee Lilton r4304 Houston av (SM) Busbee Minnie (wid Sebom B) h4304 Houston av (SM) Busbee Ollie E (Myrtle) h4300 Houston av (SM) ,,^ ,, Busbee Tabie sec Burden Smith & Co r 4304 Houston av (SM) Busbee Timothy watch repr The Watch Shop r759 1st , Busbee Wm B r4304 Houston av (SM) Busbie Jefferson J (Mamie) h407 Capital Buasvby(MEiukgaednoiapi)fctywkr r718 2d Busch Christine fctywkr Happ Bros Co r763 2d 73 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Busch Kathleen fctywkr Happ Bros Co r 763 2d Bush Albert T (Vennie S) mach h2220 Broadway Bush Bessie Mrs smstrs r2177 2d Bush Chas R (Ethel) slsmn Union Fum Co r504 Hemlock Bush Clara (c) cook h308 Clarks av (V) Bush Clarence R (Sarah M) acct hl305 Vineville av (V) Bush Earl (Myrtice B) r2108 Broadway Bush Edna rl21 Steele (SM) Bush Edw (Mary) hl21 Steele (SM) Bush Ella (c) h425 E 2d (EM) Bush Emmett Y (Essie L) detective Dan- nenberg Co r513 Main Bush Geo F (Belle C) inspr h2108 Broadway Bush Gordan slsmn ih815 Orange Bush Grady student r210 Broadway Bush Henry elk r2108 Broadway Bush Henry C (Janie) bar tndr Otto S Osborne h750 Pine Bush Howard (Essie) loco firemn r513 Main (EM) Bush Jas J supvr CofGRy r568 1st BBuusshh JMoahrnguReriltaebstrul2d1enSt ter2e1le08(SBMro) ad- way Bush Martin E (Annie) r369 1st Bush Nellie (wid John H) h440 Calhoun Bush Opal r7 Hill Park av Bush Thos J (Kye) eng Dixie Dairies h7 Hill Park av Bush Thos S (Norma S) hl09 Clayton (V) Bush Walter T frigidaire repr Dixie BuDsahiriWesmr7pnHtrillr5P5a3rkHeamv lock Bush Winona smstrs rl21 Steele (SM) Busha John A (Anna L) eng SBT&TCo rSOl 2d Business & Professional Women's Club Frances Oliver sec 200 Baconfield (N H) Bussey Carrie L (c) rllO (18) Turpin la (T) Bussey Dennis (c; Irene) lab hllO (18) Turpin la (T) Bussey Dennis jr (c) rllO (18) Turpin la (T) Bussey Edw (c) lab rllO (18) Turpin la (T) Bussey Harlan E (Ailene) sec-treas Macon Shoe Co h229 Stanislaus cir Bussey Henry (c) rllO (18) Turpin la (T) Bussey Marion (Nelle) pntr r868 Elm Bussey Parker r431 Jackson Bussey Wm M (Mary J) lab h431 Jackson BBuussysieBAeennLiuenLch (c()MlrnsdMrsahrgl3t 3CBorors)ti1c00la7 Broadway Butcher Albert (Pearl C) carp h355 Walnut Butler Albert (c) asst funeral director Hutching's Funeral Home r518 New Butler Albert R (Mae E) atndt h863 American blvd Butler Annie (c) lab Central City Bag Co hl55 E Academy (EM) Butler Betsy (c) cook rl02 5th av (B) Butler Celie (c) drsmkr 318 Jackson r do Butler Chas S (c; Mary O) h409 Applewood (EM) Butler Clifford (c: Ethel) lab h605 (205) Charles (SM) Butler Clyde R r863 American blvd Butler Colbert mech Ga Power Co Butler Danl P (Mary) elk Dunlap-Peeler Hdw Co W7I2I2 Napier av Butler Doris (c) r76 Oliver av (SM) Butler Doshia (c; Rosa) lab h218 Pear (EM) Butler Earl W Hon (Mary) judge City Court of Macon h355 College Butler Edgar (c; Fannie) hlpr CofGaRy hl04 Johnson (SM) Butler Eliz fctywkr r76!3 2d Butler Ella (c) h519 (535) Maynard (EM) Butler Emma (c) maid r731 Ocmulgee Butler Erastus (c; Gath) lab hl4l E Ell Butler Fanny sten Macon Chamber of Commerce r Walden Butler Flossie (c) lab Central City Bag Co Bustolner Frank (c; Celie) lab h318 JackButler Frank (c) lab r205 Orange Butler Geo (c) lab rlC4 Adams Butler Geraldine (c) student r715 Daisy (SM) Butler Gibson L (Jewell) farmer hll9 Lamar (V) Butler Guy C (Frances H) eng WPA r 221 Georgia av Butler Harden (c) h208 Coles al Butler Hattie (c) cook r423 (474) 3d av (V) Butler Hattie (c) fctywkr h76 Oliver av (SM) Butler Henry (c; Princetta) rl04 (724) Waynes al (SM) Butler Ivey (c) carrier US PO h301 Pat- terson (NHts) Butler Jas (c) lab r406 (505) Prince (S M) Butler Jas E chf elk CofGaRy r301 Cherry Butler Jas M (Anna K) car inspr hllO Piedmont av Butler Jas M (Beadie J) elk W R Wer- den & Co r358 Spring Butler Jonnie M (c) nurse r423 (474) 3d av (V) Butler Jos B (c) r337 Bookers al Butler Leontine business sec YWCA r 763 2d Butler Lewis (c) r409 Applewood (EM) Butler Lizzie (c) lndrs h2 Park Hotel al Butler Louise (c) r3 Chestnut la Butler Luke soda elk r559 2d Butler Mamie E (c) smstrs h20 Spring Butler Mary E Mrs sten Corbin Supply Co r Gray Butler Minnie H (c) prin Hazel Street iSch h314 (326) E 2d (EM) Butler Mitchell (c; Sylvia) hlpr CofGa Ry h757 Port Hill (EM) Butler Norman (c; Rosie) lab CofGaRy h232 Orange Butler Ozeri (c) lab r782 Reynolds al Butler Ray auto mech r611 2d Butler Rebecca (c) rl02 5th av (B) Butler Rosalee (c) r5 New Butler Sami L (Roberta) asst press formn Macon Teleg Pub Co hl93 Belmont av Butler Seebram (c) r314 (326) E 2d (E M) Butler Thos J (Lady B) hl23 Lawton av Butler Tommie Mrs furn rms 504 Hemlock h do Butler W Harvard (Jeffie) auto mech h 260 Orange Butler Walter C (Ruth) gro 3011 Houston av (SM) h Hawkinsville rd Butler Wayne r618 Montpelier av Butler Wm (c; Carrie) hl03 Harris Butler Wm B (c) fctywkr r76 Oliver av (SM) Butler Wm R A (F Rebecca) h209 (206) Hydrolia (EM) Butler Wm (R A jr 1209 (206) Hydlroli'a (EM) Butler Wilman '(c) auto repr 118011 (Biroad- Butt Richd L (Faye) div frt and pass agt SouRy h722 Ridge av (V) Butts Alton (c) lab r489 Short al (V) Butts Amanda (c) cook hl48 (146) Syca- more (V) YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Life Of Your CITY 74 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES I ijg Plymouth Budtitsse Beatrice (c) maid hl2 (127) ParaButts Benj (c; Mary) hl31 4th av (V) Butts Charity (c) lndrs h202 (229) Astor (EM) Butts Constance student r271 Hardeman Butts Danl (c: Rosa) h621 Middle (EM) Butts David M jr bldg contr 271 Harde- man av h do Butts Ernest C (Mary N) meatctr W Edw Hamlin h363 Walnut Butts Eula (c) lndrs r642 4th av (WH) Butts Evelyn (wid David) h271 Harde- man av Butts Fanny (c) cook Benj F Lyles r470 Bay Butts Florence (wid Frank) h530 Col- lege Butts Frances (c) cook r238 (240) Far- gason (V) Butts Gene (c) lab CofGaRy r2Q2 (229) Astor (EM) Butts Geoffrey I slsmn r271 Hardeman Butts Geo D (Martha H) linemn SBT& TCo r212 Armond ter Butts Jack W slsmn L N Jordan r530 College Butts Jeff slsmn Snow's Lndry & Dry Clng Co r271 Hardeman av Butts John (c; Lula) lab h'77 Forest av (V) Butts John (c; Beatrice) lab h620 Ham- mond Butts Lonnie (c; Hattie) labh403 Forest av (V) Butts Marcenia (c) lndrs h489 Short al (V) Butts Mary (c) lndrs rl024 College dr Butts Mittie (c) rl57 Lincoln av (V) Butts Moses mach r530 College Butts Nathan J (c; Lois) lab h230 Edge- wood av (SM) Butts Noah F solr Morgan & Morgan Ins Agcy r530 College Butts Sarah E (wid Thos) elk SBT&T ICo hi435 2d Butts Walton E (Edith M) linemn SBT &TCo hi 15 Academy Butts Wm (c; Eliz) cook rl70 College Butts Wm (c; Nina) lab hl57 Lincoln av (V) Butts Wm (c) lab r406 Mitchell al Buxton John N (Annie) slsmn McKes- son-Riley Div hl33 Rogers av (V) Buxton Raiford E (Lucille) pricemn Coleman-Meadows-Pate Drug Co h211 Rogers av ICV) Buzzard Dock (c) lab rll8 Franklin Byars Geo W (Della) h520 (522) Oglethorpe Byars Mary (c) maid 2311 Forsyth Byars Robt (Frances) fctywkr r520 (522) Oglethorpe Byars Steph M (May C) field mgr Met Life Ins Co hA07 Napier av Byars Steph M jr student r407 Napier Byars Thos (c; Stella) lab h226 (43) Virgin la (V) Byas Eug (c; Laura) lab hlOl Dure (U) Byas Marie (c) cook hl09 Moughon (V) Byington Arch meatctr Rogers Stores r 766 Cherry Byington Benj B barber Southland Bar- ber Shop rl802 2d Byington Jas W (Margt J) slsmn Can- ada Dry Ginger Ale Inc h605 Orange Byington John E (Ola) mach hl802 2d Byington Oscar F (Lula) cond h208 Heard (SM) Byne Edw student rl219 Oglethorpe Bynes Celestine (c) student r971 Fort Hill (EM) Bynes Clara (c) tchr r971 Fort Hill (E M) Bynes Emerson (c) tchr r971 Fort Hill (EM) Bynes Gibson (c) r971 Fort Hill (EM) Bynes Henry S (c; Sarah) editor h971 Fort Hill (EM) Bynes Henry S jr (c) student r971 Fort Hill (EM) Bynes Mamie (c) tchr r971 Fort Hill (E M) Bynum Joel C (Annie B) cond hl03 Hill ByCrraenst Haevnry(CHag)t r468 Walnut Byrd Addie (c) lndrs h629 4th av (WH) Byrd Addis (c) h407 (450) Womack (E M) Byrd Alex (c; Ella) hllO Hazel Byrd Alice Mrs r219 Reid (SM) Byarvd A(Vm) os (c; Irene) lab h347 Forest Byrd Annie (c) rllO (815) Amos (V) Byrd Annie L (c) rl02 Peacock (SM) Byrd Benj L (Lavelle) ship elk McAfee Candy Co r728 Walnut Byrd Cath Mrs r407 Walnut Byrd Chester (c; Sara F) driver h438 Hammond Byrd Elsie L Mrs bkpr Ga Carolina Oil Co h2l3 Grenada ter Byrd Emma (c) h526 E 1st (EM) Byrd Eula (c) cook rllO (815) Amos (V) Byrd Francis C printer Macon Teleg Pub Co hill Ponce de Leone av (SM) ByRryd Gh5e0o2 (c(:12L9u) ciCleo)wsatna f(iEreMm)n CofGa Byrd Geo H (Nellie) auto mech hl09 Davis (SM) Byrd Georgia (c) r209 Lincoln av (V) Byrd H A (Ruby) driver h352 Clinton (EM) Byrd H Paul car repr CofGaRy Byrd Harold L elk Flanagan's Camp r 213 Grenada ter Byrd Harry (c; Annie) fctywkr hl09 Simmons av Byrd Hiram V (Bessie) lab hll7 Yates av (EM) Byrd Ida Mrs h718 3d Byrd Ida M (wid Mitchell A) h428 Main '(EM) Byrd Jennie (wid Edw D) gro 236 (102) Virgin la (V) h do Byrd John (c) hauler r438 Hammond Byrd John G (Helen) lab r213 (159) Center (EM) Byrd John M (Georgia) fctywkr hl7 (18) Lake City (EM) Byrd Josephine (c) r264 Division St la Byrd Julia M (wid John F) rill Ponce de Leon av (SM) Byrd Julius M (Elsie L) auto mech h213 Grenada ter Byrd Lee C (Ruth) auto mech hlOO Davis (SM) Byrd Leon waiter Douglas B Fincher r 213 Grenada ter Byrd Lizzie W (wid Henry) rlOO Davis (SM) Byrd Mamie (c) cook h43 Green's la Byrd Martha L (wid Clamont) r213 Grenada ter Byrd Mary student r822 1st Byrd Mary (wid Walter) r822 1st Byrd Mary E (c) cook hllO (815) Amos (V) Byrd Mattie (c) lndrs r247 5th av Byrd Michl (Ethel) lab h39Q Clinton (E M) Byrd Milton G firemn r428 Main (EM) Byrd Oscar (Zelma) hl06 Emerald (E M) Byrd Robt T (Annie) elk hl32 (133) Maynard Byrd Sadie millwkr rl03 Ross Byrd Sami C h940 (942) Elbert (SM) Byrd Thos (c; Hattie L) fctywkr rl09 Simmons av Byrd Thos (Edna) millwkr Bibb Mfg Co h334 Calhoun Byrd Thos M (Viola) lab hllO Enter- prise (SM) Byrd Veda millwkr rl06 Emerald (EM) 75 Byrd Velma picker Macon Peanut & Stge Co rin Yates av (EM) Byrd Walter C (Gladys) blrmkr h822 1st Byrd Wm (c) lilpr CofGaRy Byrd Wm E (Doris) fctywkr hl4 (13) Lake City (EM) Byrom Ada (c) drsmkr 354 Ash r do Byrom Edw (c; Susie) hlpr CofGaRy h 810 Elm BByyrroomm EIndwez jr(c()c)r8s1tu0deEnlmt r810 Elm Byrom Wm (c) hlpr CofGaRy r354 Ash Cabiness Leila r315 Bond Cadle Geo (Gladys M) mgr G Bernd Co hl09 Emory av (SM) Caesar Chas (c; Ida) lab Mansfield Dray Line h552 Smith row Caesar Wm (c; Prances) hl004 Broad (EM) Cagle Guy N (Marie) iformn CofGaRy h 810 Mulberry Cagle Guy N ir student r810 Mulberry apt 7 Cain Arth R (Ruth) service mgr rl20 Fort Hill (EM) Cain Ben (c; Carrie) bell boy Hotel Lanier r rear 318 Forsyth Cain Carl G (Rita) asst bureau of identity Police h206 High Cain Carrie B millwkr Willingham Cot- ton Mill r623 Carling av Cain Cicero S (Josie) eng MD&SRR h 120 Fort Hill (EM) Cain Emma (c) h9 Plant al Cain Emmie (wid Chas) r422 Vineville av (V) Cain Hal C (Nancy H) elk Ry Exp Agcy Cain Henry (c) lab r713 (621) Prince (SM) Cain Herbert N (Addie B) mach r821 CaMinulbHerorzyzie B (Bernice R) meatetr CaVinineJvaislleRPevack(icn;gSCalolieh22M1) Aedvaamngselist hill Berthadale dr (V) Cain Jas waiter Hotel Lanier r56 Spring Cain Len (c) rill Berthadale dr (V) Cain Lillian (c) lndrs hl29 (205) Mag- nolia la Cain Lillie M (c) maid h rear 342 Book- ers al Cain Minnie (c) cook h713 (621) Prince (SM) Cain Oscar (c) student r312 Curd (SM) Cain Paul G agt Life Ins Co of Va r623 ICarling av Cain Robt L (Jessie) wtchmn h355 New Cain Robt R (Sarah E) trimmer Stro- berg Body & Fender Wks h209 Applewood (EM) Cain Sarah E Mrs sten Steve M Solomon jr r209 Applewood (EM) Calahan Harris (c; Mamie) lab hi Harris al Calbert Albert (Esther) mill wkr Willingham Cotton Mill r206 Duncan av Caldwell Beck carp r2007 3d Caldwell Bennett L (Mattie) fctywkr h5 CaBldewlleevllueC rdE cond r30'l Cherry Caldwell Carrie (c) lndrs r801 Curd (S M) Caldwell Cathes F (Coniebell) mill wkr h78 Short (PM) Caldwell Clifford H (Kathleen) trav slsmn h204 Hill Crest av (CH) Caldwell Clifford H jr student r204 Hill Crest av (CH) Caldwell Frank B barber Commercial Barber Shop r Jeffersonville rd Caldwell Henry H r523 Fairmont av (B) Caldwell Herbert G (Ella D) linemn Ga Power Co h760 Cherry Ca(ldCwHe)U Jas H student r204 Hill Crest av Caldwell Jas L (Mary) elk rl33 Bellevue rd Caldwell Jas W (Mamie) lab r523 Fairmont av (B) Caldwell Jessie (c) cook h230 (21) Virgin la (V) Caldwell Kathleen office sec Henry W Elkins r204 Hill Crest av (CH) Caldwell Lewis J (Wyolene) electn h869 Mulberry Caldwell Mattie (c) r309 Broadway Caldwell Milton (c) lab rllO Bostic la Caldwell Otis L (Nellie S) interior dec- orator Brown's Book Store h716 Plum Caldwell R Frank carp h2O07 3d Caldwell Robt (c; Eula) lab r206 (110) 2d -av (U) Caldwell Ruth smstrs r Bellevue rd Caldwell Sallie (c) cook rl03 Tindall av (SM) Caldwell Sami r420 Winship (WH) Caldwell Wilbur student r254 New Caldwell Wm C r660 Walnut Caldwell Woodrow (Kathleen) mill wkr Bibb Mfg Co rl023 2d Calhoun Adeline (c) maid h818 Elbert (SM) Calhoun Andrew (c; Azzilene) lab h214 Walker la Calhoun Annie (c) rl805 Dempsey av (U) Calhoun Aquilla (c; Lillie) lab h344 4th av (U) Calhoun Benj (c) h355 (12) 7th Calhoun Benj (c) lab City Calhoun Bernice r812 2d Calhoun Chas (c; Lula) lab r411 (554) Henrietta (SM) Calhoun Clifford (c; Annie) loco firemn h358 Ash Calhoun Clifford F formn Taylor Iron Wks & Sup Co r350 Ingleside av Calhoun Crisler elk rll3 Habersham av Calhoun Early (c; Ella M) lab hll30 Montpelier av Calhoun Edw (c) r818 Elbert (SM) Calhoun Edw (Emma; Oscar's Place) h 941 Montpelier av Calhoun Ellen (c) lndrs hlOll Elbert (S M) Calhoun Emma (wid Jack) h812 2d Calhoun Ernest Rev (c; Lula M) h974 Montpelier av Calhoun Estella (c) lndrs hl58 Ernest la Calhoun Florrie (c) tchr rlOlS Main (E M) Calhoun Fred beer 513 Poplar r812 2d Calhoun Geo (c; Bessie) lab h708 (620) Prince (SM) Calhoun Hazel (c) hl24 Concord (SM) Calhoun Horace C (Annie D) real est 361 Cotton av h711 Birch (NHts) Calhoun Isaac (c) lab rl09 5th av (B) Calhoun Isaac (c; Rosa) lab hill May av (U) Calhoun J H (Willie E) lab Coplan Junk Co r625 Chapman al Calhoun Jesse (c) h521 Bright la Calhoun Jewel Mrs slswn r821 Mulberry Calhoun John student r315 Coleman av >(CH) Calhoun John C h3145 Houston av (S M) Calhoun John C jr police County Sheriff r3145 Houston av (SM) Calhoun John O (c; Annie L) lab hl03 E Ell Calhoun John K appr Taylor Iron Wks & Sup Co r350 Ingleside av Calhoun John W (c; Julia) mail porter Ry Exp Agcy rl03 E Ell Calhoun Jos (c) rlO (78) DeBorde (SM) Calhoun Joshua C (c) lab r344 4th av (U) Calhoun Kath student r421 Adams Calhoun Lavonia (c) maid hl805 Demp- sey av (U) Calhoun Lyman (c; Willie H) lab CofGa Ry h202 Tindall av (SM) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 76 Who Sells It? IS Answered By the Classified Business Lists In this Directory FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Calhoun Mary (c) fctywkr rlO (78) DeBorde (SM) Calhoun Mary E (c) r358 Ash Calhoun Mary F dental asst Drs Heard & Boone rll3 Habersham av Calhoun Obie Mrs mill wkr Willingham Cotton Mill r56 Holt av (NHts) Calhoun Obie B (Aline J) elk SBT&TCo r804 2d Calhoun Ralph r3145 Houston av (SM) Calhoun Richmond (c; Julia A) farmer h'1018 Main (EM) Calhoun Ruby Mrs hi 13 Habersham av Calhoun Sarah R (wid Geo E) r320 (368) Hill Crest av (CH) Calhoun Sim (cr Mittie B) lab h501 (502) Elbert (SM) Calhoun Wadie B (c) r313 Telfair Calhoun Walter (c; Sallie) lab CofGa CaRlhyouhnl21W5m(1C123e)lk WBoiboblfoMlkfg(ECMo) rll3 Habersham av Califf Mary waiter rl80 Virginia av Callaghan Frank J (Grace T) bkpr First Natl Bank & Trust Co rll8 Stonewall Caplilag(hVa)n Martin J jr dry clnr Crescent Lndry Co h821 New Callahan Elliott (c) student r223 (208) Pear (EM) Callahan Viola (c) lndrs r219 Pear (EM) Callaway Clark L (c; Lizzie) h337 Ernest (CH) Callaway Claud N (Nimie; Callaway Service Station) hlOO 1st av (CP) Callaway Edw (c) r524 (497) Hill Crest av 0CH) Callaway Handy C (c; Ida M) porter h 101 May av (U) Callaway Hattie (c) lndrs r428 Lawton Callaway John C atndt Callaway Service Station rlOO 1st av (CP) Callaway Louise (c) cook hl09 (111) Brief (V) Callaway R D mill wkr r220 (28) Clin- ton (EM) Callaway Roy A (Annie M) fety wkr Bibb Mfg Co h218 (29) Clinton (EM) Callaway Service Station (Claud N Cal- laway) 1801 Vineville av (V) Callaway Wayne atndt Callaway Service Station rl801 Vineville av (V) Callaway Wm (c; Annie) lab hl57 Elm Callaway Wm A carp rlOO 1st av (CP) Callianos Peter A (Stella; Plaza Cafe) h 340 Duncan av Calloway Annie h707 Vineville av apt L (V) Calloway Beatrice (c) maid rll2 Elklon pi (SM) Calloway Handy (c; Clara) lab hl710 (1514) Dempsey av (U) Calloway Henry (c; Lilia) lab h930 (870) Montpelier av Calloway Jack (c; Rosa) mill wkr Bibb Mfg Co hll2 Elklon pi (SM) Calloway John (c) barber 101 Cedar (U) h do Calloway John W (c) pntr hll60 Ocmul- gee Calloway Josephine (c) maid r rear 22 (243) New Street la Calloway Marcellus (c) porter r354 Mad- ison CarlloSBwaFyosStpere'nscearl! (c; Beatrice) orderly Calloway Thos (c) pntr r218 Jefferson Calloway Thos (c; Helen) porter hi Park Hotel al Calloway W Henry (c; Sophie) janitor h868 Foster's al Calloway Wm (c) lab rl710 (1514) Dempsey av (U) Cally Harry (Jennie) mgr Southland Coffee Shop h4250 Houston av (SM) Calvin Fleming (c) lab rl24 Bartlett's la Calvin Lula (c) maid hl24 Bartlett's la Calwell Ruth tailor rl33 Bellevue rd Cameriero Nicholas (M Frances) gro 305 Broadway h401 Walnut Camerio Nicholas J (Bernadette) route supvr Crescent Lndry Co r534 Boulevard (NH) Cameron Alex B (Louise R) mgr Southern Textile Co r473 Duncan av Cameron Chas L (Gladys) lab h347 Flanders (EM) Cameron I Kenneth librarian Mercer Univ h401 College apt 6F Cameron Thos L elk CofGaRy r471 Orange Camp C H formn CofGaRy CaAmnpdeDrsaoisny f(cStMyw) kr Happ Bros Co r752 Camp Eliz student r257 Hardeman apt 2 Camp Erwin L (Alberta) h257 Harde- man av apt 2 Camp Geo M baker American Bakeries Co Camp J G broker r866 Mulberry Camp Jay W (Helen S) in charge Geor- gia Industrial Home h Industrial Home rd RD 1 2 mi w of Log Cabin blvd Camp Mack (Agnes) driver r448 Edgewood av (SM) Camp Sarah E (wid Geo W) h752 Anderson (SM) Campbell Albert B (Addie) blrmkr Cof GaRy h4041 Houston av (SM) Campbell Albert N (Alice) elk in charge RyMS r420 Forest Hill av Campbell Archie student rl25 Washington av Ca1m53p7beClloCllehgaes B gro 316 Plant (SM) h Campbell Chas H genl mgr Independent Lndry Co hl24 Stonewall pi (V) Campbell Chas R (Della) elk hl74 Cedar (SM) Campbell Clarence (c) millwkr Bibb Mfg Co r623 (624) Flanders (EM) Campbell Cleonne (c) maid Dr Thos H Hall r233 Middle (V) Campbell Clifford L cook r503 Bailey av (CH) Campbell Dora L (wid Ernest C) rl975 3d Campbell Edw (c; Josephine) brklyr h 63 (102) Forest av (V) Campbell Enoch B (Josephine R) inspr h.232 Tatnall Campbell Eug (Dolly) hl20 Willingham (EM) Campbell Evelyn elk U S Dist Atty r 1603 Vineville av Campbell Fannie (c) r623 (624) Flanders (EM) Campbell Georgia Mrs slswn Standard CaSmtoprbeesll IHncarvre9y15L W(Laulnciulet) driver h504 Mikado av Campbell Henrietta (c) r308 Ward (V) Campbell Henry (c) lab rll3 Main (S) Campbell Isaac J (Emma) hllO Davis (SM) Capmbell Jack (Susie M) hl05 (29) Hydrolia (EM) Campbell John (Ruby) lab h608 Main (EM) Campbell John (c; Cleo) porter Union Dry Gds Co h233 Middle (V) Campbell John O (Janie W) carp hl21 Rutherford av (SM) Campbell Josephine (c) cook rl716 Dempsey av (U) Campbell Lillian J rl34 Tenney av (S M) Campbell Loy L (Ethel B) elk WPA h 178 Cedar (SM) Campbell Lucille rl74 Cedar (SM) Campbell Mary Mrs r223 Forest av (B) Campbell Milledge (c) hlpr CofGaRy Campbell Paul lab Builders Lbr Co r RD 5 Campbell Richd W `(Emily G) hl25 Washington av 77 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Campbell Robt D C (Evelyn C) lawyer 105 Cotton av R15 hl603 Vineville av (V) Campbell Robt E (Evelyn) prsmn J W Burke Co hi.23 Violet av (SM) Campbell Senate L (Annie P) lab hi85 Cedar (SM) Campbell Susie (c) h!623 (624) Flanders (EM) Campbell Thos (Pearl) lab r608 Main (E M) Campbell Walter auto mech W L Cone Auto Co rl25 Washington av Campbell Wm (c; Annie) lab h308 Coles al Campbell Wm H (Lillie M) elk hl34 Tenney av (SM) Campbell Wm I H (Annie) formn Cof GaJRy h815 Main (EM) Campbell Wm W rl34 Tenney av (SM) Campbell Willie M (c) lndrs h518 E 2d (EM) Canada Dry Ginger Ale Inc T Harvey Fuss mgr bottlers 312 Cherry Canada Lula (c) h607 Telfair Canady Carrie (wid John A) h716 2d Canady Eva r716 2d Canady Roosevelt (c; Mattie) lab hi 14 2d av (V) Canfield Sidney F auto mech Georgia Auto Co h408 Church (EM) Canipelli Jos student r569 College Canipelli Vincent (Theresa) tailor 316% 2d h569 College Canipelli Vincent jr reprmn Ga Power Co r569 College Cannady Albert (c) r502 (120) Elliott (E M) Cannady Beatrice bagger Snow's Lndry & Dry Clng Co rll4 Thomas Cannady Clarence (Myrtle) fctywkr h 149 Williams (SM) Cannady Fredk (c; Beatrice) lab WPA Whse hi 14 Thomas (EM) Cannady John W (c) shoe shiner r502 (120) Elliott (EM) Cannady Mollie (c) h502 (120) Elliott (EM) Cannon Benj H (Jessie) policemn h2608 Cannon Chas L (Esther) elk CofGaRy h302 Buford pi Cannon Christine millwkr Bibb Mfg Co r206 1st Cannon Clarence E (Annie L) mech Central Sash & Door Co hl511 Broadway Cannon Edwin msngr Postal Tel-Cable Co r827 Main (EM) Cannon Georgia (c) cook r400 Ward (V) Cannon Hazel fctywkr rlSll Broadway Cannon Henry (Louis) mill wkr Willing- ham Cotton Mill h61 Holt av (NHts) Cannon Henry M Rev (Evelyn) r419 Forsyth Cannon Jack C (Cora L) h657 Elm Cannon Jas P (Lillie M) h211 (27) Holl av (NHts) CaInnnsonCoJars21P7 HagatrdNematlanLiafve & Accdi Cannon Jewell tchr 419 Forsyth. Cannon John D (Bertha) h405 Cedai ViSlM) Cannon Mildred (wid Jos W) h220 Magnolia Cannon Pearl hl904 2d Cannon Robt L (Grace) auto mech rl34 Wmship (WH) 662 Cherry Store Thos L Parker mg: Cannon Thos J (Susie) lab h365 (2) Hydrolia (EM) Cannon Verna (wid Geo) hl05 Thomas (EM) w Edw h827 do (Viola) gro 816 Main Cannuett Olive student rlOl Ridge av Canter Herman slsmn Dannenberg Co r869 Cherry Canter Louis dept mgr Dannenberg Co r869 Cherry Ca2n0t8erCNotatothnanav(Bhei8s6s9ie CPh)erdryelicatessen Canter Sara student r&69 Cherry Canter Wm P (Lucy) r216 American blvd Canty Jas (c; Mozelle) lab h253 Cowan (EM) Cape Geo D (Blanche V) driver Dixie Dairies h410 Hanson (SM) Cajrel Bessie (c) tchr h231 (230) 1st av Capers Jas (c; Letitia) h315 Norris (E M) Capitol Art Studio (Noah A Hartley, Wm R Cox) photogs 362% 2d Capitol Cycle Co (Lloyd Newbern) bicycles 506 2d CAPITOL HOTEL, Arbie E Weems Mgr, Weekly and Monthly Bates, Small Furnished Apartments, 560 Plum, Tel 1267 Capitol Theatre Harvey Whalay mgr motion pictures 368 2d Capps Ethel A Mrs h2001 3d Capps Wm P firemn MD&SRR Caras Jas (Harry's Cafe) r Hotel Gor- don Carbart Addie (c) lndrs rl!l55 Edgewood Carburetor & Electric Service Inc Geo J Essig pres Aug W Farres sec-treas auto reprs 706 3d Card Andrew (c; Fannie) lab h404 (403) Mitchell (EM) Card Booker (c; Lillie) h203 Yates al (EM) Card Boyd (c; Gertrude) lab r478 Chestnut Card Floyd (c) lab h449 (452) Martha (EM) Card Frobel (c) r730 (742) 3d av (V) Card Pleasant (c) smstrs h301 Green Card Prime lab B F Merritt Coal Co Card Sallie (c) mill wkr Bibb Mfg Co b500 Cowan (EM) a(rEdMW) Ulie b (c) r404 (403) Mitchell Cardell Barney (Lenora J) lab hl522 Broadway Cardell Bessie W (wid Edw W) rl522 Broadway Cardell Edgar H (Cora) lab hl09 Stratton (SM) Cardell Grover (Beatrice) lab rl522 Broadway Cardell Minnie rlOl (1) Balcom av (E M) Cardell Virginia L (wid Jos) rlOl (1) Balkcom av (EM) CaMrd)ell Wm C hlOl (1) Balkcom av (E Cardwell Jas bkpr r853 Cherry apt 3 Carey Aurie nurse 722 Mulberry h do Carey Effie (wid Chas) matron Macon Hospital Nurses Home and Scott Memorial Cottage h754% New Carey Ernest L (Willella) auto mech h 507 Duncan av Carey Jas (c; Rose) vehiclemn Ry Exp Agcy hl33 2d av (V) Carey Julia (c) h330 3d av (V) Carey Julia M (c) tchr PS r330 3d av (V) CCaarreeyy Robt atndt r754% New Willa nurse rl22 2d Cargile Cecil B (Sara B) porter Burney Bros Co h657 Plum Cargile John F (Virginia) h826 Orange Cargile Lucius (c; Sadie B) mill hd Middle Ga Lbr Co r507 (405) Gantt City rd (SM) Cargile Robt L (c) mill hd Middle Ga Lbr Co rl02 Gantt City rd (SM) 78 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Bo, Publishers 431 Howard St. Detroit 3S4 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY RONDS Telephone 1811 Cargile Rufus (c; Caroline) firemn Middle Ga Lbr Co rl02 Gantt City rd (S M) Cargile Sara B Mrs fctywkr Happ Bros Co h657 Plum Cargill Edw K (Martha) pres-mgr S E Broadcasting Co h350 Ingleside av Cargill Edw S (Lonie B) slsmn Toole Turn Co hl03 Lamont av Cargle Mary L (c) lndrs h rear 1214 3d Carithers Emma (c) lndrs h23 Clayton (V) Carithers Geo F elk Triangle Pharmacy rl30 Piedmont av Carithers Geo W (Sara E) bus opr Ga Power Co hl30 Piedmont av Carithers Henry A (c) porter r212; Roosevelt av (V) Carithers Martha E student rl30 Pied- mont av Carithers Thos (c; Daisy) hlpr CofGa Ry h212 Roosevelt av (V) Carline Henry (c) lab hlOl Harris Carling Tile Co Roy E Lowrance mgr 116 Poplar Carlisle Alek O (Ruby E; Carlisle Bros) hl03 Marshall av Carlisle Benj P (Ruby J; Carlisle Bros) rlOl Dell way Carlisle Bros (Lewis W, Alek O and Bsnj P) auto reprs 2111 Vineville av (V) Carlisle Dorothy Mrs r796 Hillyear av (CH) Ca2r3l9isleCoJlleDgoeuglas (Carlisle & Bootle) r Carlisle Jas S elk rl65 Virginia av Carlisle Jos Y rl65 Virginia av CaBrilrioslse) hLleOwlisDeWll w(Nayellie R; Carlisle Carlisle Mary E, jr opr SBT&TCo rl65 Virginia av Carlisle Maude Mrs hl65 Virginia av Carlisle Ola (c) r Coy Burton Carlisle Roy M (Daphne; Macon Feed & Seed Store) r732 Ridge av (V) Carlisle Thos H (Jessie S) mach CofGa Ry h771 Blackburn (NHts) CARLISLE & BOOTLE (J Douglas Carlisle, Wm A Bootle), Lawyers 501-2-37 Happ Bldg 150 Cotton av, Tels 664 and 665 Carlos Lucy (wid Wm P) r227 Ross Carlos Wm S (Nora B) routemn Crescent Lndry Co h227 Ross Carlton Lonnie (c; Queen) lab h4 Fordville la Carlyle Julia Mrs r211 Hines ter (V) Carmichael Edw E (Ola) atndt Tank Car Service Sta h2650 Houston av (S M) Carmichael Ella (wid John) rl09 Grady (SM) Carmichael Henry G (Ruby A) elk Kingman & Everett Inc hl50 Dixie av (SM) Carmichael Jos F (Lois) elk Piggly Wiggly Stores h606 Woolfolk (EM) Carmichael Leonard N (Mary B) meat ctr Sidney W Abel hl05% Cabiness av (EM) Carmichael Leroy r270 Main (EM) CARMICHAEL R JOSEPH (Katherine), SThreiralseyCHeniltlrsa, l TeSlas3h204& Door Co, h Carmichael Raleigh millwkr Willingham Cotton Mill rl23 (39) Holt av (NHts) Carmichael Ruth A (wid Frank S) h219 Vineville av (V) Carmichael Sarah (wid Wm) mill wkr Willingham Cotton Mill hl23 (39) Holt av (NHts) Carmichael Wm mill wkr Willingham Cotton Mill rl23 (39) Holt av (NHts) Carmichael Wm C (Louise) porter Union Dry Gds Co hlOS Pierce (EM) Carnegie Abetha B (c; Irene) oven hd Central Ga Baking Co hl67 4th av (V) Carnes Kath librarian Wesleyan Coll r 576 College Carolan John L (Florence) mgr Jake H Wilensky Co h4Ql College apt 8E Carolina Life Insurance Co Clarence E Black mgr 617 Mulberry R504 Carpenter Arth B (Venice I) loco firemn Cahr2p2e6ntDeruMncaarnvinavQ (Lillie M) car inspr CofGaiRy h302 Ormond ter Carpenter Melba M Mrs millwkr Wil- lingham Cotton Mill r227 Lawton av Carpenter Minnie (wid John W) hllQ (5) Holt av (NHts) Carpenter Ralph E (J Marie) mill wkr Willingham Cotton Mill h243 Duncan Carpenter Rufus A (Pauline) mill wkr Willingham Cotton Mill rllO (5) Holt av (NHts) Carper Sami F (Floy B) formn h803 Cherry Carr Anna C (wid Arth F) smstrs Happ CaBrrrosACrtoh r6(6M7 abHeelm) lobcakker American Bakeries Co hl23 Yates av (EM) Carr Dave (c) lab City hl09 (678) Stripling al (EM) Carr Doris (c) maid r803 (816) Cowan (EM) Carr Edw S (Flossie E) h632 Division Carr Emma I (wid John) rl98 Hightower Carr Geo M (Riscoe) carp hill Stonewall pi (V) Carr Guyton M student rill Stonewall pl (V) Carr H E filling sta 3107 Houston av >(SM) Carr H Eleanor tchr PS h401 College apt 41 Carr Harry (c; Bessie) lab hill (154) Cedar (U) Carr Heywood P (Phoebe M) slsmn h 661 New Carr Homer H (Lavonia M) pntr r2 Grand av Carr John L (Maude) bkpr hl03 Edna pl Carr John L (Emma M) millwkr Willingham Cotton Mill L420 Winslhip (W H) Carr Laura (wid Walter L) h2 Grand av Carr Leo P r667 Hemlock Carr Lewis student rill Stonewall pl (IV) Carr Mabel Mrs pickers Macon Peanut (c) h400 Ash Coffee McKenna (c) lab r400 Ash Coffee Robt elk College Hill Pharmacy r253 Washington av Coffee Robt student r7 N Arlington pi Coffey Amelia (wid Danl) rT71 Hemlock Coffey Mary A (wid Jack) h771 Hem- lock Coggin Jas M (Coggin & Mann) r614 Arch Coggin Jasper L (Sara) dist mgr Interstate Life & Accident Co hll6% Rich- mond , _ Coggin & Mann (Jas M Coggin, Robt E Mann jr) printers 618 Poplar Coggins Albert (c; Essie M) hlpr H Mar- Cosghgailnls FJumC (Cc)o phntBr ur6c5k'3neEr lmal al Coggins J Wilbur (Eleanor) buver Wil- lingham Cotton Mill h359 Orange Coggins Mary L (c) rl02 Gantt City rd (SM) Coggins Robt M (Lollie) slsmn rll6% Richmond Coggins Rufus (c; Carrie) lab 11102 Gantt City rd (SM) Coggins Sarah (c) maid r653 Elm al Cohen Abr r302 (202) Pio Nono av (V) Cohen Abram S (Belle) inspr h720 2d Cohen Mrs sec-treas Standard Stores Stores Inc hi 19 Birch apt 3 (NHts) Cohen Ethel (c) tchr Ga Academy for the Blind r418 Pio Nono av Cohen Gus (c; Mamie) porter r252 Plant row Cohen Harry elk Max Cohen r302 (202) Pio Nono av (V) Cohen Inez (c) r872% Hazel Cohen Isaac (Esther) slsmn Standard Stores Inc hi 19 Birch apt 3 (NHts) Cohen Isaac student r302 (202) Pio Nono av (V) Cohen Jacob (Mollie) rl09 Brentwood av Cohen Jesse driver J W McCook Lbr Co r349 Hawthorne COhen John student r302 (202) Pio Nono Coahven(VJ)os elk Max Cohen r`302 (202) Pio Nono av Co!(lUli)er Beatrice (c) maid rll6 (742) 2d Collier Carrie bkpr Moore & Boone h561 Hillyer av (CH) Collier Chaney (c) maid h228 Lexington Collier Deanna (c) h460 Ward (V) Collier Edw (c; Lena) lab h256 Franklin Collier Elder (c; Viola A) lab hl24 (224) Dannenberg av Collier Frances inspr Happ Bros Co r 1305 2d Collier Frank (c) lab r315 (267) Gantt City rd (SM) Collier Geraldine (c) r609 (685) Elbert (SM) Collier Homer (Nelle) lab h918 Oglethorpe Collier Homer ir elk Morris Kolodner r 918 Oglethorpe Collier Horace (c; Carrie) lab CofGRy rll5 Rose Crest av (SM) Collier Hubert driver r918 Oglethorpe Collier Jackson (c) h207 (307) Morris i(EM) Collier Jas (c; Lois) hl22 E Ell Collier Laura (wid Thos E) hl305 2d Collier Lawrence (c; Pauline) pntr hl08 (7-8) Hawkins av Collier Lily r561 Hillyer av (CH) Collier Linder Mrs fctywkr Happ Bros CoClloierrl0L5o4naAtschhr PS r461 Boulevard (N H) Collier Mary inspr Happ Bros Co rl305 2d Collier Melissa (c) car clnr CofGRy h4 Spring Collier Millard (c; Cora) lab hll6 (742) 2d (U) Collier Ollie O (Lyre) emp CofGRy hl28 Richmond Collier Perry (c) delmn Enrico DiVenuto r Antioch rd Collier R P Mrs emp WPA r320 College Collier Robt (c) lab hl274 Cheatham al Collier Robt (c) lab hl05 Concord (.SM) Collier Robt (c) lab h609 (68'5) Elbert (SM) Collier Robt (c; Pearl) lab hi03 (76) Frdiiik 3,1 Collier Robt M (c) lab rl42 Brooklyn av (S) Collier Ulysses (c; Ida M) lab CofGRy h 229 North (V) Collier Wm (c) barber John W Peeks rlO Cheatham al Collier Wm L (Minnie) h461 Boulevard (NH) Collier Wm R rl305 2d Codings Henrietta supvr r360 College apt 1 Codings Thos L (Wilhelmina) coml agt h360 College apt 1 Collins Ada r460 New Collins Addie (c) cook rS41 3d av (V) Collins Adolph D (Willie M) millwkr Willingham Cotton Mid hll5 (43) Holt av (NHts) Collins Alf (c) driver Taylor Iron Wks & Sup Co hi 136 Broadway Collins Alton millwkr Bibb Mfg Co rlOl 3d Collins Annie (c) lndrs hl4 Elm Collins Archie porter Clark Drug Co r 240 Church la (SM) Collins Arth (c; Evelyn) hlpr CofGRy h 109 Tindall av CCoolllliinnss AArrtthh J(c;mDacahisyh)30l3a2b Hrlo2u3s0to1nstav (SM) Collins Asberry (c; Lula) lab Taylor Iron Wks & Sup Co rl84 (313) Roye (CH) COLLINS BAKING CO, Wm F Shannon Mgr, 205 Cotton av, Tel 4900 (For further information see left side lines and page 4 Buyers' Guide) Collins Carrie B sten Harris Harris Russell & Weaver r296 College Collins Chas (c; Susie) rl63 (161) Hazel Collins Chas (c; Lizzie) rl88 Tindall av Collins Chas (c; Lula) lab h215 (255) Neel (U) Collins Chas D (Minnie) pharm Nipper's Pharmacy rll2 Lee (EM) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St, Phones 2200-2201 Who Sells it? IS Answered By the Classified Business Lists In this Birectory 94 "A SAFE PLACE TO TRADE*' STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Collins Chas L capt Fire Dept hll2 Lee ('EM) Collins Clarence (Bessie) pntr h204 Roff Home la Collins Clarence G mgr Standard Parts Co h210 Henry (SM) Collins Clarice millwkr Bibb Mfg Co r36 (37) Brigham Collins Cora S (wid Alf E) h415 Georgia Collins Cornell (c) waiter r457 E Academy (EM) Collins Danl (Eva) wtchmn hl703 2d Collins Della (c) r240 Church la (SM) Collins Dolores A slswn Darling Shop r 415 Georgia av Collins Dossie (c) lab hS23 Division Collins E Lee (c; Lucretia) lab h201 Oc- mulgee Collins Edw (c; Gussie G) lab Yates & Tabor Co hi 18 Cowan (EM) Collins Edw L (c) r913 Pio Nono av (V) Collins Emma (wid Will) rl05 Church (EM) Collins Essie fctywkr Happ Bros Co r419 CoNlleinws Eufa Mrs fctywkr Happ Bros Co h22Q Reid (SM) Collins Eug (c; Valline) lab hl26 (447) Orchard av Collins Eulie M (Lillie) millwkr Bibb Mfg Co h31 Bibb av Collins Eunice Mrs millwkr Bibb Mfg Co rll5 Jones av (EM) Collins Eva (c) lndrs rl55 (408) Nuss- baum (SM) Collins Floyd (c; Nellie) h407 (330) Eliz- abeth (SM) Collins Frances student rl07 (167) Cher- okee av Collins Frances V millwkr Willingham Cotton Mill r'115 (43) Holt av (NHts) Collins Frank (c) r308 Wood al CoHlloinmseFarvank(VC) (Susie) lab h240 Roff Collins Fredonia (c) h475 (464) Alabama (SM) CoMllifngsCGo hClllOifto(n14)(MBaalrkyc)ommilalvwk(rEMB)ibb Collins Geo (c) r708 (605) Hall (EM) Collins Geo (c) porter Macon Beverage Distributors rl4 Elm Collins Geo H (Verdie) stone ctr r3020 Houston av (SM) Collins Geo W (Ida) rll3 Schell av (EM) Collins Helen (c) r234 (214) Elliott (EM) Collins Henry (c; Jda) lab h308 Burnett Co(lEliMns) Ida (c) h457 E Academy (EM) Collins Ida Mrs r51'3 Main (EM) Collins Inez L r619 Oglethorpe CoIlrloinns WIvkesrs&onSu(cp: CHo ahttlile3)0 lBarboaTdawyalyor Collins Iverson (c; Viola) lab Taylor Iron Wks & Sun Co r803 Ocmulgee Collins J C (cl r782 Reynolds al Collins J Walter (Carrie M) slsmn hl07 (167) Cherokee av Collins Jas erreaseboy Steve M Solomon jr rl703 2d Collins Jas (c) lab rl07 Drews qtrs Collins Jas (Anne) lab G Bernd Co r605 Hall (EM) CCoolllliinnss JJaass ((cE)dlnaab)r6m0i3llw(2k2r0)BPibribncMefgSWCo rl041 1st CCoolllliinnss JJaass C(C(acr;rieJ)esssiles)mnlabh2h4H7e7le(n466) CoAlllianbsamJaas (HSM()Arline) stone ctr hl03 Newberg (SM) Collins Jas L (Daisy R) formn Willing- ham Cotton Mill r502 Duncan av Collins Jas T (Allice B) millwkr Will- ingham Cotton Mill hi26 (15) Holt av Co(lNlinHstsJ)as W r3041 Houston av (SM) Collins Jas W (Mary) millwkr Atlantic Cotton Mills h32 Atlantic Village Collins Jamison (Mae) millwkr Bibb Mfg Co hl06 Church (EM) Collins Jeremiah T r9 Atlantic Village Collins Jeremiah T jr (Susie) millwkr Alatgleantic Cotton Mills h9 Atlantic VilCollins Jesse D (Carrie B) formn h870 1st Collins Jewell E file elk Dannenberg Co F4`l& Georgia av Collins John (c) lab r233 Morgan av (W H) Collins John (Florene) millwkr Bibb Mfg Co h'38 Brigham Collins John H (c; Laura M) lab h540 (510) Grant Chapel al (SM) Collins John W (Lala B) stone ctr h 2909 Houston av (SM) Collins Jos (c; Pearl) lab r475 (564 Ala- bama (SM) Collins Jos (c; Katie) lab h205 Holmes av (V) Collins Josephine (c) cook hl24 Orange Street la Collins Josephine (c) lndrs r258 Hill al Collins Laura (c) cook h rear 925 (959) Ocmulgee Collins Lester fctywkr Happ Bros Co r 619 Oglethorpe Collins Lizzie (c) r308 Wood al Co4l1l9insNLewouise fctywkr Happ Bros Co r Collins Louise H Mrs h859 Walnut Collins Lucius (c) rlOl Long St la (SM) Collins Lucy F (wid George) r2909 Hous- ton av (SM) Collins Lynwood G slsmn American Bak- eries Co r Cross Keys RD 4 Collins M Imogene sten Bankers Health & Life Ins Co r416 Georgia av Collins Mamie (c) r658 Strayers al (SM) Collins Mamie (c) lndrs r215 (255) Neel XU) Collins Mamie (c) maid h5 Harris al CoDllriynsCMlnagriCeo(crl)l3e6mBp rSonaodww'asyLndry & Collins Marie (c) lndrs r330 Barfield al Collins Martha (c) r6 Harris Row Collins Mary (c) lndrs r rear 554 Orange Collins Mary L (c) r554 Chappell (SM) Coblalimnsa M(SaMtti)e (c) maid h502 (453) AlaCollins Milton (c; Lucille) farmer r215 (339) Hawkins av Collins Nancy E (c) h225 Chestnut Collins Nealy (wid Richd) r619 Ogle- thorpe Collins Nell tchr PS rl21 Culver (V) Collins Nell P (wid David C) hl29 Vir- ginia av Collins Obie M Rev (Goldie T) pastor Tremont Temple Baptist Church r374 Monroe Collins Odessa (c) rl4 Elm Collins Oscar B (Susie B) flagmn M D <5s ISRR hl05 Church (EM) Collins Otherine (c) lab Taylor Iron Wks & Sup Co rll30 Broadway Collins Paul L driver A G Rhodes & Son rl421 2d Collins Polly (c) h708 (605) Hall (EM) Collins R Milo (Delta) suburban mgr SBT&TCo h313 Ridge av (V) Collins Richd (c) lab h615 Division Collins Robt (c) elk Zack Roberts r Un- ionville Collins Robt (e; Ella) driver h953 Hazel Collins Robt student r313 Ridge av (V) Collins Robt E (Maggie D) car repr CofG Ry hi 14 Holt Collins Roberta (c) r226 Gilmer Collins Roberta (c) midwife 118 Neal av (V) h do Collins Roy auto mech rl703 2d Collins Roy R hlpr Miller Bros r870 1st Collins Rubv (c) cook rl30 (242) Rail- road av (V) Collins Ruby (c) tchr rllS Neal av (V) 95 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Collins Ruby (wid Robt W) r210 Henry (SM) Collins Ruby L sten Southland Coffee Co rll4 Holt Collins Rudolph (c) rll8 Cowan (EM) Collins S Rossetter rl30 Georgia av Collins Sallie (wid John) millwkr Bibb Mfg Co h36 (37) Brigham Collins Savannah (c) Indrs hlOl Long St la '(SM) Collins Sidney (Agnes) appr hll2 Ken- nington pi Collins Thos (c; Willie) talksmith h319 Middle (V) Collins Thos (c; Lula) firemn Central Sash & Door Co r'712 Elbert (SM) Collins Thos S (Ethel) formn rl421 2d CCoolllliinnss UViBrgi(nci)a r4(Sc)7 Er61A5caDdievmisyion(EM) Collins Virginia E cash Dannenberg Co r . 415 Georgia av Collins Wilfred student r269 Astor (EM) Collins Wm (c; Janie) lab h236 (220) El- liott (EM) Collins Wm (c; Bessie) millwkr Bibb Mfg CoClloinsh4W31m TBe(lfNaiitra R) slsmn Central Ga Baking Co rl09 Napier av Collins Wm H h460 New Collins Wm J (c) lab r477 (466) Ala- bama (SM) Collins Wm M (c) r4?5 (464) Alabama (SM) Collins Wm S (Mary L) shoe repr Sharps Shoe Shop r339 Ross Collins Willie B student r415 Georgia av Collis Wm W (Alma) millwkr Atlantic Cotton Mills rl Atlantic Village Colonade Apartments 263 Georgia av Colonial Apartments 520 Orange Colquict Prank A pharm Macon's Pharm- acy r620 1st Colquitt Florence sten rl05 Clayton (V) Colquitt Prank W (Ruth M) ins agt Mur- Phev Taylor & Ellis Inc h536 Hillger av (CH) Co(l1q2u6i)tt CJahsarEles(Lu(ScvMM) ) driver Citv hll6 Colquitt Laura H Mrs cash Met Life Ins Co rl89 Magnolia C(V)itt Lelia (wid Wm T) h105 Clayton Colquitt Lewis H (Laura H; Monk's Ga- rage) rl89 Magnolia Colquitt Lucile sten McKesson-Riley Div rlOS Clayton (V) Corlqduoitt Mary mus tchr 105 Clayton (V) Colquitt Wm T (Lillian) elk G G Harde- man Co rllO The Prado (I) Colson Georgia (c) Indrs h578 Monroe Colson Lucius (c; Lydia) lab Natl Handle Co h94 (100) Hazel Colson Rebecca (c) cook r578 Monroe Colvin Henrietta Mrs head slswn S H Kress & Co r Hotel Pickling Colvin Nan waiter r Hotel Fickling Colwell Clarence (Lucile) millwkr Bibb Mfg Co r301 (300) Flanders (EM) Comas Bessie (wid P Hovisl r852 1st Combess Essie Mrs millwkr Bibb Mfg Co rl03 (264) Pearce (EM) C orsa L (c) cook r620 (619) , . 4th Cooper Nathaniel (c; Eula M) driver h 150 Lynwood av (V) Cooper Onan G (Audrey K; Vineville Fdrurniture Co) h431 (430) Log Cabin Cooper Otis O (Eula W) hl30 Rogers av (V) Cooper Pearl E (wid Richd T) h2333 2d Cooper Raymond (c; Mattie) lab h410 (718) Campbell av (SM) Cooper Rebeccah (wid John) rl327 2d Cooper Richd carp r2333 2d Cooper Ruby (c) maid r562 Plant al Coaolper Smithey (c) lndrs r8 Buckner CoPpipnoeck John G (Martha) ms agt h721 Corbett Emma Mrs rlOl Wood (SM) Corbett Eva E (wid John M) smstrs Union Dry Goods Co hl04 Cherokee av Corbett Jas D (Bessie M) mill wkr Bibb Mfg Co rl03 (264) Pearce (EM) Corbin Culver C (Gladys) pres Corbin Supply Co hll3 Rogers av (V) Corbin Culver C jr elk Corbin Supply Co rll3 Rogers av (V) Corbin Eliz Mrs bkpr Freeman-Dent- Sullivan Co rl47 Rose Park Corbin Florine (c) h321 Ash Corbin Irene (c) mill wkr Bibb Mfg Co rl08 6th av (B) Corbin Jas (c) r322 Gilmer Corbin Jas (c) hlpr CofGRy Corbin Jas B (Elvie) lab hll8 Lamar (V) Corbin Jas E elk Goodrich Silvertown Stores r RD 2 Corbin Madge Mrs rll8 Lamar (V) Corbin Matthew (c; Emma) porter h712 HawthMoorniiieo rp'i p.rvnlr Hammond YOUR CITY D I R C T O R Y MIRRORS the CIVIC Of Your CITY 98 D. H. Adams TAYLOR STORAGE SHIPPING Motor TRANSFER COMPANY 458 PLUM ST. PACKING PHONE 388 Go. Stodebaker Willys Corbin Reano eErsxcNh.anYge. N. Y. Cotton Exchange Chicago Board of Trade AssNoEc. ixaYcteh. aMnCgeuemrbbers Local Stocks and Bonds Government Bonds Home Owners Loan Gorp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 THIRD AT PINE GMC TRUCKS PHONE 5100 Cox Mary P Mrs fctywkr Happ Bros Co r610 Plum Cox Maude E waiter P W Woolworth Co Corx24N4 oAram(ecr)icamnaibdlvhdl3 Parker av (V) Cox Oliver E (Fannie L) carp h244 American blvd Cox Oliver E ir r244 American blvd Cox Otho B (Eldee) slsmn D H Adams Motor Co h415 Montpelier av Cox Owen r335 Winship (WH) Cox Pearlie M mill wkr Atlantic Cotton Mills r332 Pio Nono av (V) Cox R Raynelle elk Am Natl Life Ins Co r947 Montpelier av Cox^Ray T mill wkr r332 Pio Nono av Cranford Cecil E (Annie R) mill wkr Wbeirlglinaglham Cotton Mill h92 Dannen- Cranford Colton (Lizzie) r708 Main (E M) Cranford E Carl carrier PO r Cross Keys Ga Cranford Edw (c; Nancy) lab h884 Maynard (EM) Cranford Edw F (Annie J) slsmn KAedyasmsG-Ba uchanan Motor Co r Cross Cranford Eli R (Mildred) mill wkr WilliHntigSh) am Cotton Mill r59 Holt av (N Cranford Estelle mill wkr Willingham Cox S Effie (wid John A) r475 Duncan Cox Sadie (c) rl06 (44) Short (EM) Cox Thos E (Eddie F) bus opr Ga Power Co h947 Montpelier av Cox^Wm L mill wkr r332 Pio Nono av Cotton Mill r57 Holt av (NHts) Cranford Ethel H Mrs slswn Dannen- berg Co r515 Boulevard av Cranford Geo mill wkr Atlantic Cotton Mills r!77 Roff Home la Cranford I Clyde (Ethel) dept mgr Dan- Cox Wm N drftsmn Dennis & Dennis h263 Georgia av apt 8 Cox Wm R (Capitol Art Studio) r362% nenberg Co h515 Boulevard (NH) Cranford Isaac (Pearl) mill wkr Will- ingham Cotton Mill h57 Holt av (N 2d Cox Wilmer M (Alice) restr 3403 Hous- ton av (SM) h do Coyle Cula (wid Joel B) beauty shop 520 Washington av h do Coyle Joel B r520 Washington av Cozine John E (Gwendolyn B) slsmgr Macon Gas Co hl21 DeSoto pi CrSapbrtirnege Guy E (Jessie) signalmn h208 Cr(aVc)ker Ida (c) lndrs r211 Holmes av Cracklin Lula (c) cook rl07 Tindall av Craddock Harry W (Louise R) dentist 567 Walnut h423 Beech av Craddock Louise R Mrs slswn Darling Shop h423 Beech av Craddock Nancy C (wid Harry W) r423 Beech av Craft Felton (c) r852 Ash Craft Fisher A (Emily) elk Birdsey Flour Mills h'l 07 Brentwood av Craft Wm C (c; Cevia) h852 Ash Crafter Edw J (c; Clara M) lab hl234 1st Cranford Isaac jr r57 Holt av (NHts) Cranford J Beaufort msngr Ga Power Co r203 Plant (SM) Cranford Jewell (wid W Geo) hllO Will- ingham (EM) Cranford John (c; Archie) lab r511 (527) Maynard (EM) Cranford John p (Florence) mill wkr Alatlantic Cotton Mills hl77 Roff Home Cranford John T mill wkr Willingham Cotton Mill r57 Holt av (NHts) Cranford Julian E (Margt M) plstr h 340 Grenada ter Cranford L Frank (Cleo B) paper ruler J W Burke Co h203 Plant (SM) Cranford L Frank jr r303 Plant (SM) Cranford Lois (Odessa) h407 Hill Crest av (CH) Cranford Louis D (Lucille) cond h219 New Cranford Louise r57 Holt av (NHts) Cranford Lucille r314 College Cranford Lucille (wid Frank) smstrs r 252 Jeff Davis (SM) Who Sells It? Crafton Hazel beauty opr Union Dry Gds Co r201 Berkley dr Craig Genevieve M r680 College Craig Howard W slsmn r680 College Craig Jas C acct r232 Georgia av Craig Lindsey (c; Adell) lab h239 (240) Waterville rd Craig Louis (c) lab r239 (240) Water- ville rd Craig M Eliz (wid Geo) h680 College Craig Mildred sten Dunlap Chevrolet Co r390 Suwanee av Crambes Peter S (Adeline A; Ingleside Cranford Odessa Mrs beauty opr College Beauty Salon h407 Hill Crest av (CH) Cranford Oleta slswn F W Woolworth Co r RD 6 Cross Keys CrranCforrodss RKoeyysslsGman Standard Oil Co Cranford Velma fctywkr Happ Bros Co rlio Willingham (EM) Cranford Virgil mill wkr Willingham Cotton Mill r54 Holt av (NHts) Cranford W Geo rllO Willingham (E IS Answered By the Classified Electric Co) hl05 McGee (CP) Crsaomner(BD)anl (c; Gussie) lab h HenderCrandall John R dept mgr Sterchi Bros Stores Inc r401 College Crandall Mamie (wid Robt L) hl53 Sum- mit av (NH) Crandall Mary L Mrs bkpr WPA Whse rl02 Rogers av (V) Crandall Robt student rl219 Oglethorpe Crandall V Haleman tchr Public Sch r 153 Summit av (NH) Crane Co Wallace M Davis mgr plmbrs' Cranford W Lafayette (Emma) h708 Mam (EM) Cranford Wm r2308 Broadway Craps Wm M (Pauline) wtchmn h209 Cr(a2v0e8y) ALuosgboCn awbianitedr rPlantation Lunch rl235 2d Cravey Geneva student r815 Montpelier Cravey Lillian Mrs h815 Montpelier av Cravey Louis lab r244 Washington av Cravey Marion driver rl235 2d Cravey Wiley J (Julia) elev opr hl235 Lists In fin's Directory supplies 500 Broadway Crane John (Bessie) mill wkr Bibb Mfg Co hl015 1st Cranford Arth A (Willie A) mill wkr h 10 Grand av Cranford Augustus M (Pearl K) h2308 Broadway Cranford Augustus M jr lab r2308 Broad- way Cranford Barler C (Marie C) h2:308 Broadway Craavwfo(SrdM)Ada C (wid Theo F) r203 2d Crawford Alice (c) rill (302) Craft (V) Crawford Alvin J (Edna R) florist Idle Hour Nurseries r Forsyth rd CrNawewford Bertha (wid F Marion) h922 CrwawkrforBdibCbarMrifeg (wCiod hS5i6m3psHonawGth)ofrnetey Crawford Chas T (Helen) carp hl41l 2d Crawford Clarence elk r509 Arch 101 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Crawford D McCurdie (Lollie) driver h 302 Ell (SM) Crawford Edw lab Ga Power Co Crawford Ellen t922 New Crawford Elmer hlpr r509 Arch Crawford Eula (wid C B) r440 Ross Crawford F Pringle (Florrie) formn Riverside Lmbr Co h914 Orange Crawford Frances student r628 Orange Crawford Freeman (c; Nancy) carp h 813 Center (EM) Crawford Geo W (Nellie) wtchmn CofG Ry h232 Ross Crawford Helen B r563 Hawthorne Crawford Henry (c; Emma) lab h734 Hazel Crawford Herbert F (Julia V) store mgr GtA&PTeaCo h331 Vineville av (V) Crawford J Wm (c) loco firemn r503 Pebble (SM) Crawford Jack elk r509 Arch Crawford Jas lab r628 Orange Crawford Jas B (Martha E; Crawford's Barbecue Lunch) h308 Linden av Crawford Jas C (c; Ruth) swtchmn r 358 Ash Crawford Jas E (Emma M) lab h2109 Broadway Crawford Jas T (Eva) mgr Southland Barber Shop r508 Ridge av (V) Crawford John (Mary) mill wkr h387 Pio Nono av (V) Crawford John J (Beulah) h204 SimCrmawonfosrd John W (c; Thelma) loco fire- man r403 (100) Texas (SM) Crawley Benj (c; Lizzie) hl27 Holmes Craavwle(Vy ) Chas h309 Jenkins (SM) Crawley Jos L (Ruth) auto mech r859 Cherry Crawley Milton mill wkr Bibb Mfg Co rl7 Bibb av Crawley R Howard emp CofGaRy r309 Jenkins (SN) Crawley Sidney E firemn MD&SRR Cray Beulah (c) cook r230 Madison Cray Delacey (c) r230 Madison Cray Ethel ' (c) elev opr Hotel Grady r 230 Madison Cray Floyd (c; Beatrice) chauf r230 Madison Cray Mary (c) r230 Madison Creamer Benj L (Hazel M; Superior Welding Shop) r RD 4 Creamer Eldora (Sue F) mill wkr Will- ingham Cotton Mill h25 (63) Mill Creamer Ethlyn elk Happ Bros Co r623 Walnut Creamer Forrest (c; Flossie) brkmn h 16 (752) Steins al Creamer Forrest jr (c) r!6 (752) Steins pi Creamer Julian (Ethel) fctywkr Happ Bros Co r750 2d Creamer Marvin (Mabel F) driver Cen- tral City Bag Co hl03 Washington av Creamer Mary F Mrs fctywkr Happ Bros Co h623 Walnut Creamer Thos W fctywkr Happ Bros Co r623 Walnut Crawford Lark (c) farmer r449 Gilmer Crenshaw Alice Mrs millwkr Bibb Mfg Crawford Lee E (c) maid r826 3d av (V) Co hl78 Gardner (PM) Crawford Lester J (Mamie) barber Wat- Crenshaw Edw W (Sarah K) car repr h kins Barber Shop r557 1st 185 Cedar (SM) Crawford Lillian (c) cook r289 1st av (V) Crawford Lillian (wid John) r460 Mulberry C rLenawshtaown Eliz av N (wid John W) r227 Crenshaw J Wm (Gussie) mill wkr Bibb Mfg Co h20 Brigham (Payne Mills) Cra(Vw)ford Lillie (c) cook hl02 Empire av Crenshaw John T (Beatrice E) mill wkr Willingham Cotton Mill h203 (31) Holt Crawford Lois (c) maid rl09 (48) Tracy's av (NHts) la Crenshaw Lillian B student r203 (31) Crawford Lozia M (c) r814 Edgewood av Holt av (NHts) Cr5a0w9foArdrcLhucius E ftr Macon Gas Co r Crenshaw Lois N mill wkr Willingham Cotton Mill r203 (31) Holt av (NHts) Crawford Luther elk Hotel Fickling Crenshaw iM Josephine smstra ri05 Cedar Crawford M Peter meat ctr Rogers (SM) Stores r922 New Crenshaw Robt L ship elk A S Hatcher Cr2awford Mamie tchr Public Sch r RD Crawford Mairgt (c) r209 (17) Bay Crawford Marie (c) lndrs hl03 Brook- lyn av (S) Cr(aVw)fo'rd Morabelle (c) cook r826 3d av Cra(Vw)ford Myrtice (c) cook r306 1st av Crawford Nathaniel G student r505 (400) Crisp (SM) Co r227 Lawton av CRESCENT LAUNDRY CO. Aristide A Benedetto Pres-Treas, High Grade Laundry Work, Dry Cleaning and Dyeing, 519 2d, Tel 16 (For further information see front cover and page 21 Buyers' Guide) Crescent Restaurant (Harmon C McDaniel) 623 3d Cressville School (c) Ida Brown prin 109 Crawford Nellie elk r232 Ross Crawford O P (c) rl35 Holmes av (V) Crawford Phoebe (c) maid hl24 N Tat- nall la Crawford Reid (Irene P) lab hlOlO Hazel Crnaawllforlad Rosa (c) maid r204 (1) N Tat- 6th av (B) Creter Frances S tchr r714 Holt av (N Hts) Oreter Louis P (Kath A) mgr h714 Holt av (NHts) Creter Stuart A (Ruth) cash Natl Bis- cuit Co h301 Chatham (SM) CrSapwrfionrgd Slaami (c; Luella) cook hll4 (7) Crew Hazel (c) r804 Fort Hill (EM) Crew Inez (c) lndrs hl232% Broadway Cr8a2w6fo3rdd aSvol (WV) (c; Mattie) brklyr h Crew Nelson (c; Ida) lab hllO (134) Wayne al (SM) Crawford Thos (c; Savanna) lab h423 Damour la Crews Delmar H (Vera) formn Bibb Body & Fender Works r559 2d Crawford Thos F (Imogene) fety wkr Crews Jas S (Narbo) asst genl mgr MD r709 Anderson (SM) &SRR h360 College apt 3 CrrawWfoardlnuWt L agt Am Natl Life Ins Co Cribb Cath student r314 Randolph (E M) CrHawtsf)ord Wm (c) lab r317 Patterson (N CrCibrbesCt oanvsta(nCcHe )student r212 (220) Hill CrrawLfoorrdainWemGAa elk J S Waldorf & Son Cribb Hazel T Mrs private sec Burden Smith & Co r401 Duncan av Crawford's Barbecue Lunch (Jas B Cribb Henry J (Nell) dairy wkr Dixie Crawford) 677 Broadway Dairies r915 Walnut apt 2 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on ue R. L. POLK & CO. DETROIT 102 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Cnbb Llewellyn S (wid J Lee) h212 (220) Hill Orest av (CH) Cribb M Alice (wid Henry) h314 Randolph (EM) Cricket The (Jos G Coleman jr) restr 620 Poplar CrBimeamniensrlElSdnaSuCmmteitl aovpr (NFHen) ner & Crimmins Harry USN rll8 Summit av Crosby Hemmie (wid Henry K) fctywkr Happ Bros Co h915 New Crosby Hugh W slsmn G R Kinney & Co r915 New Crosby Jas W (Avie W) hl432 3d Crosby John mill wkr rl432 3d Crosby Leon A firemn MD&SRR r915 New Crosby Marion E (Mattie) mill wkr At- O o a iiC0nnO5 u H J 2 o M35 U j Crimmins Jerry usher rll8 Summit av (NH) Cr(iNmHm)ins Ned student rll8 Summit av Crimmins Sign Co (Timothy E Crim- mins) 469% 2d Crimmins Timothy E (Martha Y: CrimCnmpiensFSreigdnk C(oT)hhelim18a)Sufmctmywit karv H(NaHpp) Bros Co hll9 School (SM) Crisp John K (Elsie H) jwlr Kemaghan- Goodman Inc h203 Ponce de Leon av (SM) Criswell Andrew F (Douita) plmbr 411 Cotton av h313 Forsyth Criswell Andrew F hlpr Andrew F Criswell r313 Forsyth Criswell Harold C (Edith) plmbr Andrew F Criswell r313 Forsyth Criswell Roy E (Estelle) carp h302 Dover (fi) Criswell Stella (wid Wm V) r302 Dover (B) lantic Cotton Mills h303 White (SM) Crosby Mary fety wkr Happ Bros Co r 915 New Crosby Otis T r915 New Crosby Troas D elk r915 New Cross Carrie mill wkr Bibb Mfg Co rl04 CrYosastesDoavrot(hEyM)Mrs elk r71 Cherry Cross Elnora (c) r515 Monroe Cross Geo D (Willie M) formn Bibb Mfg Co No 2 h716 Oglethorpe Cross Henry (c) porter rl07 Empire av Cross Henry C (Zella) mattressmkr Bibb Mattress Co hl04 Yates av (EM) Crho5s0s1JoFhonrsyJth(c; Marie) carrier USPO CrtKs Jos B (c) student rl07 Empire av Cross Katie (c) cook hl31 Franklin St la Cross Keith (Dorothy S) elk r871 Cherry Cross Rosie (c) cook hl07 Empire av (V) Cross Ruby mill wkr Bibb Mfg Co rl04 Ztu-1, nuo: W g tt geo I QQ2 oojs ar*s hj >w> ZO CJ Pres Macon Federal Sav & Loan Assn, Pres McKesson-Riley Drug Co, h334 (364) Cherokee av, Tel 4543 Crump Jos R student r334 (364) CheroCrkuemepaLveon C slsmn J K Chandler rl354 Edgewood av Orumplar J Cecil (Clarie N) elk rl38 Rembert av Crumpley Ruben F (May) pdlr h398 Belmont av Crumpton Evion (c) sta firemn r244 5th av (V) Crumpton Jas (Ethel) hll7 Ponce de Leon av (SM) Crumwell Hattie (c) maid r403 (819) Cedar (U) Cruse Elijah (c; Cynthia) brk mason h455 (468) Broad (EM) Crutchfield Anderson B (Crutchfield's Gash Grocery) r Clinton rd (EM) nr River rd CrMutacchofnielTdelCeaglrdaeprh Bhl6(3FraSnpcreinsgL)apctol4lr Crutchfield Jack E (Genevieve) metermn h307 Forsyth CrOutilchCfioeldr4J0a3s SRpri(nLgena) driver Power Crutchfield Lucius R (Alice) emp CofG Ry r Clinton rd (EM) nr River rd Crutchfield Ralph L (Alatha) collr City Water Wks Shop r617 Carling av Crru61tc8hfMielodntRpoelbiet rHav(Hilda) city firemn CrMCutr)cuhtcfnihreflideR'lsidv)CeragsehrndlGmrodcseeryC(liAnntodnersrodn (BE Crute W Frank (Hattie) fotttan Macon Evening News r RD 2 Bloomfield rd Crute W Frank jr (Marita) appr Macon Evening News rl220 Montpelier av Crymes Ernest C (Elmina) mgr Economy Auto Stores Inc r218 Georgia av Cubby Nancy (c) cook h721 Whitehead al Cubie Annie (c) lndrs h234% Woodcliff Culberson Georgia L fctywkr Happ Bros Co r202 Newberg (SM) Culberson Lizzie Mrs h202 Newberg (SM) Culbreath Anna K r201 Clisby pi (V) Cullen Irving (c; Annie) lab h354 Pine Cullen Juanita (c) student rll9 May Cullen L J Co The John J Story mgr farms 409 2d R418 Cullen Mamie (c) rll9 May Cullen Oscar (c; Mamie L) janitor hll9 May Cullens Celia (c) maid h963 Pio Nono av" '(V) Cullens Christine (c) maid r963 Pio Nono av (V) Cullens LeRoy (Sibyl) driver hl37 Mag- nolia Cullens Mary (c) cook r963 Pio Nono av (V) Cullens Wm (c) carp h933 Woolfolk (EM) Culler Jas W (c) porter Charles Place rll4 Price (V) Culler Mary r705 Winton av Culler Mary (wid Jake) r703 Winton av Cullers Dallas (c; Stella) blrmkr CofG Ry h323 3d av (V) Cullinan Grace slswn Fairyland Dairy r279 College Cullins Johnie (c) r609 (102) Elliott (EM) Cullins Lee (c) driver r24 (18) Mulberry la Cullins Leila (c) h24 (18) Mulberry la Cullins Lennie (c) hl202 Woolfolk (EM) Cullins Ophelia (c) lndrs h609 (102) El- liott (EM) Cullins Willie janitor WPA Cullom Henry M (Lellie A) mgr Good- year Service Stores h264 Belvadier dr Cullom Henry M jr student r264 Bel- vadier dr Culp Elleanor (c) student r428 (460) Womack (EM) Culp Jos (c; Rosa) millwkr Bibb Mfg Co hl03% Elliott Culp Lfly (c) lndrs h428 ( 460) Womack (EM) Culpepper Annie L (c) r247 Woodcliff Culpepper Chas D (Hessie M) electn h Cu1l9p1e7pp3edr Clara hl25 Stonewall pi (V) Culpepper Frances J sten Natl Handle CuClopepr9p0e7r F2rdank W elk Davis Ins Agcy rl06 Euclid av Culpepper Howard slsmn Stansell Potato Chip & Sandwich Co r907 2d Culpepper J W Edw (Nellie) cabtmkr Builders Lbr Co h414 Clinton (EM) Culpepper John C (c; Donie) draymn h 512 E 2d (EM) Culpepper John W (Gertrude S) mech r 126 Cole Culpepper Julia (wid John A) h907 2d Culpepper Lena (c) maid h247 Woodcliff Culpepper Louise opr SBT&TCo r871 Orange Culpepper Mary (c) lndrs hl43 Middle (V) Culpepper Milton elk Merritt Andrews rlll7 Ash Culpepper Minnie (wid Sami E) h871 Orange Culpepper Robt (c; Sadie) lab hl34 Woodcliff CuTloppelprcpnetir Sami (c; Ruby) lab h321 Culpepper Thos D rlll7 Ash Culpepper Thos W (Sadie C) eng City Water Wks h2428 (2480) 2d Culpepper Wm J (Lucille ) driver hlll7 Ash Culver Carrie (c) lndrs h512 (110) El- liott (EM) Culver Chas (c; Willie) h214 Fargason (V) Snow's Laundry and Dry Gleaning Go. Licensed "Santa" Gleaner Phone 6000 104 AUTHORIZED DEALER PRINTING BINDING R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L, Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Culver Eula tchr rl62 Magnolia Culver Mabel sten Phoenix Mutual Life Ins Co rl62 Magnolia Culverhouse B W (Eula) fctywkr hl05 Heard (SM) Culverhouse Geo M (Georgia M) h33 Cunningham John A (Eliz S) adv mgr rl415 Edgewood av Cunningham L Ernest (Dorothy M) swtchmn h890 Hemlock Cunningham Leola (c) cook h420 North Marion pi (WH) Culverhouse Minnie D fctywkr Happ CuBmrobsus CEo rnr7e6s3t l2adb r354 Fairview av (EM) Cumbus Louise millwkr Happ Bros r354 Fairview av (EM) Cumbus Mary C Mrs r204 Spring Cumbus Mary L millwkr Bibb Mfg Co r354 Fairview av (EM) Cummings Alf (Nora) driver rl432 2d Cmnmings Alice (c) hll4 (14) Wise av Cunningham Rebecca (wid Joel A) h608 Plum Cunningham Stewart O (Virginia) agt Shell Petroleum Corp (office) h93 Osborne pi Cureton Chas H (Patricia) auditor and asst treas Georgia Peach Growers Exchange hllO Lamar (V) Curl Lillian W (Mildred) pntr hill Grady (SM) Curley Top Beauty Shop (Mrs Vera Ellington, Mrs Fannie D Penn) 605 Cummings Andrew (c; Ethel) porter R S Thorpe & Sons h600 (251) Hall (EM) Cummings Aretha (c) maid rl25 (124) Orchard av Cummings Arth (c; Lula) detain Kinnett-Odom Co h321 Division (T) CCuummmmiinnggss ^BCehsassie M(c; (cE)lizm) aipdorr8te5r9 h3ld59 .Hill Cummings Chauncey (c) student r815 CuOmcmmiunlggseeDennis (c) porter r349 Middle Cherry Currie Brainerd (Elmyr P) instr Mercer Univ h507 Adams Currie G Ernest (Lucille) student hll34 College Currie Lillie B (c) r204 Industrial Home rd uurrie unman d (Recie M) lab hl09 CuErnriteerWprmiseS (pShMar)m Nipper's Pharmacy r656 Pine Currier Mary E (wid Frank E) r202 VlStSi PlT Cummings Dorsey (c; Lily) porter Corbin Supply Co h502 (507) Edison (EM) Cummings Drunell Mrs emp Snow's Lndry & Dry Clng Co r211 (431) Alabama (SM) Cummings Ernest (c) lab r7 StPaul Cummings Grady (c) lab r211 (431) Alabama (SM) Cummings Henry (c; Agnes) lab h211 (431) Alabama (SM) Cummings Jas (c; Grace) pdlr h807 El- bert (SM) Cummings Jas W (c; Alma) lab hl06 5th av (U) CuBmibmbinMgsfgJoChon r3(c3;7 TMhaeplmlea) millwkr Cmnnnngs John M (May D) millwright CofGRy h622 Carling av Cummings Lennie E Mrs elk J S Wal- dorf & Son r620 pine Cmgenemings Lizzie (c) Indrs h815 Ocmul- Curry Albert (c) r369 North (V) Curry Alice (c) h419 Hazel Curry Andrew (c; Annie) lab Taylor Iron Wks & Sup Co hi 13 3d av (U) Curry Annie B student r821 (745) Fort Hill (EM) Curry Beatrice maid Mercer Univ r925 Ash Curry Beulah '(c) hl69 Glen (EM) Curry Carrie (c) hl22 N Tatnall la Curry Ella L Mrs h656 Pine Curry Geo (c) rl69 Glen (EM) Curry Henrietta (c) maid rll9 (24) Mag- nolia la CURRY JAMES A (Joyce), Asst Mgr Finance Service of Macon Inc, r644 Forsyth, Tel 5996-W Curry John L pntr D H Adams Motor Co r656 Pine Curry Jos (c) delmn Wilson's rlOl MagCunrorlyia Klaate M rl424 3d Curry Lee (c) janitor rl69 Glen (EM) Cummings Lois fctywkr r416 Elm Curry Lillian Mrs waiter Wisteria Cafe Cummings Louise (c) student rl59 Hill rl713 2d Cummings Mary T (c) rl59 Hill Curry Lillie B (c) rl03 Morris Cummings Mattie (c) cook Kitchen's Curry Lizzie (c) Indrs hi 19 (24) Mag- Kitchen r62 New Noli'a lia Cummings Molly (c) cook r rear 723 Curry Lonnie (c; Beatrice) lab h925 Ash Broadway Curry Lucile r256 (56) Maynard (EM) Cummings Robt (c) lab r211 (431) Ala- Curry Odilla (c) Indrs r225 Neal av (V) bama (SM) Curry Pies (c) rl69 Glen (EM) Cummings Rosa (c) maid h225 Carters Curry Rosalie (c) maid rll'5 (298) Craft al Cummings Thos (c; Hattie) lab hll9 3d av (U) Cummings Wm (c; Esther) lab h408 (334) Anthony (U) Cummings Wm (c; Ethel) lab hl60 Birch (U) Cunningham A Eug (Bessie M) carp Willingham Sash & Door Co (plant) h 125 Fort Hill (EM) Cunningham Annie (c) maid r24 Moore al Cunningham C Clifford (Lila) elk County Comnrs h761 Pine Cunningham Celeste sten Dr James A Fountain hI505 3d Cunningham Claude S slsmn r375 College Cunningham Colbert A (Frances) lawyer 362% 2d r277 College Cunningham Grace H cash Darling Shop r855 Mulberry apt 404 Cunningham Ida (c) r239 Jefferson Cunningham Joel A student r608 Plum Curry Scott C Rev (c; Laura) h74 (139) Forest av (V) Curry Sidney (c; Cornelia) lab h336 Boardman's al Curry Taylor (c) rl38 (174) Roye (CH) Curry Thos (c; Minnie) r819 (844) Fort Hill (EM) Curry Thos J (Kathleen) supvr r290 Cherry av Curry Tommie (c) lab rl69 Glen (EM) Curry Walter (c; Beadie) hl08 (7) Jor- dan (EM) Curry Wm (c; Ida L) plstr hlpr hlO Sparks al Curtis Albert (c; Ruby) lab h856 Hazel Curtis Anna (c) cook h518 Monroe Curtis Benjamin (c; Hattie) lab h451 Collinsville la Curtis Bessie (c) h340 Madison CuHratiUs C(oErMrin) e F (c) tchr PS r502 (460) Curtis Ella (c) h502 (460) Hall (EM) Curtis Fannie P (c) maid r295 2d av (V) 105 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Curtis Fredk L pntr r215 Chappell (SM) Curtis Geo (c) lab CofGaRy r340 Madi- son Curtis Gladys (c) waiter Nettie Curtis r 108 Concord (SM) Curtis Gussie (c) maid rll4 (341) Rock av Curtis Hugh (c; Eliz) lab Bibb Mfg Co h400 (403) Maynard (EM) Curtis Jas (c; Josephine) janitor Postal Tel-Cable Co h2 Bartlett av Curtis Jas lab r411 Jackson Curtis John (Letha) h225 Applewood (EM) Curtis Josephine (c) maid r2 Bartlett Curtis Lawson (c; Lizzie) h701 (224) Hall (EM) Cur2rtisMLuelebecrorayl delmn Kinnett-Odom Co Curtis Lewis (c; Gladys) lab rl08 Con- cord (SM) Curtis Mamie (c) maid hl021 Ocmulgee Cugreteis Morris (c; lone) lab h211 OcmulCuhrtidsoNettie (c) restr 701 Elbert (SM) Curtis Olevia (c) maid r531 Calhoun Curtis Otis (c; Gussie) rl070 (1071) Coleman's la Curtis Pearlie (c) maid r518 Monroe Curtis Rebecca (c) lndrs hl33 Moccasin Daly Christopher B benc'hmn Willing- ham Sash & Door Co (plant) 151 2d Daly Edwina (wid Christopher B) h 23571/2 2d Daly F X Co (Frances X Daly) plmbrs 613 Poplar Daly Frances X (Lucile G; F X Daly Co) hl04 Boulevard (NH) Daly Jane (wid Ignatius) r771 Hemlock Daly Jos K (Leta) acet 617 Mulberry R311 and corres Interstate Bond Co rl23 2d Daly Lena (c) hl08 Elm Daly Rose r2357% 2d Dame Aubrey J (Gladys L) dept mgr R A McCord Motor Co r RD 2 Dame Lucile smstrs rl30 (126) Grady (SM) Dame Mildred student r RD 2 Dame Reva B (Gertrude) pres Macon DaMmiellinSgamCi o!J r Shirley (Hulit R) Hills driver Yellow Cab Trans & Baggage Co hl04 High- land av (LCHts) Dame T J elk r569 Broadway Damour Edw A (Mozelle) real est r202 High Damour Hypolite real est 421 Walnut h do Damour Laura S (wid Chas E) h202 High Slide Damour Paul real est 421 Walnut r do Curtis Sylvia (c) rl09 Harris la Curtis Thelma student r225 Applewood DDaannddiiee DFariasnykwaJite(rc;F AWnnWieo)ollwaborthh8C11o (EM) Curtis Thos (c) lab h202 (100) Kitchens Curtis Wm (c; Letha) fctywkr hl4 (750) Steins al Curtis Wm (c; Eliz) lab r422 Lawton av Daisy (SM) Dandie J John (c) barber John W Peeks r811 Daisy (SM) DaKnidtychenFarn8n5i8e W(icl)lowcook Kitchen's Curtis Wm (c) porter W L Cone Auto Danforth Josephine (c) lndrs h626 Co rl85 (562) North av (NH) Gresham la Curtis Wm A r225 Applewood (EM) Danforth Metta T (c) prin Green St Sch Curtis Wm N rl02Q Oglethorpe Curtis Wm N (Jane) elk hll9 Ayers rd Cusson Charlotte private sec Dr O H Weaver r87 Arlington pi Cusson Eliz tchr PS r87 Arlington pi Cusson Julia r87 Arlington pi Cusson Julia (wid Larkin G) h87 Ar- lington pi Cutler Gaynor bellmn Hotel Southland Cutler Jack (Louise C) agt The Texas Co r Forsyth rd (High Haven) Cutro Antonio h617 Arch Cutter Howard D (Callie) surveyor Bibb County hl29 Summit av (NH) Cutter Mary sten r220 1st r205 College Danforth Remus J (c; Metta T) h205 College Daniel Annie (c) h227 (439) Alabama (SM) Daniel Annie C (c) maid r227 (439) Ala- bama (SM) Daniel Betty J student r2412 Forsyth rd Daniel Billie r744 Walnut Daniel Bluford N (Margt) h910 Log Cabin blvd , , Daniel Bluford N jr student r910 Log Cabin blvd Daniel Clarence (c) porter American Cutter Wm H h519 Ridge av (V) Bakeries Co r229 Roosevelt (V) Cu(tVte) r Wm H jr student r519 Ridge av Daniel David (c) lab r206 Woodcliff Daniel Elijah (c) porter DuPree Barber Cutts Margt (c) maid rll5 May av (U) Cutts Wm student rl03 Lawton av Cutwright David (c; Mamie) driver h 1023 Edgewood av Cuyler Abraham (c) lab r501 Moore av Shop r407 Peachtree (EM) Daniel Eliz r761 Hillyer av (CH) Daniel Emma (c) maid hlOl Woodcliff Daniel Emory A (Lucia M) elk USPO h41 Marion pi (WH) Cuyler Martha (c) maid r'501 Moore av Daniel Frances (c) rllO Roberts (U) Cuyler Rebecca (c) h501 Moore av Daniel Frank (c) lab CofGaRy Cuyler Roosevelt (c) r501 Moore av Daniel Fred M (Mary) bkpr h906 Napier Cuyler Rozella (c) maid r501 Moore av Daniel J Frank (Emma) millwkr Bibb Dago Elnora (c) h204 Lynwood av (V) Mfg Co h'124 (50) Hydrolia (EM) Daily J Harvey Rev (Selena T) hl32 Daniel J J slsmn L B Price Mercantile Gordon (SM) Co rl57 1st Daley Adelle (wid F J M) r570 College Daniel J Walter (Bessie M) prof Wes- Daley Christopher (Helen) mach rl51 leyan College h2412 Forsyth rd 2d Daniel Jas (c) lab hl43 Auburn av (S) Daley Jas J (Murray) bkpr h385 Orange Daniel Jas (c) lab Bibb Mfg Co r407 Dallas Laura (c) maid Empire Furn Co Peachtree (EM) rl020 Ocmulgee Daniel Jas (c; Linnette) lab rl50 (226) Da(lSlaMs)Lucy (c) r502 (712) Campbell av Roye (CH) Daniel Janie (c) lndrs ,, rl32 _ . Davis (UT) Dallias Moneta (c) tchr Hazel Street Sch Daniel Jesse M (Ruth) elk r91 Lawton rl68 2d av (V) Daniel John (c; Carrie) lab r201 Roberts Dallias Vernell (c) sten rl68 2d av (V) OJ) Dalton Anice Z (wid Chas T) millwkr Daniel Jos W (Bonnylin M) mgr Ga DaBlitbobn MPfagulCor3h13818(3(6306)0) CCeennteterr ((EEMM)) S(CtaHte) Farmers Market h761 Hillyer av 8 Daly Augustin lawyer 566 Mulberry hl40 Curry dr Daniel Jos W jr student r761 Hillyer av (CH) SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY D 1 R E C T O R Y MIRRORS the SOCIAL Of Your CITY 106 MORE GOODS -aresought -AMDsold THROUGH THE Classified Business Directory than by Any Other Medium on Earth YATES MOTOR CO. M* 707 THIRD ST. PHONES 1 \\% PlyiHOllth Daniel Juanita millwkr Bibb Mfg Co r604 Main (EM) Daniel Judson J (Margt) slsmn rl64 1st Daniel Lillie (c) student rl38 2d av (V) Daniel Louise (c) cook h271 North (V) Daniel Maggie (c) maid rl37 (139) 4th av Daniel Margt Mrs slswn W T Grant Co h910 Log Cabin blvd Daniel Mary (c) lndrs r238 Middle (V) Daniel Mildred sten rl31 Rose pk Daniel Milledge (c) lab hl04 Woodcliff DDaanniieell OMrimnnaine p(hc)ys h420l59 2PdowRe5ll12(Er5M3)3 Orange apt 18 Daniel R G (Louise) civ eng State Hwy Board Div No 2 hl202 Ridge av Daniel Robt (c) rlOO Blount Daniel Rosa (c) lndrs h205 Wood al Daniel Rufus (c) r407 Peachtree (EM) Daniel Stella E tchr Whittle Sch rl03 Academy Daniel Thos W (c) student rll5 4th av Daniel Tillie K musician h855 Mulberry apt 401 Daniel Wallace millwright Willingham Sash & Door Co (plant) r568 1st Daniel Walter (c) student rlOO Blount Daniel Walter E (c; Annie M) hlOO Blount Daniel Warren (c) rl09 Harris la Daniel Wm (c) janitor r247 5th av (V) Daniel Wm (c; Doris) lab Natl Handle Co h810 Ash Daniel Wm (c) lab r962 Pio Nono av (V) DaCnoielhW40m7 (Pce;aSchartraehe) m(EilMlw)kr Bibb Mfg Daniel Wm (c) porter Kaybee Store r227 (439) Alabama (SM) Daniel Wm L (Marie K; Union Tailor- ing Co) hf>59 Hemlock Danielly Emma (c) hll6 (778) Nussbaum (SM) Danielly Thos J (c) lab rll6 (778) Nuss- baum (SM) Danielly Wiley (c) lab CofGaRy Daniels Adeline (c) r520 Monroe Daniels Alice r319 Clinton (EM) Daniels Allie M (c) maid r414 (222) . Elizabeth (SM) Daniels Annie (c) hll3 (451) Johnsons al Daniels Arth (c; Desteen) cook r513 Hazel Datoninels Danl (c; Willie) lab r Coy BurDaniels David (c) lab r414 (222) Eliza- beth (SM) Daniels Ella M (c) lndrs r515 Smith row Daniels Emmett millwkr Bibb Mfg Co rl05 (261) Clinton (EM) Daniels Ernestine (c) maid rl67 (168) Tellfair Daniels Eunice (c) maid rl06 Woolfolk (EM) Daniels Floyd (c) delmn Mrs Beulah M Poppell r212 Church al (SM) Daniels Frank (c; Hattie) lab h597 Cen- ter (EM) Daniels Geo (c) lab h207 Wood al Daniels Henry (c; Bertha L) porter Ry Exp Agcy h414 Peachtree (EM) Daniels Isabeth (c) maid r349 Middle (V) Daniels John (q; Nellie) h427 Chestnut Daniels Lillian waiter Duke M Roberts r 759 Poplar Daniels Lula B (c) h759 Murray al Daniels Mattie (c) lndrs h518 Ross Daniels Nelson A (c; Willie) porter hl46 (198) Washington (EM) Daniels Retha (c) lndrs h56 Cheatham al Daniels Robt W (c) porter Watkins Barber Shop r857 (858) 3d Daniels Sami (c) lab r427 Chestnut Daniels Sarah (c) h317 Harris la Daniels Simon (c; Rachel) h349 Middle (V) Daniels Sylvia (c) cook r206 Madison Daniels Walter (c; Fredonia) lab Taylor Iron Wks & Sup Co hl67 Telfair Daniely Arth J (c; Nora) millwkr Bibb Mfg Co h511 (510) 3d av (V) Danley Annie (c) rlOl Tindall av (SM) Danley Jas (c; Josephine) elk Clyde F McCook h367 North (V) DAneNnNbEerNgBPErReGs, CJoOs TWHED, WananletnerbFergDa1ns-t V-Pres, Herbert S Greenwald 2d VPres, John E McBride Sec-Treas, 462470 3d, Tel 6400 (For further information see page 12 Buyers' Guide) DAPrNeNs ETNhBeEDRaGnnJeOnSbeWrg (CCol,arrli5c0eO), 1VsitnVe-ville av DANNENBERG WALTER F (Lillie), Pres The Dannenberg Co, r401 College, Apt 2A and 2B Damnngernb46e2rg'3sdCafeteria Mrs May Hays Dansby Smith (Jane) millwkr Bibb Mfg Co h355 Central av (SM) Da&nthDervy CColrninge CMors re4m53p S(4n5o0w) 'sMLanrdthrya (EM) Darbey Wm H formn Bibb Mfg Co r865 Orange Darby Carrie (c) r210 Industrial Home rd Darby Cullen lab Barfield Feed Mills r 921 Ocmulgee Darby Harry H (Annie C) h527 Linden Darby Hattie A (c) cook r571 Monroe Darby Idonia (c) h210 Industrial Home rd Darby John H (Jeanette W) slsmn Co- operative Fire Ins Co r523 Linden av Darby John J (Alma C) slsmn hl27 Clisby pi (V) Darby Lillian (c) r210 Industrial Home rd Darden Carrie (c) r458 Bay Darden Jethro A (Juanita) store mgr The Great A & P Tea Co hl02 Clay av (NH) Darden Lucy (c) maid rll5 4th av (V) Darden Robt J (Smytha M) loco eng h453 Carling av Dare Annie M (wid Jos) rl707 2d Darity Chapman C slsmn r750 2d Darity Elma (wid Carlton C) h750 2d Darity Emmett (Luella S) millwkr Bibb Mfg Co rlOl Capitol av Darity Freeman A (Irma L) gro 1021 Hazel h do Darity Lavert opr Ethel B Davis Beauty Shop r750 2d Darity Luella Mrs fctywkr rlOl Capitol Darity Thos rl021 Hazel Darity Wm delmn r750 2d Darley Chas T millwkr Willingham Cotton Mills r203 (3) Dannenberg av Darley Doshia (wid Sidney O) h203 (3) Dannenberg av Darling Shop Mrs Gladys Reynolds mgr women's clothing 552 Cherry Darsey Earl P slsmn r315 Mulberry Darsey S Elliott (Edyth) hlpr Ga Power Co hl42 (107) Parkwood av Dasher Arth L bkpr Empire Dixie Coal Co r644 Forsyth Dasher Benj J jr (Dasher Electric Co) r290 College Dasher Campbell K (Dasher Electric Co) r290 College Dasher Electric Co (Benj j jr and Campbell K Dasher) radios 312 3d Dasher J M Lumber Co (John M Dasher) whol Poplar nr 10th Dasher John M (Byrdie; J M Dasher Lumber Co) h371 Orange Dasher Lois E student r<544 Forsyth Dasher Odille K (wid Benj J) r290 College 107 WILLINGHAM SASH & DOOR CO. Lime -- Roofing -- Cement 457 Third St. Plaster Phones 277-278-279 Dashier Keifer bkpr r768 Cherry Daughters of America JOTJAM meets 1st Daaungdhte3rdy TJuoehsndaOys (M8 apry)mfo5r1m5 n2hd601 Carman Daughtery pi Robt R (Prances C) ,, elk rl,l,On Napier av Daughtry Curtis student rl42 Magnolia Daughtry Geo student r662 College Daughtry Geo W tnach CofGaRy Daughtry Reedy W (Eddie) asst mgr Right Way Finance Co h305 Center Da(vEeMnp) ort Mary (c) cook r611 (21, 1)v Edison (EM) Davenport Mildred sten Ga Power Co r 119 Corbin av (V) Davenport Otis (c; Della) lab h443 (433) Peters al (EM) Davenport Pierce mgr r533 Orange apt 2 Davenport Ralph L (Marie K; Ideal SCtaobriangeav& Garage) hl28 (120) Log Davenport T Fred (Margt C) emp CofGa DaRvyenhp4o5rt0 WWmasHhin(gLteonna) aevmp CofGaRy h533 Orange apt 21 DAVENPORT WM H JR (Laura K), Mgr Community Savings & Loan Co, h401 CoUege, Apt 5F, Tel 3125 David Jessie (c) cook rl06 Key (U) Davidson see also Davison Davidson Addie V (wid John T) h410 DaHviindessonteArlu(rVa )bkpr Dannenberg Co r 901 Cherry Davidson Arth D (Rosa) rodmn r551 DaMviadisnon(EGMeo) D (Mattie) millwkr hl823 Da3vdidson Geo F roofer rl28 Violet av (S M) Davidson Henry C (Pearl) hl28 Violet av (SM) Davidson Isaac L (Nina) car repr hl812 Da3vdidson John W r5 Randolph pi Davidson Laura (c) cook r931 Montpelier Davidson Lon D (Lucille) lab hl062 Og- lethorpe Davidson Lottie O (wid John W) hl55 Hendley (NHts) Davidson M L Electric Co (Murrell L Davidson) 474 Cotton av Davidson Mary H student r305 Hendley (NHts) Davidson Murrell L (Maggie; M L Da- vidson Elec Co) r Columbus rd Davidson Paul C (Geneva B) loco eng h305 Hendley (NHts) Davidson R Ernest (Emma L) millwkr r5 Randolph pi Davidson R L slsmn Central City Bag Co r Bloomfield rd Davidson Robt O (Beulah L) roofer hl22 Violet av (SM) Davidson Roy I (Verna M) lab rl22 Vi- olet av (SM) Davidson Sophie (wid Elias) r220 Cal- houn Davidson Wm lab rl28 Violet av (SM) Davidson Wm C (c; Wyline) porter r312 Cedar (U) Davidson Wm E (Maud) h311 Forest Hill av Davidson Wm E jr (Polly) probation of- ficer Bibb County r311 Forest Hill av Davidson Willie C student rl823 3d Dainvigs Aav Jos (Annie W) elk h606 Carl- Davis A Minzer (c) plmbr h220 Jones Davis Ada (wid John W) hll5 Madden Davis Albert (c) rll8 Tindall av (SM) DaBvliosunAtlbert (c; Ellen) farmer r309 Davis Albert (c) lab rllO May av (U) Davis Albert (c; Annie) lab h406 (505) Prince (SM) Davis Alex (c; Belle) pntr h30O Middle (V) Davis Alma opr SBT&TCo r760 Cherry Davis Amanda (c) lndrs hl50 Moore al Davis Ambrose (c; Ethel) hlpr CofGRy rl52 Madison Davis Amy (c) maid r221 Carters al Davis Andrew (c) lab h235 Riley av Davis Anita tchr Whittle Sch r RD 4 Davis Anna (c) h20'6 E E31 Davis Anna C asst mgr r3905 Houston av Dafis^Anna S tchr Whittle Sch r288 Orange _ Davis Annie (c) lndrs r235 Riley av Davis Annie (c) lndrs r48 Schofield (V) Davis Annie B fety wkr r312 Peachtree (EM) Da9v6i8s APniothoNnoyno(c;aMv a(rVie)) lab CofGRy h Davis Arbie (Mary) lab Central Sash & Door Co rl28 (112) Colquitt (SM) Davis Arth L (c; Alice) lab hl54 (229) Roye (CH) Davis Asa C (c; Elma) lab h220 Cedar (U) Davis Aurie S (wid E McCall) h288 Orange Davis Beatrice (c) maid rl09 E Ell Davis Benj (c; Lena) h462 Hazel Davis Benj F jr (Una) slsmn rll07 Montpelier av Davis Benj M (Carrie) slsmn hl413 2d Davis Bernice elk r440 New Davis Bernice Mrs (The Davis Studio) r 533 Orange apt 23 Davis Bertha M (c )r327 (417) Bright la Davis Bertha M (c) r206 E Ell DabvaiusmBes(sSiMe )(c) maid rl39 (159) Nuss- Davis Bethonia (c) lndrs h720 (218) Whitehead al Davis Blanche (c) cook rl33 Jones Davis Bright (c; Annie) hlpr CofGRy h 110 (172) Bartlett Davis Bristol R (c; Lizzie) lab h rear 109 Walls al (NH) Davis C O hlpr Ga Power Co Davis Calvin (c) millwkr Bibb Mfg Co r 890 Taylor (EM) Davis Carey L (Annie L) h501 Duncan Davis Carl J (Ruby) dept mgr Happ. Bros Co h91 Osborne pi Davis Cary M (c; Lorena) plstr hl060 Pio Nono av (V) Davis Oath rll Randolph pi Davis Chaney (c) h202 (100) Kitchens Davis Chas (c; Lena) lab rl335 Broad- way DaCvhiseCsthnaust (c; Lucille) lab CofGRy h207 Davis Chas (c) lab hll8 (37) Craft (V) Davis Chas (c) lab r222 Lynwood av (V) Davis Chas (c; Mackie) lab hll2 (555) Magnolia la Davis Chas (c; Alma) lab h217 (325) Turpin (T) Davis Chas plant mgr Macon Three- Centa Bottling Co 114 EM (SM) Davis Chas (c) porter Glass Pharmacy Davis Chas (c; Rebecca) porter hl2 Sparks al Davis Chas jr (c) student rl335 Broad- way Davis Chas H (M Odessa) cash N W Mut Life Ins Co h510 Courtland av Davis Chas H jr student r510 Courtland Davis Chas S (c) lab r314 Green Davis Chas W driver rll4 Ell (SM) Davis Chester (c) lab Bibb Mfg Co rl64 5th Davis Clarence (c) r708 (588) Maynard (EM) Davis Clarence (c; Nettie L) washer Crescent Lndry Co h730 (640) Prince (SM) Davis Clarence O auto mech r318 New DaRv.Ti7s ClarkeAAmp(rMirialrdireKdlvCH) mach CofG Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 108 1$ Answered By the Classified Business Lists in this Directory FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature DaMvi)s Claudia (c) maid rl242 Broad (E Davis Cleo (c) h210 E Ell Davis Collos R (Lillian E) mgr All States Life Ins Co h265 Bond Davis D Plumbing & Heating (Durward Davis) 25 Wall Davis Daisy (c) h414 Lawton av Dasvoins Danl (c; Sarah) chauf h380 MadiDavis Danl H (Eugenia S) slsmn Sears Roebuck & Co hll8 Beverly pi Davis David (c; Mary) hlpr City Water Wks h502 E Academy (EM) Davis Delmer millwkr Bibb Mfg Co r252 Jeff Davis (SM) Davis Dewey r359 New Davis Dewey H (Beulah) millwkr Bibb Mfg Co hl9 Bibb av Davis Dinah (c) h6 Bay al Davis Dora (c) Indrs r604 Ross Davis Dorothy tchr PS r208 Vineville av (V) Davis Durward (D Davis Plmbg & Heat- ing) r715 Pine Davis E Clifford (Lucille) gro 2904 For- syth rd hl21 (33) Park (L) Davis Eugenia S Mrs hostess Hotel Dempsey Tavern hll8 Beverly pi Davis Eula (c) cook rill (110) 1st av (U) Davis Eva (c) r300 Middle (V) Davis Evelyn r359 New Davis Evelyn (c) maid r594 Fort Hill (E M) DAVIS F CLARK (Clara S; Rex Optical Co), Physician 504 Mulberry, Tel 2700, hll2 Rogers av (V) Davis Falola (c; Geraldine) lab hl36 (214) Clark (EM) Davis Fannie (c) r604 (111) Colquitt Davis Fannie (c) h318 Greene Davis Fannie (c) rl04 (6) Toombs (SM) Davis Fannie (c) Indrs hl23 Sycamore (V) Davis Fannie B (c) prsr hl61 Elbert (S M) Davis Felton student rl07 (101) Hydrolia (EM) Davis Fleming (Loris) millwkr h6 Ford la Davis Florence elk WPA r Columbus rd Davis Florine B Mrs hl40 High Davis Frances A student r606 Carling av Davis Eddie M Mrs smstrs r2166 2d Davis Eddie R rl21 Park (I) DaDvrisugEdSittohreW rM86r7s eMlkulSbteervrey M Wright Davis Frank (c) r206 (113) Gibson av (S M) Davis Frank A (Alace) slsmn hl298 Ridge av Davis Edw rl08 Patterson (NHts) Davis Fred plmbr h300 Mikado av (S Davis Edw (c; Sallie) carp h890 Taylor M) (EM) Davis Geo (c; Maggie) janitor Vineville Davis Edw (c) lab rl09 4th av (V) Baptist Church h711 (708) 3d av (V) Davis Edw (c; Daisy) lab h949 Pio Nono av (V) Davis Geo (c) lab hlO Opera House al Davis Geo (Mary) millwkr Bibb Mfg Co Davis Edw jr (c) r890 Taylor (EM) hi 041 1st Davis Edw student rl07 (101) Hydrolia (EM) Davis Edw L (Sidney) lab hl07 (101) Hydrolia (EM) Davis Edw R (Marie H) adjuster Fire Co's Adjustment Bureau hi 15 Tyrone blvd Davis Edwin S dist agt John Hancock Mutual Life Ins Co r271 Boulevard (N H) Davis Edwin S jr (Etheldra) acct h271 Boulevard (NH) Davis Effie (c) h221 Gantt pi Davis Eleanor tchr PS r RD 4 Davis Elijah (c; Lizzie) barber rl'252 2d Davis Eliz (wid Lawrence F) r720 San Juan av Davis Ella (c) Indrs r360 Campbell av (S M) Davis Ella (c) Indrs rl200 3d Davis Ella M millwkr Bibb Mfg Co rl041 1st Davis Ellis (c; Margt) lab hl74 (341) Plummers al Davis Geo student r905 Cherry Davis Geo W carp Packer Adv Corp r801 Clinton (EM) Davis Georgia (c) Indrs h314 Green Davis Georgia M (c) maid rlOl Mutual av (V) Davis Gertrude (c) r227 Chestnut Davis Gertrude (c) Indrs hill New Davis Giles (c; Emma) carp h207 3d av (U) Davis Gladine student rl7 Hill Park av Davis Grace r224 (300) Reid (SM) Davis Gus (c; Emily) lab r201 (362) Craft (V) Davis Gussie (c) h804 Fort Hill (EM) Davis Gussie (c) cook rll6 (10) Frank al Davis Gussie (c) maid rllO May Davis H Roland (Lillie) mach h935 Beech av Davis Harrold D (Leila) bartndr h4'12 Chappell (SM) Davis Harry (Dora) filling sta Forsyth rd h do Davis Ellis (c; Malissa) lab hl64 (604) May av (U) Davis Elmer (c; Annie) lab r249 Morgan av (WH) Davis Elnora (c) r525 Plant al Davis Emanuel (c; Dora) lab h415 For- est av (V) Davis Emma (c) r607 Telfair Davis Emma (c) Indrs h220 Mitchell la (V) Davis Emma (c) Indrs hl43 Moore al Davis Era Mrs cash r805 Pine Davis Estelle (c) cook hl056 Hazel Davis Ethel (c) cook hllO Elklon pi (S M) Davis Ethel A (wid Gardner L) h401 Na- pier av Davis Ethel B Beauty Culture School (Mrs Ethel B Davis) 514 Mulberry Davis Ethel B Beauty Shop (Mrs Ethel !B Davis) 514 Mulberry Davis Ethel B Mrs (Ethel B Davis Beauty Shop) r514 Mulberry Davis Etoy (c) maid h330 Madison Daavvis (ESuMg) (c; Lula) h309 (306) Tindall Davis Eug (c; Lottie) lab h214 Gilmer Davis Harry (c; Lula) lab hll5 (7) O'Neals al (EM) Davis Harry L wtchmn CofGRy Davis Hattie (c) cook h!32 Jones Davis Hattie (c) Indrs hlOO Mutual av (V) Davis Hazel r256 Washington av Davis Helen P student rl08 Stonewall pi (V) Davis Henry (c) firemn rl435 Broadway Davis Henry (c) lab h28 (121%) Malloy's al Davis Henry (c; May E) lab h57 North la Davis Henry H Rev (c) pastor Bethel C M E Church h314 Patterson (NHts) Davis Herman (c; Martha) lab hl60 5th Davis Hester L (c) smstrs rl014 Elbert (SM) Davis Hollis (c; Belle) lab hllO May av Da(vUis) Howard student Ga Academy for the Blind r RD 3 Sylvania Davis Hubbard (c) clo prsr John T Bish- op r314 Green Davis Hugh (c; Vally) lab h208 (218) Neal av (V) 109 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS S69 MULBERRY STREET PHONES 946-947 Davis Hugh jr (c) lab r208 (218) Neal av (V) Davis Hugh R mach CofGRy Davis Ida (c) maid h313 Telfair Davis Ida M (c) maid r327 (417) Bright la Davis Ike (c) r861 Edgewood av Davis Insurance Agency (Jesse W Da- vis) 516 Mulberry R203 Davis J F slsmn Bankers Health & Life Ins Co r Shirley Hill Davis J Gilbert (Helen B) sten Met Life Ins Co r Jeffersonville rd DaMviuslbJeLrrayiFha2y0e8tteVi(nMevairlyleBa)v re(Val) est 557 Davis J T (c) r314 Elm Davis Jack (Rachel) millwkr Atlantic Cotton Mills h41 Atlantic Village Davis Jack (c; Leatha) porter hl09 4th av (V) DaCvoisalJaCcoobr2(4c0; GSaalrldye) ndr(iEvMer) Houston Davis Jas (Princess) carp h665 Ash Davis Jas (c) lab r202 (423) Plummers al Davis Jas (c; Leola) lab h583 (24) Siam (EM) Davis Jas (c) prsr Dixie Jobbing House Davis Jas student r803 Pine Davis Jas B (c; Doris) barber r819 OcDamviuslgJeaes B (Marie) elk Ethridge Bros r3905 Houston av (SM) Davis Jas G (c) porter Ry Exp Agcy h 922 Montpelier av Davis Jas I (Mary) agt Progressive Life Ins Co r467 Carling av Davis Jas M (Ophelia) carp Packer Adv Corp h801 Clinton (EM) Davis Jas R atndt Pilchers Service Sta r399 Belmont av Davis Jas R (M Artie) chf elk WPA rl21 Magnolia Davis Jas T Rev (c) h227 Chestnut Davis Jas W (Mary J) mgr Dixie Neon Shop h2213 (2137) Forsyth rd Davis Janie (c) lndrs h210 Turpin (T) Davis Janie (c) maid hl27 Ritchey (EM) Davis Jennie M (c) cook r509 (309) Hall (EM) Davis Jerry B (c) lab r300 Middle (V) Davis Jesse W (Merlyn; Davis Ins Agcy) h629 Forsyth Davis Jessie M beauty opr Robt S Free- man rl7 Hill Park av Davis John (c) r890 Taylor (EM) Davis John (c) cook r304 5th av (V) Davis John (c) emp CofGaRy hl05 For- est av (V) Davis John, millwkr Willingham Cotton Mill hll Randolph pi DaEvdisisoJnohn(EBM)(c; Sadie) lab hl07 (345) Davis John D (Lucille) auto repr 114 Whitehead (SM) h do Davis John D (Willie) driver h508 Church (EM) Davis John P (Mildred) farmer rl03 Troup Davis John R (Elsie F) lino opr Macon Evening News h689% College Davis John T (c; Ruth) lab h5l2 (513) DaCvriissp Jo(sSM(c)) delmn r428 Monroe Davis Jos fruits 306% 3d h do Davis Jos (c; Retha) lab rl64 5th Davis Jos B (c; Dorothy) barber Geo W Hatfield jr r819 Ocmulgee Davis Jos B (Bertha) millwkr h rear 102 tBrookdale av (B) Davis Jos T (Ethel B) dep sheriff Coun- ty Municipal Ct hlO'S Stonewall pi (V) DDaavviiss JJooss WW (N(Seutstiiee)) hf7o2r0mSnanr81J3uaMn aaivn (EM) Davis Josephine (c) r221 Carters al Davis Josephine (c) h280 1st av (V) Davis Josette (c) student r330 Madison DaMvi)s Julia (c) r525 Grant Chapel al (S Davis Julia (c) lndrs h206 (113) Gibson av (SM) Davis K D emp McKesson-Riley Div r RD 3 Davis Katie L (c) maid rl05 2d av (U) Davis L Melton elk Chapman's Pharma- cy r Skipperton Davis Lee (c) lab r718 (628) Prince (S M) Davis Lee (Nannie) sta atndt hl06 Ingle- side av Davis Leila M (c) maid r206 E Ell Davis Lemiriah (Addie B) janitor G Bernd Co r Berry (Bartletts cir) Davis Lemuel E nurse 401 Napier av r do Davis Lena (wid Robt L) h3905 Houston av (SM) Davis Lennie F student r419 Johnson av (HH) Davis Leonard (c; Susie M) sta atndt h 133 E Ell Davis Lessie maid Capitol Theatre Davis Lester (c; Minerva) oiler h417 (450) 3d av (V) Davis Lillian (c) maid r211 Green Davis Lillian Mrs fety wkr Happ Bros Co r203 New Davis Lilly (c) rl25 Forest av (V) Davis Lizzie (c) rll06 Pio Nono av (V) Davis Lizzie (c) lndrs hll5 May Davis Lizzie (c) maid h201 2d av (U) Davis Lonnie (c; Gussie M) h865 Edge- wood av Davis Lonnie (c) pntr h7 StPaul Davis Lonnie J (Helen) elk W U Tel Co h4l6 Mikado av Davis Lottie (c) lndrs r204 Green Davis Louise (c) rl09 E Ell Davis Louise (c) rll4 Reid (SM) Davis Louise student r201 Pierce av (V) Davis Love (c; Pauline) lab h306 1st av (V) Davis Lucile auditor hl03 Log Cabin way Davis Lucile mgr E Clifford Davis rl21 ' (33) Park DaMvi)s Lucile (c) student r!03 Smith (E Davis Lucile B (c) tchr hl05 (5) Or- chard av Davis Lucius (c; Martha) lab hl315 1st Davis Lucy (c) lndrs rl08 (131) Eliza- beth (SM) Davis Lula (c) cook r291 2d av (V) Davis Lula (c) maid r401 (708) Hender- son (SM) Davis M DuQuince business mgr J La Fayette Davis r208 Vineville av Da(vVis) Maggie B (c) maid r300 Middle Davis Margt (c) r320 Jackson Davis Margt student r416 Mikado av Davis Margt S tchr Kaigler's Business College rlOO Pursley (V) Davis Marie Mrs r3042 Houston av (SM) Davis Marie L rll Randolph pi Davis Marion S lab h322 Chappell (SM) Davis Mark D (c; Angeline) farmer h 1242 Broad (EM) Davis Marshall J (Willie M) slsmn Burns Boot Shoppe Inc h605 Orange apt 1 Davis Martha (c) r206 E Ell Davis Martha asst cash S H Kress & Co r905 Cherry Davis Martha (c) maid r313 Telfair Davis Martha A sten SBT&TCo r401 Na- pier av Davis Mary A (c) r241 Church la (SM) Davis Mary C asst supvr r629 Forsythe Davis Mary L (c) h320 Jackson Davis Mary L (c) h819 Ocmulgee Davis Mary L (c) lndrs h545 Mitchell (E M) Davis Mary V waiter Dannenberg Co rlOO 2d Davis Marylou (c) hl31 Ritchey (EM) Davis Mattie (c) rlOO (101) 2d av (U) MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory- Publishers Detroit, Mich. We make up Special Lists no Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Davis Mattie (c) maid rll5 (146) Hudson Davis Mattie E (c) maid r319 Green Davis Mattie S (c) maid h291 2d av (V) Davis Maude S Mrs smstrs Union Dry Gds Co h501 Carling av Davis Millie (c) smstrs r28Q 1st av (V) Davis Miriam (c) student r330 Madison Davis Mollie (c) r215 (327) Turpin (T) Davis Nancy (c) maid rll6 (49) Orchard Davis Nancy C (wid John) h905 Cherry Davis Naomi lndrs Crescent Lndry Co r 616 Telfair Davis Napoleon (c; Bernice) butler r201 Grant av (V) Davis Nell McK (wid Thos F) hl29 Na- pier av Davis O F Truck Line (Ollie F Davis) 858 Broadway Davis Obie (c; Eugenia) lab WPA Whse hl62 Sycamore (V) Davis Ola (wid Wm R) h35l9 New Davis Oliver (c) pdlr rll8 Tindall av Davis Ollie (c) lndrs rl72 (304) Roye (C Davis Ollie F (Mary; O F Davis Truck line) r RD 1 Davis Ollie F (Ethel) driver h203 Rocky Creek rd .... Davis Oren (Willie) lab hll40 Clinton rd (EM) Davis Oscar (c; Lillian) cook hl21 2d av (V) Davis Oscar (c; Janie) porter Maxwell Bros Furn Co hl015 Oglethorpe Davis Ossie (c) maid rl09 4th av (V) DaCvois PhlOAOlto2nd (Mary V) mach Bibb Mfg Davvisi,s-HPaosbssmonorLe RPoaosfsimngorCeo) (1W34m3 BWroDada-- way Darv3i1s4 PGaurel e(nc) emp Riverside Cemetery Davis Paul (c) student r708 (588) May- nard (EM) Davis Pauline (wid Wm) smstrs h318 Cleveland (SM) Davis Perry (c; Willie M) cook Ga Academy for the Blind h233 Morgan av (W H) Davis Porter (c; Hattie) lab r200 (305) Neal av (V) Da(vEisMP) rentice (c) sta atndt h508 E 2d Davis Preston M driver rl49 Magnolia Davis Putman (c) r300 Middle (V) Davis Putnam hlpr Macon Auto Exch DaBvoisarPdmutanna'ms a(lc; Leila) porter h355 Davis Rayfield (c) r300 Middle (V) Davis Raymond (Annie V) roofer hl08 Patterson (NHts) Davis Rebecca (c) r221 Carters al Davis Reubin G (Pauline) dist supt Rog- ers Stores h337 Adams Davis Reuben R (c) carp h213 Roosevelt av (V) Davis Richd M (Carrie L) hlOO Pursley (V) Davis Robt r207 Appleton av Davis Robt (c) r209 Lincoln av (V) DaCvliisntRoonbt(EcMar)p Packer Adv Corp r801 Davis Robt fum repr r689% College Davis Robt (c) lab r220 Mitchell la (V) Davis Robt (c; Annie) lab rl28 (241) Railroad av (V) Davis Robt (c; Sallie M) lab hll2 Ruby (V) Davis Robt (c; Susie) lab r526 E 2d (E M) Davis Robt B (c; Eva) lab hl53 Walker la Davis Robt J (Mary M) elk Heard Bros h613 Orange apt 2 Davis Robt T (c) student r511 (510) 2d av (V) Davis Rosa (c) h226 Gilmer Davis Rosa (c) cook r922 Montpelier av Davis Rosa (c) lndrs r813 (725) Dempsey av (U) Davis Roy sta atndt r399 Belmont av Davis Ruby (c) maid rllO May Davis Rufus (c) lab r205 Wood al Davis Sami (c; Janie) lab hl718 Demp- sey av (U) Davis Sami (c; Pearlie M) lab rl20 (706) Henderson (SM) Davis Sami (c) lab h387 Melrose (EM) Davis Sherman (c; Savanah) porter hl03 Smith (EM) Davis Sidney V (Fanny M) h312 Peach- tree (EM) Davis Sims (c; Addie) lab h3l5 Berry DDaavviiss SStounanryt C(c;(AMnnoilelieT) )r2b1k1prWKoiondgmalan & Burnette h350 Pierce av (V) Davis Stuart C jr (Virginia) inspr hll2 Cleveland av Davis Studio The (Mrs Bernice Davis) art gds 506 Orange Davis Sue Mrs r244 Washington av Davis Susie M (c) rl39 Jones Davis Sylvia (c) hl017 Elbert (SM) DaKveisssoTn-ARlitloeyn D(Rivubhyl)l3whAsveonsurpdt McDavis T Fletcher (Eliz) janitor r412 Montpelier av Davis T Hoyt student rl2l9 Oglethorpe Davis T Hoyt U S dist atty r Vienna Ga Davis Thelma (c) student r380 Madison Davis Theo (Ella) r905 Clinton (EM) Davis Theodosia (c) maid r304 (450) Elizabeth (SM) Davis Thos (c) hl64 5th Davis Thos (c; Okie) hi27 McKays al Davis Thos (c; Ossie) lab h813 (724) Dempsey av (U) Davis Thos (c) lab r227 Linden av Davis Thos E (Rosa B) mach CofGRy h 712 Napier av Davis Thos F elk Macon Gas Co rl08 Stonewall pi (V) Davis Tobe (c; Emma) lab hl20 (706) Henderson (SM) Davis Ulysses (c) lab h207 Collins pi DaPvoisweVrelCmoa hHl063(MWenadlonlu) t linemn Ga Davis Veola (c) rl27 Ritchey (EM) Davis Versie (wid Jas) r256 Washington Davis Vinie (c) hl05 2d av (U) Da5vtihs Wav A(lVle)n jr (c) student rl32 (142) Davis W Frazier (Louise G) driver hl53 3d Davis Wallace M (Thelma) mgr Crane Co h315 Corvin av (V) Davis Walter (c; Mattie M) lab h319 Davis Walter (c) student r708 (588) May- nard (EM) Davis Walter jr (c) student r319 Green DainvgishWamaltSearsEh (&CliDffooordr) Cdooohrm20k7r FWaiilrl-- view av (EM) Davis Walter E (Gladys) reprmn CofG Ry hl47 Sulphur Springs rd DaMviuslbWerarlyterhEd(oRuth) watch repr 414% Davis Walter T (Lois B) agt Met Life Ins Co h241 Belvadier dr Davis Walton W student r410 (460) Hill Crest av (CH) Dahvli3s2W(a1n4z2)a A5th(c)avphy(Us )556 New R412 Davis Warren (c; Ella) lab h708 (588) Maynard (EM) Davis Wiley S (Lillian B) carp r203 New Davis Wm (c; Minnie) bellmn Hotel La- nier hl90 Northwest Boundary Davis Wm (c; Mattie) carp hll06 Pio Nono av (V) Davis Wm (c) delmn Hugh L Tabor rl20 (123) Jones St la Davis Wm (c; Annie M) driver r241 Church la (SM) Davis Wm (c) lab CofGRy Davis Wm (c) lab hl04 Davis (NH) Ill DUN LAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Davis Wm (c) lab rl60 5th Davis Wm (c; Camilla) meats 275 Madi- son h do Davis Wm jr (c; Roberta) lab hll4 May DaLvnisdrWy mCo Bh34(0CCameniltlraa)l aevng(SMC)rescent Davis Wm C (Lourette) firemn MD&S RR r657 Pine Davis Wm H (Marjorie S) filling sta 1811 Vineville av (V) hl807 do Davis Wm H (Annie) millwkr hl05 Grand av Davis Wm J (Eddie D) hi 120 Elm Davis Wm J (Janie) h224 (300) Reid Davis Wm J (Mildred S) field mgr Met Life Ins Co h205 Berkley dr DaCvois hW25m2 JJe(EffmmDaav) iswtc(ShMm)n Bibb Mfg Davis Wm L (Mabel) r711 College Davis Wm M (Frances) mech Dunlap Chevrolet Co rl05 Appleton av Davis Wm R elk GtA&PTeaCo r359 New DAVIS WM V (Winifred), Sec-Treas Hotel Macon Co and Mgr Hotel Macon, r460 Hillcrest av, Tel 706 Davis Wm W' (Marie A; Davis-Passmore Roofing Co) h578 Boulevard (NH) Davis Wm W (Minnie E) driver City h 509 Arch Davis Willie (c) r708 (588) Maynard (E M) Davis Willie M (c) cook hll4 Elklon pi (SM) Davis Willie M (c) emp Snow's Lndry & Dry Clng Co rl27 Ritchey ('EM) Davis Willie M Mrs mgr Peggie Hale Dress Shop h605 Orange apt 1 Davis Wylie jr student rl40 High Davison see also Davidson Davison Chas (Ada) hl06 (136) Colquitt Davison Jeanie (wid Green T) rl06 (136) Colquitt Dawkins Sami (c) h609 Hazel Dawson Delia (c) rll7 2d av (V) Dawson Elmo R (Annie) slsmn r706 Pine Dawson Jas N (Eloise) blrmkr CofGRy h200 (400) Villa Esta Dawson Jas T jr (Verna M) hl2: Grand Dawson John H (c) lab hllO (301) Hawkins av Dawson Josephine (c) drsmkr 159 Middle (V) rl08 Forest av (V) Dawson Lucile r314 Flanders (EM) Dawson Mildred H Mrs sten Jones Johns3ton Russell & Sparks r476 College apt Dawson Mollie (c) maid h2l4 Collins pi DDaawwssoonn MRoesuebsenA hM314(MFlaarngdt eJrs) (mEMill)wkr Bibb Mfg Co rll62 Edgewood av Dawson Virginia student Ga Academy ifor the Blind r Bluffton Ga Daewl saoln W(SaMlt)er (Lila) h229 Grant ChapDawson Wm (c; Emma) lab hllO (122) Cedar (U) Dawson Wm H (c; Josephine) barber Wavilli(sV)Braswell Barber Shop r260 2d Day Edw (Minnie) millwkr Bibb Mfg Co h707 Broad (EM) Day Hugh D atndt Robt L Stevens fill- ing sta r812 Hillyer (CP) Day Jas (Mae) live stock dir r400 Wash- ington av Day Jas L r560 Arch Day Jas L auto mech Bob Young Used Car Exch r Glencove Springs Ga Day Mattie L (wid Jas M) h624 Main (E DaMy)Robt L (Virginia) baker Andrew H DaAytkRinusper4rt17L (s4l1s8m) nLDogunClaabpi-nFederler Hdw DaCyo Sru4s0i4e MForrssytethl opr SBT&TCo r619 2d DAY'S, W H Chew Mgr, Clothing for the Family 406 3d, Tel 3026 Deal Fernando D (Anna) pntr hllO Rutherford av (SM) Deal Rosalind cash A G Rhodes & Son r 321 Buford pi Dean A (Lillie M) porter Am Printing Co r246 Church la Dean Alice r91 Lawton av Dean Annie (c) lndrs h859 3d Dean Beatrice (c) lndrs r:220 Plant (S M) Dean Bertha C tel opr SBT&TCo rl24 (116) Colquitt Dean Carrie (wid David E) rl624 Broad- way Dean Columbus P (Carlease) carrier r 316 Belmont av Dean Edmond (c) h220 Plant (SM) Dean Elijah (c; Bessie) lab h310 (309) Crisp (SM) Dean Freeman N mech r416 Elm Dean Geo (c; Ella) lab CofGRy h218 DeJaonneHs arry student rl04 (138) Colquitt Dean Henry M (c) janitor City Water Wks Shop h73 Oliver av (SM) Dean Herman (c; Maggie) lab h540 DeFalnanJdoehrsn ((cE)Mr)73 Oliver av (SM) Dean Jordan (c; Pearl) hll5 E Ell Dean Kath C Mrs slswn Sterchi Bros Stores Inc r623 Vineville av (V) Dean Kennon (Ruby) lab r220 Cedar (S M) Dean Lee (c; Berna) lab City hll08 El- bert (SM) Dean Lena (c) hl07 Peacock (SM) Dean Leona (c) student r614 (411) Hall (EM) Dean Mamie r rear 1161 Milledgeville rd (EM) Dean Mattie (c) gro 311 (211) Waterville rd h do DEAN OTIS GROCERY, W Bonnie Dean Mgr, Meats and Family Groceries, We Deliver 478 Cotton av, Tel 2338 DeIgagng Peggy private sec WPA r335 ColDean R Walter (Eliz) cranemn CofGRy hi 143 Milledgeville rd (EM) Dean Rebecca emp Snow's Lndry & Dry Clng Co r208 (306) Elizabeth (SM) Dean Richd (c; Mabel) carp h614 (411) Hall (EM) Dean Richd M (c) r614 (411) Hall (EM) Dean Sallie (c) r312 Telfair Dean Sami lab h rear 1161 Milledgeville rd (EM) Dean Sami A (Jessie) elk Riverside Ice & Coal Co h230 Jones av (EM) Dean Sami A (Lula) formn PO hl04 (138) Colquitt Dean Vera (c) r220 Woodcliff Dean W Bonnie (Mary A) mgr Otis Dean Grocery h478 Cotton av Dean W Emory student rl624 Broadway Dean Walter G (Stella D) gro 1624 Broadway h do Dean wash (c; Katie) h307 (209) Waterville rd Dean Wm H (Bonnie) h413 Lawton av Dean Wm L (Reunette) wood wkr h437 (1002) Ajax Dean Woodrow W (Lady D) waiter h515 Hemlock Deas Ernest E student rll7 Ninadell dr Deas Leo D (Ruth D) inspr CofGRy h De1a1s7 LNeoinDadejlrl (dFrlorence) elk r324 Forsyth Deas Mattie (wid Nathaniel) r416 Montpelier av Deas Willard H atndt Power Oil Co r 117 Ninadell dr Deason Martha smstrs r280 Main (EM) Deason Wiley A millwkr Bibb Mfg Co r280 Main (EM) Deaton Harry W (Ethel P) watch mkr Kemaghan-Goodman Inc h204 Beech DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES ' and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere eall on us R. L. POLK & CO. DETROIT g < J M i Where To Buy? Consult the Classified Business Lists In This Directory EDWIN S. DAVIS, District Agent JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 Deaton Harry W jr student r204 Beech Deaust Annie S (wid Thos E) sten hl27 Culver (V) Deaust Josephine E rl27 Culver (V) Deaust Josephine student Ethel B Davis Beauty Shop r Macon Ga Deaust Thos E jr rl27 Culver (V) Deaver Bascom S Hon (Emily) judge U S Dist Court h503 Boulevard (NH) Deaver Jennett student r503 Boulevard (NH) Deavors Wm A (Roberta) loco eng hllO Madden av deBeruff Lulie rl09 Hill Crest av (CH) DeBorde Alice (wid John M) hl08 Magnolia DemBsutrttsSoWu RHyuSnytesrtem(Mhair1y4 BCufLo)rdtrpaiin Dee Alex (c; Jessie) lab r731 Edgewood Dee Alex (c; Annie) lab h409 Richard J) Deem Clyde (Eliz) elk r613 Plum Deep Anthony (Jewel) elk Jake's Shoe Store r401 Walnut Deep John (Mary) r404% Mulbrry Deep Dees Sami Vera (Amelia) (c) maid f2h24004WV2ooMducllibfefrry Deese J C (c; Celia) emp Empire Dixie Coal Co h508 O'Hara la Deese Vester L asst mgr Hotel Southland r569 Broadway Defer Sidney D sergt Ga Natl Guard r 525 Mulberry DePiore Marietta (wid Philip W) elk Lu- cretio Caserio r253 Washington av Defore Ardell (Stella) electn h426 Ridge Defore B B (Elma) lab h321 Randolph (EM) DeFore Bell (wid H P) r207 Rogers av (V) Defore Benj P (Lera P) millwkr Willingham Cotton Mill rl39 Rembert av Defore Danl (Nellie) driver City hllO Yates av (EM) DePore Emmett R (Annie) wtchmn Stewart Oil Co hl05 Ocmulgee DeFore Emmett R jr (Mary E) driver h 104 Ocmulgee DePore Florzell (Armenia) millwkr Willingham Cotton Mill hl24 (14) Holt av (NHts) DePore Gaston P E (Carrie M) millwkr Willingham Cotton Mill h5 (73) Mill DePore Henry A millwkr Willingham Cotton Mill rll8 (9) Holt av (NHts) DePore J Walter (Clemmie; DePore & Estes) h423 (419) Forest av (V) DePore Jas A (Pearl) bus opr Ga Power Co hi09 Nelson (SM) DePore John H rl05 Ocmulgee Defore Lawrence (Enid) driver Kenning- ton's Market r321 Randolph (EM) Defore Louise slswn r247 High Defore Ruby elk Collins Baking Co r247 High Defore Thelma rl39 Rembert av DeFore Wm A (Nina) bus driver Ga Power Co hl916 2d DePore Wilson E (Lillian) bus driver Ga Power Co h209 Henry (SM) DePore & Estes (J Walter DePore, Jas C Estes) lawyers 516 Mulberry R501 Deidrich Jessie N Mrs home dept Wes- leyan College Dekle Chas L mach Macon Mach Shop r Recreation Park Dekle Chauncey W student r301 Buford DePkile Ruth (wid Chauncey W) r3Ql Buford pi Delacroix Raymond A (Evelyn T) staff sergt U S Organized Reserve r206 Ridge av (V) DeLamar Curtis W (Sara B) asst circDuelsastaioun pmi gr Macon Teleg Pub Co r9 Delk Bertie F (Carrie P; Delk Saw & Knife Works) h902 Oglethorpe Delk Essie (c) maid Metro Studio rl403 Ardvine's al Delk Saw & Knife Works (Bertie P DeDllelMk)ar8y63(wBidroaJdaws ayG) sten Juliette Milling Co rl89 Magnolia Dell Otha (c; Pauline) lab h219 Hazel Dellinger Doris E Mrs slswn Darling Shop rl09 Washington av apt 1 Dellinger John E (Bell) 1st asst chf Fire Dept hl09 Washington av apt 1 Dellinger Ralph W (Doris E) bkpr A B Lavee aPplmt b1g & Htg Co rl09 Washington DeLoach Lewis C (Lennie) derrick eng CofGRy h555 1st DeLuxe Cafe (Geo Zaloumes) 555 Cherry De(mSMar)est Mary P fctywkr h293 Cedar Demarest Mildred P r293 Cedar (SM) DeMeritt Eug B (Marjorie L) signal eng h267 Bond DeMeritt P Wm student r267 Bond Deming j Harvey (Edna) signal supvr hll7 Cleveland av (V) Deming Jas student rl'17 Cleveland av (V) Deming Mary student rll7 Cleveland av (V) Demouy Tarleton (Almeta) butcher h 1116 Elm Dempsey Clifford A (Louise) gro 506 Clinton (EM) h do DEMPSEY HOTEL (See Hotel Dempsey) Dempsey John T (c; Emma) barber Wil- lis Braswell Barber Shop hl58 Middle (V) Dempsey Norbert A (Merriman P) customers' mn Fenner & Beane h205 Riverdale dr Dempsey Thos r587 College Denerson Emmitt (c; Georgia M) lab h 219 Linden av Denicke Amalia (wid Robt C) r903 Napier av Denicke Clarence H (Eva R) dept mgr Burden Smith & Co hl09 Hill Crest av (CA) Denkins Calloway (c; Beulah M) lab r 110 Elklon pi (SM) Denkins Elijah (c; Corinne) lab Standard Oil Co h526 Grant Chapel la (S M) DeCnhkainrlsesGe(oSM(c); Minnie) lab h608 (301) Denkins Ora C (c; Ethel M) porter rl9 Elbert la (SM) Denmark Annie M (c) maid r6 Spring Denmark John (c; Alberta) lab h770 Moore al Denmark Rosa (c) maid r rear 377 Monroe DENMARK T IRVING (Lucille), V-Pres The Citizens & Southern Natl Bank, h Shirley Hills, Tel 6128 Dennard Geraldine student h533 Orange apt 7 Dennard H Leon (Emma L; Dennard SiceerviSctea)Stah7a9n0d HGoelot rgaiva M(NarHktest) ServDeMn)nard Josie (c) rl26 (120) Powell (E Dennard Josie (c) lndrs rl21 (6) Holmes av (V) Dennard Mary (c) maid r523 Forsyth Dennard Mary (c) smstrs Dixie Jobbing House Dennard Nicie (c) h523 Forsyth Dennard Rose P Mrs bkpr McClure Office Equipment Co r533 Orange apt 7 Dennard S E (Ruth G) slsmn Prank Roberts r Columbus rd Dennard Service Station (H Leon Dennard) filling sta 443 Vine (NHts) Dennerson Eunice M (c) lndrs rl30 5th av (V) Dennis Alf (c; Mary) lab h313 Womack (EM) 13 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 Dennis Aline (c) r29 Reid (SM) Dennis Allen J (Norwood) supt Bibb Mfg Co h350 Olive (EM) Dennis Bloomer R (Nora O) mill wkr Willingham Cotton Mill hll7 (42) Hot av (NHts) DeHnanrisrisChalarlie (c; Trelha M) lab rl7 Dennis Clement O (Eugenia) dept mgr Firestone Auto Sup & Serv Stores r 720 Mulberry Dennis Elexander (c; Annie) h341 3d av (V) Dennis Emma (c) lndrs h206 (320) Hawkins av Dei(n1n13is) ESmhomret tt(EM(c;) teliz) bellmn hlOO Dennis Evelena (c) r86 Bay Dennis Everett D (c; Lillie P) auto repr 640 Washington av h225 Moughon (V) Dennis Frank (c; Nell) porter Worsham i& Sherrill h303 Henderson's row (SM) Dennis Geo T (Mary) pntr Bibb Mfg Co r908 New Dennis Helen B millwkr Willingham Cotton Mill rll7 (42) Holt av (NHts) DDeennssoonn DDeolriaa ((cc)) lrnl2d4rsThi3n3d8alJlacakvso(SnM) Denson E Jones (Laura B) sec-treas Karsten & Denson Co Inc hl25 Stonewall pi (V) Denson Gus (Clara W) lab r417 Jackson Denson Jessie (c) lndrs hl054 Power House al DeCnrsaofnt J(oVh)n (c; Laura) lab h207 (73) Denson John W (Charlotte K) pres Karsten & Denson Co Inc h746 Patterson Hts Denson Johnnie M (c) cook r209 Madison. Denson Leila sten J W Burke Co h203 Mikado av (SM) DDeennssoonn MLeanrya (Mc) br8a0k7er Philnpier Central Ga Baking Co rll7 (15) Wise av (V) Denson Miriam sten WPA Denson Nannie sten McKesson-Riley Diy r203 Mikado pi (SM) Denson Patsy (c) r424 Peachtree (EM) Denson Wm (c) lab rill (557) Campbell av (SM) Dennis Henry p (Maybelle) lab h321 Denson Willie M (c) maid r306 Wood al Melrose (B) Dennis Herdie (e) lab r225 Moughon Dent Alice (c) r349 Hawthorne Dent Annie Mrs r510 Courtland av (V) Dent B Jas student r215 Heard (SM) Dennis Hervie J millwkr Willingham Dent C Randolph r215 Heard (SM) Cotton Mill r207 (11) Dannenberg av Dent Edgar E r530 Courtland av Dennis Inez (c) maid hl52 College Dennis J Herbert millwkr Willingham Dent Harrison H (Grace) pipeftr hl006 Napier av Cotton Mill r26 ( 88) Mill Dent Iola (wid Jas L) hl05 Lawton av Dennis J Melton (Sallie M) millwkr Wil- Dent J Thos (Helen) sec-treas Freeman lingham Cotton Mill h218 (20) Holt Dent Sullivan Co h530 Courtland av av (NHts) Dennis jas (c; Mollie M) lab r428 Mon- roe Dennis Janie (c) maid r282 Madison Dennis John (c; Cornelius) lab h525 (521) E Academy (EM) Dennis John C (Dennis & Dennis) hlOl Oliver av (LCHts) Dennis Kath (c) maid hlOO (101) Texas (SM) Dennis Liza (c) r303 Henderson's row '(SM) Dennis Lizzie (c) rl08 6th av (B) Dennis Lucile (c) h6 (555) Witkowski's la Dennis Maggie L (wid Edmund M) h26 De(n88n)is MMiallry (c) rll2 (300) Craft (V) Dennis Mattie (c) cook h247 5th Dennis Mildred F millwkr Willingham Cotton Mill r207 (11) Dannenberg av Dennis Rena (c) h22 7th Dennis Sidney L (c) lab hl09 Price (V) Dennis Sidney L jr (e) student rl09 Price (V) Dennis T Ward (Dennis & Dennis) rlOl Oliver av (LCHts) Dennis T Z (c) lab rlOO (101) Texas (S M) Dennis Thos (c; Martha) lab hllO (954) Dent Luther cond MD&SRR r Vedalia Dent Orrie (wid Rufus L) rl02 Kemper av Dent Pearl waiter Betsy Ross Coffee Shop r821 Mulberry Dent Quinton H (Jane) elk G G Harde- man av h360 Orange Dent Reuben student r914 Orange Dent Rufus ins agt rl05 StJames av (S M) Dent Troy L swtchmn rl061 Ash Dentley Asihley (c; Mabel) porter John W Peeks h901 Fort Hill (EM) Dentley Corene (c) r901 Fort Hill (EM) Dentley Lovett (c) r901 Fort Hill (EM) Denton Albert (c; Martha) carp hl20 Kay (U) Denton Alice M elk County Probation Officer rl03 Clisby pi (V) Denton Chas (c; Josephine) lab h329 Ernest (CH) Denton Chas (c; Hattie) lab Ga Power Co h304 (405) Berry Denton Elijah (c) delmn Fisher's Drug Store r304 (405) Berry Denton F Lester eng S E Broadcasting Co r811 Poplar apt 2 Denton Horace (c) lab r310 Patterson (N Hts) Ocmulgee la Denton J Fred (Ethel M) slsmn h811 Dennis Ulysses (c; Lillie) r621% (622) Middle (EM) Dennis W S dist director WPA rl20 Poplar apt 2 Denton M Elise sten County Comnrs r 103 Clisby pi (V) Coleman av Dennis Walter (c; Mamie) lab rllO (98) Bay Dennis & Dennis (John C and T Ward) airdhts 556 Mulberry Densley Onie (c) r22 (19) Mulberry la Denson Ada (c) hl75 Kay (U) Denson Allen (c; Carrie P) lab r424 Peachtree (EM) Denson Billie K student r746 Patterson (NHts) Denson Chas (c) lab r402 (565) Elizabeth (SM) Denson Cleveland (c; Anna B) driver h 141 College Denson Cleveland (c) lab rl75 Key (U) Denson Davis (c) lab r295 Mosley (U) Denton Mary R (wid Jas W) h!03 Clisby Depnl to(nV)Ozzie L ,(c) r317 Madison Denton Sarah J (c) lab rl26 (127) Cedar (U) Denton Wm (c; Lizzie) formn Ga Power Co h306 Berry Denton Wm (c: Naomi) lab hl09 (116) 3d av (U) Denton Wm B (c) porter r317 Madison Depree Lonnie (wid Marvin) r52 Holt av (NHts) Deriso Louise E :r231 Belmont av Derlien Peter (Maude) slsmn h563 Col- lege apt 2; Derr Harold A (Frances) cash Buckeye Cotton Oil Co h2345 Forsyth rd We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R, L Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 14 T. L. W 0 0 D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call" on us R. L. POLK & CO. DETROIT WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. 64 Derrick Edw (Eloise) linemn hl08 Thomas Derry Henry P (Mary B) h664 College Derry Wallace T (Margt N) h664 Col- lege Deschauser Geo (c; Rose) lab Macon Gas, Co h358 Masonic Home rd (NH) DeShazor Mary E (c) r710 (75) May- nard (EM) DeShazor Wm (c; Ida D) lab h801 (810) Maynard (EM) Deshazor Wm (c; Rosa) lab r211 OcmulDEgeSe OTO MOTOR CARS, Yates Motor Co Dealers, 707 3d and 510 Pine, TelS 1445-1446 (For further information see left top lines and page 3 Buyers' Guide) Dessau Fannie G (wid Wash) r301 Hines ter (V) DESSAU REALTY & INSURANCE CO, Washington Dessau Pres, Leroy B Thompson Sec-Treas, Real Estate and Insurance 101 Georgia Casualty Bldg 516 Mulberry, Tels 271-272-273 (For further information see page 29 Buyers' Guide) Dessau Washington (Frances) pres Dessau Realty & Ins Co h2524 Forsyth rd DeVane Willene dental asst Robt H Murphy r209 1st Deveraux John (c) lab h201 Holmes av (V) Devereau Jack (c) porter rl22 Spring Devereau G Stacer (Bertha V) bkpr h 425 Forsyth Devereux Saramae matron SBT&TCo r Edna Place rd Devlin Andrew F (Eliz M) capt Fire Dept h236 High Devlin John p (Mary A) lieut Police h 902 New Devlin P Leo bkpr r902 New Devlin Sallie M elk U S Re-employment Service r902 New Devlin Sarah nurse 236 High r do Dewberry Alex H (Vesta L) elk Brass Rail hl538 2d Dewberry Annie F (wid Wm) h250 Columbus Dewberry Chas E elk Brass Rail r321 Coleman av (CH) Dewberry Chas H clo clnr r321 Coleman av (CH) Dewberry Cora (c) maid hl07 (204) 3d (U) Dewberry Felix G elk John G Read r 1532 3d Dewberry Jas (c; Martha) lab h371 Chestnut Dewberry Mamie Mrs h321 Coleman av (CH) Dewberry Mason I r250 Columbus Dewberry Rejina (c) maid rlOlO (1108) Main (EM) Dewberry Sallie A (wid Chas A) hl532 3d Dewberry Victorine (wid Thos D) r718 2d Dey Gertrude (wid Byron B) r812 Hillyer av (CH) Dey Hugh D sta atndt Robt L Stevens r812 Hillyer av (CH) Dey Max H asst mgr Broadway Trading Co r371 1st Dezon Minnie (c) rlO08 Clinton rd (EM) Dezurn Roosevelt (c; Daisey) lab hl3l Moccasin Slide Diamond Carl (Estelle) dept mgr Dannenberg Co h316 Linden av ant C Dick Ida M (wid Wardorp H) h211 3d Dick Nancy student r211 3d Dick Thornton A (Sue E) chiro 576 Mulberry R208 r211 3d Dickens Jas W (Effie) wtchmn Bibb Mfg Co hl29 (32) Bellevue rd Dickens Robt L millwkr Bibb Mfg Co r 129 (32) Bellevue rd Dickerson Alex R (c; Maggie) brklyr h 106 Forest av (V) Dickerson Gladys millwkr Willingham DiCckoettrosonn MMililnnrilel6%(widRoAyeC(hCaHpm) an) r 326 Hanson (SM) Dickerson Nannie L (wid Thos E) h H61/2 Roye (CH) Dickerson Sallie (wid Jas) r220 (121) ICuttus la (EM) Dickey Caesar (e) lab rl62 College Dickey Percy (c) prsr Snow's Lndry & Dry Clng Co rl62 College Dickey W S Clay Mfg Co Patk J Mur- phy supt sewer mfrs Pine at 10th Dickinson Julia hill (173) Cherokee av Dickinson W Edw (Ruth) observer U S W6 eather Bureau h263 Georgia av apt Dicks Robt A (Willie) loco eng h404 In- glesicte av Dickson see also Dixon Dickson Anna (c) h310 (210) Bay Dickson Curtis (Pearlie M) slsmn King- man & Everett Inc hl52 Oakland av Dickson Julia (c) fctywkr r497 Gilmer Dickson Martha (c) lndrs hll3 Johnson (SM) Dickson Mary L (wid Wm I) hl41 Pierce av (V) Dickson Mildred rl52 Oakland av Didly Sami (c; Emma) lab r374 Monroe Dieffenwierth Wm B (Mae H) elk rl20 Park pi Digby Eliz Mrs bkpr Day's r545 Telfair Digby Ernest W policemn r545 Telfair Dikes Robt M (Gertrude) lab hl03 For- est av (B) Dill John (c; Emma) h705 (612) Crisp (SM) Dill Wilbur (c) lab r705 (612) Crisp (S M) Dillard} Bobbie (c) fctywkr h320 Hazel Dillard Clarence H slsmn r97 Coleman av (CH) Dillard Elba L (wid Jas C) h97 Coleman av (CH) Dillard Eliz (c) lndrs r341 Monroe Dillard Ernest C (Sara F) millwkr Bibb Mfg Co rl223 Oglethorpe Dillard Ernestine (c) cook r291 2d av (V) Dillard Gertrude (c) r365 Chestnut Dillard Henry (c; Pearl) lab h512 (304) Straight (11) Dillard John (c; Pearl) lab h205 Neel (U) Dillard Jos (c; Bessie) lab r401 (204) 1st av (U) Dillard Julius (c) student rl02 Ruby (V) Dillard Laura (c) r221 Linden av Dialllard Lela (c) lndrs hl20 (133) Kahn's Dillard Lillian tchr PS r97 Coleman av (CH) Dillard Robt student r97 Coleman av (OH) Dillard Virginia r816 3d Dillard Willie M (c) lndrs r803 Elbert (S M) Dilliard Geo (c) lab h411 Colquitt Dilliard Henry (c) lab WPA Whse Dillon J R jr slsmn McCormick Deering Store r621 Orange Dime Store Mrs Tava Wilcher mgr dept store 330 Main (EM) Dingier Frank E hlpr Nehi Bottling Co rl980 3d Dingier Geo H (Bexma) formn Nehi Bottling Co rl980 3d Dinkins Andrew (c; Mamie) lab Natl Handle Co hdll (11) Gilmer Dinkins Carlos E elk S Jones Co rl08 2d Dinkins Early (c; Willie) porter S Jones Co rl20 Hill Dinkins Henry E (Emma) gro 1301 3d h do Dinkins Jas (c; Janie) lab hlO (309) Hanson (SM) 15 PITTS' MORTUARY HOTEL Phones 146-147 AMBULANCE SERVICE 814 Mulberry M C Dinkins Janie L (c) tchr PS h914 Pio Nona av (V) Dinkins Jessie (c) maid r208 Corbin av DiiXins Mattie ftr Union Dry Gds Co Dixon Chas E (c) porter Union News Co rlOO (3) Center (EM) Dixon Claud C (Frances F) slsmn hl22 Inverness av , Dixon Clinton (c; Beulah) lab hl05 T 0 U R Dinktas Maude (c) cook hl20 Hill DIRECTORY LIBRARY, We Maintain a Complete and Up-to-Da,te Library * City Directories of American Cities for Your Accommodation and Convenience aAtudCithoarmiubme,r RofL CPoolmkm&erCceo PMuubnliischipearsl DIRECTORY OFFICE, R L Polk & Co Publishers, Martin Bldg, Birmingham, Ala Disabled American Veterans 617% Pop- Dixon Clinton (c; Mae) lab h359 Robinson rd Dixon Colonel (c; Lady) h469 Chestnut Dixon David (c) h507 Fort Hill (EM) Dixon Della (c) maid r383 Madison Dixon Dollie (c) cOok r469 Chestnut Dixon Dolly (c) mach opr Bibb Bag Co 1*5 P&r&djsB 9,1 Dixon Edith Mrs elk Union Dry Gds Co rl23 Highland av Dixon Eliz (c) rl44 (148) Bowman (EM) Dixon Ella (c) h778 Reynolds al 1 s T 0 A M M E C R C 0 1 A L N 125 Discher Jessie elk r205 Ingleside av Dismuke Alice (wid Jas) rl43 Magnolia Dismuke Harry (Rassie) slsmn r411 Col- leg Dismuke Harry jr student r411 College Dismuke Sally sten r556 Boulevard (NH) DDiissmmuukkeess HJaasrrCy s(tRuodseen) t cro6n2d9 MAdDa&mSsRR h2346 Forsyth rd Dismukes Jas C jr r2346 Forsyth rd Disroon Eliz J (c) tchr PS rll2 Frank- Dixon Co h8E0l6la; Mrs 2d bkpr Union Dry Gds Dixon Ella M student r204 (202) Heard (SM) Dixon Elmer (Nipparee) millwkr Bibb Mfg Co h29 Bibb' av Dixon Evin O r301 Fort Hill (EM) Dixon Frances (wid Wm A) h533 Or- ange apt 15 Dixon Geo (Emma) hlpr County Sheriff h216 Walker la Dixon Glover N (Evelyn W) city firenan ROOMS Mulberry at Broadway Disroon Frank W (c; Eliz J) porter hll2 Franklin DiVenuto Enrico (Santma) gro 2918 DiVenuto Santina elk Enrico DiVenuto r2918 Houston av (SM) Dix Anthony millwkr Bibb Mfg Co rll2 (107) Dewitt (EM) Dix Chas (Irene P) r!521 Broadway Dix Jas T (Eula D) lab rl521 Broadway Dix Lee Mrs millwkr Bibb Mfg Co h256 Hydrolia (EM) Dix Lee A (Leirsey) waiter Spiller's iRestr h200 Mikado av (SM) Dix Mattie Mrs rl06 (265) Pearce (EM) Dix Myrtle cash r200 Mikado av (SM) Dix Rebecca (c) cook r rear 554 Orange Dix Wm A (Mabel) terminal mgr Union r302 Duncan av Dixon Henry (c; Minnie) janitor Georgia Casualty Co rl31 4th av (V) Dixon Horace (c; Azie L) lab h79 Wil- der (SM) Dixon Horace L (Ella) filling sta 768 2d h806 do Dixon Irvin (c; Maud) emp CofGaRy h 225 Neal av (V) Dixon J B mach MD&SRR rl65 Eng- lish (V) Dixon J L driver Wofford Oil Co Dixon Jas (c) lab r216 Walker la Dixon Jas J (Avalia) reprmn h204 (202)' Heard (SM) Dixon Jas S (Eliz) mach h3O07 Houston av (SM) Tel. 4600 Bus Terminal r620 Pine Dixon Jefferson jr (c) bellmn Hotel Dix Wm D (Lillie) pntr hl521 Broadway Dixie Cafe & Commissary (John E Schmidt) ns Pine cor 7th DIXIE CYCLE CO (Hugh C Barron), Excelsior Bicycles, and Expert Repairing, 410 2d, Tel 9178 (For further information see right side lines and page 7 Buyers' Guide) Gordon r213 Northwest Boundary Dixon Jerome (c; Susie) driver BuildDiexrosnLbJirmCmo ihe30L3 ((3c0:0)LTililniadna)ll daavir(ySwMk)r h468 Log Cabin dr Dixon John student r315 Coleman av (OH) Dixon John L (Edith A) radiomn Em- Bankers Dixie Dairies Hugh H Hill mgr 658 Arch Dixie Dental Laboratory (Chas H Brooks) 407 Broadway R2 pire Fum Co rl23 Highland av Dixon Jos (c; Nellie) carp hlpr hl27 (112) Wood al Encyclopedia Dixie Jobbing House (Edw Bashuk) men's fuxngs 554 Poplar Dixie Neon Shop Inc C Augustus Yarbrough pres 1912-16 Vineville av (V) Dixie Peanut Co (Wm A Cleveland) nut dlrs 617 Poplar Dixie Roll & Cot Inc Jas L Lowrance Dixon Lady (c) cook r469 Chestnut Dixon Leola (c) rll6 (1229) Tracy's la Dixon Malcolm R (Eliz C) dept mgr h 100 Berkley diDixon Margt E student rl22 Inverness av Dixon Melinda J (wid Wm) h403 Frank- lin (SM) The Bank Directory of the World Issued pres Dixie Shoe Repair Shop (Chas P Ivey) 307 Broadway Dixon Minnie (c) cook rl31 4th av (V) Dixon Osborne P (Doris) prsmn Flynn Printing Co hl069 Hazel Mar. and Sept. $15.00 Dixon see also Dickson Dixon Alvin K (Sophronia) h301 Fort Hill (EM) DiTxorandinRgo&bt InPv C(oMha3r6th3aC) oelllekgeMaapcton4 Dixon Roy elk r867 Cherry per volume Dixon Alvin K jr r301 Fort Hill (EM) Dixon Rupert T woodwkr Central Sash Dixon Andrew L (Susie B) sta eng h439 Duncan av & Door Ct> r213 Reid (SM) Dixon Sami atndt Horace L Dixon r806 R. L. Polk Dixon Andrew T (Iva W) asst mgr Met Life Ins Co h728 Ridge av (V) Dixon Annie (c) maid rl02 (1-2) Hawkins av 2d Dixon Sami L (Eileen) mech Central Sash & Door Co hl45 Sulphur Springs ird & Co. Publishers Dixon Arth P (Oleene) lab City h413 Dixon Thos (c; Mary) lab h706 (618) 431 Chappell (SM) Prince (SM) Dixon Carlton student r301 Fort Hill Dixon Thos T (Ona K) hl220 Montpe- (EM) lier av Howard St. Detroit Dixon Chas (c; Dollie) lab r225 (101) Moore la Dixon Chas (c; Ella) lab hl632 1st Dixon Tobias A (Sallie D) h302 Duncan Dixon Viola (c) maid r209 Green Dixon Wattie E (Chloe T) pharm h502 3S4 4th Ave. New York Dixon Chas E r301 Fort Hill (EM) Beech av 16 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City In the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on u9 R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 Dixon Zetta (c) h213 Northwest Boun- Doke Jos (Pearlie) millwkr Bibb Mfg dary Co hl8 (19) Brigham Dobbin Albert (c: Lillian) lab r301 (11) Henderson (SM) Doke Jos H pntr h280% Orange Doke Juanita bndrywkr J W Burke Co r Dobbins Dock H (c; Hazel) h405 Mason 613 Arch (SM) Doke Louise millwkr Bibb Mfg Co rl8 Dobbins Homer (c) r405 Mason (SM) Dobbins Melissa (c) h234 Plant (SM) (19) Brigham Doke Riley L millwkr Willingham Cot- Dobbs Letha (c) cook h414 Monroe ton Mill rlll8 Ash Dobbs Spivey L (Lena) mach h201 Pulton (SM) Doles Alex slsmn Nu Icy Bottling Co Doles Betty (widl Geo F) h917 New apt Dockery Clarence r3l5 Mulberry Dockery H A Mrs hsekpr Hotel Macon r 315 Mulberry 2 DoCleos rE9n17a BNeMwrsapemt p2 Burden Smith & Dockery Pearl asst cash Hatcher & McCrary Inc r315 Mulberry Doctor Chas (Leah) collr J Backer Fum Doles Geo P (Alma) ftr Macon Gas Co Dorlle2s3Jo3hdn W driver Safety Cab Co r270 Co h!63 Spring apt 2 Maple DoCchtoerrrJyacob (Rose L) city firemn h906 Doctors' Building 700 Spring Doles Lee (Ena B) elk Hopp Bro Co r 917 New apt 2 Doles Marvin H barber Palace Barber DOCTORS' BUSINESS BUREAU & COLLECTION SERVICE, John M Heame Mgr, Collections and Credit Shop r204 Spring Doles Mittie (wid Walter) smstrs h270 Maple Reports 420 First Natl Bank Bldg 409 2d, Tel 3386, Night Tel 6007-W Dodd A Mack supvr bridges bldgs and tracks CofGaRy r860 Pine Dodd Asa M jr (Carolyn) traffic mgr Ga Peach Growers Exch h325 North Doles Robinelle r204 Spring DDoolleess TThhooss JJ ((REullbay)) hs2l0s4mnSprNinug Icy Bottling Co hl23 3d Dolinsky Leon (Sophie) dry gds 418 Poplar r243 Ross av (NH) Dodd Claud L r533 Elm Dolley Edw (c) rl23 Chestnut Dolman Danl (c; Hattie M) lab hl06 Dodd Doris (wid Horace) rl515 2d (4) Toombs (SM) Dodd Edna Mrs slswn Lerner Shops r 130 IHigh Dodd Henry O bkpr Ga Peach Growers Exch r632 Forsyth Dodd Henry S steelwkr Taylor Iron Wks & Sup Co r533 Elm Dodd John S (Alma) elk T M Raines Gro Co h903 New Dodd Julia B Mrs h632 Forsyth Dodd Robt (Edna) slsmn rl30 High Dodd Wm A r533 Elm DDooddddsardSamIsiaaDc ((cE)lizr34F4) Gslislmmner Macon Feed & Seed Store h732 Ridge av (V) DODGE BROTHERS MOTOR CARS, Steve M Solomon Jr Distributor 462 Broadway, Tels 4956-4957 (For further information see right side lines and page 4 Buyers' Guide) DODGE BROS TRUCKS, Steve M Solomon Jr Distributor 462 Broadway, Tels 4956-4957 (For further information see right side lines and page 4 Buyers' Guide) Dodge Mary E R Mrs slswn Burden Smith & Co r305 College apt 7 Dodgen Hugh S (Mabel) slsmn Ga Power Co h99 Osborne pi Doggett Chas E millwkr rl325 3d Doggett Wm T (Mary F) millwkr rl314 3d Dogwood Mary (c) cook h208 College Dogwood Susie (c) tchr Hazel St Sch r 20 College Doihn Adolph (Cassie A) formn Macon Cabinet Wks h221 Lawton av Dohn Adolph jr (Willene F) slsmn A S DoHhantcChearrl C(oJulhi7a11K)CpolrleesgeMacon Cabt Dolman Frank (c; Mary) lab hl08 (2) Toombs (SM) Dominey Eliz nurse County Bd of Health Domingos Alice student rl06 Hines ter (V) DoCmoifnGgaoRs yAlro7n1z6o FMors(yLtuhcia C) chf elk Domingos Angus B (Florence) hl03 iVineville av (V) Domingos Angus B jr student rl03 Vine- ville av (V) Domingos Ann M student rl06 Hines ter (V) Domingos Florence student rl03 Vine- ville av (V) Domingos Helen A (wid John W) r593 Carling av Domingos Isaac L (Alice) sec-treas G G Hardeman Co h!06 Hines ter (V) Domingos Jas M (Gladys) civ eng r224 Georgia av Domingos Karl K pharm Chapman's Pharmacy hi 09 Buckingham pi (V) Domingos Karl K jr mach CofGaRy r 109 Buckingham pi (V) Domingos Marjorie student r838 Winton Domingos Mary A rl09 Buckingham pi (V) Domingos Robt B (Ethel; Ga Auto Co) h838 Winton av Domingos Roy student rl06 Hines ter (V) Domingos Walter D (Charlotte M) elk WPA h593 Carling av Donahoo Jos (Gladys) slsmn Stansell Potato Chip & Sandwich Co h304 Mikado av (SM) Donahue Maggie Mrs r525 Mulberry Wks h815 Hemlock Donald Albert pkr rl26 Mill av Dohn Julia K Mrs v-pres Macon Cabt Donald Henry driver r757 Pine Wks h815 Hemlock Donald J W elk Standard Parts Co r Dohn Philip H (Mary W) sec-treas Ma- Bloomfield rd con Cabinet Wks h202 Beech av Donaldson Annie (c) nurse 164 Lynwood Dohn Willene F Mrs sten Bankers av (V) h do Health & Life Ins Co h'711 College Donaldson Battie G (Carmine) metal Doke Addie Mrs rlllS Ash Doke Dora E Mrs h613 Arch wkr Bartlett Sheet Metal Wks h411 Winship (WH) Doke Edw C collr Union Fum Co r611 2d Doke Eva bndrywkr J W Burke Co r613 Donaldson Eulia B (Lilia) millwkr Willingham Cotton Mill r243 Duncan av Donaldson Jarel (Maxine) junk h71 Arl- Arch ington pi Doke H Lane (Leslie) hlpr A B Lee Donaldson Jean bkpr Dunlap Chevrolet Plmbg & Htg Co h855 New Co r70 Arlington pi 117 ROBERT O. THOMAS 569 % Cherry St. REALTOR Telephone 1067 Donaldson Jesse (c; Theresa E) janitor Ga Academy for the Blind hl35 Middle (V) Donaldson John B student r774 Mulberry Donaldson John H (Maxie; Bibb Auto Wrecking Co) rl04 Culver (V) Donaldson Milton (Cath) r216 Ameri- can blvd Donaldson Newton J slsmn r411 WinDosnhaiplds(oWn HR)evester V lab hl21 Thomas Donaldson Sidney L (Dovie) millwkx h 26 Blossfield (AM) Donnan Albert B (Mary F) loco eng h 106 Dell way Donnan Ernest A (Laura) formn Bibb Mfg Co h404 (410) Montpelier av Donnan Homer E (Nell C) pricemn Mc- Kesson-Riley Div h469 Duncan av Donnan J Edwin student r404 (410) DoMnonnantpeMliielrdreadv student r469 Duncan av Donnelly Anne (wid Thos M) rl47 Park pi Donnelly Bertha rl47 Park pi Donnelly Elia r!47 Park pi Donnelly Eliz student rl24% Cole Donnelly Gladys H Mrs elk Crescent Lndry Co r385 Orange Donnelly Marvel Mrs slswn W T Grant Co r Pine Donaldson H Edw (Ruth) millwkr Will- ingham Cotton Mill r226 Duncan av Donovan Patk J butcher rll57 Elm Donovan Produce Co (Wm Donovan) 659 Poplar Donovan Wm (Jetta; Donovan Produce Co) h470 Orange Donthit Carl elk Sears Roebuck & Co r RD 2 Dooley C Manell sten rl25 Virginia av Dooley Claud W (Lessie L; Macon Cas- ket Co) hl25 Virginia av Dooley E Jos lab Macon Casket Co rl25 Virginia av Dooley Ralph E trmr Macon Casket Co rl25 Virginia av Doolittle Edw B (Georgia) r544 Log Cabin blvd Doolittle Ralph r544 Log Cabin blvd Dopson Jas M (Lois) detective Police h Do7r2m8 aCnolCleligfeford C (Winifred) inspr C ofGaRy h262 Jeff Davis (SM) Dorman Earlie (Beatrice) blr mkr Cof Ga Ry h201 Lee (SM) Dorman Eula Mrs fctywkr Hopp Bros Co r821 Cherry Dorman Lillian B r262 Jeff Davis (SM) Dorman Oliver driver r201 Lee (SM) Dorman Olivia (wid Charlie) r201 Lee (SM) Dornhart Carl (Ruth C) dept mgr The Dannenberg Co h81l Poplar apt 7 Dornhart Emily student r811 Poplar apt 7 Dorough Augustus B Rev (Emily) pastor Mikado Baptist Church h602 Mikado Dorough Carswell student r602 Mikado Dorr Carl slsmn r302 Bend Dorsay Eldora (c) lndrs hl4 (154) Par- adise al Dorsay Frances student rl40 Jefferson Dorsay Vera (c) maid rl4 (154) Para- disc 3/1 Dorsett John G (Ida L) ins Henry W El- kins h325 Vineville av (V) Dorsett Mildred Mrs sten Central Cot- ton Oil Co r763 2d Do1rsstett Millard G mach CofGRy r554 Dorsett Nina M (wid John G) tchr PS r6 Drury av (I) DoCrosetrt WRDR4Mrs elk Sears Roebuck & Dorsett Wm R electn Ga Power Co Dorsey Alberta (c) h401 Peachtree (E M) Dorsey Danl B (Effle) slsmn Dannen- berg Co h211 (220) Villa Crest Dorsey Harriet (c) h448 Coles al Dorsey Henry (c; Ruby) lab h262 Broad. (EM) , Dorsey Jacob (Lilly M) lab Macon Mill- ing Co roll Hazel Dorsey John (c; Mary) lab h202 Toombs (SM) Dorsey John (c) student r262 Broad (E M) Dorsey Julia (c) maid r448 Coles al Dorsey Lou (c) r538 Grant Chapel al (SM) Dorsey Mamie L (wid Sami) h310 Ran- dolph (EM) Dorsey Nettie C (wid Wm E) mgr Massee Apts h401 college apt 2G Dorsey Otis (c; Hattie) lab h243 Morgan av (WH) Dorsey Rebecca (c) maid rill (157) Elizabeth (SM) Dorsey Sol (c) lab R C Cropper Co r234 Plant (SM) Dorsey Wm (Lula) emp CofGaRy Dorsey Wm (c) lab rl07 Roff Home av (V)' Dorsey Willie M (c) cook h814 Edge- wood av Dortch Russell (Eura M) h'554 Plum Doster Allie M (wid Jefferson A) rl36 Hines ter (V) DOSTER PAUL J (Mary W), Sec-Treas Murphey, Taylor & Ellis Inc and MortgTaegle4I5n8v3estment Co, hl08 Alabama av, Dotson H A (Hazel) r301 Cherry Dotts Howard F (Pauline M) flagmn MD&SRR hl41 Piedmont av Doty Henry J (Edith) h210 Park (I) Doty Jas C (Carine) carp r553 Walnut Doughlas Mollie (c) maid h303 Blount Doughtie Claude H (Lucile) mgr Otis A Murphey Co Inc h99 Vineville av apt C4 Douglas Anice elk Lanier High Sch for Boys r High Point Mineral Wells Douglas Bessie (c) lab h436 (417) E Academy (EM) Douglas Building 351 Broadway Douglas Cortez M student rl02 Pineview Douglas Eliz R rl02 Pineview av Douglas John W (Cassie L) formn hl02 Pineview av Douglas Lily (c) r436 (417) E Academy (EM) Douglas Nellie (wid Wm W) r558 Hemlock Douglas Wm (c; May B) lab hll5 Hicks al Douglass Annie B marker Snow's Lndry & Dry Clng Co r750 Pine DoHuogtleals)s Ch8h5a9s PHine(c; Fannie; Douglass Douglass Chas H jr (c) billiards 361 Broadway r859 Pine Douglass Hotel (c; Chas H Douglass) 363 Broadway Douglass Hotel Grill (c; Chas H Douglass) restr 363 Broadway DDoouuggllaassss JMosaryD I(EmualarkMer) Shn7o5w0'sPiLnnedry & Dry Clng Co r750 Pine Douglass Theatre (c) Mallory P Jackson mgr 357 Broadway Douglass Vinson B (c; Pearl) woodwkr Stroberg Body & Fender Wks h201 Mutual av (V) Douse Susie M (c) rl67 Hilliard al Douthit Hyram C appr CofGRy Dove Wm B (Jean) phys 617 Mulberry R215 hl27 Curry pi (NH) Dover Gladys Mrs fctywkr r23 Bellevue rd) Dover Mary Mrs millwkr Bibb Mfg Co r 158-59 Comer ter (PM) Dover Sidney E millwkr r21 Grand av Jit? Consult ' the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 118 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Dover Sidney J (Cora L) millwkr h21 Grand av Dowdell Earlie (c) lab h219 Pear (EM) Dowdell Eli (c; Mardena) h348 Flanders (EM) Dowdell Eloise (c) r348 Flanders (EM) Dowdell Jos (c; Estella) hl03 Rose Crest av (SM) Dowdell Luther (c; Lillie) lab Cenxtra,l Sash & Door Co h310 2d av (SM) Dowdell Ola M prsr Snow's Lndry & Dry Clhg Co rl03 Rose Crest av (SM) Dowdell Sami (c) lab Willingham Sash & Door Co i310 2d av (SM) Dowell Kane M (wid Alex) h304 (316) Hill Crest av (CH) Dowell Spright (Camille) pres Mercer University h'501 Adams Dowell Spright jr asst embalmer Hart's Mortuary r501 Adams . Dowell Thelma (c) student r520 Monroe Downer Julius (c) busmn r268 1st av (V) Downey Gertrude technician Dr Jas A Fountain r533 Orange apt 20 DoPwanrkie Bros Circus 1th at Central City Downs J Bradley receiver Fourth Natl Bank r Tiftori Ga Downs John (c) lab hl38 (434) Tinsley la) i Doyle Andrew (c: Nettie B) caulker City Water Wks Shop h'635 4th av (WH) DOYLE EDWARD B (Reba P), U S Marshal, 325 Federal Bldg, Tel 6411, r 306 Buford pi, Tel 4193 Doyle Jack (Wynona T) r319 Walnut Doyle Robt O dep marshall r306 Buford DoIpylle(VW)alter student r629 Adams Dozier Claudie Mrs r559 Oglethorpe Dozier Early L Rev (c; Lillian) hl08 Forest av (V) Dozier Edw (c) lab CofGaRy r237i Riley Dozier Eug R (Leola W) asst wire chf WUTelCo h424 Log Cabin blvd Dozier Eug R .ir (Frances) rl63 2d Dozier Geo (c) lab x237 Riley av Dozier Geo I (Rose M) loco eng h814 Cherry Dozier Hazel student r401 College apt 4F Dozier Jane (c) lndrs h23!7 Riley av Dozier Mary tchr r424 Log Cabin blvd Dozier Ruth, millwkr Bibb Mfg Co rll7 2d DoLzoiegr CWabiEndwblv(dFrances) ins agt r424 Dozier Warren C (Annie M) loco eng h 855 New Dozier Warren C jr (Charlie M) slsmn r855 New Dozon Fannie (c) cook h526 Calhoun Drain Chas (c) r554 Smith row Drain Hattie (c) h554 Smith row Drake Archie A (Mary) v-pres-sec Bibb Mfg Co h327 Hill Orest av Drake Raleigh M (Irene) asso prof Wesleyan Coll h210 Berkley dr Drake Wm F (Hattie D) hl31 Rose Park Drake Wm J (Pearl) mill wkr h31-34 Melrose (B) Drake Wm N (Estil S) emp SBT&TCo r226 North av (NH) Draper Sami (c; Rosa) lab h417 (328) Elizabeth (SM) Drawhorn Horace H rl054 Ash Drawihorn Ira J (Eula) carp hl329 3d Drawhorn Jas A millwkr Willingham Cotton Mill rl054 Ash Drawhorn Jas M msngr rl329 3d Drawhorn Jos W msngr Postal Teleg- Cable Co rl329 3d Drawlhorne B Jos (Hazel S) lab Will- ingham Sash & Door Co r594 Duncan Drawhorne Hazel S Mrs asst dept mgr F W Woolworth Co r594 Duncan av Drayton Gena (c; Annie) lndrs rl06 Smith (EM) Drayton Roosevelt (c) lab CofGaRy Drew Arth S (Abbie C) cabtmkr Will- ingham Sasih & Door Co r324 Cleveland (SM) Drew Martha E r904 New Drew Sallie (wid Thos C) h751 College Drew Thos A (Edna) guard City Stockade h904 New Drew Thos H (May B) loco eng hll5 (109) Montpelier av Driggars Annie B Mrs elk WPA hl36 (102) Colquitt Driggars Seymour B (Annie B) pipe ftr hl36 (102) Colquitt Driggars Seymour B jr student rl36 (102) Colquitt Driggers Annie (wid John) r318 Hydrolia (EM) Driggers Jack D (Recie L) atndt Standard Oil Co hl57 1st Driggers Pearl (wid Kelly) millwkr Bibb Mfg Co h29 Bibb av Drinkard Willard N (Marie) dist supvr WPA rl30 Cleveland av (V) Drinnon Everett S (Mattie) slsmn Yates & Tabor Co to533 Orange apt 19 Drinnon Jas R r97 Clayton (V) Drinnon Nellie C elk r97 Clayton (V) Drinnon Virginia R student r97 Clayton Dr(iVnn) on Wm C (Mamie) dep elk County Tax Collr h97 Clayton (V) Drinnon Wm M (Callie) engr Macon Teleg Pub Co hl37 Culver (V) Driscol Mamie L (c) emp Central City Bag Co Driscoll Claudie M (c) maid rll8 (554) Magnolia la Driscoll Jas (c; Cornelia) porter rl34 Pecan av Driscoll Robt (c; Willie B) lab h355 (456) Alabama (SM) Driskell Allen (c; Minnie L) sta firemn h405 Henderson (SM) Driskell Andrew (c; Willie M) lab rll4 5th Driskell Bernice (c) lab h300 (200) Smith (EM) Driskell Beulah (c) smstrs h302 (303) Crisp (SM) Driskell Elmer (c; Mamie) lab rll6 5th Driskell Hattie (c) lndrs rl02 (202) Elliott (EM) Driskell Jacob (c; Amie) porter h597 (503) Smith (EM) Driskell Nathaniel (Ida) lab h.233 Forest av (B) Driskell Viola (c) maid r3 Woodcliff Driskill Jesse E (Allie M) hllO Ormond Driver Chas (c; Mattie B) lab h607 (683) Elbert (SM) Driver Curtis millwkr Atlantic Cotton Mills rl9 Atlantic Village Driver Lester millwkr Atlantic Cotton Mills hl9 Atlantic Village Driver Mary smstrs Snow's Lndry & Dry Clng Co r505 Moore av Dryb Walter (Marion) tchr hl740 Broadway Dryer Sarah (c) lndrs rl232 Broadway Duberry Ophelia (c) maid h93 Harris al Dublin L Roy (Leva S) mgr WUTelCo h 122 Boulevard (NH) Dublin Leva S Mrs br mgr WUTelCo h 122 Boulevard (NH) Dubose Betty B student r713 Cherry DuBose Edwin A (Ida M) collr Macon Telegraph h424 Calhoun DupBelolse(SEMrn)est (Martha) lab h319 ChapDubose Ella (wid John S) h7'13 Cherry Dubose Flemon I (Nellie) millwkr Bibb Mfg Co hl77 Gardner (PM) DuBose Howard (Ellen) millwkr Bibb Mfg Co hl43 Comer ter (PM) 119 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Dubose I Boyd (Marie L) cond h713 Cherry DuBose J H & Son (Jas H and Winston H DuBose) junk 121 Poplar DuBose Jas H (Mary C; J H DuBose & Son) h765 Mulberry Dubose John A fctywkr Bibb Mfg Co r 10 (9) Lake City (EM) DuMbofgse CJoohhnlOH (9()AlLmaakeR)Ciftcyty(wEkMr )Bibb Du(BSoMse) Louis (Maggie) h320 Chappell Dubose Mabel r713 Cherry DuBose Marie tchr PS r713 Cherry DuBose Marie L Mrs instr City Play Grounds Supvr h713 Cherry DuBose Marion G r320 Chappell (SM) Dubose Matthew (Clara) pntr hl05 May DuBose Theo P (Hasseltine) pharm hllO Holt av (V) DuBBoossee &WiSnosnto)nhH202(SPairearicheLa;vJ (HV) DuDucan Jos (c; Annie) lab h728 (638) Dudney Donald millwkr r598 Boulevard Du(fNfeHl)l Gordon (Helen C) student rl502 Vineville av (V) Duffell Helen C Mrs r517 Napier av Duffell Jack W (Marjorie M) rl30 Rem- bert av Duffell John W (Marjorie H) student rl502 Vineville av (V) Duffell Richd student rl'502 Vineville av (V) Duffell Richd S (Eliz M) vet 659 Broad- way hl502 Vineville av (V) Duffell Wm (Ruby) pdlr h459 Jeff Davis (SM) Duffey Prances Y (wid Philip C) r868 1st Duffey Louise tchr PS r225 Masonic Home rd (NH) Duffey Robt G (Clara) elk h225 Masonic Home rd Duffy Paul A (Lois; Sugar Bowl) rl43 Magnolia no -- 21 M'S ^ fl Prince (SM) Duck Cosby (c) cook r816 Ash Duck Tommie (c) maid h816 Ash Duck Wm (c) delmn Danl E Hudson r Dugan Henry (c) lab r235 Woodcliff Dugan Lela (c) lndrs h235 Woodcliff Dugard Chas W millwkr Bibb Mfg Co ihl70 Gardner (PM) P 5 w 816 Ash Ducker C L Mrs hsekpr 106 (170) Cher- okee av Ducker Carolyn A tchr rl06 (170) Chero- kee av (CH) Ducker Clotilda (wid Wm J) rl06 (170) Cherokee av (CH) Ducker Wm J Rev pastor Lutheran Oh of The Redeemer hl06 (170) Cherokee av (CH) Duckett Sarah J (c) r601 Straight (U) Duckworth Jesse M (Annie B) city firemn h467 Duncan av Duckworth Malcomb L (Kath) city firemn rll4 Brentwood av Duccaknwoavrth Martha E student r467 DunDuckworth Mary sten r2009 2d DuMckfgwoCrtoh rR55o6btPBineauto mech Colbert Duggan Chas A elk Hotel Lanier r Jeffersonville Ga Duggan Lorenz A (Edna) mgr Loose DuWggilaens BRioscbut itSC(oBrelrlt4ha)RoeglekrsRayvMS(V)r Jeffersonville rd Duggar Jesse (c) lab r238 Collins pi DuMggaettrheDwusdleIyncB h(2W01iniFfroerds)ytshlsmn R H Dugger Jas G (Mamie M) h519 Johnson av (HH) Dugger Jas G jr store mgr Rogers Stores r519 Johnson av (HH) Dugger Sara L private sec Dun & Brad- street Inc r519 Johnson av (HH) DuSigpirnins gIrlvain (c; Rosie) lab hll8 (5) Duhart Anderson (c; Mary) lab h238 1st av (V) ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT. EM. gr. YOUR CITY Dudley Andrew (c; Indiana) lab hl309 Broadway Dudley Averilla M (wid Chas) h219 Duhart Annie (c) lndrs r275 2d av (V) Duhart Asa C (c) lab r238 1st av (V) Duhart Ezra (c; Annie R) porter King- (120) Cutters la (EM) man & Everett Inc r211 (79) Craft D Dudley Betty (c) smstrs Dixie Jobbing (V) DuHdoleuyse Carrie (c; Martha) lab hl38 Duhart Ezra (c) lab h238 1st av (V) Duhart Geo (c; Lena) driver h355 Ham- I Roosevelt av (V) mond Dudley Charlotte (c) r321 (214) Ernest (OH) Duhart Henry L (c) hl61 Phillips al (S M) Dudley Elijah Oc; Pearl) lab Taylor Iron Duhart Jas lab Macon Gas Co rl46 (132) R E Wks & Sup Co hl236 Broadway Phillips la (EM) Dudley Ennis (c; Mattie) lab r207 Or- Duhart John (c) student r238 1st av (V) ange Duhart Johnnie M (c) r220 Jordans al C Dudley Eug r2218 2d Dudley Prank (c; Marie) lab h553 Dun- lap al Dudley Geo L (c; Mattie) auto repr 1016 Main (EM) h do Dudley Jas (c) lab r603 Straight (U) Dudley Jewell Mrs smstrs h2218 2d Dudley Jos (c) lab r603 Straight (U) Dudley Lenora (wid Marion S) h594 Duncan av Dudley Lilia (c) h420 Hawthorne Dudley Maggie (c) lndrs h957 Hazel Dudley Mary (c) maid r603 Straight (U) Dudley Mazie (c) lndrs h402 (509) Prince (SM) Dudley Pearl emp Snow's Lndry & Dry Clng CP rl236 Broadway Dudley Ree emp Snow's Lndry & Dry Clng Co ro55 Cotton av Dudley Robt (c; Carrie) cook hl02 (342) Grant av (V) Dudley Robt (c; Gertrude) lab h321 (214) Ernest (CH) Dudley Robt jr (c) lab r321 (214) Ernest (CH) Dudley Zella (c) maid A G Rhodes & Son h204 Grant av (V) (SM) Duhart Marion (c) millwkr Bibb Mfg Co r238 1st av (V) Duhart Mary (c) student r238 1st av (V) Duhart Rivers (c) lndrs r220 Jordans al (SM) Duke David (c; Lily) blksmith h267 (663) Hall (EM) Duke Fredk C (Rebeca) pdlr r304 Fair- mont av (B) Duke Jack waiter r Hotel Fickling DuMkeulbNeircrhyolas (New Life Lunch) r510 Duke Patk electn Hotel Lanier r525 Mul- berry Duke Warren N (Nora) stone ctr hi Bond Dukes Alton A wldr rll2 Gant (EM) Dukes Cecil elk r500 Edgewood av (SM) Dukes Collis N (Elise D) agt Carolina Life Ins Co r8'51 Hemlock Dukes Gertrude Mrs millwkr Bibb Mfg Co r520 (552) Oglethorpe Dukes Jas M (Rosa) h235 Cutters la (E M) Dukes John millwkr Bibb Mfg Co r520 (552) Oglethorpe T O R Y MIRRORS the Industrial LIFE Of Your CITY 120 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON ARLINGTON HOTEL FREE STORAGE BMRoOdeArDn WaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. Dukes John H (Willie) hll2 Gant (EM) Dukes Jos driver r313 Cherry Dukes Louie M (Iris) millwkr Bibb Mfg DuCmoashlAl2nniCeoRmesrtutdeernt(Pr4M20) Calhoun Dumas Chester M (Lucy B) gro 704 Hawthorne h859 2d Dumas Clement student r420 Calhoun Dumas Daisy (c) maid r61 Craigs la (S M) Dumas Danl (c; Mamie) diriver r810 Ash Dumas Easter (c) r807 Edgewood av Dumas Edw (c; Lizzie) porter hl06 (300) Spring la Dumas Fannie (wid Stanley) h435 Vine- ville av Dumas Georgia M (c) student r921 Oc- mulgee Dumas Gussie r420 Calhoun DuPmopaslarHar4m2l0et CHalh(oMunarcella) restr ft Dumas: Helen (c) maid r61 Craigs la (S M) Dumas Jas (c) pdlr r56 Craigs la (SM) Dumas John H (Blondina) lab Barfield Feed Mills r RD 1 Dumas Laura (c) maid rlOll Elbert (S M) Dumas Lillian (c) h274 Madison Dumas Louise (c) rl28 (1) Fulton al Dumas Louise (c) Indrs h603 Straight Du(mU)as Maude W (wid Wm C) slswn Mrs Alice V Walker h420 Calhoun Dumas Nora (c) hl38 (150) Washington (EM) Dumas Orasten Ga Power Co rl357 Ogle- thorpe Dumas Robt (Willie M) lab Barfield Feed Mills r RD 1 Dumas Thos (c; Gertrude) lab CofGaRy hl43 (301) Nussbaum (SM) Dumas Thos C (c) hl5 Spring Dumas Viola (c) cook h921 Ocmulgee Dumas W Carlton (Lillian) eng h723 College Dumas Wm prsr Hill Dry Clng Co r420 Calhoun Dumas Wm P (c; Fannie) lab rl38 (150) Washington (EM) DUN & BRADSTREET INC, James B Felmet jr Mgr, The Mercantile Agency, (Suite 709-10 Bibb Bldg 403 Cherry, Tel 184 Dunaway Ralph T (Grace) lawyer 403 Cherry R705 h855 Mulberry apt 303 Dunbar Chas C (Lizzie) h209 Williams (SM) Dunbar John G (Julia B) hl08 2d Dunbar John W (Stella A) loco eng h 166 Virginia av Dunbar Sarah H (c) h61 Spring Duncan Arth L (c; Willie B) lab hll3 Rose Crest av (SM) Duncan Beulah (wid Donald S) r756 New Duncan Carrie (c) maid r207 Madison Duncan Ella (c) r3 Harris Duncan Eister (c; Viola) loco firemn h 520 Hawthorne Duncan Frances r207 Vista cir Duncan H S emp Happ Bros r315 Mulberry Duncan H Levi (c; Emma) hl25 Ward (V) Duncan Jas (c; Bessie) lab r949 Pio Nono av (V) Duncan Jas D (c) lab Natl Handle Co r333 Gilmer Duncan Lee R (c; Arizona) carp h201 Ward (V) Duncan Louise (c) Indrs r304 (450) Elizabeth (SM) Duncan Lynnwood (c) h333 Gilmer Duncan Maggie (c) maid Ga Academy for the Blind r247 Madison Duncan Malachi (c; Jonever) delmn Wm Davis h306 Coles al Duncan Malachi jr (c) lab r308 Coles al Duncan Mall (c) lab CofGaRy Duncan Marshall (c; Annie) hlpr Ga Roofing & Sup Co rl05 Tindall av (S M) Duncan Mary (c) Indrs rl43 Forsyth la Duncan Millard S (c) dean Beda Etta College rlOO Grant av (V) Duncan Nell sten r218 Georgia av Duncan Riley (c; Gussie) lab h432 Lawton av Duncan Rosa (c) lab r317 Harris la Duncan Sallie M (c) cook rl02 Tindall av (SM) Duncan Seaborn (c) lab r356 Madison Duncan Verna (c) smstrs Dixie Jobbing DuHnocuasne Whiteford W (Myrtle) slsmn h 2071 Vista cir Duncan Wm (c; Hattie) lab r815 Elbert (SM) Duncan Wm (c; Pearl) porter D H Adams Motor Co hl56 Phillips al (S M) Dungan L Glenn agt Gamble Motor Express r Capitol Hotel Dunham Bertha (c) maid r203 (118) Bowman (EM) Dunham Chas L mach CofGaRy Dunham Fred (Rhunette) r858 New Dunham Hilburn H (Loleita) hlpr Ga Power Co rl22 Cole Dunham Howard H (Ethel) printer h 1020 Whlnut Dunham Jack student rl020 Walnut Danker Leroy W (Sadie) signalmn h 2648 Houston av (SM) Dunklin Lee r219 High DUNLAP CHEVROLET CO, Robert C Dunlap Pres, Durward Watson Sec and Treas, Sales and Service, Good Used Cars 620 3d, Tels 2297-2298-2299 (For further information see right side lines and page 3 Buyers' Guide) DUNLAP KINLOCH F (Marie W), Mgr The Dunlap Roofing Co, h37 Arlington pi, Tel 1931-W DUNLAP KINLOCH F JR (Nell; The Dunlap Roofing Co), h37 Arlington pi, Tel 1931-W Dulentlta/sp 1M'3, ary (c) Indrs rll9 (100) BartDUNLAP-PEELER HARDWARE CO, Aaron M Peeler Pres, Thos B Peeler V-Pres, Chas W Johnson Sec-Treas, L FSuponrdteinrbguGrkooMdsg, rP,aiGntesn,eBraulildHerasr'd, Fwaarrme, and Electrical Supplies, Cherry Southeast cor Broadway, Tels Store 26, Offriicgeht73t6op(Flionresfuarnthderpaingfeorm16atiBounyesrese' Guide) Dunlap Robt C (Annie W) pres Dunlap Chevrolet Co r Shirley Hills DUNLAP ROOFING CO THE (Kinloch F Dunlap Jr), Roofers, Bldg Materials and Supplies and Fire Extinguishers, Overhead Doors, Office and Warehouse 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) Dunlap Wm H elk r37 Arlington pi Dunlavey G Thos (Sou Investment Co) r RD 2 Dunn Annie L (c) maid h771 Ash Dunn Chas G (Jessie) millwkr Bibb Mfg DuCnon hCl3h7as CHom(MerartgetrM()PMde)p collr XJ S Internal Revenue r644 Forsyth Dunn Elery (Bernice) millwkr Bibb Mfg Co h26 Bibb av Dunn Eliz Mrs slswn Standard Stores Inc r722 Mulberry Dunn Ellis H (Myrtice) carp CofGaRy h 218 Georgia av Dunn Emma (c) h506 (119) Elliott (EM) Dunn Geo H Rev (c; Willie M) presiding elder h611 3d av (V) 121 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AYE. PHONE 3176 Dunn Georgia (c) lndrs rl233 Broadway Dunn H L (Bessie M) h223 Boulevard Durden Andrew B (Pearl M) mach hl25 Piedmont av Durden Andrew C (Ruth D) supt Metho- Dunn Janie (c) maid r500 Campbell av Dunn Jesse W (Mary) policemn hl61 Nelson (SM) Dunn John H (Annie L) mach CofGaRy hll6 Tenney av (SM) Dunn Jos (c; Luella) porter J S Waldorf & Son M30 Pebble (SM) Dunn Leon (c; Aurelia) cook hll02 Oc- mulgee Dunn M Prances rll6 Tenney av (SM) Dunn Myrtiee Mrs fodg 218 Georgia av r do Dunn Reuben (c) lab r240 Middle (V) Dunn Roy L jr (Helen) 2d hd clothes 1749 Broadway hl08 Curry pi (NH) Dunn Sol (c; Eliza) h511 E 1st (EM) Dunn Thos (c) janitor Community Sav & Loan Co r514 (112) Elliott (EM) Dunn Wm H (c; Elma) driver r611 3d av (V) DUNWODY DANIEL D (Mary), County Tax Receiver, Court House, Tel 1084, h214 Corbin av (V), Tel 5983 Dunwody Howard R (Mary) office eng City Eng hl85 English av (V) DUNWODY ISAAC L, Permanent Tax Assessor City of Macon, r212 Spring, Tel 2139-J Dunwody Kate Mrs h212 Spring Dunwody Kenneth W (Pauline) supt h Rivoli dr Dunwody W Elliott jr (Mary B) archt 460 Broadway h Rivoli dr Dunwody Wm E (Bessie W) pres Standard Brick & Tile Co r Rivoli dr Dunwoody J Marion ins agt r371 1st Dupree Ada r274 Columbus DuPree Barber Shop Wm E Floyd mgr 510 2d DuPree Carrie cash DuPree Barber Shop tr755 Poplar DuPree Doris H (wid Emmitt J) tchr PS hi 24 Glynn av DuPree Eliz cash r3809 Houston av (SM) DuPree Eliz fctywkr Happ Bros Co r 755 Poplar DuPree Ernest (Lona) lab r355 Walnut DuPree Ernest L bkpr Bankers Health & Life Ins Co hl03 Capitol av (Mikado PI) DDuupPrreeee JJeassse T(Idha2)01labDru2n7c0anAsatovr (EM) Dupree Jesse P (Alma L) blrmkr CofGa Ry r3329 Houston av (SM) DudridstenOrpAhnannesttHeomseturd2e01ntPier2rc2e2 av(2(5V8)) Church (EM) Durden Arth (Anna M) roofer rl318 3d Durden Augustus (c; Emma) lab rl04 (4) Alabama (SM) Durden Beni W (Della) lab h312 Melrose (B) Durden Bessie Mrs rll3 (114) Duncan av Duhr2d2e2n C(2a5r8l) BCh(Muracrhie)(EmMa)ch MD&SHR Durden Danl B (Mattie) h369 Marion av Durden Danl B jr r369 Marion av Durden Eldora S (wid Jas) rl29 Knott (SM) Durden Elmer E (Allene E) mill wkr h 106 American blvd Durden Emma (c) emp Snow's Lndry & Dry Clng Co rl04 (4) Alabama (SM) Durden Esther 869 Orange Durden Evelyn G mill wkr r7 Randolph DuPriden Geo (Mary L) h305 Church (EM) Durden Geo (c: Mattie) lab r302 Coles al Durden Henry W fish 216 Lynmore av r do Durden Irene Mrs elk WPA h420 Mikado av Durden Jas C (Alice) h210 Villa Esta Durden Jas T msngr Postal Teleg-Cable Co rl318 3th Durden John L (Mary) eng Buck Ice & Coal Co h506 Ridge av Durden John L (Stella) fish 216 Lynmore av h do Durden John M (Jennie G) h7 Randolph pl Durden John R (Emma) mill wkr Buil- ders Lbr Co h501 Fort Hill (EM) Durden John R jr (Sarah) baker Atkins Bakery r501 Fort Hill (EM) Durden Jos M garage hlpr Ga Power Co r399 (411) Montpelier av Durden Leon F (Irene) loco eng h420 Mikado av Durden Lewis F student r501 Fort Hill (EM) Durden Lonar H jr msngr CofGRy Durden Louise Mrs beauty opr Jozefs Permanent Wave & Beauty Salon rl56 Magnolia Durden Lucille sten Swift & Co r869 Orange DuPree John (Jessie) r755 Poplar DuPree John jr elk r755 Poplar Durden Lula (c) cook r502 (453) Alabama (SM) Dupree Luther (Mary) rl05 Willingham 66 Farren John J (Irene) adv mgr Union Dry Gds Co h797 Hillyer av (CH) Farren John J jr student r797 Hillyer av (CH) Farrer Chas (c) h315 Gilmer Farrer Gussie (c) h452 (25) Mitchell (EM) Fairres Aug W (Pearl E) sec-treas Car- buretor & Electric Service Inc h2400 Forsyth rd Farris Jack F slsmn R S Thorpe & Sons r841 Courtland av Farris Waldron sten-bkpr Lowe Elec Co r841 Courtland av Farris Walter L (Clara) tailor R S Thorpe & Sons h841 Courtland av Farrow Andrew C (Minnie) millwkr Bibb Mfg Co h413 Jackson Farrow Della (c) lndrs hl31 (122) Wood al Farrow Elmo C millwkr Bibb Mfg Co r 413 Jackson Farrow Felton (c) driver hl38 (130) Army Lot Farley Jas M r667 Elm Farrow Isaac (c) millwkr Bibb Mfg Co Farley John M (Johnnie O) wtchmn r rl40 (128) Army Lot ~ 667 Elm Farrow Martha E student r413 Jackson Farley Margt (c) cook rll5 Penn av (V) Farrow Mary (c) r596 (108.) Norris (EM) Farley Marie (c) maid rll5 Penn av (V) Farley Martha (c) lndrs hll5 Penn av Farrow Sami (c: Mattie) h319 (320) Short (EM) (V) Farley Richd jr (c) student r352 Monroe Farley Rosa L (c) maidJil04 Clemons la Farrow Vallie (c) nursemaid r531 (530) 3d av (V) Farrow Wm (c; Frances) lab h514 Wo- Farley Willie M (c) student rl22 Hill Farmar Charity (c) tchr h205 Ward (V) Farmer Amanda (wid Alonzo) h352 Fair- view av (EM) mack (EM) Fary Chas (c) r354 Church al (SM) Fary Steven (c; Maggie) lab h354 Church al (SM) Farmer Anna (c) hll2 (955) Ocmulgee la Farmer Bost (c) lab r226 Plant (SM) Farmer C Hall (Eugenia) phys h401 Col- lege apt 5G Farmer Chas 419 Poplar W (Erin) whol rubber hl30 Buford pi gdsK Farmer Frampton W (Helen C) dentist 700 Spring R315 hl22 Stanislaus cir Farmer Geo A (Annie) pntr h2314 2d Farmer Geo W student r2314 2d Farmer Hattie (c) r477 (466) Alabama (SM) Farmer Henry (c; Alice) lab h502 Charles (SM) Farmer Jas (c; Lucy) lab CofGaRy h 407 Charles (SM) Farmer Marjorie student r421 Adams Farmer Perry (c) lab CofGaRy Fary Wm (c) delmn r354 Church al (SM) Faulk Ada Cc) maid Maxwell Bros Furn Co h312 Madison Faulk Hallie Mrs pickers Macon Peanut Fa&ulkStHgeenrCyo Grl0(9Ma3rdy) elk h425 College Faulk Julia M (c) maid r721 Daisy (SM) Faulk Mahala (c) h462 (486) Clinton (EM) Faulk Wm (Marcia) carrier hll8 DeSoto FaPuIlk(VW)m (c; Lillie) lab CofGaRy h301 (250) Prince (SM) Faulkner J Lee (Thelma R) millwkr Bibb Mfg Co r523 Jackson Faulkner Mary (wid Henry J) h244 Washington av Fausett Eva rl45 Laurel av (NH) Farow Fannie (c) lndrs r504 (505) Edison (EM) Fausett J Albert jr (Ruth W) lawyer 566 Mulberry R9 r333 (395) Hill Crest av Farr Henry B (Willie L) millwkr h4 (CH) Grand av Fausett John D (Mary E; Whitman's Farr Henry T (Dollie E) textilewkr At- Pharmacy) rl40 Appleton av lantic Cotton Mill h223 American blvd Fausett Mary E Mrs opr SBT&TCo r Farr Jas B r4 Melrose (B) 140 Appleton av Faarlr Mary L (c) maid rl9 (427) Sparks Fausett Ruth W Mrs jr opr SBT&TCo r333 (395) Hill Crest av (CH) Farr Nettie F (wid Wm C) r336 Carling Favors Annie B millwkr Willingham av Cottpn Mill r205 (30) Holt av (NHts) Farr Noel (Anna) millwk Bibb Mfg Co Favors Cath student rl47 High hl45 Comer ter (PM) Favors Emma L (wid Jas W) r718 Pine Farr Ruth upt nurses Oglethorpe Pri- Favors G Dana (Doris) mach h718 Pine vate Infirmary Inc rl321 Oglethorpe Favors Homer (Sallie B) h201 College Farrar Alex (c) lab h216 Elliott (EM) Farrar Cora (c) h467 Log Cabin dr FaPviors Jas W formn CofGaRy Farrar Hattie (c) lab Central City Bag Favors John A (Fannie) millwkr Wil- Co h502 (402) Smith (EM) Farrar Homer (c) h769 (766) Ocmulgee lingham Cotton Mill h205 (39) Holt av (NHts) Farrar Margt rl308 Vineville av (V) Farrar Patience (c) cook 402 Montpelier Favors John G (Dixie M) policemn hl47 High Farra Ruth R elk Met Life Ins Co rl32 High Favors Nellie R millwkr Willingham Cotton Mill r205 (30) Holt av (NHts) S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 132 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLEr-BUICK--PONTIAC & CO. THIRD AT PINE GMC TRUCKS PHONE 5100 (Members N. Y. Stock Exchange N.ExTc.haCnogteton ChicagoTraBdoeard of AssNoEc. ixaYcteh. aMnCgeuemrbbers Local Stocks and Bonds Favors Robt H slsmn L B Price Mercantile Co r618 Pine Favors Wm B (Hattie) elk h219 Buford Fapvlor(sV)Wm W millwkr Willingham Cotton Mill rll8 (9) Holt av (NHts) Fay Geo J (Ruby B) chef Hotel Demp- sey-Dining Room hlOl (25) Avon rd Feagin Edw F drftsmn rll5 Ninadell dr Feagin Eliz M (wid Robt K) tchr PS h 129 Jefferson; Fenn Mattie smstrs r23 Bellevue rd Fennell Addie (wid Chas) fctywkr Happ Bros Co rl743 Broadway Fennell Estelle P (c) h416 (417) 3d av (V) Fennell Sula (c) maid rl016 (1017) Cole- man's la Fennell Henry r315 Mulberry Fennell Jas (c) rl016 (1017) Coleman's la Fennell Jas (Ruth) rl57 1st Fennell Oluis L store mgr Tinsley's Gro- Feagin Harriet E sec Macon Typewriter cery & Market r315 Mulberry Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds & Office Sup Co r310 Duncan av Feagin Lillie (wid Brantley) h310 Dun- can av Feagin Ned driver City r221 Georgia av Feagin Owen T (Eva F) mach CofGaRy hllb- Ninadell dr FEAGIN R DOUGLAS HON (Janette), Judge Municipal Court, Bibb County Court House, Tel 2381, h204 Vista cir, Tel 5841 Feagin R Douglas jr (Elmina C) lawyer Fe1a0g5inCWottiollnie a(vc)RI2ndrrl4s0h6l2V5in(e2v)ilHleolamves av (V) Fears Edgar L (Clarisse) ins agt h99 Vineville av apt E4 Fenne & Beane Jasper T Hogan mgr brokers 363 3d Penney Wm (c) porter 1 Sparks al Ferguson Beatrice E jr opr SBT&TCo r 905% New Ferguson David C timekpr Sou Ry Sys- tem r363 Cherry Ferguson Estell (c) Indrs rl526 1st Ferguson Hazel Mrs elk r812 Napier av Ferguson J Oswald (Annie) millwkr AtFelrngtuicsoCnoJtatosnEMdilrlfstshm22n AWtlaEnltliicottVDilluange- wody jr r278 College Ferguson Janie C (c) tchr PS h310 For- est av (V) Ferguson John C (Hazel J) slsmn A G Feb Josephine S (wid Chas) hl63 2d Rhodes & Son h812 Napier av Bank Stocks FFeedb RLoilsleier!M63 2(cd) r246 (244) Church la (SM) FerrguCsoolnumKbuesnnredth B prof Mercer Univ Ferguson Lamar (Ruth) waiter Craw- 405 Ga. Casualty Bldg. Fed Wm (c; Janie) h246 (244) Church la (SM) FEDERAL BUILDING, Mulberry ne cor ford's Barbecue Lunch hl25 Inverness Ferguson Sami J elk r371 1st Ferguson Wyolene Mrs slswn Mayson's Phone 1681 3d Women Apparel h356 New apt 7 Feets Lucille (c) Indrs hT78 Lincoln av (V) Fernandez Lott P (Mildred E) mus tchr 909 Walnut h do Felder Allen (c; Leila) orderly h809 Ash FFeellddeerr CEhllaampLiornl2(0c) Hlaibners772teMr o(oVr)e al Ferree Lillie (wid Harry) r533 Orange apt 2 Ferrell Bessie (c) cook rl04 Amos (V) Felder Jennie (c) h255 Woodcliff Ferrell Eug (c; Mary) brklyr hl32 4th Felder Sami L (Hattie D) spl agt h405 av (V) Carling av Felder Thos S lawyer 516 Mulberry R906 r 525 Mulberry Felker Frances smstrs r406 Cedar (SM) Felker Wm M (Viola) lab h406 Cedar (SM) Ferrell John S (c) janitor r423 Ward (V) Ferrell Mamie (c) maid h423 Ward (V) Ferrell Ralph (c) chauf 257 4th av (V) Ferrell Robt G (Berta) h205 Nottingham dr (NH) Ferrill Margt S (wid Hampton L) h702 Felmet Jas B jr mgr Dun & Bradstreet Forsyth Who Inc h855 Mulberry apt 105 Feltner Mary (c) h28 (16) Mulberry la Felton Augustus C jr (Hattie C) pres Nye Odorless Incinerator Co h376 College Felton Evans (c; Ethel) glazier Willing- Ferry Hodges (c) h315 Gantt pl Ferry Zoina (c) r315 Gantt pl Fetner Emmett S r2601 Forsyth rd Fgtner Leo A (Louise W) formn CofGa Ry h312 Duncan av Sells It? ham Sasli & Door Co plant h501 E list (EM) Felton Geo student r207 Clayton (V) Felton Jay (c; Ella) hll5 Walls al (NH) Felton John (c; Leola) hlOl Mutual av (V) Felton John (c; Armelia) pntr h716 3d Fetner Leo A jr student r312 Duncan av Few Florence F student r208 Napier av Few Mark C (M Ethleen) h208 Napier Few Mark 0 jr reprmn r208 Napier av Few Wm E (Ida M) slsmn Steve M Solo- mon jr r320 Spirng Fick Edw N student rllO Buckingham Answered By the Classified av (V) Felton Leslie (c) pdlr h215 Fretwell Felton Mariah (c) smstrs WPA r714 3d av (V) Felton Robt L (c; Eliz) pntr h714 3d av (V) Felton Wm H (Louise) farmer h207 Clayton (V) Felton Wm H jr v-pres Middle Ga Pecan Growers Assn r207 Clayton (V) Fetlitcs HCoomttoenr (Mc;illHs athtliel6)2mOillcwmkurlgAeetlanFelts Julia (c) Indrs r250 5th av (V) Ficpkl P(Ve)ter N (Cecile) slsmn hllO (190) Buckingham pl (V) Fick Peter N III (Delores) slsmn Remington-Rand Inc r203 Clisby pl (V) Pickling Anna (c) r512 (110) Elliott (EM) Pickling Eva (wid Jerry L) h713 2d Pickling Rosa (c) rl066 Hazel Pickling Wm (c). carp r512 (110) Elliott (EM) Fickling Wm A (Claudia; Hotel Fick- ling) h510 Mulberry Business Felts Paul (c) porter Boyd Shoe Store FIDELITY PHENIX FIRE INSUR- r250 5th av (V) ANCE CO OF N Y, John E Wilson & Felti Wm (c) a-250 Powell (EM) Son Agents, 702-703 Bibb Bldg, 403 Lists Felts Wm (c; Maggie) lab h64 (133) Forest av (V) Cherry, Tel 214_ (For further information see bottom stencil and page 18 Fender Annie L Mrs fctywkr Happ Bros Buyers' Guide) In this Directory Co h562 Arch Fender Marvin S (Annie L) driver h562 Arch Fendt Esther (wid Walter A) r246 Jeff Davis (SM) Field Benj (c; Maria) porter hll6 (272) Singleton's la Fierdld Budd (c) lab r303 (205) Waterville Field Chas H R student r209 Cherokee Fenley Jas (c; Mary) lab r208 Elliott Field Edw G (Rose K) mach inspr Cof L (EM) GaRy hl28 (112) Colquitt 133 The World's Largest Siore SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Held Jos H pipeftr r209 Cherokee av Field L Fetner r209 Cherokee av Field Maude r209 Cherokee av Held Merrion E mach Taylor Iron Wks & Sup Co r209 Cherokee av Held Rosa (c) maid h303 (205) Water- ville rd Held Rose E slswn Collins Baking Co r209 Cherokee av Field Wm E formn CofGaRy h204 Cher- okee av Helding A Josephine student r206 Na- pier av Helding Rosa (c) maid h96 Shamrock Fielding Sami B morse opr WUTelCo h206 Napier av Helds Alvin (c) student rl07 Roberts (U) Helds Annie (c) maid h354 Madison Helds Cath (c) maid r28o Madison Fields Clarence C (Thelma) driver h 2224 Broadway Helds Dorothy V r2534 2d Fields Edw (c) porter h315 (333) 1st av (V) Fields Elbert L (Grace F) office mgr Central Sash & Door Co h300 (301) Burton av Helds Gladys student r547 Georgia av Helds Glenn student rll5 Washington Fields Gustave D (Susie) meatctr rll5 Washington av Fields Howard J r2534 2d FieelrdinseJaBckuileloc(kBilrl3ie1)5 bMarutnlbderrrMy rs CathFields Jas (c) carp r315 (333) 1st av (V) Fields John (c) lab h537 Dunlap al Helds Jos (c) lab rl07 Roberts (U) Helds Lamar student rll5 Washington av Fields Leonard (c; Katie C) plstr h420 (419) 3d av (V) Fields Luke (c) lab r537 Dunlap al Helds Mack (c) lab h204 (1) N Tatnall la Helds Martin (c) lab rl07 Roberts (U) Fields Robt D (c; Essie) lab hl07 Roberts (U) Fiewldays Thelma Mrs millwkr r2224 BroadHelds Wm (c; Hattie) driver h267 Walnut Fields Wm (c) orderly rllO Middle (V) Hfilds Wm H (Leo S) cond h2534 2d Fields Wm L butcher Spiller's Restr r547 Georgia av Him Shop The (Jas P Myddelton) photogs 123 Cotton av Filmore Brownie (c) maid r718 Hawthorne Hlsinger Conrad N (Rose; O K Grinding Co) hi 19 1st Filsinger Harry E (Addie M) policemn h208% Montpelier av Filsinger Hendrick (Margt) r208% Montpelier av Hlsinger Rose Mrs beauty opr Jozef's Permanent Wave & Beauty Salon h 119 1st FINANCE SERVICE OF MACON INC, Emory C Smith Pres-Mgr, James A Curry Asst Mgr, A Complete Loan Service, 411-13 First Natl Bank Bldg 409 2d St, Tei 366 (For further information see left top lines and page 2 Buyers' Guide) Finch Laura student rl06 Cleveland av Hn(Vch) Roy student rl06 Cleveland av (V) Hnch Susie (c) lndrs h409 Forest av (V) Finch Walter R (Mary T) dept mgr Dunlap Chevrolet Co hl05 Cleveland av (V) Hncher Arth B (Mollie) millwkr Atlantic Cotton Mills hl02 English av (V) Hncher Ben] H (Virginia B) mgr Ga Motor Finance Co hll5 Calloway (V) Hncher Boone (Ossie L) lab h315 Chappell (SM) Hncher Douglas B restr 3212 Houston av (SM) rl02 English av (V) Fincher Erma G rl60 (101) Oakland av Fincher Harold auditor rl60 (101) OakFilnacnhderavIra D (Lizzie) elk Steve M Wright Drug Store hl60 (101) Oakland Hncher Lucille millwkr Happ Bros Co r 516 Orange Fincher Nell student rll5 Callaway (V) Fincher Raymond (Mary) millwkr Bibb Mfg Co hl21 Comer ter (PM) Hncher Raymond E student rl02 Eng- lish av (V) Hncher Robt F (Beatrice Z) genl mgr Steve M Solomon jr h513 Ridge av (V) Fincher Sami (c) lab Bibb Auto Wreck- ing Co r576 Edgewood av Findlay Agnes (wid Jas N) tchr hll65 Ash Findlay Christian tchr PS rl206 Ash Hndlay Mary B (wid Arth P) hl219 Vineville av (V) Hndlay Prentiss E '(Eunice) millwkr Bibb Mfg Co hl60 Gardner (PM) Findlay Prentiss E (Delma) v-pres Bibb Mfg Co hl206 Ash FINDLAY RICHARD E, Sec-Treas City Board of Water Commissioners, City Hall, Tel 1880, h926 College, Tel 1470 Findlay Susie elk TJ S Dist Atty rl219 Vineville av (V) Findley J Lester asst mgr Bibb News Co rll9 Coleman av (CH) Finison Ernest H (Sarah) slsmn h738 Date av FinbkdmBnoySdBWT&T(ICsaobehl2le10S)Bucfhofrdtolpli test Finley Grady (c; Mary) lab h204 Elliott (EM) Finley Lola E (wid Casmer S) h252 1st Finleyson Early driver Power Oil Co r403 Spring Hnleyson Lloyd F (Eula) plant mgr Power Oil Co Inc r403 Spring Finn John (c) r720 Hazel Hnney Annie (c)_ lndrs r5 (10) West Boundry Finney Ben.j hlpr Morris Putzel rl55 2d Finney Berij (c; Katy) lab hl3 Clayton (V) Hnney Chas (c; Dollie) lab h219 Lexington (EM) Hnney Clara (c) rill Short la (EM) Hnnev Clyde (c) h212 Bookers al Finney Dauphie rl06 Cabaniss av (EM) Finney David (c; Edna) h401 (541) Stevens (SM) Hnney Fanny B Mrs millwkr Bibb Mfg Co r33 (31) Taylor av (EM) Hnnev Frank (c; Della M) hll07 (807) Woolfolk (EM) Finney Frank (c; Agnes) lab Taylor Iron Wks & Sup Co r303 Charles (SM) Hnney Grady P elk US PO hl06 Cabaniss av (EM) Finney Harry (Fanny B) millwkr Bibb Mfg Co h33 (31) Taylor av (EM) Hnney Henry (c) lab h403 Charles (SM) Hnney J D (c) lab rll3 Edgewood av Hnney Jack (c; Clara) carp r263 Madison Hnney John (c; Janie) lab h315 (65) FinPnluemy mJoesr (ca;l Clifford) lab hl02 Tindall av (SM) Finney Kate (c) smstrs Dixie Jobbing House hl37 (327) Clark (EM) Hnney Laura (c) r319 Hazel Finney Lillian (c) waiter h232 Jones Hnney Logan (c) delmn Irene Jones Finney Lois rl06 Cabaniss av (EM) Finney Lula (c) maid r.100 (205) Amos (V) Hnney Mackey G (Nannie M) mgr Liberty Candy Co r865 Walnut DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 134 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Finney Major (c; Alline) lab h420 Hammond Finney Mary (c) hl2 Hazel Finney Mildred (c) r401 (541) Stevens Fisher Clara (c) maid rl74 (415) Nussbaum (SM) Fisher Etta (c) r503 Fort Hill (EM) Fisher Etta (c) lndrs r203 (204) 3d av (SM) (U) Finney Nannie M Mrs sten Ga Roofing & Sup Co r865 Walnut Fisher Guy L (Lois) chf torpedomn USN Recruiting Sta hl31 Merritt av (I) Finney Norman (c) porter r401 (541) Fisher Mary (c) cook rl29 Railroad av Stevens (SM) (V) Finney Pate (c) lab rl Buckner al Fisher Sylvia (c) hl55 2d av (V) Finney Perry S (Grace J) swtchmn h Fisher's Drug Store (Albert Fisher) 942 109 Washington av apt 6 Napier av Finney Perry S jr student rl09 Wash- Fiske Kate (wid Geo) h401 College apt ington av apt 6 3B Finney Richd A (c; Ella B) coach Hud- Fitch Lillie (c) lndrs r rear 377 Monroe son Industrial Sch hl04 Forest av (V) Fitts Calvin E (Irene P) ship elk Natl Finney iRobt (c) lab r8 Woodcliff Biscuit Co r655 1st Finney Robt A (Tommye T) trav slsmn Fitts Eliz sten Jones Johnston Russell & h920 Colege apt 1 Sparks rll4 Magnolia Finney Rosa L (c) maid r205 Yates al Fitts Irene P Mrs waiter Betsy Ross Cof- (EM) fee Shop r655 1st Finney Sarah slswn rlOS Cabaniss av Fin(EnMey) Susie (c) hill Short la (EM) FidttesnJoahvn C (Minnie B) cond h526 LinFitts Mildred Mrs r324 Jenkins (SM) Finney Wm D (c; Fleta) millwkr Bibb Fitts Wm M (Rufina) custodian IOOF Mfg Co h602% Broad (EM) Bldg h.484 Orange S Finny Sara (c) h41 Harris Finsley Jos (c; Ida) lab 11254 Middle (V) FFiittzzggeerraalldd THhaorvseWy J(Ocnara)relapbr Ch4o0fGMaRely- Fire Companies Adjustment Bureau Inc rose (B) Edw R Davis adjuster ins 516 Mulberry Fitzgerald Willie M (c) r341 4th av (U) CO h R1001 FIRE DEPARTMENT (See Macon--City of) FIREMEN'S FUND INSURANCE CO, John E Wilson & Son Agents, 702-703 Bibb Bldg 403 Cherry, Tel 214 (For further information see bottom stencil and page 18 Buyers' Guide) FIRESTONE AUTO SUPPLY & SERVICE STORES, J D Adams Mgr, Firestone Tires and Tubes, Auto Service Station, 667-73 Mulberry cor 1st, Tels 116 and 117 First Baptist Church (c) 567 New First Baptist Church Rev Jos P Boone pastor services 11:00 Sunday School 10:00 112 Washington First Christian Church Rev Edw T Small pastor services 11:15 and 8:00 p m Sunday Sch 10:15 a m 265 High First Christian Church Sunday School Room 263 High First Church of Christ Scientist 455 Georgia av First Congregational Church (c) 440 Monore First National Bank Building 2d cor Cherry Fitzhugh Willis M (c; Mary) brklyr h Fi6tz1p0aFtroicrkt HAilllile (sEtMud)ent r249 Hardiman Fitzpatrick Annie M (c) maid hl3 (3) Moore al FFiittzzppaattrriicckk BBeennjj ((cc)) lha8bl5r21E4lbWerot o(dScMlif)f Fitzpatrick Benj jr student r301 Corbin av (V) Fitzpatrick Benj S (Mildred; Central Tire Co) h301 Corbin av (V) Fitzpatrick Dock (c; Nora) lab hll3 (850) Singleton's la Fitzpatrick Eliz (c) rl20 (123) Jones Street la Fitzpatrick Jas P (Annie L) cond MD& SRB h249 Hardeman av Fitzpatrick Jas P jr student r249 Harde- man av Fitzpatrick Julia (c) maid rl20 (123) Jones Street la Fitzpatrick Pauline (c) maid hl20 (123) Jones Street la Fitzpatrick S B_(c) r815 Elbert (SM) Fitzpatrick Seaborn (c; Lola) mill wkr FiBtzipbabtriMckfgThCoos h(c7;23EsFteollret) Hlaibll r5(1EM(4)8) Green's la Flag Alma (c) h529 (527) Middle (EM) FIRST NATIONAL BANK & TRUST Flagg Lucinda (c) rl02 (136) Bay CO IN MACON, Wm G Lee Chairman Flahive Jos J (Lewellen) slsmn Bateman of the Board, Marion H Liles Pres, J K Hogan Exec V-Pres, C E Newton Jr FlCanoahg5a3n3 DOernanngise Japt(L2e0ona B; Flana- V-Pres and Trust Officer, H P Fleming Cashier, W G Cobb, E S Lee Asst gan's Camp) h2929 Houston av (SM) Flanagan's Camp (Dennis J Flanagan) fCicaesrh,ieCrsh,erJryWcorO2ldiv,eTrelA2s8st34T(rFuosrt fOurf-ther information see backbone, back tourist camp 2923 Houston av (SM) Flanders Anne student r869 New Flanders Edw T (Bruce) v-pres Macon CO cover and page 6 Buyers' Guide) Milling Co h206 Buford pi First Presbyterian Church Albert G Flanders Eva M Mrs dish washer Dan- Harris pastor services 11:30 a m and nenberg Co r208 Lincoln av Fir7s:3t 0Stpremet M660EMCuhlbuerrcrhy Rev G Reid Flanders Florence r869 New Flanders Jacob (c; Essie) lab CofGaRy Smith pastor services 11:00 a m and r539 Calhoun 7:30 p m Sunday Sch 9:45 a m 859 1st Flanders Lee (Sudie M) lab hl016 Ogle- First & Last Chance (Waller M Tyson) thorpe filling sta Forsyth rd Flanders Leonard (c) hlpr CofGaRy Fish Malvin K (A Pearl) mach Taylor Flanders Minnie millwkr Bibb Mfg Co Iron Wks & Sup Co 711 Walnut Fish Spencer (c; Narcissa) janitor hl07 Flra5n2d0ers(5R52o)btOLglceotlhlor rSpwe ift & Co r Hotel Douglas av (V) Pickling Fisher Albert (Jewell; Fisher's Drug Flanders Ruth student r869 New Store) h206 Crescent av (CH) Flanders Sam (c; Trudy) hlpr CofGaRy Fisher Albert jr student r206 Crescent av h956 Elm (CH) Flanders Wm (Minnie) millwkr Bibb Fisher Arth (c) lab rl005 3d Mfg Co r520 (552) Oglethorpe Fisher Carl student r203 1st Flanders Wm R (Pauline J) whse supt Fisher Carrie (c) lndrs rl335 1st Standard Oil Co h869 New 135 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING in all its branches WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 Flanigan Thos E (Nina F) mech McCormick Deering Store r659 2d Flatau Carol elk rll8 Callaway (V) Flatau Isaac (Estelle H) v-pres Inde- pendent Lndiry Co hll8 Callaway (V) FlSatearvuicIesaralcl8jr CmagllrawInadyep(Ven)dent Linen Fleetwood Edith r569 Broadway Fleetwood Gertrude (wid Hugh) r622 Orange Fleetwood Hugh P (Eugenia) mgr real est dept Robertson Walkers Inc h622 Orange Fleischer Julius M '(Susie H) agt Conn Mut Life Ins Co hl306 Vineville av Fleming Edw (c) lab rl02 Adams FLEMING HORRY P (Adele J), Cash First National Bank & Trust Co, hl04 Alabama av, Tel 5032 Fleming John C (Mary) rep h864 Mulberry Fleming Jos (c; Fannie B) fctywkr r205 (2) 3d av (B) Fleming Marshall R (Pearl E) head toll testbdmn SBT&TCo h809 Napier av Fleming Matthew L (c; Malinda) tailor 618 Poplar h227 Telfair Fleming Otis (c; Beatrice) lab hl03 3d (II) Fleming Wm P (Euphrasia T) v-pres Taylor Iron Wks & Supply Co h757 Mulberry Fleming Winnie student rl04 Alabama av (V) Flemming Beatrice (c) r61 Spring Flemming IChas (c; Inez) h851 Foster's al Flemming Kathleen (c) r420 Hazel Flemming Sami (c) bellboy Hotel Lanier r525 3d av (V) Fletcher Albert (c) lab r214 Cedar (U) Fletcher David C (May A) driver Yellow Cab Trans & Baggage Co hl40 Piedmont av Fletcher Dell nurse Chiropractic Health FlHetocmheer rE50ls.1ie C(ocl)leglnedrs r213 Patterson (NHts) Fletcher Elzie (Georgia) lab Taylor Iron Wks & Sup Co r403 Mitchell al Fletcher Fredk E fctywkr Happ Bros Co rll5 (133) Charles (SM' Fletcher Jas (c) blksmith 102 Cedar (U) h do Fletcher John P (Hattie C) hlpr Ga Carolina Oil Co rlOO Nelson (SM) Fletcher John S (Thelma) loco swtchmn hll5 (133) Charles (SM) Fletcher Mamie D nurse The Chiropractic Health Home r501 College Fle(Vtc)her Morris (c) lab rll6 (16) Wise av Fletcher Rex P (Nellie M) formn r262 Washington av Fletcher Virginia (c) h313 5th av (V) Fletcher Wesley F (c; Hattie) lab h215 (216) Cedar (U) Fletdher Wm (c) r313 5th av (V) Fle4w35e)lleNnoHrtehnrSytrJee(tc;laAmelia) lab hl02 Flewellen Jas (Una) lab h231 Washington av Flewellyn Brown (c; Leila) lab h614 (615) Crisp (SM) Flewellyn Julia (c) lndrs rl23 Brooklyn av (S) Flewellyn Mattie (c) maid r403 Craft la Flewellyn Nancy (c) r359 (355) North Flewellyn Purvis (c; Fanny) hll02 (1008) Broad (EM) Flint Willie M (c) maid r93 Harris al Flood Harry T (Angie) eng h719 Date Florida Fish & Oyster Co (Geo Stefano) 318 Main (EM) Floros Gustavus (Mary B; Ellis Cafe) h 1166 Oglethorpe av Floros Jas student rll66 Oglethorpe Floros Kath rll66 Oglethorpe Floros Spiro G waiter Ellis Cafe rll66 Oglethorpe Flounders Julius (c; Rosalie) lab hlOO (12) Toombs (SM) Flournoy Benj (c; Ida) driver h214 Madison Flournoy Copley lawyer r509 Ridge av Flo(Vur)noy Hannah (c) lndrs hl04 (4) Henry (SM) Flournoy Hattie (c) cook r238 Collins pi Flournoy Hattie `(c) maid r764 Chappell la Flournoy J Everett (Adele) pres hl50 Beverly pi Flournoy Jos A (Lilia; Macon Cafeteria) h565 College Flournoy Julia (c) maid r257 3d av (V) Flournoy Lena (c) cook rll7 (525) Craft (V) Flournoy Lillie M (c) maid h629 Georgia av Flournoy Mary L (c) maid h238 Collins Flopul rnoy Robt J slsmn Firestone Auto Sup & Serv Stores x509 Ridge av (V) Flournoy Sadie (c) cook rl38 (434) Tins- ley la Flournoy Walker slsmn Lyon-Harris & Brooks rl40 Magnolia Flournoy Wm (c) driver h320 (314) Mon- roe Flowers Albert T (Della) wtchmn South- eastern Compress & Whse Co h393 Orange Flowers Albertha (c) maid hl4 Plant al Flowers Claudell (c) cook r314 Green Flowers Earl A atndt Sou Oil Stores Inc r316 Spring Flowers Edw D (Mollie) elk hl42 Stratton (SM) Flowers Jennie (c) maid rll3 (11) Wise av (V) Flowers 'Jesse (c; Lucy) lab h803 Charles (SM) Flowers John jr student r452 Woolfo.k (EM) Flowers John E confr 108 Mulberry rl42 Stratton (SM) FloWwoeordsfJoolkhn(EWM)(Alice B) wtchmn h452 Flowers Lewis cook Mercer Univ r528 Calhoun Flowers Lula M slswn W T Grant Co r 452 Woolfolk (EM) Flowers Ross (c) delmn rl52 (154) Middle (V) Flowers Ruth student r452 Woolfolk (EM) Flowers Sampson (Jennie W) driver A G Rhodes & Son Flowers Sarah (wid Wm E) r204 Mikado av (SM) Flowers Sol (c; Carrie) loco firemn h509 (709) Campbell av (SM) Floyd Belle r758 Plum Floyd Chas A millwkr Bibb Mfg Co r22 Schell av (EM) Floyd Clarence E (Josie) millwkr Bibb Mfg Co hl8 Schell av (EM) Floyd Della (c) maid r326 Cedar (U) Floyd Dieie (c) rll8 (83) Bay Floyd Edith student r821 2d Floyd Edwin H (Mary) hd bkpr McKes- son-Riley Div r218 Georgia av Floyd Emma (c) cook hi356` Bay Floyd Ethel (c) hll8 (220) Green (V) Floyd Etta (c) cook hl22 Green Floyd Eug lab r233 (203) Cutters la (E M) Floyd Fanny (c) r356 Bay Floyd Frances A rl08 West End av (WH) Floyd Geo (c) lab rl30 (151) Orchard av Floyd Helen student r653 Plum Floyd Homer (c; Sarah) porter hl30 (151) Orchard av Snow's Laundry and Dry Gleaning Go. Licensed "Sanitone" Gleaner Phone 6000 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Barkers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume . L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 136 AUTHORIZED DEALER R. A. McCORD MOTOR SALES AND SERVICE CO. (m^p) CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 Floyd Ida h758 Plum Floyd J Aubrey ship elk Jos N Neel Co rl08 West End av (WH) Floyd Jesse I (Irma L) city firemn hl08 West End av (WH) Floyd John (c) hll (157) Bright al Floyd John W (c; Vallie) lab h208 Roosevelt av (V) Floyd Johnny (c) rl!8 (83) Bay Floyd Joshua (c; Susie) h222 Jefferson Floyd Joshua (c) lab h326 Cedar (U) Floyd Josie Mrs millwkr rl8 Schell av (EM) Floyd June Mrs smstrs r355 Walnut Floyd L Belle (wid Chas A) h22 Schell av (EM) Floyd Lawrence electn r653 Plum Floyd Leonard (Daisy) millwkr Bibb Mfg Co r269 Astor (EM) Floyd Lillie (c) rl (417) Stein's al Floyd Lillie M (c) lndrs h408 Collinsville la Floyd Lucius lab Snow's Lndry & Dry Clng Co r767 Ash Floyd Luzella (c) student r622 Washing- ton av Floyd Maggie elk Bibb Mfg Co r22 Schell av (EM) Floyd Margt Mrs tchr r218 Georgia av Floyd Marshall (c) hlpr CofGaRy Floyd Mary A Mrs r364 Orange Floyd May D tchr Whittle Sch r218 Georgia av Floyd Myrtice Mrs millwkr Bibb Mfg Co r28 Schell av (EM) Floyd Nathan (c) r318 Jackson Floydt Robt delmn r233 (203) Cutters la (EM) Floyd Rosebud millwkr Bibb Mfg Co r22 Schell av (EM) Floyd Ruby M (c) maid r222 Jefferson Floyd Russell E student rl08 West End av (WH) Floyd Thos (Mary B) carp r653 Plum Floyd Timothy (Buria) baseball umpire r821 2d Floyd Wm (c; May E) lab Taylor Iron Wks & Sup Co r767 Ash Floyd Wm (c; Gertrude) lab r311 Hazel Floyd Wm (c) lab r953 Pio Nono av (V) Floyd Wm E (Georgia) mgr DuPree Barber Shop hl335 2d Floyd Wm S (Myrtice) mill wkr Bibb Mfg Co h28 Schell av (EM) Fluellen Annie (c) maid r515 E Acad- emy (EM) Fluellen Ida (c) lndrs h238 Woodcliff Fluellen Ida M (c) student r238 Wood- cliff Fluellen Lester (c; Elia) lab CofGaRy h 309 (310) Campbell av (SM) Fluellen Lillie P (c) lndrs h573 Monroe Fluellen Louis (c) lab r573 Monroe Fluellen Obie (c) gro 1024% Main (EM) r RD 4 Fluellen Wm (c) lab r318 Walnut Flury Carrie M (wid Jos A) h616 Walnut Flury Thelma waiter r616 Walnut Flynn Jas W (Flynn Printing Co) r817 FlyNnenw Leon W (Bessie) millwkr Bibb Mfg Co h724 Oglethorpe Flynn Printing Co (Jas W Flynn) 505 Broadway Flynn Wanda Mrs sten Clinic hll33 Walnut Flynt Henry G (Mattie W) Flynt's Bar- ber Shop) h269 Boulevard (NH) Flynt Jas F (Doris) policemn hl409 2d Flynt's Barber Shop (Henry G Flynt) 404 Cherry Fogarty Drew T hll58 Edgewood av Fogarty Nicholas J (Annie M) mach Taylor Iron Wks & Sup Co h456 Walnut Fogarty Thos Z (M Valley) h205 Carling av Fogarty Troy (Thelma) driver h!319 2d Foggy Ray (c; Lizzie D) porter h214 Jones Folds Alice (wid Wm) hl22 Stratton (SM) Folds Arth L (c) janitor r859 Ocmulgee Folds Chas H (c; Laura) carp h507 (307) Hall (EM) Folds Edna rl22 Stratton (SM) Folds Janie (c) h201 (213) Jones Street la Folds Joshua P watch repr 763 Broadway r552 Hemlock _ Folds Laura (c) confr (507%) Hall (EM) r507 (307) Hall (EMI Folds Marie (c) cook h859 Ocmulgee Folds Mattie (wid Geo) rl20 Highland Folds Terrell carp rl22 Stratton (SM) Folds Zachariah T agt Natl Life & Accdt Ins Co r221 Georgia av Foley John (Lula) slsmn r354 College Folk Estelle slswn Dannenberg Co rl414 Edgewood av . ,, FoElkdgeWwmoodE av(Minnie E) pharm hl414 PFooltstosmOCscaarrl W(c; (ESallraa)hlIa)b mr4s1n1grMUaSdisPoOn hl05 Feb av Folsom Geo H ,, (Marguerite) carrier TUT,,S PO h811 Poplar apt 9 Folsom Gussie A Mrs gro 301 Duncan av h432 Carling av . Folsom Marcus B (Gussie A) h432 Car- ling av Foote Ezra L (Geneva F) batterymn Smith's Battery & Elec Co hl29 Ruth- erford av (SM) Forbes Ella A (c) cook h374 Monroe Forbes Evan H (Ethel) genl agt NC&StL Ry hll2 Clayton (V) Forbes Gabrella slswn r322 New Forbes Johnnie emp Snow's Lndry & Dry Clng Co r767 Ash Ford Alice (c) hll9 Elm. Ford Anderson (c) elk r705 (227) Hall (EM) Ford Annie M Mrs slswn W T Grant Co rl723 3d Ford Arth (c; Marie) elev opr Georgia Casualty Bldg r857 Ocmulgee Ford Augustus (c) lab hll6 (533) Ocmulgee la FFoorrdd BAeusrseieliaMM(rwsidrl2O0sc3adr L) h507 Hawthorne Fogr0d0 Betty (c) maid r209 (207) Ocmul- Ford Blanche (c) r607 (683) Elbert (SM) Ford Carrie (c) hll6 (167) Plummers al Ford Clifford (Maud) millwkr h3 Melrose (B) Ford Clisby (c; Ruby) lab CofGaRy h911 (844) Maynard (EM) Ford Cooper student rl354 Edgewood av Ford D Walter (c) carp rl55 Broad (E Ford David (c) lab rl33 Moccasin Slide Ford Eddie B (c) maid r756 Ocmulgee Ford Edwin (c) lab h2 (4) Short St la Ford Emma (c) h8 Reynolds al Ford Epise (c) h409 Forest av (V) Ford Eva Mrs smstrs r237 Washington Ford Frances (c) lndrs h506 (15) Hall (EM) Fo(rEdMG) race (c) smstrs h705 (227) Hall Ford Helen J (c) rl244 (770) Broad (EM) Ford Irvin (c) h264 Broad (EM) Ford Isaac (c; Janett) lab CofGaRy r 613 (614) 4th av (V) Ford Jas W furn r623 Main (EM) Ford Jas W jr (Ruby) pntr h623 Mam (EM) Ford Jeanette (c) cook 614 4th av (V) Ford John (c) lab Taylor Iron Wks & Sup Co h211 Hazel Ford Jos (c) hll Gas House al Ford Josie (c) r8 Reynolds al 137 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Ford Julia (c) lab h255 Cowan (EM) Ford Kelly (c; Delia) h220 Northern av (EM) Ford Laura (c) lndrs h409 Forest av (V) FFoorrdd LLoauuirsae ((cc)) mhla5i5d Br7r7o2adRe(yEnMol)ds al Ford Lula M (c) lab Central City Bag Co Ford Mamie L (wid R Oscar) smstrs h 814 Hemlock Ford Margt G (c) tchr h555 Broad (EM) Ford Mary L (c) maid rl Barnhart's Bottom Ford Matilda (c) hill Woodcliff Ford Mildred checker r814 Hemlock Ford Milton (c) lab r705 (227) Hall (EM) FFOorRdDMMinOnTieOR(c)CAr2R64S,BRroAadM(cECMor)d Mo- tor Co Authorized Dealer, 215-221 2d, Tel 11 (For further information see left top lines and page 4 Buyers' Guide) Ford Nancy (c) r264 Broad (EM) Ford Nora (c) r409 E 2d (EM) Ford Odessa (c) r538 (1144) Smith (EM) Ford Phoebe (c) prsr h538 (1144) Smith (EM) Ford Ray (Mabel) driver r!716 3d Ford Richd (c; Viola) lab Coplan Junk Co h209 ( 207) Ocmulgee Ford Rubv (c) student r255 Cowan (E M) Ford Thos V (Lottie) loco firemn h210 Davis (SM) Ford Victorana (wid Jas T) hlOl Pryor (SM) Ford Viola (wid Robt L) rll7 Forest av (B) Ford Walter (c) lab r409 Forest av (V) Ford Walter (c) lab r209 (207) Ocmulgee Ford Wm (c) h rear 554 Orange Ford Wm (c; Mary K) lab Natl Handle Co Ford Wm (c; Ela) lab CofGRy h523 Aca- demy al (EM) Ford Willie (c) lab CofGRy Ford Willie B (c) r211 Hazel Fordesh Eileen r811 Poplar apt 16 Fordesh Falban loco eng r811 Poplar apt 16 Fordham Annie (wid L Troy) hlll5 Ash Fordham Charlotte (c) rl21 (123) Wood al Fordham Dock (c; Pauline) lab r401 Charles (SM) Fordham Geronia Mrs mill wkr Bibb Mfg Co rl028 2d Fordham Howard elk Piggly Wiggly Stores rlllS Ash Fordham Jeweline slsmn rlll5 Ash Fordham Mary L (wid Jos D) h253 Rocky Creek rd Fordham Ruth r253 Rocky Creek rd Fordham Sami (c: Essie) lab h!2l (123) Wood al Forehand Burney (Grace B) slsmn Snow's Lndry & Dry Clng Co r717 1st Forehand Claude (c; Ada P) cook De- Luxe Cafe h rear 723 Broadway Forehand Wm (Marie) civ eng r307 For- syth Foreman Green J (c; Willie L) lab CofG Ry hl23 Telfair Forest Christine (c) rl06 (913) Walls al (NH) Forest Nathaniel (c; Louise) lab hll2 Walls al (NH) Forest Viola (c) lndrs hl06 (913) Walls al (NH) Forest Violet (c) rl06 (913) Walls al (N H) Forkner Della r778 Blackburn (NH) Formbv Jos E (Kate A) rl25 Rembert av Formby Lottie B elk rl25 Rembert av Forney John (c; Willie) h440 Flanders (EM) Forrest Atheline (c) lndrs hl:10 Cowan (E M) Forrest Chas (c; Florence) h508 (504) Edison (EM) Forrest Daisy (c) lab Central City Bag Co Fotrornest(EEMld)er (c; Willie M) carp h ClinFFoorrrreesstt RMoabrtieBlnstdurdseCntrers7c8e5ntHLolntdaryv C(No Htsi Forrest Robt L (Georgia I) trav slsmn h 119 Birch apt 1 (NHts) Forrest Sheila student r785i Holt av (N Hts) Forrester Clifton A Rev (Mary) pastor Cross Keys Baptist Ch hll38 College Forsyth Estelle (c) smstrs hl72 5th av For(Vsy)th Terrace Apartments 579 Orange Forsyth Tommie (Mae) driver r767 Wal- nut Fort Bruce (c: Sallie) carp h333 2d av (V) Fort Hawkins Lodge F&AM 410 Main (E M) Fort Hawkins School 450 Fort Hill (EM) Fort Hill Cemetery (c) es Norris (EM) cor Mitchell Fort Ozie B (c) tchr r333 2d av (V) Fort Ralph (c) pntr r333 2d av (V) FFoorrtt WWmS(c)stuladbenrlt69GMa aPyowaver(UC)o Fort Wm E ir (Helen) prof Mercer Univ rl40 Ridgeland av Forte Ruby D Mrs slswn Dannenberg Co h209 Ingleside av Foss Helen F instr Ballard Normal Sch r50 Forest av (V) Foster Addie M (c) r223 Price (V) Foster Albert (c: Mackye) driver McKes- son-Riley Div h424 Ward (V) Foster Alf (c) lab Idle Horn Nurseries r rear 3012 Forsyth rd Foster Banks (c; Annie B) lab r;106 (436) Bright al Foster Beni (c; Fannie) hl02 Mason (S M) FFoosstteerr CChaBs Wstondeispcrtrh5r24HHoitlellyeFricakvlin(Cg H) Foster Claude (c: Mabelle) h227 Mutual av (V) Foster Cleo (wid Wade H) h307 Peach- tree (EM) Foster Danl (c) lab r2l9 Hawkins av Foster Earl (Rose) supt h2639 2d Foster Elease (c) r rear 3012 Forsyth rd Foster Emmett L (Martha C) detective Police h610 Montpelier av Foster Eug B (Essie M) ctr S M Watson Mfg Co r555 Elm Foicstee)r hElul5g RAc(aGdermeayter Foster Adv ServFoster Expell (c) lab rl37 (327) Clark (EM) Foster Felton (c: Janie) lab hl6 Bertha- dale dr (V) Foster Geo D (c; Mattie) pdlr hl4 Ber- thadale dr (V) Foster Green (c) lab rll9 (28) Frank al Foster Henry (c) lab r926 Pio Nono av (V) Foster Henry (Pearl) lab h!26 Yates av (EM) Foster Henry mech Tyler Bros Garage Foster Henry F (c; Emma) lab rl07 6th av (B) Foster Herbert (c; Ola M) firemn City Water Wks hll6 Berthadale dr (V) Foster Jas (c) rl6 Berthadale dr (V) Foster Jas (c; Ethel) lab CofGRy hl64 Sycamore (V) Foster Jas (c) student r227 Mutual av (V) Foster John (c; Sarah) h Forsyth rd Foster John L (Louise) h821 2d Foster Margt lab rl26 Yates av (EM) YOUR CITY D I R JE C T O R Y MIRRORS the SOCIAL Life Of Your CITY 138 MORE GOODS --ARE-- BOUGHT --AND-- SOLD THROUGH THE Classified Business Directory THAN BY Any Other Medium on Earth YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES i |J8 Plymouth Poster Marjorie (c) Indrs r327 Corbin av (V) Poster Nellie (c) dom h219 Hawkins av Poster Ova L (c) lab rl26 Cemetery la Poster Richd (c) student r227 Mutual av (V) Foster Richd P (c; Sylvia) carp r225 Middle (V) PoCstoe)r Rr oSbht iMrle(yGrHaiclels: Macon Neon Sign Poster Shell (c; Mattie) lab hlio Sim- mons av Foster Sol (c) rl6 Berthadale dr (V) Foster Troy T (Dorris) mill wkr h323 Lake Foster Wade H jr student r307 Peachtree (EM) Poster Wm (c) r227 Mutual av (V) Poster Wm E (Rosa L) mill wkr Bibb Mfg Co h303 Bailey av (CH) Poster Wm M (Sallie) elk h244 Roff Home av (V) Poster Wm M driver hl07 (233) Patter- son (NHts) Pouchi Ella (wid Thos) r405 Cleveland (SM) Fougerousse Henry L (Lydia) medical of- ficer USN Recruiting Station hl28 The Prado Fountain Arch S (Laverne) mach r628 Mam (EM) Fountain Asa (c; Mattie) cement fnshr h Fo1u5n0ta(i2n26B) enRjoy(ec: (KCaHt)e) h53 Craigs la (SM) Fountain Bertie M bkpr r253 Church (E M) Fountain Beulah (wid Ernest) mill wkr Bibb Mfg Co hl32 Willingham (EM) Fountain Chas (c; Lula) hlpr CofGRy h 223 Long St la (SM) Fountain Curly (c) r53 Craigs la (SM) Fountain Danl S (Lalia) driver rl667 3d Fountain Earl (c) chauf r53 Craigs la (SiVL) Fo:ru4n50taiWn aEsrhniensgttoJnwaaviter Spiller's Restr Fountain Geo (c: Beatrice) porter Goodrich Silvertown Stores hl89 Hatfield av (SM) Fountain Grace rl32 Willingham (EM) Fountain Iola bkpr Union Dry Gds Co r 253 Church (EM) Fountain J Arth hlpr Ga Power Co r652 FoPuinnteain Jas A phys 516 Mulberry R417 r Sunset dr (Shirley Hills) Fountain Jas M (Ada) h253 Church (E M) Fountain Jas M driver r533 Orange apt 7 Fountain Jesse (c) r53 Craigs la (SM) Fountain Jos F (c: Idella) sewer grader A B Lee Plmbg & Htg Co h208 (211) Henrietta (SM) Fountain Mary F (wid Thos) rl04 Pio Nono av rv) Fountain Mattie (c) Indrs r208 (211) Henrietta (SM) Fountain Otis (c) auto mech r53 Craigs la (SM) Fountain Robt mach Bibb Mfg Co r628 Main (EM) Fountain Rosa (wid Danl) rl667 3d Fountain Rosena (wid Elbert L) r678 Courtland av Fountain Temple A M E Church (c) Rev Arth Threatt pastor Madison Fountain Woodrow W baker American Bakeries Co r620 2d Four Point Grocery (Jas C Weems) h268 Maple Fourth National Bank Receiver's Office J Bradley Downs receiver 409 2d R516 Fowler Annie (c) rl02 Johnsons al Fowler Benj J lawyer 51'6 Mulberry R415 r298 College Fowler Billie librarian Burden Smith & Co r305 College apt 5 Fowler Boise (c: Mamie) lab h634 Hammond Fowler Calloway (c) lab Arth J Kelley r 113 (9) Jordan (EM) Fowler Chas J (Georgia) mill wkr WilFoiwnglehramEdwCo(ttHonattMie)illlahb24r050D4 uHncemanlocavk Fowler Ellen (c) hlO Gas House al Fowler F Alton (Mary C) waiter Craw- ford's Barbecue Lunch. r458 Caling av Fowler Harry C (Annie L) lmbrmn h305 College apt 5 Fowler Hazel student r48S Orange Fowler Herbert mill wkr Willingham Cotton Mill r240 Duncan av Fowler Ida B r504 Hemlock Fowler Ida M (c) hl05 (2) Clara (EM) Fowler Jas J mill wkr rl411 3d Fowler John C (Ethel) r630 Forsyth Fowler Jos (e; Eva) porter h562 Chappell (SM) Fowler Jos (c) porter h208 E Eil Fowler Jos ir (c) r208 E Ell Fowler Julian T (Katharine) driver r486 Orange Fowler Mary tchr PS r305 College apt 5 Fowler Mildred (c) maid r314 (320) Mon- roe Fowler Nelson slsmn Collins Baking Co r 664 Plum Fowler Pierce (c: Louella) carp h205 Mu- tual av (V) Fowler R T eng r315 Mulberry Fowler Robt (c; Ida) pdlr rl56 Guern- sey la Fowler Roosevelt (c: Viola) lab h824 FoEwdlgerewRoooyd Eaveng r Capitol Hotel Fowler Sallie (wid Thos J) rl41l 3d Fowler Saphronia (c) Indrs r923 (953) Osmulgee Fowler Thos E (Ida) cond MD&SRR h 486 Orange Fowler Ulysses G slsmn Ga Roofing & Sup Co r664 Plum Fowler Victoria Mrs r255 (139) Heard (S M) Fowler Wallace J mill wkr Willingham Cotton Mill r240 Duncan av Fox Harrold r82I Cherry Fox Henry (c) rl04 Elm Fox Henry A (Mae L) slsmn hl03 Emory av (SM) Fox John A pres Macon Circus Equipment Co r516 Mulberry R308 Fox O'Hara B formn h204 Washington av FOX RICHARD K (Willie M), Asst Mgr Bibb Brokerage Corp, h206 Center (E Fox Sallie E Mrs h372 Clinton (EM) Fox W Harold (Julia) lab h372 Clinton (EM) Foxworth John E (Belle B) mill wkr Will- ingham Cotton Mill h4 (77) Mill Foy Henry W (Sarah) ship elk Dunlap- Peeler Hdw Co r Columbus rd Fozahes Despena waiter New Yorker r 615 Walnut Fraley Lillie (c) millwkr Bibb Mfg Co r 79 Wilder (SM) Fraley Malachi L (c: Annie M) lab CofG Ry hlOl 3d av (B) Fraley Martha (c) Indrs hl08 6th av (B) Fraley Minnie (c) h411 Arch Fraley Mollie (c) h218 Hilliard al Fralick Lucille smstrs Happ Bros Co r 465 Orange France Ernest H (Edith) h2335 Forsyth rd France Sydney T (Bernice) h2344 For- syth rd Francis Antonio gro 518 2d h do Francis John (c; Essie M) carp h!06 1(621) Johnson's lal 141 A. T. HOLT CO. cI n REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Frost Sally a waiter Betsy Ross Coffee Shoo r754 Cherry Fuller Sidney (Nell) mill wkr h27 Blossfield (AM) Fruitticher Beverly student r415 New apt Fuller Steven H (Jeannette) slsmn h261 Fr4uitticher Jas C (Virginia) elk Sands & Georgia av apt B4 Fuller Thos (c) lab rl05 (921) Ocmulgee Co h855 Walnut apt 3 Fruitticher Lila supvr SBT&TCo r415 Fullaler Thos D (c: Linconia E) porter New apt 4 Kernaghan-Goodman Inc h965 Ocmul- Fruitticher Lila H (Jas C) h415 New apt Fuller Thornton (c) lab rl29 (22) Frank Fruitticher R Lawrence (Deseree) slsmn al Dunlap Chevrolet Co rlOO Mercer ter Fuller Wm (c: Carrie) sta firemn hi 12 Fruitticher Virginia Mrs slswn W T Grant Co h855 Walnut apt 3 Fry Isaiah (c: Cora) lab h Forsyth rd Fry Lena (c) r227 Patterson (NHts) Hawkins av Fuller Wm K (Nettie) driver -Leaptrot Dry Clng Co hl223 2d Fuller Wm L (Stella) elk Robt O Thomas Fry Mamie (c) lab Idle Hour Nurseries r Forsyth rd Fry Mary (c) h227 Patterson (NHts) h436 Vineville av Fuller Wm M (Ella; Small Animal Clinic) h202 Henry (L) Fry Nottingham (c: Molly) lgbh419 C540) Henrietta (SM) Fry Walter (c; Corine) lab hl2 (367) Hanson (SM) Fryer Milton (e: Susie) lab r528 (498) Hill Crest av (CH) Fryer Rose L nurse 260 Winship (WH) r do Fudge Hezzie (c) lab r200 Texas (SM) Fudge John F (c: Clara) lab h711 Daisy (SM) Fulford Foy W (Effie) marble wkr h208 Fuller Winfred IE (Mattie) mach h401 Fort Hill (EM) Fullington Annie (wid Louis L) h.763 Cherry Fullington Beni H (Lula D) supt Georgia Casualty Bldg h264 Washington av Fullington Ben.i H jr bkpr r264 Washington av Fullington Dorothy student r264 Washington av Fullington Felder mech McCormick Deering Store r619 2d Reid (SM) FuNlfaotrld GHuaarrryd BCoarmCor1y21csutstIondfiaanntrUy hS Fullington Janie L slswn r264 Washing-. ton av Fullington Louis auto mech r619 2d rear 456 2d Fullington Louis L r763 Cherry Fulford Herman O (Nettie W) pharm Fulmore Janie (c) cook h223 North (V) - Lester A Thomas h560 Oglethorpe __ Fulmore Virgil G (c) pntr h289 1st av Fulghum Chas C student r419 Johnson av (HH) Fulghum J Walter (Carolyn B) v-pres (V) Fulton Baptist Church (c) 506 Hawthorne Fulton Etta (c) maid r324 Monroe Ttearylo(Vr )Iron Wks & Sup Co h205 Hines Fulton Marie (c) lndrs r324 Monroe Fulton Mary (c) lndrs h324 Monroe Fulghum Lillian rl09 Rogers av (V) Fulton Thos (Dolores) slsmn hl46 Sum- Fulghum Matilda (wid Chas M) hl09 mit av (NH) MAILING (t Rogers av (V) Fulghum Robt electn Co r815 Orange Macon Neon Sig--n 1 Fulk Alice (c) cook r227 Cedar (U) Fuller Addie (c) r775 Reynolds al Fuller Alvin C r!19 1st Fuller Annie B r405 Montpelier av Fuller C Otis (Allie J) elk Geo W Gibson r9 Randolph pi Fuller Carey (c) del mn John D Boone rl26 Coleman al Fuller Chas H (Ines) bartndr r865 Mul- berry Fuller Clifford F mill wkr Willingham Cotton Mill r9 Randolph pi Fuller David (c) carp hllO (12) Frank al Fuller Edw (c) student r968 Ocmulgee Fuller Edwin (Evelyn) driver hl40 Ap- pleton av Fuller Geo (c; Christine) lab h775 Rey- nolds al Fuller Grant P (Myrtle S; Brown's Book Store) h931 Orange Fuller Henry R (Minnie) mill wkr h22 Blossfield (AM) Fuller Jas W (Essie) carp hl64 Mont- pelier av Fuller Jennie (c) hl26 Coleman al Fuller John C (c) lab rllO (12) Frank al Fuller John H (c: Clara) hlpr CofGRy h510 (530) Maynard (EM) Fuller Jos (c: Annie) lab r3 Stewart's la Fuller Maggie Mrs mill wkr h36 Bloss- field (B) Fuller Margt r36 Blossfield (B) Fuller Marie (c) rllO (12) Frank al Fuller Millard L (Carrie A) mill wkr Willingham Cotton Mill r442 Lawton Fuller Myrtle S Mrs elk r931 Orange Fuller Sarah student Ga Academy for the Blind r Luthersville Ga Fultz Anderson (c) lab r520 (120) E Aca- demy (EM) Fultz Bernard (c: Leila) lab h804 Maynard (EM) LISTS Fultz Clifford (c: Annie) lab CofGRv h 520 (120) E Academy (EM) Complete Fultz David V (c: Maggie) loco firemn h 1134 Broadway Accurate Fultz Estella (c) lndrs h455 4th av (V) Fultz Fred (c) lab r804 Maynard (EM) for Fultz Homer (c) restr 460 (456) Clinton (EM) r520 (120) E Academy (EM) Any Fultz Robt (c: Florrie) lab r804 Maynard Locality (EM) Fultz Wm (c) student r520 (120) E Aca- demy (EM) Fulwood Hilliard W (Thelma L) uphol Burden Smith & Co hl39 Lamont av Fulwood Susie sten Wesleyan Coll rl39 Write for Catalog Lamont av Fulwood Vernon fety wkr Happ Bros Co rl39 Lamont av "Mailing Lists Funderburke Addie tchr PS r410 Forest av Funderburke Benj F (Helen) chemist That Pull" Bibb Mfg Co rll4 Magnolia Funderburke Eliz E sten Macon Gas Co It's Free 'rl05 Lawton av Funderburke Georgia (wid Jackson) r605 Carling av Funderburke Julian G slsmn r410 Forest R. L. POLK av (V) Funderburke Thos L (Julia) mgr Dunlap- & GOi Peeler Hdw Co h410 Forest av (V) Funderburke Thos M (Eliz E) elk S Jones Directory Co rl05 Lawton av Funderburke Vibe'rt student r936 College Funkenstein Flora (wid Louis) v-pres-sec Publishers Detroit, Mich. Burns Boot Shoppe Inc h864 Mulberry apt 40 Fuqua Dorothy (wid Henry E) r518 Pine Fuqua Proctor L (Laverne) rll27 Wal- 1 We make up nut Furchess Martha student rl27 Highland Special Lists av i 142 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Furchess Wade B (Mattie J) earn rl27 Highland av Furgeson Sami (c; Hattie) janitor r539 (512) Grant Chapel al (SM) Furgison Jas (c: Susie) lab h25 O'Hara la Furlow John (c) hlpr Elsia Shank r320 Ward (V) --` Furman Rose A (c) maid rll06 Mont- pelier av Furman Thos (c; Susie) lab hll06 Mont- pelier av Fuss Flora M Mrs opr W U Tel Co hl436 College Fuss J Pelham (Flora M) serv mgr Good- year Service Stores hl436 College Fuss Leroy (Susie H) hl71 Mary (Ar- tope Hts) Fuss Otis cash Hatcher & McCrary rl71 Mary (Artope Hts) Fuss Reba rl71 Mary (Artone Hts) Fuss Ruth rl71 Mary (Artope Hts) Fuss T Harvey (Camille D) mgr Canada Dry Ginger Ale Inc hll4 (194) Buck- ingham pi (V) Fussell Helen sten WPA r218 Georgia av Futch Claudine student r201 Pierce av (V) Futch Lonnie B (Ilda) blrmkr CofGRy r772 Montpelier av Futch Thurston D (Eliz) mach h233 Riverdale dr (I) Futral Sue P (wid Rabun G) rll3 Ameri- can blvd Fye Wm (c: Mary) h212 Jones GAB SCHOOL OF COMMERCE, Robt L Wilson Pres, Jas A Knott V-Pres- Treas, Edgar L Ray Prin, 567 Mulberry, Tel 621 (For further information see front cover and page 10 Buyers' Guide) Gatoblne Aavlbert E (Phebe L) h258 Washing- Gabriel Fredk B (Lula) mgr Postal Tele- graph-Cable Co hlC9 Rogers av (V) Gaddy Maggie (wid Frank) h313 Orange Gar3d1d3v MOraarntghea elk Macon Teleg Pub Co Gaddy Paul c (Maude F) starter Yellow Cab Trans & Baggage Co h310 Wash- ington av Gafford Elma J Mrs tchr Ga Academy for the Blind rlOO Corbin av (V) Gafford Gordon B (Elma J) mach rlOO Corbin av (V) Gaillard Margt C student r405 Napier av Gaillard Wm P (Margt H) associate tax assessor Citv of Macon h405 Napier av Gaines Chas M jr (Iris F) elk Happ Bros Co h2106 Bway Gaines Cora (c) rll3 Jones Gaines F Clarke (Wylanne) div supt Ga Power Co h405 Suwanee Gaines Frances student r405 Suwanee av Gaines Jos (Laura) mill wkr Bibb Mfg Co h912 2d Gaines Mattie C (wid W Peyton) hl64 New Gaines T Pearman (Kate) elk Happ Bros Co rl64 New Gainey Chaney (c) r202 (229) Astor (E M) Gainey Forest (c) porter Brad Wall r411 Applewood (EM) GaCinoevhlH58arrBieatyt (c) lndrs Crescent Lndry Gaither Andre L (c; Mamie) porter Hen- drick's Grocery r600 3d av (V) Gaither Lillie (c)' maid r60O 3d av (V) Gale Jas (c) lab r700 (519) Colquitt Gale Lucille (c) h700 (519) Colquitt Galkin Beni (Esther) tailor h776 Walnut Gall Martha (c) r518 Bright la Gallaghan M J slsmn Macon Cigar & To- bacco Co r821 New Ga(l1l6a4w) avPluCmhamser(sc;alAnna L) lab h304 Gallemore Apsv (c) lndrs rl06 (228) Tur- pin (T) Gallemore Clara H (wid John L) h865 Orange Gallemore J Parker (Fannie M) v-pressec Central City Bag Co h.808 Courtland av Gallemore John interne r865 Orange Gallemore Levi (Nora) slsmn r863% Orange Gallemore Lois slswn W T Grant Co r865 Orange Gallemore Rosa M rl62 5th Gallemore Sara slswn W T Grant Co r 865 Orange Gallemore Wm slsmn Nu Icy Bottling Co r220 1st Gallimore Floyd (c: Mary) lab h512 Cal- houn Gallimore Jas W (c: Gertrude) porter h99 Smith (EM) Gallimore John W (c) del mn r28 Cheatham al Gallimore Leila (c) lndrs h28 Cheatham al Gallimore Winfred (c) lab MD&SRR r 257 Broad (EM) GaNlleowwsavCCo hra3s01MC(hDeerlrlya R) mgr Union Galloway Della R Mrs waiter Union News Co r301 Cherry Galloway Horace (c; Mary L) lab h212 Mutual av (V) Galmard Alf B bkpr r250 Columbus Galry Alonzo J (c: Mattie) lab h302 Gantt City rd (SM) Galry Hattie (c) lndrs hi (316) Hanson (SM) Galt Robt H (Vivian) chemist hll5 Stonewall pi (V) Gamble Geo (c: Janie) janitor Mercer Univ h217 Jefferson Gamble Geraldine tchr r2524 Forsyth rd Gamble Lee driver r563 Hemlock Gamble Mildred tchr PS rill (173) Che- rokee av Gamble Motor Express L Glenn Dungan agt 756 Broadway Gamble Robt M rill Buford pi (V) Gambrell Harriet D (wid Patk H) h268 Hardeman av Gammage Angeline H (wid Norbie) hl09 Washington av ant 3-4 Gammage Carlton D (Nita C) mech D H Adams Motor Co h335 Winship (WH) Gammage Frank T (Nancy) trav slsmn r507 (501) E Napier av Gammage lone slswn rl09 Washington av apt 3-4 Gammage Nita C Mrs elk Union Dry Gds Co h'335 Winship (WH) Gammage Norman C emn CofGRy Gammage Thos elk rl09 Washington av 8i.pt) 3~1 Gandy Israel G (Grace) mill wkr h5 Mel- rose (B) Gann Lizzie (wid Chas) hll2 Capital av Gann Viola mill wkr Bibb Mfg Co rll2 Capital av Gann Wm pntr r555 2d Ganns Robt (c; Ida) lab h503 Fulton (EM) Gans Adele H r811% Cherary Gans Alf N (Bertha C) bkpr Fried's Ga- rage r818 Cherry apt 4 Gans Floy B (wid Milton N) slswn Dan- nenberg Co h718 Mulberry Gans Juliette student r811% Cherry Gans Nathan slsmgr Happ Bros Co h 818 Cherry apt 4 Gans Sanford N slsmn h811% Cherry Gant Lee (c) lab r4 (3) West Boundry Gant Margt (c) h628 Washington av Gantt Chas (c: Doris) lab r701 Ash Gantt Harrison (c) lab rl09 (7) Frank al Gantt Jas T (Blanche) h424 Vineville av' (V) Gantt Lee (c) firemn CofGRy Gantt Oliver (c) lab rl08 2d av (V) Gantt Rosalie E (c) h329 Madison 143 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Gantt Rose B (c) tchr Hudson Industrial Sch r329 Madison Gantt Willie M (c) maid h701 Ash Garbutt Robt student r315 Coleman av (CH) Garcia Arth printer Macon Teles Pub Co rlOOl Montpelier av Garden Harry (Evelyn E) acct hi84 Holt av (NHts) Garden Perry mill wkr r784 Holt av (N Hts) Gardiner Alf S (Roberta J) supt Snow's Lndry & Drv Cine Co h229 Riverdale Gardner Alice (c) cook rl47 Pecan av Gardner C M r5E5 Mulberry Gardner Chas (c; Willie) lab Sawyer Coal & Ice Co h368 Bay Gardner Ed"ar R ice cream mkr Swift & Co r769 Mulberry Gardner Ella F (c) nurse 120 Green h do Gardner Fredk P (Freda D) pntr hi 19 Richmond Gardner Fredk P ir dist mgr Macon Eve- ning News rll9 Richmond Gardner Geo A (Clara) h223 Riverdale dr (I) Gardner Hattie (c) r200 (201) Colquitt Gardner Henry (c) h242 Woodcliff Gardner Jack (c; Mabel) lab h2 Ross st pl Gardner Jos H tchr Lanier High Sch for Boys r Houston rd Gardner Leroy (c; Nellie) lab r750 Edge- wood av Gardner Lula M (c) lndry wkr r430 (329) Straight (U) Gardner Mamie (c) r368 Bay GGaarrddnneerr MMaunrrdavy (Rc) m(Sauied Cr7)60suApsth Bibb Mfg Co No 2 hll62 Oglethorpe GaMrdancoenr GPaauslCEo h(lFl4ranCcoirnbain Gav) (sVls)mn Gardner Ruben (c) lab rl 17) Spring Gardner Ruth (wid Emmett E) matron Methodist Orphan's Home r201 Pierce av (V) Garey Fanney D (wid Dupont) r600 Napier av Garfield Alf L (c) agt Pilgrim Health & Life Ins Co r419 (468) 3d av (V) Garfield Beatrice G (c) tchr r419 (468) 3d av (V) Garfield Chas H (Annie) h706 Pine Garfield Howard R (Sarah M) elk Ga Power Co hl20 Beech av Garfield Jeannette bkpr R C Cropper Co r209 Brentwood av Garfield Jones (c) lab r606 Clinton (E M) Garfield Kate B (wid Leonard H) h209 Brentwood Garfield Leonard H (Carrie M) slsmn h 102 Rogers av (V) GaerrfsieladvL(eVo)nard H jr student rl02 RogGarfield Mary E (c) tchr PS r419 (468) 3d av (V) Garfield Wm H (c; Gertrude) repr h419 (468) 3d av (V) Garland Annie (c) lndrs r487 Short al (V) Garland Jas (c: Nellie M) porter Collins Baking Co hl05 (361) Edison (EM) GGaarrllaanndd JJoohhnn T(c)(Slaubsarn4)87phSyhsohrtl0a8l B(Vu)- ford pl Garland Lena M emp Snow's Lndry & Dry Clng Co Garland Meta (c) maid hl25 Green Garling Beni T (c) h24 (23) Malloy's al Garlington Cecil G (Susie M) reprmn h 207 Heard (SM) Garman Carrie (c) emp Snow's Lndry & Drv Clng Co h803 (816) Cowan (EM) Garner Edw hatter Economy Shoe Reprs & French Dry Cleaners Garner Eliz Mrs mill wkr Bibb Mfg Co rl823 3d Garner John C (Annie) loco eng h4100 (3980) Houston av (SM) Garner Mary L student r4100 (3980) Houston av (SM) Garner Mary V tchr Wesleyan ConservaGatornryerr4O51scaCrol(lce)ger217 Chestnut Garner Patience C (c) tchr PS h217 Chestnut Garner Tucker fety wkr Bibb Mfg Co r ill Lake City (EM) Garner Virginia prof Wesleyan Coll r Wesleyan Conservatory Garner Walter (Irene) mill wkr Atlantic Cottton Mills h'53 (8) Roff Home pl Garner Wm B (c: Mary) lab r265 Wood- cliff Garner Wm M (Emily) carp hl42 Knott Garrafa Camillo B v-pres Williams Jewelry Co r533 Orange apt 22 Garrafa Quinto auto mech r533 Orange apt 22 Garrett Addie (wid Ocea) rl02 2d Garrett Cecil elk Jake's Shoe Store rl02 2d GARRETT CHAS H (Edith), Solicitor General Macon Judicial Circuit, Court House, h926 Vineville av, Tel 1653 Garrett Clyde (Nettie) mill wkr Bibb Mfg Co r2 Handers (EM) Garrett Edw M (Sarah R) fety wkr h2080 3d Garrett Eliz (wid Jas) slswn The Eleanor Shop rl09 Oakland av Garrett Emmett F (Nettie M) mach opr Happs Bros Co r222 6th av (SM) Gashrrieptt (WEtHtie) (wid Robt H) h250 WinGarrett Eug E slsmn Macon Lumber Co h3006 (5) Forsyth rd Garrett Eug E .ir (Macon Lumber Co) r 3006 Forsyth rd Garrett Geo C (Thelma) slsmn h209 Hardeman av Garrett Gerald (c) lab r402 Mason (SM) Garrett Geraldine student r926 Vineville av (V) GaErlrliestt IHncarrry25P4 bAkppprleMtounrphavy Taylor & Garrett Jas driver rl02 2d Garrett Jos F (Martha) elk h279 College Garrett Jos Z (Clara) r30O6 Forsyth rd Garrett Judson (c; Ophelia) r405 Mason (SM) Garrett Layton driver rl02 2d Garrett Lehman student rl6 Lake City (EM) Garrett Lucy (wid John) fety wkr Bibb Mfg Co hl6 Lake City (EM) Garrett Onie hsekpr 3006 Forsyth rd Garrett Quinton student rl6 Lake City (EM) Garrett Robt L (Pearl) marker Crescent Lndry Co h254 Appleton av Garrett T Eug (Bessie) chf detective Police hl55 Park pl Garrett Wm slsmn Collins Baking Co r 754 Cherry Garrison Edw G (Helen) lab r201 Park (I) Garrison Lorena Mrs elk GtA&FTeaCo rl30 Highland av Garrison Marion E (Sammie) lab h201 Park (I) Garrison Paul H slsmn American Bakeries Co r2301 2d Garrison Roscoe C cond MD&SRR hi21 3d Garrison Walter (Lorena) elk GtA&PTea Co rl30 Highland av Garrity Mary A (wid Walter J) h341 Vista cir Garvin Ellis E (Annie B) slsmn h2528 2d DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES ' and Canada These are for your convenience If you want infurination you are unable to procure elsewhere call on ua R. L. POLK & CO. DETROIT 144 J. GUY JACKSON, General Agent GUARANTEE MUTUAL LIFE CO. Purely Mutual Legal Reserve Old Line Company--Organized 1901 Third Floor First National Bank Bldg. Telephone 1142 Garvin Fredk slsmn American Oil Co r 608 Holt av Garvin Gladys S cash r723 1st Garvin IL (Lucile B) slsmn Collins Bak- ing Co r Centerville Ga Garvin John C (Anna M) carrier USPO hl02 Capitol av Garvin Wm F (Jimmie) lab h416 Elm Gary Anna (c) r232 Jones Gary Annie (c) hi 14 (515) Johnsons al Gary Charlie (c; Bobbie) porter King- man & Everett Inc rl65 Telfair Gary Kelly (c) lab rl20 Franklin Gary Jos (c: Clanzy) lab rl06 (6) Ala- bama (SM) Gary Laura (c) r964 Pio Nono av (T) Gary Maggie (c) hl06 (204) Henry (S M) Gary Marie (c) h319 Norris (EM) Gary Maude (c) h468 Bay Gary Sami (c; Annie E) chauf h526 3d av (V) Gary Sol (c) hl05 Elm Gary Wm (c; Eliza) lab rl2 Sparks al Gaskin Henry (c; Evelyn) firemn h702 Elm Gassaway John S (Kathryn H) buyer Swift & Co hl508 Vineville av (V) Gassett Mason r279 Rutherford av (SM) Gassett Thos J (Lucille) signalmn r378 GaOsrsaenttgeWm O (Mary) hl02 Heard (S M) Gaston Aubrey driver Sunlite Elec Bake Shop r518 Pine Gaston Clinton (Maybelle) driver r518 Pine Gaston David (c; Henrietta) lab h229 Riley av Gaston Eliza (c) lndrs hll3 Main (S) Gaston Emma (c) lndrs r219 (221) Hazel Gaston Harold r518 Pine Gaston Maybelle Mrs mgr Zettler House r518 Pine Gates Alva (c) rll9 (112) Green (V) Gates Cleo (c; Doris) lab hl039 Mont- pelier av Gates Duncan (c; Mary E) pdlr h333 Er- nest (CH) Gates Eunice (c) lndrs rl642 1st Gates Josephine elk Bibb Mfg Co r811 Poplar apt 5 Gates Louise (c) student r333 Ernest (C H) Gates Nettie (c) r333 Ernest (CH) Gates Otis A (c: Addie) lab h357 Flan- ders (EM) Gates Paul G (Reba) dentist 516 Mul- berry R1005 h315 Vineville av (V) Gates Richd slsmn r356 New apt 5 Gates Robt (c; Josephine) lab Taylor Iron Wks & Sup Co h962 Hazel Gates Rosa (c) maid rll9 (112) Green (V) Gates Rosa L (wid Oscar H) hl29 Pio Nono av (V) Gates Thos (c) gro 1125 Montpelier av h do Gates Thos E (Evelyn) slsmn h331 Vine- ville av (V) Gates Walter S (c: Annie) h935 Broad Gates Willa M opr SBT&TCo r811 Pop- lar apt 5 Gates Willard E slsmn J W Burke Co h 356 New apt 5 Gatson Elbert (c) r516 (100) Elliott (E M) Gatson Jos (c; Irene) porter United Food Bakers Co Inc r516 (100) Elliott (EM) Gatson Wm L (c) pntr h224 1st av (V) Gattie Barney (Mary) lab City h818 Main (EM) Gattie Louise r353 Flanders (EM) Gadtetries P(eErMry) (Lula) lab City h353 FlanGattie Perry jr r353 Flanders (EM) Gattis John P (Jewel M) cable splicer SBT&TCo h352 Log Cabin blvd Gaultney Edmond T (Effie G) slsmn h 448 Beech av Gaultney Edmond T jr agt Industrial Life & Health Ins Co r448 Beech av Gaultney M Pauline slswn r448 Beech av Gaultney Robt L (Lena M) hl04 (105) Cleveland (SM) Gavin Estelle (wid Chas M) h509 Ridge av (V) Gay Beulah (c) lndrs h260 Broad (EM) Gav Clothing Co Chas D Payne mgr 458 3d Gay Donna (c) r313 (327) 1st av (V) GaMv) Essie M (c) maid h504 Martha (E Gay Guy (Sarah) r278 College Gay Lehmon student Ga Academy for the Blind r RD 2 Garfield Ga Gay Malley L (Lucy) slsmn r207 (195) Henry (L) Gay Owen V (Vera) driver O F Davis Truck Line h307 Church (EM) GaMv)Rosa L (c) student r504 Martha (E Gay Sarah K Mrs dist supvr WPA r278 College Gaylar Eliz (wid Abbv J) r2129 Broad- way Gaynor Ernest (c) lab r220 Patterson (N Hts) Gazaway Eula (c) rl24 Edgewood Gazaway Lizzie (c) h625 Division Gdrolstein Chas G (Economy Dry Clean- ers) r Terrace Apts Gear Nell (c) cook r258 Orange st la Gebara Chas gro 641 Fort Hill OEM) h 639 do GeWddaoywnessJaasl ((cS:MP)auline) lab hl03 (26) Geddows Wm (c) rl03 (26) Wayne's al (SM) Geeslin Chas B (Maggie L) slsmn r415 Church (EM) Geeslin Emmie L sec Ga Ret Lmbr & Bldg Supply Assn r216 Adams Geeslin Jack (Julia) slsmn Coleman- Meadows-Pate Drug Co r494 Orange Geeslin Julia Mrs opr SBT&TCo r494 Orange Geeslin Lois (wid Jack) h310 Forsyth Geeslin Louise (wid Wm F) h220 Adams Geeslin Michl elk Crescent Lndry Co r 216 Adams Geeslin Ola (wid Benj F) r765 Walnut Geeslin Pearl L (wid Jas M) h216 Adams Geeslin R Fleming r216 Adams Geeslin Wm student r220 Adams Geeslin Wm F 1st lieut Ga Natl Guard r494 Orange Geiger Jessie sten Park & Strozier r209 1st Geiger Lillian (wid Clinton) r921 (1989) GeLigoger CQaubiilnliabnlvd(c: Hannah) lab h309 Jefferson Gelders Albert L sports editor Macon Evening News r818 Cherry apt 4 General Reduction Co Karl R Slocum mgr clay products ft Poplar Genone J Ernest (Leah; Genone's Bar- ber & Beauty Shop) hl06 Buena Vista dr Genone John J (Jessie O) lino opr Macon Evening News rl06 Buena Vista dr Genone Rose rl06 Buena Vista dr Genone's Barber Shop (J Ernest Genone) 568 Mulberry Gentry Wm student r804 2d Geoghegan Brooks (Geoghegan & Norris) h401 College apt 8!C GEOGHEGAN & NORRIS (Brooks Geoghegan, Albert L Norris), Certified Public Accountants, Audits, Systems, Tax Matters 505 Happ Bldg, 150 Cotton av, Tel 6266 145 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 George Amelia (c) midwife 440 Liberty (SM) h do ,, ,, George Amos (c) lab rl02 Woolfolk (EM) George Annie D (c) r263 (667) Hall (E M) George Clifford C (Ariminta) carp h28 Melrose (B) George Cora (wid Drew) mill wkr Bibb Mfg Co h351 Fairview av (EM) George Dazzel C (c) cook h336 D av (V) George Durward P (Dora B) cond h429 Johnson av (HH) George Edgar (c: Virginia) agt Afro- American Life Ins Co h340 Middle (V) George Estela (c) maid rl02 Woolfolk (EM) George Evelyn G r429 Johnson av (HH) George Fuller (c) lab Geo F Yetter Inc r210 Bostic la George Helen (c) cook r406 Ward (V) George Hetty (c) r94 Harris al George Jas F r429 Johnson av (HH) George Jos B (c; Bertha) lab h407 E 2d (EM) George Julia (c) maid r5 Sth av (V) George Lula M (c) rl67 May av (U\ 'George Mary L (c) cook r26'3 (607) Hall 1 ICE1M)' George Mattie (c) Mrs rl'2 Cheatham Georgia Power Co sub sta 43 Franklin Georgia Radiator Co (`Hubert D Howell) reprs 61(4 3d' Georgia Railroad Robt flrt agt 403 Cherry RIF6051Wynne div Georgia Railroad (freight depot) John 1C Wydhe frt agt Sth bet Pine and Dak Georgia Retail Lumber & Building Sup- ply Assn (District No 3) Emmie L Geeslin sec 105 Cotton av RJ5 GEORGIA ROOFING ,& SUPPLY CO, Albert E Sheridan Mgr, Roofing Con- tractors and Distributors, Barrett Roofings, Everlox Shingles, Easy Terms, 3 Years to Pay, 30 Oglethorpe, Tel 3121 (For further information see right side lines and page 29 Buyers' Guide) Georgia Seed Store ((Robt D Kingman) (460 3d Georgia Service Station 28'46 Houston av (SM) Georgia Southern and Florida Ry Co (frt depot) Otis G Prentils flrt agt Plum sw cor 5th ^hops 891 Watervllle rd Georgia State Farmers Market Jos W Daniel mgr 430 Oglethorpe' GEORGIA--STATE OF Forestry and Geological Development ial ((Forest Service) Herbert C Casrruth IGeorge Rulby H 1+429 Johnson av (HH) idist forester Cherry nw cor 1st (George S'adie Mrs r5'2 Holt av (N Hts) Highway Board Division No 2' E Jack IGeorge Washington (c; Rebecca) lab (Smith div eng Court Housd hll04 Washington (OH)IGeorge Wm (c; Louise)' hi3ii;i Harris la Income Tax Office 3'd fl Federal bldg INlational Guard Armory 506 1st IGeorge Willie (c; Mary) lab r28!3 ( 067) Hall (EM) Georgia Academy for the Blind G Frank National Guard 121st Infantry Felton A Whitaker lieut col (h'dqtlns) 51 Mulberry R4H2-13 lOliphant supt 1501 Vineville av (V) (Georgia Academy for the Blind (c) Jdhn National Guard Co C 121st Infantry '(Floyd Rifles) reiar 45 2d IA Williams prin 247 Madison 'National Guard 1st Battalion ('Head- 'Georgia Ae'rie No 977 FOIE Lester H . Chapman sec meets every Wed at 8 p m 404% 1st Georgia Auto Co (Robt B Domingos) reprs 517 Plum quarters Co) 50 ISt National Guard l(21st Infantry (medi- cal detachment) 222% cotton av (National Guard lBlist Infantry (Ma- con Machine Gun Co) 506 1st Georgia Better Business Assn Inc Helon iOhichesteir pres Louis B Wilson treas GELOutRhGerIAA UMNcD'CEraRryWRPIrTeEs,RST AINyCer, Arth L Brooke sec 506 Orange Hatcher Sec-Treas, 508 Mulberry, Tel Georgia Beverage Supply Inc inm'an D 6186 Averett mgr brewers agts 802. Broadway Georgia Casualty Building 51 Mul- Georgian Apartments 813 Poplar Georgian Terrace Apartments 281 Geor- gia av berry Geotte Phillip W (Eliz) tailor h'41 IGeorgia-tOarolina Oil Co Ins Rudolph American iblvid W Jones pres Julian R Maddux vpres 603 Hammond Georgia Highway Express Inc Geo R Gerard Wm elk Piggly Wiggly Stores . rl?13 2d Germany Amanda (c) rlOl Ell Barfield agt 103 Cherry' Germany Frank (c; Sallie) clh'auf hl0(3 Georgia Industrial Home Jay W Camp 1st in 2 charge mi w oIffndLuostgriaCl 'aHbionmeblvrdd1 RD 1 Georgia Inspection & Hating Bureau (Wilson Y Mason spl agt 403 Cherry (RJ314 Gerner John H (Hath K) chi elk Ma- con GasjCo h`9'9 Vineville av apt B2 Getson (Log Carrie Cabin (wid Chas dir h302 J) gro (3110) d3o01 4 (317) Gewin Christopher C (Dora A) rate elk Georgia Loan & Trust Co T Harold hiiai Miagnolia 'Boone preS-genl mgr Wm V Williams Gewinner Hazel tch'r FIS 1111200 Vine- sec Walter S Boone toeas loans 409 2d (R302 Gevwilliennearv H(Vol)t J jr reporter MaJcon Georgia Market House J Wm Young (Evening News rl`205 Vineville av (V) mgr public 460 2ldl Gewinner Napoleon G phys rl'206 Vine- Georgia Market Service Station (U Leon ville av (V) Dennard and Wialton E Mize) 42i6 Gholson see also Golson' Oglethorpe Gholson Chas H (Efiz)i 1503 Boulevard Georgia Motor Finance Co (Sidney L l(NIH) Burns) SI Mulberry Rll'l' Gholson Julius tchr rl65 Ell (SM) Georgia Peach Growers Exchange Wm Gholson Riclhd L (Bessie F) dept supt C Bewley genl mgr 409 2d (R318 (CofGIRy h'1'05 Ell (SM)' GEORGIA POWER CO, B Ruffin Chest- Gibbons Irene Oc) Ind'rs h'108 (290) ney Division Manager, W (Erwin Houser District Office Manager, For In- (Craft (V) Gibbons Mary (c) student r414> 0446) quiries Concerning Electric-Topics and 'Street and Bus Service at Ali Hours, 179 Cotton av, Tel 4100 (For Womack (EIM) Gibbons Rosa (c) Ind'rs Crescent Ln'dry (Co r414 (446) Womaick (EM) further information see inside front Gibbons Thos W (c; Ellen) e'arp h414 cover) , '(448) Womaick (EM)' We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go, Publishers 431 Howard St. Detroit 354 4th Ave. , New York 146 WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. 64 Gibbs Artih (Gladys) millwkr Willing!ham Cotton Mill MBI4 Roff Home la Gibbs Burke (c; Ruth) elk b94 Forest av (V) Gibson Leila M (c) rl08 Gantt City rd USM) Gibson Levi (c; Fannie) lab h30'6 (432) (Alabama (SM) Gibbs Caeser (c) bellmn Hotel Lanier Gibson Lillie Mrs tel opr City of Macon r229 Moughon (V) rl3B Cole Gibbs Carrie B (wid Jas E)i r43IS Oairling Gibson Lillie (wid Robt) r809% Pine av Gibson Louise (c) rl55 E Academy (E Gibbs Chas (c; Peialrl) porter h3!ll2 (323) Bowman (EM) MX Gibson Lu'cy (c) rllO May" Gibbs Clara E slswn r4B6 Carling av Gibson Mamie (c) rlOS Ganltt City rd Gibbs Gibbs Eliza (e) Eras'mus r229 E (c; MJoousgehpohnine()V)h806; 13d av (V) GiKbSsoMn) Marion Mrs rl29 Buford pi Gibson Martha sten Cornell-Young Co Plumbing and Gib'bs Gladys (c) h'503 E 1st (EM) GiKbVb>s Horace (c) porter h229 Moughon Gibbs Ida M slswn W T Grant Co r436 Darling av Gibbs Ma'rgt student r897 Wiriton av rl08 Lee (I3M)I Gibson Nellie (c) cook Lawrence H Gib- son rl38 5th av (V) Gi2bdsonh!2O64beHdiaairhdeCma(nWialvli1e) phys 362% Gibson Oliver C (Eliz) Ship elk Macon Heating GifbWbsintWonalatevr W (Sadie) slsmn h897 [Cigar & Tobacco Co hlio Lee (SM) Gibson Oscar Oc; Delia) bill poster The Gibbs Wlm D (Lizzie) h205 Grand av Gibson Ad'die (c)' lndxs Macon av Packet A'dv Corp h308 Ward (V) Gibson Oscar (c; Pearl) lab hH63 (162) Best Plumbing is Always the Cheapest I OEM) Gibson Biartoiw (wid Robt H) millwkr hlT6 Short (PM) Gibson Carolyn tchr PIS r<404 Fdrest av KV)' Gibson Carrie (c) lndrs r3 Mitchell (E DVD May av (U) Gibson Peggy N student r3(B Duncan av Gibson Prince (c; Janie) l'ab r309 Edge- wood av (SM) Gibson Quinton (c) lab rBB Macon av I (IBM) 512 1st TEL. Gibson Clifford B (May I) electn Jack IMann Battery Co r302 Duncan avt Gibson Daisy L (c) h530 Clinton (HM) Gibson Danl (c) gro 424% Pio Nono av Gibson Rachael (c) h'12 Malloy's al Gibson Robt (c) lab rlB'2 1st Gibson Robt (c; Alberta) lalb hW White l(SM) 529 KV) ?m do Gibson Dollie (c) r9il'7 Pio Nono av (V) Gibson Ella (c) cook rl09 (450-) Cedar l(U)< Gibson Ruby (wid Cecil) fctywkr Happ Bros r4001 Houston av (SM) Gibson S'aml Oc) r303 (2012) Slmith (E M) DIRECTORY Gibson Ella (c) Mi's hl3l3 Middle (V) Gibson Emma (wid Lewis L) h533 GiObsroanngeErnaiepsttin1e8 V student ri3S Vir- ginia av Gibson Eug C opr Ga Power Co t404 Gibson Sami Oc) lab r2l2 Macon av (E M) Gibson Sami j;r (c) r303 (202) Smith (E M)' Gibison Sim (c; Sulsie) lab hl338 2d av l(U)i LIBRARIES (Forest' av (V) Gibson Simeon J (c) driver r333 Mid- I -- Gibson Fannie (c) lndrs hil41 Forsyth la dle (V) Gibson Temlple (c) r4'85 Chestnut We Have on File in Our DIRECTORY Gibson Frances Oc) maid r32 Malcon av ((IBM) Giibaison Geo (e; Rena M) lab h!2I Moore Gi'bson Thelma student r208 Tatnall iGib'son shine Thos A Dairies (Ah'd2a08B)Tamtniaaclhl1 opr Sun- Gibson Thos B (Violet C) loco eng hl2'6 LIBRARY Gibson Geo G (Lula B) swtchmn hl08 Virginia av Copies of the Directories of Practically Every City Lee (SIM) Gibson Geo W (Bessie M) gro 3i37 Dan- nenberg av h do Gibson Glenn (Agne's Q) cond h513 Beech av Gibson Van (c; Libby) carrier UIS PO h917 Pio Nono av (V)' Gibson Vinegar Works (HaTry Gibson) 1149 5th Gibson Wm (c; Bessie) lab W109 1st av in the UNITED STATES and Canada Gibson Harriett W (wid Harry) h404 Forest av (V) GigbasronWHkas)rryh.0(4M'91 arBieouAle;vaGrdib1 so(NnIHV)lineGibson Helen tchr PIS iS50 Orange |(U> Gibson Wm (c; Annie M) lab Central ISash & Doolr Co h'81 Wilder (SM) Gibson Wm (c) porter r2 Woodcliff Gibson Wm D auto mecih Clay's Garage These are for your convenience Gihb7s1onFHoroemsterav(c; (LVe) ara) lab CofGaRy If you want information you are unable to Gibson Isaac (c) lab h24 Moore al Gibson J C eng MDi&BIRR Gibson Jas (c) lab h303 (202) Smith (E M)`, procure elsewhere Gibson Jeff (c; Laura) h444 Douglas av call on us i(V)' Gibson Joanna (c) tchr PS r917 PioNona r3H8 develand Gibson Willie student rl08 Lee (SM) Gibson Williis W slsmn r404 Forest av l(V> Giddens Dan'l B (Maud) milllwkr Bibb Mfg Co h58 Davis (EM) Giddens Grace L Mrs checker rSll 5th av (SM) Giddens H W millwkr Bibb Mfg Co r R. L. POLK & CO. av (V) Gibson John M (Mary G) mgr Standard Oil Co h3'41 Collegel 6611 Ash Giddens Isbon A (Crawford) 112119 Jones av (EM) DETROIT GiSbhsoenrifJfohhn;20T3 (Ida W,) Sheriff Rogers av (V) County Giddens Jas Oc; Lena) carp h831 3d av (V) Gibson Jolhn T jr student r20 Rogers Giddens Myrtle beauty opr Union Dry av (V) iGds Co r243 Hardeman av Gibson JOhn W (c; Elmira) farmer h Giddens Nora agt r343 ColumJbus 1334 Robinson rd tGid'd'ens Robt (Irene O) Waiter Jas A Gibson Josephine (c) maid r2i2: Macon Smith h3l3 6'th av (SM) av (-EM) (Giddens Wm Oc; Leila) pouter h267 Gibson Katih (c) tchr r420 Ward OV) Gantt City rd (SM) Gibson Lawrence H Oc) restr rear 303 Giddens Wm S (Nor'a) lab h343 Colum- 'North (V) hl38 5th av (V) bus 147 Phones 146-147 ' MORTUARY AMBULANCE SERVICE 814 Mulberry HOTEL Gigfoy Ernest W (Eliz) city policeman r545 Telfair vGiger Quil'lie (c) l, anb ,, COEGIRy Giglio Cecilia Mrs mus tchr 800 Orange tr do Gignilliat Geo W prof Wesleyan Coll r [Rivoli Gilbert Corine (c) lndrs hll16 ROff Home iav (V) Gilbert D Wade (Emmie) madh h203 Central av CSM)i ^Gilbert Eliza (c) rt22B Madison' Gilbert Ethel (c) maid ril'18 Lynwood av KV)t Gilbert Frances Mrs r335 College Gilbert Frank I (Estelle D) linemn SIB T&TCo hllSl Oakland av Gilbert Geo (c; Ella) lab hl53i (50) Green's la Gilbert Geo (c; Victoria) lab r417 Ward i(V> Gilbert Helen (c) r520 Mon'roe Gilbert Herschel (c; Laurine) hlpr Cof GRy hSOO (119) Charles (SIM) Gilbert Ida M (c) student r201 (3162) Craft (V) Gilbert Irmia tel opr City of Macon h 11115 Lawton av Gilbert Jas F (Della) loco eng hl333 3d Gilbert Jerry (p; Janie J) lab 11258 MSadison Gilbert Kate (Wid Randolph M) hl30 Cleveland av (V) Gilbert Kathryn A slswn F W Wool- worth Co rl91 Oakland avl Giallbl ert Lula (c) maid M09 (122) Kahn's Gilham Henry (c; Ellen) madh h202 1(124) Bowman (BM) Gilham Jas (c; Ossie) driver Central ash & Door Co r456 Coles al Gilham Julia (c) r202 (124) Bowman K'EM) Gi/l(lEhMam) Malry (c) r202 (124) Bowman Gilham Minnie K (c) maid r316 Madi- son Gill Arth (c; Laura) loco firemn hi 12 1(15) DelBarde (SIM); Gill Beni H student r301 Peachtree (E OVD! Gill Clark D (Helen) distributor W109 1(2116) Mill av Gill Effie M (wid Ernest) h301 Peach- tree IBM) Gill Ernest jr appr CofIGRy r301 Peach- tree (BM) Gill John J (Lena; Gill's Bakery) h303 (Bu'fOrd pi Gill John J jr student r303 Buford pi Gill's Bakery (John J Gill) 813 Vine- vllle av (V) Gillard Annie (c) rll2 Hammond GilMand Addie h!250 Ell (S/M)l Gilleland Augustus (Loretta) car re'pr CofIGRy h62 New Gilleland Dempsey (Cleara) tester Cof GRy 11)11113 Grady (SIM) Gilleland Dillard A appr CotBGRy r62 (New Gilleland ElSie r250 Ell (SIM) GiI (lSleIMla)n1 d Lawrence fcftywkr rl'13 Grady Gilleland Lena ri!l3 Gtnady (SIM)I Gilbert Maria (c) maid i76 Middle (V) Gilbert Mary (c) maid h02O Monroe Gilbert Mattie (c) lndrs h413 Ward (V) Gilleland Leonia fc'tywkt Oarstaphen r 1113 Grady (SIM) Gilleland Louie (Eva) driver rlOB 2d Gilbert Mildred (c) maid hll'18 Lynwood av (V) Gilbert Mil'dlred Mrs slswn Thos E smith r HD 2 Gilleland Lucille rec elk Dannenberg Co rll3 Grady (SM) Gilleland Marguerite office sec Dr E (Roy Respess r2l50 Ell (SIM) Gilbert Nancy (c) maid rll3 Johnson Gillespie Artth M (Maggie) wtchmn I0SM)) Hapip Bros Co h'7'18 Hemlock Gilbert Oscar (c; Leola) r822 Elbert (S Gillespie G Emory (Susie I) emp CofG IRy r Edna Place rd Gilbert Ray (c; Martha) t5U'7 Coleimian. al Gilbert Thos (Rosa) medh h685 Hillyer av (OH) Gillespie Jamie M (Bettie) ship elk Happ Bros Co hH7H3 2d Gillespie Rebecca slswn P6613 Mulberry Gillespie Rolbt hlipr Freed's Garage r68 Gilbert Willis L ('Annie P) mach CofG Mulberry IRy lilt Richmond Gilchrist Walter J (c) car washer Mrs araih C Nutting , ,, Gilder Gordon (Lillian) lalb M'10 Em- erald (IBM) Gilder Opal rl'10 Emerald! (BM)1 Giles Alice (wid Walter W) h218 Orange Giles Andrew J r92'l (1989) Log cabin tolvd __ ,, Giles Carl driver ri04 StJJ'olhn (iBM)' Giles Foster (c) barber 205 % 5th h do Giles Jas C (Hazel) elk WRA h'104 St John (EM) Giles John B elec eng COflGtRy h921 1(1989) Log Cabin blvdi Giles John B (c) lab rll9 (28) Frank al Giles Lula M r4!5!7 Oak Gillette Wm J (Geneva) slsmn rl04 Delaware av (V) Gilley Jas (Ada) millwkr Bibb Mfg Co !r2140 Jones av (BM) Gilliam Dillard (Ned) maich xl7'71 1st Gilliam Eabl V elk r3i7ll 1st Gillian Gillian Eudell Liola (c) (c) rr880099: Elfoeirt Elbert (SIM) (SIM) Gilliard Jos (c; Martha) bellmn Hotel Southland r208 College Gilliard Julius (c; Eliz) liab h'182 Broad l(EIM) Gilliard Sarah (C) lndrs h410 E 1st (E IMP Gillmian BOssie (c) cook M140 Pecan av Gillon Althea student r905 (925) Na- pier av Giles Mae bk'pr Juliette Milling Co r 628 Orange Giles Manton glasswkr Sign Co rl(M Stdbhns M(EalMco)n.; Neon Giles Margt sten r245 Hatrdeman av (V) Giles Nelle r628 Orange Giles Sanford L elk E Clifford Davis r iZebulon Giles Wm rd M RD II OLucile) hl!3!5 Daisy Park Gillon Elaine Cadet tcWr r905 (925) Na- pier av , Gillon M Virginia aslst Met Life Ins Co Girl9l0o5n O(925G) raNdyapie(rAiralvyln) lawyer 56 Mulberry R2 h095 (925) Niapier av Gillon O Grady jr student r905 (925) Napier av Gillon Robt C mialch Taylor Iron Wks Gilfield Primitive Baptist Church (c) 92 (85) Hazel '& Sup Co r Arlington Hotel Gills H D (Juanita) meidh r68 Mulberry Gilham Carrie (c) maid hSil Madison Gills OlScar L mach opr iCUlff 2d Gilham Earl (c) lab r921 Oemulgees Gilham Eula (c) maid hB14 Ocmulgee Gilham Gyrie M (c) cash r814 Ocmul- Gilman Jesse P (Aline C) cornl agt L&N lill h842 Courtland av Gilman Lizzie A (wid Fleming E) gro 'gee 315 Rutherford av (SIM) h do 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 148 WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 L&J 4ac<-ouJ OS <43to f aas* 3 imCnM Gilman Onnie F (Jessie D) hl!3 Rutherford av (SIM) Gilman Thais D (Gladys L) hlpr Ga (Power Co M416 Forsyth Gilman Thos H r315 Rutherford av (S IM) Gilman Welton H afllB Rutherford av i(SIM) Gilmore Annie (c) lndirs hlllTa Lincoln Uv (iV) Gilmblre Bishop (c; Daisy) fab hJ135 1(104) Glen (EM) GiI'Mlm)'ore Ch'as P (e) rl25 (104) Glen (E Gilmore David (c) r224 Madison Gilmore Geo (c) T302 (4318) Alabama (S IM) Gilmore Geo (c) hSOB (438) Alabama KSM) Gilmore Jas R appr CofGaRy rll32 Col- lege dr Gilmore Jennie M (c) student rtOT 5th Gilmore John G bldg contir 219 Ad'ams r do Gilmore Jos (c) lab rl06 (260) Railroad av (V) Gilmore Lillie Oc) maid h318 (1316) Mon- roei Gilmore Lum (c) lab rl08 (250) Rail- road av (V) iGGiiltmooo)rree Mae Mai-y Mrs rl26B Grange A (c) maid Hotel Arcadia IW1I5I8 4tih av (V) GiGlmleonrne M(EoIzMe)lla (c) student rl05 (124) Gilmore Starling C (Pearl L) brick ma- son CofGRy hll'130 College dr Gilmore Willis (c) lab ri25 (124) Glen l(EM) Gilreath Edgar (Jean) fotywkr W349 IPlande!rs (EM) Gilreath Pealrl Mrs tclhr PIS h602 Carling Glass BUrney L (Hattie) millwkr Willingham Cotton Mill hl03 (49) Holt av (NBts) Glass Danl G millwkr Willingham Cotton Mill r2I6 (19) Holt av ((NHts) Glass Edlw (Beckie) pn'tr hi33a Pio Nono Glass Eliz student rl25 Nottingham dr KNH) Glass Frances E rli31 (36) Holt av (N (Hits) Glass Helen R millwkr Willingham ICotton Mill rl01 (35) Holt av (NHts) Glass Lula E hl03 Academy Glass Nannie M r2l6 (19) Holt av (N Hts) Glass Raymond C (Leila V) millwkr Wil- lingham Cotton Mill hl31 (35) Holt av (NHts) Glass Sadie S (wid Emmett) h2l6 (19) Holt av (NHts) Glass Glass Thos Siam! E E jm!r il(lDwokrrort3h3y(2GP)ioelNkoUnonioanv (Dry Gds Co h061 Georgia av apt C4 Glass Wm (Lucille M) millwkr Willingham Cotton Mill hl07 (37) Holt av (N Hts)' Glass' Pharmacy (Albert W Glass) 300 Broadway Glassman Sami J (Myrtis) mgr h'426 Cherry av Glawson Geo (c; Helen) M> h01O Lee l(EM) Glawson Harry (c; Irene) lab h813 (036) Fort Hill (EM) Glawson Jesse (c; Bessie) lab CofGRy h'8812 Maynard (EM) Glawson Raymond A (Elsie) mgr Glaw- . son Service Station r!218 Spring Glawson Service Station Raymond A Gllawson mgr filling sta 280 (2) Main i ('EM) mmm (Gilreath Zebulon H (Pearl) repbmn City (Water Wks Ji'602. Carling av GLAZE MILLARD (Martha), Envoy in Charge The Salvation Army, h.618 Gilstrap Lizzie B Mrs picker Macon-Peanut & Stge Co rl20 Fort Hill CBM) (Gilstrap Olan OLizzie B) flgmn rl20 Mulberry, Tel 2836 Glazier Harvev W student rl03 Law- ton av We Have on File in Our Fort Hill ('EM) Ginn Jas driver ri767 Walnut1 Girardeau Robs (Elvie) ship elk Wil- lingham Siaslh & Door Co plant r657 Gleason Eliz (wid Edw D) h718 2d Gleason Ovellfa M dentist 516' Mulberry (R50I3 r718 2d Gleaton Mary Mrs beauty dplr Genones DIRECTORY LIBRARY IPine Barber & Beauty Shop rl'14 Cole apt Givens Curtis (c) porter r9i2 Forest av I) KV> Gleaton O Herman (Mary) bakeir At- CipSes of the Givens Dorothy (c) dk The Macon kins Bakery rSS3 Plum D EPeetories of Telegraph (colored br) r92 Forest av Gledhill Arth C (Sarah K) real est h277 Practically Every City in the (V) ' College (Givens Raymond (c) lab h92 Forest av (CVT Gledhill Arth C jr student r277 College Gledhill Eliz student r277 College Givens Raymond Jr (c; Eliz) detain Gledhill Josephine student r2l77 College UNITED Vineville Drug Co lil'Oe Ruby (V) Gledhill Louise student r277 College STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT Givins Ernest (c) student r306 (730) Bowman (EM) Givins Jas T millwkr Bibb Mffg Co r38 Taylor av (EM) (Givins Mary L (c) maid r306 (732) Bowman (EM) ('Givins Merchalea (c) r306 (7312) Bow- man (EM) Givins Nancy (c) r306 (732) Bowman l(HM) (Gladden Eva B (c) maid1 r404 Richard i(U)' Gladin Ivy D (Mary E) mgr Atlantic lice & Coal Co (br) W401 Duncan av Gladin Jos A (Marilou V) del elk Kin- nett-Odom Co rl2i2B Albemarle pi Gladin Margt D r40!l Durioan av GLENDENNING DON C (Violet IS), License Inspr City of Macon, h219 North av -(NH), Tel 4209-J Glendenning Emily elk A G Rhodes & ISon r219 North av (NH)' Glenn Ella Mrs wlaiter F W Woolworth Co r887 Neiw Glenn Harry J (Edna M) mgr Ritz Theatre h232 Belvadier dr Glenn Harry J jr millwkr Bibb Mfg Co r 232 Belvadier dr Glenn Helen I student r232: Belvadier dr Glenn Iona (c) maid rU07 (204) 3d (U) ,Glenn John H (e) h3i30 Biarfield al Glenn Jos (c) carp hilllB (83) Bay Glenn Roy G i (78) Mill Gladmlan Clarence (c) clo clnr 103 tHardemlan av r5I9 Monroe \IGliasco Alvin L (c; Volie) barber Willis Braswell Barber Shop hl226 1st av (V) Glasco Ninevlaih (c) elk r20S 1st av (V) IGliason Irene (c) lndrs r!42i8 (460) Wo- Glenn Susie (c) cook ri09 Price (V) GlWenonolfoTlhkosCB(Mc;) Cherry) carp hi12 IGlenn Thos G (Mary) elk T M Raines IGro Co rilllS' Culver CV) Glenn Walter (c; Rosa) orderly h2l25 mack (EM) Glass Albert W (Eliz H; Glass' Phar- Middle (V) Glenn Walter L (Ella) sign pntr Acme macy) hll05 Nottingham dir (NH) Sign Service r8OT New* 149 ROBERT O. THOMAS 569 y* Cherry St. REALTOR Telephone 1067 Glisson H Felton (Ethel) store mgr ipiggly Wiggly Stores hl08 Burton av Glisson Laura A sten r406 (405) Burton av Glisson Mary Cwidi Sami E) MO (406) (Burton av Glisson Sidney L stereo r406 (406) Burton av Glisson Wm J (Minnie) fUrn repr h2'56 Clinton OEM) Globe Dress Shop (M)ax Weinstein) 404 I3ldl GlOxe J C (Olive) millwkr Atlantic Cotton (Mills h'll Atlantic Village GlCoroettoRnoyMiLlls (hR2u9byA)tlamntiilclwVkrillaAgtelantic Glover Albert (c; Odesser O) baketr Col- lins Baking Co 11201 (225) Turpin (T) Glover Alex (c; Fleta) M10 (51(4) May- nard (EM) Glover Alford (c; Sarah) farmer h(10(12 1(11186) Clinton rd (EM)' Glover Annibell (c) lndrs r407 (460) Womack (EM) GGlloovveerr ABennnjie(c(;c)Dta3i1s0y)Nho3r3rlils ((5E21M9)) Mid- dle (lEM) Glover Bessie (c) lab OentraJl City Bag ICo Glover Callie (c) maid 2603 Forsyth rd Glover Carrie (c) lndrs M03 (6) Phil- lips la ('EM) Glover Carrie (c) m'aid r5l47 ((144) Mitchell ((EM) Glover Cecil (c; Mary) lab h!718 Daisy '(SM) Glover Chas (c) rl28 (6) Phillips la (E Glover Ohas B (e) porter rll 4th av ((V)' Glover Clara (c) cook n40O College dr Glover Claude (c; Della) MD1B 010(7) Short OEM) Glover Clifford (wid Geo Z) h'1'10 Coleman av (CtH) Glover CoUrtney r!305 FOrsythi Glover Glover Daisy (c) cook h'78!l Danl (c) lab rill 4th oacvm(uVlg)1ee Glover Della (c) rI2B Chestnut Glover Eddie M (c) maid rll2 0107) Short (EM) Glover Glover Edna Ed'w (c) (c) rlm'2a3i1 d(6r)40P8hiMlliopnsrolea (E Glover Edwin J (c; Willie M) millwkr Bibb Mifg Co h701 FOrt Hill ((EM) Glover Eliz V H (wid Fred) mus tdhr b20 Orange apt 1 h do Glover Emma (c) midwife hlll 4th av Glover Emma (c) student ri!01 4th av Glover Ernest (c; Clementine) bill paster Packer Adv Carp hl221 Chest- nut GGlloovveerr EFsrtaezlilear (cC) rl5(iGl'4erEtru2dde(ESM) ) auto medh h'4211 Lawton av Glover Fred (c) driver rll 4th av (V) Glover Genie (c) hlOS (44) Short OEM) Glover Geo (c) lalb rl'll2B Broadway Glover Geo (c; Mary)' lab. h224 (717) Pear (SM) Glover GusSie (c) cook h'2411 (226) Moore (L'ai Glover Hattie (c) Indrywkt h!807 Fort Hill (EM) Glover Henrietta (c) lndrs r00 Smith KBM) Glover Ina M waiter 1031 Cre(sthill av G'lover John (c; Carrie) atndt Thos M Jones hllO Powell (EM) I Glover John (c; Eliz) lab h301 (306) Henderson's row (SM) Glover Josephine (c) lndrs hl3(17 Madi- son Glover Kelsey (c) lab City r2T3 5!th av KV)` Glover Laura B (c) lndrs rll'10 Powell l(EM)' Glover Lillie R (wid Lake K) h217 1(21(8) Maynard (EM) (Glover Linton (c; F'leta) lab h!27 Stew- art Glover Lizzie (c) lndrs Crescent Lndry Co r923 (953) Ocmulgee Glover Lula M (c) student rl2t6 N Tat- nall la Glover Luther (e) lab r9'16 Ocmulgee Glover M Wm (c) r608 (481) Charles '(SM) Glover Maggie (c) maid h2H8 5th av ((V)' (Glover Mamie (c) h'547 (144) Mitchell KEM)' Glover Mary (c) h62 Academy al (EM) Glover Maty (c) h606 (481) Charles (S M> Glover Mary (c) maid FT2I3 (6) Phillips la (EM) Glover Mary E (c) lab Central City Bag Co Glover Milton (c) porter r2l7 Stewart 'Glover Murger (c) driver hl02 Davis la Glover Nancy (c) r5(B Hazel Glover Northern (c; Callie) lab hlOO 1st av (V) Glover Oza C (Ina M) elk hl06 Chrest Hill av Glover SIRIR OZa C h878 G(rGaneogreg1 ia) yd cond MD& Glover Peter (c) lab r408 Monroe Glover Redmon (c; Ada) porteir r312 'Madison Glover Reese (c) lab ratio Ndrris (EM) Glover Rosanna (c) rl06 (44) 'Short Glover Ruby (c) r503 (401) Chiairles (S M) Glovdr Sallie (c) h204 (405) Campbell av (SM) Glover Sami (c) r301 Wood al Glover Sarah (c) r50B (120) Elliott (E M)' Glover Sarah (c) h(310 Ndrrtts (EM) Glover Thos (c) rl'6il 4tth av (Y) Glover Thos (c) rl'10 Powell OEM) Glover Thos (c; Anna) lab hl03' Cl) IClara. (EM) Glover TObe (c; Maty) millwkr Bibb Mlfg Co h604 E 2d (IBM)' Glover Ulysses Oc) lab rl(61 4th av (V) Glover Wiley G (c; Gladys) tdhr Hudson industrial Sdh h608 (5913) Cowan l(EM)' Glover Wm (c; Mary) hlpr Oanada Dry 'Ginger Ale Ihc h'509 Forsyth Glover Wm (e; Zim'mie) Waiter Hotel ILanier r7'31 Ocmulgee rG.ilnovvmer WWmm wGstruJdTentGrr0a1n7ge(2118) May- Glover Wm L Cc) 1301 (30) Hender- son's row _ ,, Glover Wm N (Olive F; Bibb News Co) rill Coleman av (OH) Glover Willie M (c) r44l4 Douglas av Glover Willie P (c) maid rll2 (107) Short (.EM) Gober Dorothy R student nSOS Grange Gober Ernestine M bkpir Geo F Yetter Inc r7l77 Blackburn ONE)' Gober Fannie (c) r406 (411) Short (E M> Gober Fletdher C (Frances L) elk Ahier- lidan Bakeries Co r7!77 Blackburn (N H) Gober Frank D (Thelma S) driver Power. Oil Co hiai RembeTt av Gober Hiram A (Mamie R) cond h.808 Grange Gober J Fletdher OEssie P; Gober Service Sta) h7HI7 Blackburn (NH) Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 150 saSHftS vi a CO A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Gofoer J Forest (Ttieima) loco fiiemn r Goins Filmore (c; Cornelia) porter L C 1415 Virginia av ISmith & Corona Typewriters h297 Gobar Ralph J cbau'f Safety Cab Co r 1st av (V) 777 Blackburn (NH) Goins Geo W, (Leila M) giro 204 (93) Gcftjer Randolph W (Sara S) credit mgr (Holt av (NtHts) h do Ga Carolina Oil Co hTISO Napier av Goins J W (Amelia) r509 Boulevialrd (N Gofoer Sara S Mrs sten First Natl Bank H) & Trust Co 0730 Napier avi Gober Service Station (J Fletcher Go- ber) 501 Montpelier av Gober Telma s Mrs cash Kinnett- lOdom Co hUM Rembert av Goble Shelton slsmn Dannenberg Co r 1335 Oglethorpe Godard Jas (c; Alice) driver Central Sash & Door Co haiO Elbert (SM) Godard John (c) r910 Elbert (SM) Godbee Beulah W (wid Bracton) h557 Goins Robt W (Alma J) giro 200 (56) Holt av CNHts) h8!30 Dannenberg av GOlaw Hersdhel (c; Essie M) yd'mn r rear 356 Edna pli Goldberg sol slsmn Boyd Shoe Store r 803 Cherry Golden Chas (Daisy) elk rl21 Magnolia Golden Eli lab r233 (2815) Cedar (SM) Golden Louise (c) hi019 Elbert (SM) Golden Queen (c) rlOl (12) Elbert (S New Godbee Bracton driver Leapttot's Mkt (r657 New Godbee Godbee HMialdt'haildre557t35N7ewN! ew1 Godbee Sallie smstrs r557 New Goddard Calvin (c; Ida) lab h303 Gol('lldoie9n) Wm (c; Peaico'ck Mary) shoe (SM) h do repr 203 G?Midagras!hr alBl eFnu'J rnMCo(Ahnln0i2e HSi)ll sClsr'emsnt aHv (CH) GoICldo)garh5CBernNaarpdier(Eavva; Goldgar Furn ICoWian (E!M) Goddard Candus (c; Esther) cliauf h 015 Jones Goddard Edgar (c) lab r0 4th av (W H) Go14dthdaradv F(lWoriHn)e (c) smstrs WBA r608 Goldgar Furniture Co (Bernard Goldgar) 018 Poplar Goldgar Merrill student rl02. Hill Orest l&v ((CH) OutfittersBepht3t05(MHinilnlieC) remstgravRel(iOabHl)e Goldman Irma student r305 Hill ctest GoCdldaarkrd (LEiMzz)ie (c) midwife hl32 (131) Goddatrd Roy (c) lab r60S 4th av (W IH) GoHd)dard Satail (c) lalb r606 4th av (W Goddiard Silas (c; Allie) t403 (344) May- nard (EM) av (CH) !30d. Hill cremstraRv el(iaCbHle) Outfitters r Goldtaan Lizzie (wid Geo; Goldman IPawn Shop) h764 Cherry Goldman Mortimer G (Minnie H) elk Goldman Pawn Shop h18 Cherry apt Goddard Walter (e; Olia M) t308 Cowan I OEM) Goddard Wm (c) lalb t803 4th av (WH) Goddard Willie M (c) cook h812 Oc- mtofn3l8 ^3d SlhOP (Mrs Lizzie GoldG]^y Beatrice elk rS!20 Johnson av mulgee Godfree Mollie (wid Jas) hTTO Mont- pelier av Godfrey Annie B (c) hl'pr Central City Bag Co hi Barker avi Godfrey D Luke (Ida) millwkr Willing- Ihlam Cotton Mill h2! (65) Mill Godfrey Harold elk riJBl' Georgia av Go1d15fr9eyElHmenrietta V (wid Albert C) h Goldsby Boykin W m'ach opr Central G^.o^ldjdstideli.nng CcoharsSl20(TJiolhlinesoBn; avEc(oHnHo)my Shoe Repr & French Dry Clnrs) h18 Cherry apt 5 Goldstein Ellis (Mamie) trav sls'mn h401 College apt 70 Goldstein Jay student r401 College apt 7D' Godfrey Rolscoe A (Lillie M) projectionist Ritz Theatre hi 004 Walnut Goldstein Water Mack (c) Wks 1*2124 4tchoalavro(lVle)r! City Godwin Hardy C (Gladys; Godwin'S Goldwire Bessie B Mrs h38'6 American Beauty Shop) h'806 Orange! blvd Godwin Mamie (wid Lamar) h308 Ridge Goldwire Hal M (Roberta N) loco eng h av (V) '1701 3d GOdwin Walter student rll401 Oglethorpe Godwin's Beauty Shop (Ba'rdy C God- Goldwire Mitchell L (Peggy B) agt New (York Life Ins Co r'170'1 3d win) 362% 2d Goelpp Rudolph (Jessie) barber h!389 Goldwire Virginia student rl33(8 Ameriban _ blvd Orange Goldwire Wm (Virginia) p&perhngr r Goette Fred W (Naomi) pres Stewart- 307 2d lG(Vo)e' tte Electric Co hl3S Stonewall pi Goette Maria Mrs h'12!8 Academy Golsan see also Gholson' Golsan Willard R (Bazemore & Gol- san) r!734 Courtland av - Goette Phil W (Eliz C) tailor Dannenberg Co r416 American blvd Goforth Mary E student r202 Log Cabin dr Goforth Wm M (Vida) h202 Log Cabin dr Gogglans Nonie B (Ruth) m'aich COfGRy h923 (1991) Log Cabin blvd Goggins Frank (c; Mairtha) lab hl013 Elbert (SM) Goggins Fred sta atndt PSOiS Holt av l(NlHtB) Gordggins John (c; Rosa) lab h Forsyth Goihagen Marjolrie student rY20 Mul- berry Gohlston Cleonis (c; Cecile) sta flremn h2Y8 4th av (V) Golisan Wm R (Frances E) div eng Cof GRy h'7'914 Courtland av( Gonder Alf (c; Lula) lab hl20 (211) (Farga&on (V) Gonder Alf (c) lab r2l5i4 5'th av (V) Gonder Alvin (c) rl'13 Lynwood av (V) Gonder Edw (c; Theresa) r8!4i2' Madi- teon Gonder Eug (c) lab rll3 Lynwood' av l(V) Gonder Gladys (c) maid rl'113 Lynwood av (V) Gonder Houston (c) rl'1'3 Lynwood av i(V)' Gonder Mattie (c) maid r!254 5th av l (IV) Gonder Wm (c; Mary) bather Gertrude tSImith hiliHS Lynwood av (V) 151 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Gonder Wm (c) l'alb r*l!H3 Lynwood av 'Goodrum Geo (c; Wilihelmina) porter iGlo(Vn>to peter rSl'5 Orange Goocth Boxey (c) r409 Douglas av (V) Goodall Julia r>564 Orange iGoodall Minnie rt54 Orange iGoodalll Wlm S h604 Orange Goode Florence (c) h404 Applewoo'd (E IM) Goode Hattie (c) r509 Fort Hill (iEIM) Goode Mattie (c) cook. hil2B Sycamore !(V). Goode Robt (c) lab rl'14 5th av (V) Goode Rosa (c) cook r407 034) Hen- rietta (SIM) Goode Sial (c; Georgia) porter h'108 Ward (V) Gooden Albert (c; Dollie) lalb Co'fG'Ry IBiralss Biail r202 (402) Boye (OH) Goodrum Jas (c) delmn John H Pittman r264 Plant (SIM) IGoodrum Jesse (c; Mattie) lab hlll7 E Ell 'Go(oSdMru) m Lucille (c) student r'245 Plant Goodrum Marcus (c; Hattie) lab CofG By hl245 Plant (SM)/ Goodrum Pearl M (c) cook ri46i5 Chest- nut Goodrum Sarah (c) r32 2d av (V) Goodrum Wm (c; Annie) lab h233 Woodcliff Goodson Annie V student r21!3! Cedar l(ISM)' Goodison Calvin J (Myrtle) cond r554 hl!14 Cowan (BM) Goodhue Harold J (Annette) slsmn Cannon Shoe Store r304 Forsyth Goodin CMas (c; Fannie) lab rQOl (552) Waterville rd Goodin H Clinton (Besisie) car inspr h 3703 Houston av (SIM) Goodin Ida (wid Jas J) gro 2097 3d h do Goodin JOhn B slsmn Sears Boebuck & Co r370S Houston av (iSIM) Goodin Nancy (c) lndrs hl'10 Roff Home av (V) Goodin Paul F student rS708 Houston av 1st Goddson Christine da'sewkr City Dept of Public Welfare r211 Cherokee av Goodson Floyd em'p CoflGKRyi Goodson Mollie hl'112 (122) Henry (S M); Goodson Redding (Minnie L) h317 Cleveland (SM) Goodson Wm M (Janie B) lab h313 Ce- dar (SM) Goodwin Andrew Oc; Oathryn) lab h 300 Charles (SM) Goodwin Arth (c; Emma) h.212'9 Norris '(EM) ROOFINGS '(SM) Goodin Susie L (c) M20 (11:0) Gibson av (SM) Gooding Gatson (c; Nora) lab r337 (Bookers al Gooding Jas K (Inez E) mgr Hub Fish Goodwin Badger (c; Mialvenia) mach hlpr h!23i5 4th av (V) Good'win Goodwin Badger jr (c) r235 Benj F (Hattie) 4th av driver r(lV:6H) (Daisy Park Goddwin Boyce (c; Roberta) pdlr h32B EVERLOX SHINGLES SHEARLIBDEARNT. EM. gr. '& Oyster Co W2l2tl Forsyth rd Gooding Juanita h7>5i7 Hemlock Glen (iEM) Good'win Claud B (c) fctywkr r300 Gooding Nellie M (c) r6 3d Street la Gooding Bose M student r2CI3 Highland av (Hants) Gooding Thelma tchr PS r201'l For- syth rd Goodlaw Goodloe Goodloe BLJdoewhstner(c()c;CrOi[(SsE3siVuen2)icCleaobttoErn0) 17asvlBsmosns lOharleS (SIM) Goodwin Daisy r'202 (200) Heard (SM) Goodwin Dora (c) r4!ll (416) E 1st (E Ml Goodwin Ella (c) lnldrs hlGS Brooklyn av (S> Goodwin Fannie (c) h'142: 1st av (V) Goodlwin Geo (c) lab h'250 Summit Hill YOUR CITY Hatcher & McCrary Inic r42B Duncan Goodiwin Geo W slsmn L N Jordan r Goodloe Lilliia (c) ln'dirs M5'5 Walker 202 (200) Heard (SM) D la Goodloe Lillie M (c) maid rflSS Walker la Good'win HuMey (c) lab r30O Charles (SM) Goodwin J Taylor (Anne) trav slsmn r I Goodman Alex M (Fielder B) see-treias 848 Hillyer av (CH) Kmearrnteagphian-Goodman Inct h221 Alber- /Goodwin Jack (Viola) emp Co'fGalRy r Tracey Lanes BD 7 R Goodman Anna (c) tcWr h207 Ward (V) Goodwin Jackson T (c; Addle W) gro Goodman Ethel Mrs c'lk Leon D Brown 982 (939) Montpelier av h do E r Miller Field rd BID 5 Goodwin Jas (c) porter Broadway Serv- Goodman Fielder B Mrs tdhr PS r2'21 ice Sta C Al'bermarle pi Good'win Jas M (Lorraine) office sec Goteoldmaal n Irene (c) maid rl79 Park Ho- L J Cullen Co h877 Orange Goodwin John (c; Callie) lab CofIGBy T Goodman J Wright (c; Mary) lab h30 Macon av (EM) h631 4th av (WH) Goodwin Lester C (Alice E) gJro ,,,,,,,, 3496 O Goodman Jos (c; Anna B) hlpr Chas I Houston av (SM) h do' Martin h'2413 (24S%) Moore la Goodman Mary (c) rl2!4 (111) Hudson! Goodwin Mattie asst registrar Mercer Univ rl07 Hill Crest av (CH) R Goodman Paul (Ethel) elk North Highland Grocery r Miller Field rd BD 5 Goodwin Maude (wid Freeman) hl41 'Carling av Y Goodman Robt (c) janitor Beda Etta Goodwin B D (c) lab r300 Obairteis (S College r207 Ward (V) Ml Goodrich K1923) Fredk W Log Cabin (bJelvwde1 l) carp h909 Goodwin Sami (c; Grace) h224 Joirldans al (SM) MIRRORS Good'ridh Riidhd C (Gertrude M) printer Goodwin Thos E (c) lab rl0'6 Brooklyn the Jones & Coney hi207 (203) Log Cabin av (S) dr 'Goodwin Thds J (Maude) mach h202 Goodrich Silvertown Stores Garner B 1(209) Heard (SM) Industrial MclClamlroch mgr auto accessories 301 Goodwin Wm B (Eul'a) h!5 Moore (S 1st Goodtum Annie M (c) m'aid i4S6 Chest- nut Goodrum Arth (c; Mamie) driver Wil- lingham Cotton Mill b!466 Chestnut Goodrum Edgar W car repr CcffGiBy Goodrum Geo (c; Delia) porter h'104 1(164) DdBoirde (SM) M): iGoodyear Kenneth (Mattie B) oik h2H7 (Bass Goodyear Service Stores Henry M Cul- Hom mgr tires 881 3d Goolsby Annie B (c) student ril 5th av l(V) Goolsby Annie L (c) r620 (20) Gilmer LIFE Of Your CITY 152 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES Where To Buy? Consult the Classified Business Lists in This Directory ARLINGTON HOTEL FRFF I ?R?ADWA.T'dNEAR Jopdlar 1 THOMAS o. STORAGE I "A Good Place to Sleep" | Prop ' Goolsby Bertha L (c) ii&l 1 (512) Elbert Gordon Jas (c; Ruby) lab M049 Pio (SM) Nono av (V) Goolsby Chas cairp Bibb Mfg Co r24 GOrdon Jas (c) shoe shiner Macon Hat tBUbib av Cleaning Co r90tl Taylor (EM) Goolsby Cora L (c) cook rl 5th av (V) Gordon Jas A (Nora L) filling sta 3811 Goolsby Eliz cash Industrial Life & (Houston av (SM) h'101 Troup: Health Ins Co hSSS Mulberry) Gordon Jessie M (c) student rll'8 (IS) Goolsby Jas (c) r503 (19) Hall (EM) Wise av (V) Goolsby Jas (c; Bos'a) hl7 (16) Parker Gordon John (c) lab r402 (305) Charles lav (V)', l(SM> GoalSby Jas (c; Estella lab hTI2 (622) Gordon John (c) lab h0 Gunn's la (V) prince (SM) Gordon John (c; Sallie) lab r218 Lee Goolsby Katie (c) maid r58 Spring I (EIM) (Goolsby Lill'a (c) h!3ll(3 Walnut Gordon John (Bessie) millwkr BibbMfg Goolsby Lizzie (c) Indrs rl23 (13) Co h!03 Comer ter (PIM)) Franklin Street la Gordon John J carp h!03 Troup Goolsby Louanna (c) h315 (87) Plum- Gordon Julia slswn The Eleanor Shop tree (EM)' r030 Ross Goolsby Mattie (c) h'9 Parker av Gordon Julia Mrs fctywklr Happ Bros Goolsby Mildred sten Clinic rSlll Walnut Co r720 Hum Gordon Katie (c) r85;8 Foster's al Goolsby Gla (c) h'620 (20) Gilmore Gordon L V (Mildred') Ectywkir Bibb 'Goolsby Pearl (c) cook hi 5th av (V) Mfg Co hi (14) Lake City (EM)' Goolsby Prentice (c) r316 (87) Plum- Gordon Louis (c) r320 pear ((EM) tree (EiM Gordon Louis elk Siaml Gordon- r239 Goolsby R Cullen (MaTgt L) phys 700 Ross Spring R13I20 hll'6 Rogers av (V) GoolSby Ray (c) r620 (20) Gilhier Goolsby Wm (c) r9 Parker avl Goolsby Wm (c) plstr r18 (87) Plum- tree (BM) Goolsby Wm B (c; Margt) hlpr Fried's Garage b54 New Goblisby Wm M Rev (c; Elnora) pastor Gordon Lucy (c) maid hl20 2d av (V) 'Gordon Lula (c) r220 Pear (EM) Gordon Lula Oc) maid rails Powell (E M); Gordon Maggie (c) cook r33(3 Pio Nono av (V) Gordon Marie (c) cook rl24 (2114) Prank Friendship Biaptist Church h12 Cen- ter GEM) Goolsby Willie M (c) PS1'2 Center (EM) Gordon Ada Oc) h402; (724) Campbell av (SM) Gordon Alice (c) cook h'107 Simmons av Gordon Anne mgr Hotel Gordon r205 New Gordon Annie (c) Indrs hl41 Wia'shing- ton (EM) Gordon Annie L (wid John J) rldl Troy Gordon Arth (c; Willie) h& Ross Street td Gordon Gordon Bess sten Carrie B h452 rll-8 College Corbin aav!pt(V4)1 Gordon Marthia (c) h'8018 Gilmer Gordon Mary (c) cook iSS8 Pio Nono av (VI GGoorrddoonn Mattie T (c) r319 Pond (V) Norman (c) del'mn Jos O Mc- * Kinney Gro Co rl62 Elml Gordon - Peter (c) iato r503 Hazel Gordon Reuben (c; Shilie) lab h-812 Shoals al OEM) Gordon Ridh'd (c) lab r2 Gunn's la (V) 'Gordon Rofot W (Lula) gro 2120 Forsyth rd' h2122 do Gordon Rosa B (c) Indrs hill-2 Spring la Gordon M6I2 EClmha1 s (c; Oath) lab CofGRy Gordon Rose slswn Marilyn Slipper Shop r33i9' Ross Gordon Chas H (Norma L) mgr Atlan- Gordon Siallie r239 Ross tic Ice & Cdal Co h7l3i8 Ridge av (V) Gordon Sami (Esther) gro 476 Douglass Gordon Clifford (c) delmn r2 Gunn's av (V) and 859 3d av (V) h239 Ross la (V) Gordon Stanley E store mg*r Birdsey Gordon Dorothy L stuident rfOT Vir- Flour Mills h817 Poplar ginia av Gordon Eileen (e) maid h'6 Buckner al Gordon Ella (c) h36 Robinson rd Gordon Gordon Susie Velma (cM) rrs7!3opOr liSvleBrT&avTC(So1Mr3)71 Spring Gordon Ella (c) Indrs Lawton av (B) Gordon Elsie (c) h'303 ( 657) Plummers al Gordon Emanuel (c; Leila) lab h'315 Di- vision (I) Gordon Frank (c) lab r3'54 5th av (V) Gordon Frank (c) pntr r2 Gunn's ta I(V) Gordon Falton (Lizzie B) driver h418 (Mikado av Gordon Geo (c) r308 (867) Plummers G oSKrdaoihnn'sVairlginia (c) maid rl09' (122) Gordon W D (Cynthia) h202 (50) Clin- ton (EM) Gordon Wm F (Berta M) meat ctr Rogers Stores h217 Virginia av Gordon Wm F jr oik Jias E Brady r2H7 Virginia av Gordon Wm T (Grace) millwkr BHblb [Mfg Co h'li28 Comer ter (PM) al Gordon Willie (c; Mary) glazier Wil- Gordon Georgia (c) cook r-109 (122) lingham Sash & Dooir Co plant h'013 KaJhn's al Shoals al (EM) Gordon Gertrude r205 New Gordy Lewis E (Annie L) mgr Hotel Gordon Gus (c) driver r8 Buckner al [Dempsey. Barber Shop h866 Walnut Gordon Guy B (Viola H) millwkr Bibb aipt l MIfg Co h758 Oglethorpe Gore Calvin (c; Ada) lab h03il Fdrsyth Gordon Harry (Frieda; Hotel GOrdon) Golre Calvin jr (c) r53'l Forsyth h'206 New Gore Em'mitt W (Ruth S) hlpr City Gordon Henry (c; Leila) sta atndt h Water Wks Shop M77 3d) 402 (305) OhialrleS (SM) Gore Katie (c) r681 Forsyth Gordon Henry jr (c) r402 (306) Charles Gore Walter (c) student r5SU Forsyth l(SM) Gordon Homer L forimn City r'667 2d1 Garthaim Jarvis H in'spr County Bd of Health r Jeffersonville rid GOrdon Ivey (Rulby) millwkr Bibb Mfg Goiriey Georgia M (c) stu'dent r204 ICo h20i8 (58) Clinton (EM) Ward (V)' Gordon Jacob (Harry's Oalfe) r2Q5 New Go'rley Marion (c) r204 Ward (V) 155 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement - Plaster 457 Third St. Phones 277-278-279 Gray Rollie J (Mattie) stniftr T L Wood Plmbg & Htg hl72 Ell (SM) Gray Roy (c) lab r271 Tindall av (SM) Gray Royce A hlpr T L Wood Plmbg & Htg r528 Telfair Gray Rubv V (c) lndrs rlS2 Phillips al (SM) Gray Sadie (c) fctywkr h21 O'Hara la GRAY SEAL PAINTS, VARNISHES & ENAMELS, Schall Paint Co Inc Factory Distributors 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Gray Susie (c) smstrs Harry A Spivey r324 Green Grra9y1lWNmew(Ethel) millwkr Bibb Mfg Co Gray Wm E (Grace C) cond h773 Hillyer av (CH) Gray Wm H (Myrtle) plmbr rl72 Ell (SM) Gray Wm L r719 Orange Gray Willie M (c) h220 Powell (EM) Gray Wyatt (c; Kate) carp h419 Peachtree (EM) Gray's Chapel A M E Church (c) 607 Hall (EM) Grayor Jessie (cj Emma) driver Taylor Iron Wks & Sup Co h239 (236) 3d av Gr(aVy)son Annie M (wid Walter E) hl26 Lawton av Grayson Dolly Cosmetic Co Mrs Betsy Ross mgr toilet articles 150 Cotton av R307 Grayson Florence (c) cook r911 (908) Ocmulgee Grayson John H (Mabel) mach CofGRy h903 Orange Grlaazette Mabel (c) lndrs hl35 Cemetery Great Atlantic & Pacific Tea Co gros 207 Cotton av 2801 Houston av (SM) 111 Montpelier av 456 Mulberry 407 and 1005 2d and 810 Vineville av (V) Great Southern Trucking Co Harry L Burnett agt 346 Poplar Greater Allen Chapel A M E Church (c) Rev H Vernon Greene pastor services: 11:30 Sunday school 10:00 426 North (V) Greater Foster Advertising Service (Eug R Foster) adv novelties 115 Academy Grechi Gueseppi (Sarah M) music tchr 125 Beech av h do Grechi Pirro slsmn Guttenberger Music Shop rl25 Beech av Greeley Alex (c; Pearl) lab h742 Edgewood av Greeley Jefferson (c; Viola) lab hill Pringle (EM) Greely Florine (c) maid r67 Spring Greely Madison (c) firemn CofGRy r67 Spring Greely Milburn (c; Marion) porter Hotel Dempsey Barber Shop r301 Gordon (CH) Green A Tyler student rl35 Winship (W H) Green Acey M (c) lndrs r426 Flanders (EM) Green Addie (c) r709 Cowan (EM) Green Albert (c) lab hl07 (5) Frank al Green Albert E (Jessie) elk h540 Forsyth Green Alonzo (c; Lula) textile wkr Bibb Mill h550 Smith row Green Anna (c) maid r307 Monroe Green Annie (c) cook r208 (122) Virgin la (V) Green Annie B (c) cook r218 Lee (EM) Green Arrie (c) h714 Hawthorne Green Audrey (wid John W) dept mgr Happ Bros Co h270 Maple Green Birdie Mrs hll78 F-lm Green Burlee (c) r2 3d St la Green Celia (c) lndrs hl43 Tatnall Green Chas (c) h515 E 2d (EM) Green Chas (c; Mattie) lab CofGRy h 903 (916) Cowan (EM) Green Chas (c; Mary) lab hl51 (216) Nussbaum (SM) Green Chas A gro 1108 Montpelier av h do Green Clara (c) maid r818 Elm Green Claude H (Lucye J) elk rl25 Cole Green Claude J (wid W T) rll3 Corbin av (V) Green Clinton D chf elk Sou Ry System Grhelel7n8DaEislmy (c) cook r724 Daisy (SM) Green Daisy (c) lndrs rll3 Hicks al Green Dennis (c; Hattie) janitor Geor- gia Casualty Bldg h862 Willow Green Eddie M (c) student rl26 N Tat- nall la Green Edw (c; Rosa L) r497 Ward (V) Green Edw (c) lab rl27 (17) Franklin GrSetenlaEdw (c; Nora M) porter r607 Tel- fair Green Ella (c) maid rl236 Broadway Green Ellen (c) maid h361 (339) North (V) Green Elmer mach CofGRy Green Elmer L student rl35 Winship (WH) Green Elsie fctywkr McAfee Candy Co rll61 Napier av Green Essie (c) lndrs r604 4th av (WH) Green Ethel (c) r302 Charles (SM) Green Ethel (c) h223 5th av (V) Green Eug (c; Irene) lab rl633 Broad- way Green Eugenia (c) maid rl39 Jones Green Fentress B (Susie) millwkr Bibb Mfg Co r813 Woolfoik (EM) Green Fletcher (c; Bessie) lab h343 Bookers al Green Flossie nurse Clinic r5S7 Walnut Green Floyd (c) lab Taylor Iron Wks & Sup Co rl238 Broadway Green Foushious S (c; Henrietta) restr 525 Waterville rd h807 (108) Crisp (S M) Green Fred J (Josie L) ba-rtndr h!64 1st Green Front (Vincent Riley) beer 564 Poplar Gr1e2e1n PGlaanynt el(lSMfct)ywkr Happ Bros Co r Green Geo (c; Bessie) h500 Fulton (EM) Green Geo delmn Columbus A McConnell rl21 Plant (SM) Green Geo (c; Mollie) driver h718 Ash Green Geo (c; Mabel) lab CofGRy h510 Broad (EM) Green Geo c; Bessie) lab h604 4th av (WH) Green Georgia (c) tchr r500 Fulton (E M) Green Gertrude (c) r rear 925 (959) Ocmulgee Green Gertrude (c) maid r515 E 2d (E M) Green Grady (Maude) millwkr rl420 3d Green H L Co Inc dept store 450 3d Green Harris B student rl62 Nelson (S M) Green Harrison (c; Vivian) porter Arlington Hotel h253 Moughon (V) Green Hattie (c) rl049 Pio Nono av (V) Green Hattie (c) lndrs h231 (110) Hurley la Green Hattie (c) maid r524 Ross Green Hezekiah (c; Ida) carp h260 Gantt City rd (SM) Green Homer (c) lab Central City Bag Co Green Howard iLucille) lab rl231 College Green J W Cc) delmn Irene Jones r209 (17) Bay Green Jacpb (c; Willie) lab CofGRy h 106 Gustin av Green Jas C (c; Mattie) lab r502 Academy al (EM) Green Jas W elk r607 2d S* 4 r-% " o- IS 3 and Linen Service DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in. Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If yon want information yon are unahle to procure else- where, call on us R. L. POLK & CO. DETROIT r is6 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 Green Jessie (c) r419 Douglas av (V) Green Jobie (c; Letty) lab h818 Elm Green John (c; Ida) hl048 Fort Hill (EM) Green John (c; Bertha) h497 Ward (V) Green John (c; Florine) lab hl27 (526) Army Lot Green John (c; Annie) lab rl335 1st Green John A (Willene J) elk T M GrReaeinneJsohGnroAC(oRuh7th32TM) oconntpdelhile3r5avWin- ship (WH) Green John A jr appr CofGRy rl35 Winship (WH) Green John L (e) lab r313 Norris (EM) Green John W (Anna) wtchmn Ga Sou &; Florida Ry r891 Waterville rd Green Jos (Pauline) driver r753 Mul- berry Green Jos (c; Rachel) lab hl48 E Ell Green Julia (c) lndrs rl04 May av (U) Green Kelly driver rl231 College Green Laura (c) cook h335 Boardman's al Green Lee R (Lollie G) plmbr hll61 Na- pier av Green Lee R jr msngr rll61 Napier av Green Leila (c) maid rll5 (275) Brief Gr(eVe)n Lelon millwkr Willingham Cotton Mill rl231 College Green Lewellyn D gro 707 (1799) Log Cabin blvd hi 119 Brentwood av Green Lizzie (c) landrs r726 Daisy (SM) Green Lois (c) maid hl034% Broadway Green Louise fctywkr Happ Bros Co r Gr7e5e0n 2Lducile (c) student r616 Maynard (EM) Green Lucius C (Ray E) spl agt h432 Beech av Green Malcolm L (Carolyn) slsmn Dun- lap-Peeler Hdw Co hll3 Corbin av (V) Green Mamie emp> Snow's Lndry & Dry Clng Co r524 Ross Green Mamous (c) hlpr CofGRy Green Margt fctywkr r71'6 3d Green Marjorie r2619 2d Green Mark (c) lab hll6 Kitchens Green Martha L emp rll61 Napier av Green Marvin student r720 Mulberry Green Mary (c) rl048 Fort Hill (EM) Green Mary (c) maid h658 Sbrayers al (SM) Green Mary Mrs cash DeLuxe Cafe r432 Beech av Green Mattie (wid John) r732 Montpelier av Green Mazie (c) lndrs hl27 (17) Franklin St la Green Melissa (c) h305 Charles (SM) Green Minnie waiter Chicken Grill r 253 Orange Green Mittie (c) lndrs h524 Ross Green Mollie (c) h353 Chestnut Green Mollie O (c) lndrs rl06 Gustin Green Myra Mrs elk Andrew H Atkins Grrelel7n NPaanrcky p(ic) maid r647 Elm St la Green Nellie Ruth slswn Dannenberg Co rl26 Highland av Green Nettie W Mrs smstrs Dannenberg Co rl26 Highland av Green Nesbit (c; Pearl) lab hl40 Sycamore (V) Green Norman (c; Eliz) lab r612 (708) Crisp (SM) Green Norman C auto mech Southeastern Greyhound Lines r471 Orange Green Odessa (c) lndrs h546 (446) Smith (EM) Green Olive millwkr Bibb Mfg Co r763 2d Green Olivia (c) maid rl4 (154) Paradisc 3,1 Green Patsy (c) cook hl!7 Jones Green Pearl (wid John) rl231 College Green Robt (c) rl09 O'Neal's al (EM) Green Robt E (Dorothy) millwkr Bibb Mfg Co r!13 Conner ter (PM) Green Robt L (Frances) sis mgr r550 Courtland av Green Ruby (c) lndrs Crescent Lndry Co rl238 Broadway Green Seaborn (c) lab Arth J Kelley Green Seaborn (c) millwkr Bibb Mfg Co h222 Pear (EM) Green Sidney (c; Virgil) lab r212 Farga- son (V) Green Sim (c; Georgia) h616 Maynard (EM) Green Street School (c) 323 Ward (V) Green Susie (c) r303 (205) Waterville rd Green Sylvester (c) lab r302 Charles (S M) Green Thedius (c) porter r755 Ash Green Thos B (Maude) auto mech rl62 Nelson (SM) Green Thos M (c; Jennie) porter Kash & Karry Market h512 Clinton (EM) Green Walter (c) brklyr r rear 925 (959) Ocmulgee Green Wiley (c: Bertha) driver h419 Douglas av (V) Green Wm millwkr Bibb Mfg Co r730 Oglethorpe Green Wm (c) pnbr r206 (523) Craft (V) Green Wm A (Clara) city firemn h2619 2d Green Wm P (c; Effie) janitor h402 (150) Hall (EM) Grtrroeoenno WTi3lomn ia wMt rsrferllfktrivr2s)00 nChovlse n845 Courtland av Greene C Bernard (Myrtle) eng Buck Ice & Coal Co rll5 American blvd Grbelevnde Carolyn L student r716 American Greene Clay ship elk R C Cropper Co r659 1st ,,, ,, _ , Greene Coleman slsmn Buck Ice & Coal Co r2120 Forsyth rd Greene Dorothy student r208 Hill Orest av (CH) rG.vroeoennoe PEroorliypnpeR ssLtunrdipernttt, rr8N4e5w COooluurmtlbaUndS Gr[eReonoemFrredYbMartnCdrAHotel Dempsey Tap Greene Geo dairymn r302 Mercer Greene Geo F (Lillian) (Rivoli Dairy) h New Columbus rd RD Greene H Vernon Rev (c; Estella) pas- tor Greater Allen Chapel A M E Church h422 North (V) GREENE IRA D (May P), Sec WoodPeavy Furniture Co, h208 Hillcrest av, Tel 3481-W Greene J Millard (Lucille) customers'mn Fenner & Beane h204 Crescent av (C H) Greene J Oliver slsmn United Cigar Stores Inc rl28 Winship (WH) Greene Jas H (Emma W) lbr grader Willingham Sash & Door Co (plant) hl28 Winship (WH) Greene Jesse W (Dorothy) elk r281 Orange Greene Jos L elk r300 ( 306) Simmons Greene Juanita (c) student r422i North (V) Greene Julia E elk USPO r42 Arlington pi Greene Kathryn student r845 Courtland Greene Leila M Mrs slswn Lerner Shops r659 1st Greene Lucile r New Columbus rd RD Greene Lucille J (wid Jas C) h716 American blvd Greene Mamie I (wid John C) hl35 Highland av Greene Nonie O Mrs fctywkr Happ Bros Co h716% Plum 157 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Greene Ralph meter tester Ga Power Co Greene Susan (wid Jas) h42 Arlington GrPeiene Thos E (Nettie N) slsmn Toole Furn Co rl26 Highland av Greene Thos E jr student 'rl26 High- land av Greene Virgil W r300 (306) Simmons Greene W Frank (Carrie E) pipeftr MD Gr&eeSnReRWhi2le0y9 IHe(nMdaletytie (LH)ts)carp h300 (306) Simmons Greene Wilson slsmn rl09 (215) Mill av Greenleaf Thos L pres Macon Memorial Park Inc r Columbus rd Greens Tabernacle (c) 704 (208) Colquitt GREENWALD HERBERT S (Dorothy D), V-Pres The Dannenberg Co, h208 Stanislaus cir Greenway Herman C (Olive E) millwkr Willingham Cotton Mill rll (70) Mill Greenway Lois L (Lillian) millwkr Willingham Cotton Mill h2 (76) Mill Greenway Robt L (Marie) millwkr Willingham Cotton Mill hi (75) Mill GrOeelinvwerooadv Fa(SnMni)e (c) lndrs h77 (174) Greenwood Louise (c) student r300 Gantt City rd (SM) Greenwood Nelson (c; Josephine) swtch mn h300 Gantt City rd (SM) Greer see also Grier Greer Alf (c) porter r307 Monroe Greer Alvin E (Julia B) slsmn Met Life Ins Co hlll5 Walnut Greer Annie M (c) cook Collins Baking Co hllO (150) Railroad av (V) Greer Carrie (c) h8 (557) Witkowskis la Greer Dola (c) r502 Fulton (EM) Greer Ella (c) cook r470 Log Cabin dr Greer Ernest (c; Nettie) emp CofGaRy h69 New Greer Essex (c; Mattie) h200 (107) Gibson av (SM) Greer Homer millwkr Bibb Mfg Co r607 2d Gr(eSeMr )Josephine (c) maid r402 Stevens Greer Lamar r2444 Broadway Greer Leila (c) cook rl03 Sutley (U) Greer Louise student r2444 Broadway Greer Mary L (c) maid rll4 Tinsley la Greer Minzer L (c) tcbr r220 Jones Greer Monroe (c; Eula) lab h402 Stevens _(SM) Greer Nadine r2444 Broadway Greer Nellie (c) maid r7 StPaul Greer Ozie B (c) waiter r458 City Hall la Greer Robt L (Annie D) car inspr h 2444 Broadway Greer Robt L .ir (Margt) atndt Tank Car Service Sta r4201 Houston av Greer Sadie (c) cook rll8 (14) Railroad av (V) Greer Wm (c; Stella) lab CofGRy h502 Fulton (EM) Greer Wm H (Annie L) hl20 Winship (WH) Gregg Sami (c; Emma) lab rl03 Richard (U) Gregory Annie M (wid Danl) h205 (2) Dannenberg av Gregory Clara fctywkr Happ Bros Co r 116 School (SM) Gregory Guy T (Sophia S) trav slsmn Macon Beverage Distributors hl40 GrHegigohrylanHdomaver F (Mattie) car repr C of G Ry hl07 School (SM) Gregory Jas T (Emma C) millwkr Willingham Cotton Mill h233 Duncan av Gregory John student rl354 Edgewood av Gregory Jos (Willa M) lab City h76 Cedar (SM) Gregory Juanita (wid R Carl) restr 516 Mulberry R103 hl02 Lamar (V) Gregory Leonard G (Birdie M) slsmn Central Ga Baking Co h429 Duncan av Gregory Mack (c) driver r419 Damour la Gregory Minis H (Maggie) mech Power Oil Co h243 Hardeman av (V) Gregory Robt K mill wkr Wellingham Cotton Mill r233 Duncan av Gregory W Clarence (Alline) millwkr Willingham Cotton Mill r213 Carling av Gregory W Marjorie r233 Duncan av Gregory Walter (Sarah) lab hll5 School (SM) Gregory Wm C (Lucille M) h766 New Gregory Wm M. (Tanna) carp hll6 School (SM) Grenon Alida (wid Augustine) h416 Lawton av Grenon Flora J r416 Lawton av Gresham Anna (c) hl06 (20) Clara (EM) Gresham Eldridge (c) eng wtchmn C of GrGeshRaym Ferdinand (Pearl O) collr h 118 Rutherford av (SM) Gresham Florence marker Snow's Lndry & Dry Clng Co r711 Walnut Gresham Jas A dental mech r579 Orange apt 5 Gresham Martha fctywkr Happ Bros Co rl35 Park pi Gresham Martha G marker Snow's Lndry & Dry Clng Co r711 Walnut Gresham Milton I wtchmn KernaghanGoodman Inc r579 Orange apt 5 Gresham Richd B (F Jeffie) custodian h579 Orange apt 5 Gresham Ruby fctywkr Happ Bro Co r 135 Park pi Gresham School 102 Forsyth Gresham Walter G (Alice G) h257 New Gresham Wm J (Barron M) hl35 Park pi Grey see also Gray Grey Amanda (c) Indrywkr Prank Jung r447 (707) Middle (EM) Grey Carrie (c) rl06 (306) Amos (V) Grey David (c; Lena) lab h443 (440) Ballard (EM) Grey Margt (c) lab rl06 (306) Amos (V) Greyhound Sandwich Shop (Calvin W Roberts) 320 Broadway Grice Benning M (Grice & Grice) rl013 Vineville av (V) Grice Elia sten Grice & Grice rl013 Vineville av (V) Grice Ruth dept mgr Burden Smith & Co rl013 Vineville av (V) Grice Sami R elk Willingham Cotton Mill rl013 Vineville av (V) Grice Warren (Clara; Grice & Grice) hl013 Vineville av (V) Grice & Grice (Warren and Binning M) Grlaiewryesrese 5a1l6soMGurlebeerrry R215 Grier Alex S (c) mason hl02 Woolfolk (EM) Grier Annie L (c) cash hl35 Holmes av (V) Grier Aurethia (c) r529 Grant Chapel al (SM) Grier Carolyn student r604 Holt av (N Hts) Grailer Carrie (c) lndrs h9 (552) Paradise Grier Cath (c) cook rl35 Holmes av (V) Grier Celia (c) maid hl27 E Ell Grier Chas (c; Annie) lab Empire Dixie Coal Co rl301 (514) Woolfolk (EM) Grier Cornelius (c) lab rl20 (213) Frank al GGrriieerr EDsosrysey(c;MGe(cr)truhd3e5)4 hA52sh9 Grant Chapel al (SM) Grier Frances (c) r429 Chestnut Grier Prank (c) ir617 (17) Gilmer Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third Sf. Phones 2200-2201 Who Sells It? Is Answered By the Classified Business Lists In this Birectury 158 *`A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 GrCiearbiGn eodrG (Ula) type str h439 Log Grier Geo W (Bertha L) storekpr h604 Holt av (NHts) Grier Geo W jr slsmn r604 Holt av (N Hts) Grier Herbert (c; Margt) lab r205 (212) Henrietta (SM) Grier Jas (c) lab r506 (708) Campbell av (SM) Grier Jas (c; Annie) lab hl29 E Ell Grier Janie L (c) maid r!20 (213) Prank al Grier John (c; Minnie) hl06 Gantt City rd (SM) Grier Lillie M (c) maid B127 E Ell Grier Lobie D (wid John T) h2008 3d Grier Mattie (c) h617 (17) Gilmer Grier Roxie (c) tchr rl02 Woolfolk (EM) Grier Sami (c; Rose) porter Tank Car Service Sfa r310 Norris (EM) Grier Sandy (c; Arlena) lab rll5 Lin- den av Grier Sarah (c) rl02 Woolfolk (EM) Grier Whittle (c; Willie) lab hl20 (213) Pr&nk 3/1 Grier Wm (c; Lizzie) millwkr Bibb Mfg GrCieorsho5n31RoEsa2dE (hE7M65) New Grieve Douglas W (Miriam D) h228 Al- bermarle pi Griffen Millie (c) hl30 E Ell Griffin Alpha Mrs slswn Sears Roebuck & Co hi 19 Log Cabin dr Griffin Annie (c) rl04 Harris Griffin Bernice (c) cash Afro-American GrLififfeinIBnsernCiocer8C07(M3adryavE) (cVo)llr Sterchi Bros Stores Inc hl23 Heard (SM) Griffin Berry L (Gertrude J) lab hl08 Rutherford av (SM) Griffin Bessie (c) h244 Division St la Griffin Bessie (c) lndrs rll7 Hicks al Griffin Bruce r2224 Broadway Griffin Carrie C Mrs nurse h280% Orange Griffin Chas (c) r809 (801) Maynard (EM) Griffin Chas P student r217 Ormond ter Griffin Chas W (Allie P) collr Sterchi Bros Stores Inc h217 Ormond ter Griffin David (c; Ethel) millwkr Bibb Mfg Co h235 Telfair Griffin David J chf inspr Fire Dept h 123 2d Griffin DeWitt (Lillian) shoe repr O K Shoe Shop rl23 Washington av Griffin Dorothy student r2224 Broadway Griffin Edgar L (Nellie) lab Appleton Church Home Episcopal Orphanage h 330 Forest Hill av Griffin Edw (c; Rosa) lab CofGRy h309 Wood al Griffin Effie L cash Rialto Theatre r 127 Birch (NHts) Griffin Elias J guard City Stockade r 661 Walnut Griffin Emma (c) cook rl39 Pecan av Griffin Eula (c) maid r822 Montpelier av Griffin Pleta (c) elk Afro American Life Ins Co r807 3d av (V) Griffin Frances J opr SBT&TCo r210 Winship (WH) Griffin Geo (Helen) millwkr Bibb Mfg Co hl56 Comer ter (PM) GRIFFIN GEO W (Grace), Managing Editor Macon Evening News, hl27 Birch (Napier Hts), Tel 1664 GrAifdfianmsG-BlaudcishaPnan(JesMsieotoVr) Cdeopt hm20g8r Or6H3i(i3/ t/Gi* Griffin Glynnie student r343 Carling av Griffin Hardy J (c; Lottie H) janitor First Natl Bank Bldg h511 (109) Norris (EM) Griffin Henrietta (c) h610 Clinton (F, M) Griffin Henry F jr student r280% Orange Griffin Henry L (Matilda) loco eng hl31 Fort Hill '(EM) Griffin Horace (c; Mary) loco firemn h 913 Edgewood av Griffin J Ross (Lois) dry clnr r767 Wal- nut Griffin Jas electn hlpr Morris Putzel Griffin Jas A (Carrie B) hlpr Liberty Candy Co hill Lee (EM) Griffin Jas A jr lab rill Lee (EM) Griffin Jas G (Nannie) millwkr Bibb Mfg Co h46 (47) Brigham Griffin Jas M (c; Gertrude) firemn C of G Ry h807 3d av (V) Griffin Jane (c) h539 Plant al Griffin Jewell Mrs picker Macon Peanut & Stge Co hl27 Fort Hill (EM) Griffin John (c) h326 Maple Griffin John B (Glanda) pntr r!03 Stratton (SM) Griffin John H (Alpha) auto mech hll9 Log Cabin Griffin Lillie dr P (c) cook Wm J Rice1 Griffin John S rl27 Birch (NHts) Griffin Jos (c; Rosie) lab h239 Jeffer- son Griffin Jos T formn Macon Evening News r561 Boulevard (NH) Griffin Kizzie (c) maid rl40 (134) Phillips la (EM) Griffin L Felton (Willie M) h211 Buford pi Griffin Lanie Mrs r717 Plum Griffin Lewis H (Jewell) meter tester Ga Power Co hl27 Fort Hill (EM) Griffin Lois (c) maid rl21% Rockhill la Griffin Louise millwkr Bibb Mfg Co rll9 Garden (EM) Griffin Lula S (wid G Robt) r690 Arch Griffin Major (c; Lily) r219 Elliott (E M) Griffin Mangham E (Etta) mech Adams-Buchanan Motor Co hll8 Richmond Griffin Marshall F student r208 Gre- nada ter Griffin Marvin r2334 2d Griffin Memior (Lizzie) hll9 Garden (E M) Griffin Minnie L (c) cook r205 Grant av (V) Griffin Morris rll9 Garden (EM) Griffin Murray fctywkr Dixie Dairies r 816 New Griffin Peter (c) carp h221 Collins pi Griffin R Lee (Virginia S) h816 New Griffin Ralph W E (Mildred S) elk h 2134 Broadway Griffin Rosa Mrs fctywkr Bibb Mfg Co hlO (9) Lake City (EM) Griffin Roscoe (c) lab rl21% Rockhill la Griffin Sami (c) hl2iy> Rockhill la Griffin Sami B (Myrtie) slsmn Standard Oil Co rll4 (104) Heard (SW) Griffin Stella (c) maid r212 (6) Virgin la (V) Griffin Thos (c; Bessie) lab r811 (1004) Dempsey av (U) Griffin Titus (Nora) millwkr Bibb Mfg Co h42 (43) Brigham Griffin Verna rl31 Fort Hill (EM) Griffin W Reed elk S Jones Co r816 New Griffin Walter (c) pdlr h'533% Forsyth Griffin Walter (c) porter Otto S Os- borne rll4 Ballard Griffin Walter D (Mary V) bldg contr 210 Winship (WH) h do Griffin Wm (c) lab r5 Graham's Lot Griffis Clarence A (Trudie) slsmn h467 Spring Griffis Jas F (Martha J) millwkr Willingham Cotton Mill hl2 (81) Mill Griffith Alice H (wid Millard F) rl29 Cleveland av (V) 159 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Griffith Arth (Derrelle; W D Griffith & Son) hl05 Corbin av (V) Griffith Arth jr collr W D Griffith Sz Son rl05 Corbin av (V) Griffith Percy D (Victoria M) h413 Ridge av Griffith Susie social wkr r82 Arlington GrPiiffith Thos student r413 Ridge av (V) GRIFFITH W D & SON (Arthur Grif- fith), General Insurance, 353 2d, Tels 4596 and 4597 Griffith Zachariah (c) lab hl26 Cemetery la Grigsby Clayton (c) lab h612 (212) Edison (EM) Grigsby Emma K (c) cook r612 (212) Edison (EM) Grigsby Lula (c) student r612 (212) Edison (EM) Grigsby Sarah (c) r612 (212) Edison (E Griggers Robt A (Nellie) farmer h711 Mikado av Graigngs(EAMlb)ert (c) lab CofGRy r500 CowGriggs Alma (c) r920 Hazel Griggs Annie B (c) rl05 (107) Brief Griggs Durward baker Collins Baking Co rYMC A Griggs Edw Rev (c; Mary) h204 Ward (V) Griggs Emmett A (Thelma) bus opr Ga Power Co hll5 Buena Vista av Griggs Ernest (c) porter Hightower Service Station r513 Coles al GrigSgsmitFhan&nieCoP hMilrls Lseleswn(SMB)urden Griggs Jefferson D elk r371 1st Griggs Jesse T (Fannie P) hl:ll Lee (S M) Griggs Jos H emp CofGRy rll5 Lamar (V) Griggs Lalia Mrs rll5 Lamar (V) Griggs Lizzie (c) h412 Mitchell al Griggs Lucius (c; Alma) lab h325 Jack- son Griggs Marion (c) r920 Hazel Griggs Marion (c; Nellie) lab Willing- ham Sash & Door Co (plant) h757 Ash Griggs Mary D (c) rl04 Smith (EM) Griggs Maurice (c) lab h920 Hazel Griggs Miley (c) lndrs h315 Coles al Griggs Roy R (Lillie M) millwkr Bibb Mfg Co r307 Peachtree (EM) Griggs Rufus (c; Leona) lab h602 Fort Hill (EM) Griggs Thos (c) lab Coplan Junk Co r 412 Mitchell al Griggs Walter (c; Reba) h221 Calhoun Griggs Walter D (Lennie) driver hll57 Napier av Grimes Alberta (c) h312 Telfair GGrriimmeess CCeacthil rN44 r4L4akeLake Grimes Dorthy r44 Lake Grimes Emma T slswn The Eleanor Shop. r218 Georgia av Grimes Fannie M Mrs bkpr Andrews Sheet Metal Wks h4l8 Belmont av Grimes Gadson (c) porter Goldyar Fum Co h224 2d av (V) Grimes John H (Sibyl J) sis mgr Met Life Ins Co hl31 The Prado (I) Grimes Josephine (c) cook rl42 Pecan Grimes Merritt C (Lessie) millwkr h44 Lake Grimes Nora (c) lab r205 Forest av (V) Graivme(sVS)imon (c; Lura) lab h20'5 Forest Grimes Wm V (Fannie M) gro 431 Monroe h418 Belmont Grimm Jas (c; Helen) lab hl84 (313) Roye (CH) Grailmm Jesse (c) lab rl2 (104) Steins Grimmett Louise student r202 Napier av Grimmett Thos W (Florence C) dispr h 202 Napier av Grimsley Calvin millwkr Bibb Mfg Co rll6 Garden (EM) Grimsley Frank C (Frances) dept mgr Union Dry Gds Co r802 Mulberry Grimsley Geo T (Eula) hll6 Garden (EM) Grimsley Myrtle fctywkr Happ Bros Co r Gr7i2m0sle1yst Nellie S Mrs millwkr Bibb Mfg Co r430 Winship (WH) Grimsley Sadie millwkr Bibb Mfg Co rll6 Garden (EM) Grimsley Susie rll6 Garden (EM) Grimsley Wm student rll6 Garden (EM) Grinalds Archibald S (Olive) purch agt 617 Mulberry R614 h310 Buford pi Grinalds Ida V (wid Richd D) r31Q Bu- ford pi Griner Frentz B (Lottie L) mach CofG Ry h507 (50.1) E Napier av Griner Otelia Mrs dietitian Ga Academy for the Blind rl501 Vineville av Grinstead Margt C student r210 1st Grinstead Rosa (wid Chas) r210 1st Grisby Mary (c) lndrs r216 (213) Yates al (EM) Grisharn Evans (Dora) truck driver Builders Lbr Co r308 Plant Griss Karl G (Mary) slsmn r414 Vine- ville av (V) Grissom Clement D wtchmn Willingham Cotton Mill h!913 New Grissom Eug (Helen P) prsmn Jones & Coney rl541 2d Grissom Harley A (Dolores E) printer J W Burke Co h203 College pi GrJiussnogm Hattie (c) lndrywkr Frank Grissom John (Ella M) driver J W Mc- Cook Lbr Co r308 Plant Griswell Annie (c) lndrywkr rl02 (114) Bright al Griswell Eloise (c) maid r209 Green Griswell Felton (c) lab rl02 (114) Bright al Griswell Lawrence (c) hl09 (3) Bright al Griswold Benj (c) porter Macon Feed & Seed Store r205 Lynwood av (V) Griswold Benj H rl27 Pearl Griswold David (c; Gertrude) driver h 175 (323) Nussbaum (SM) Grliaswold Eva (c) h210 (650) N Tatnall Griswold Evaline (c) r440 Liberty (SM) Griswold Florine (c) tchr Green Street School h368 Monroe Griswold J B (Viola F) mach hl27 Pearl Griswold Lewis (c) porter Macon Feed & Seed Store h.112 (148) Adams Griswold Odell (c) maid r303, 5th av (V) Griswold Pearl (c) r458 City Hall la Griswold Robt (c; Susie) h201 (410), Thompsons al Griswold Robt (c; Annie L) lab r203 Tslffiir Griswold Sami riJll Boulevard (NH) Griswold Wm (c) lab r603 Straight (U) Groce Albert H (c; Stella) house mover Gr1o0c0e DFarvanisces(NHE) Mhrs dcoandy wkr r397 Morgan av (WH) Groce Frank elk U S PO rl23 Stonewall GrPoice Spartan T (Althea) wtchmn h458 Edgewood av (SM) Groce Wm T (Frances E) tile wkr r397 Morgan av (WH) GGrroooommss CIeracil rl3a5b2 r3C5l2intColnint(oEnM()EM) Groover Thos D (Martha N; Brown & Groover) h314 Georgia av Gross Abraham (c) lab r413 (420) 3d av (V) Gross Addie (c) maid hllO (8) Orchard av Macon Federal Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 160 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 Gross Arcelious C (c) porter Willis Braswell Barber Shop r303 Green Gross Danl (c; Daisy) firemn h701 (117) Cowan (EM) Gross Dave (c; Marie) r306 (732) BowGrmosasn E(mEMm)a (c) cook Ml3 (420) 3d av (V) Gross Ernest D (c; Jenny L) lab G Bernd Co r7Ql (117) Cowan (EM) Gross Ivey (c) porter Power Oil Co Gr(oEsMs H) enry (c) lab h26 (205) Macon av Gross Henry (c) wtchmn CofGRy Gross Ira (c) lab CofGRy Gross Nell (c) lndrs r26 (205) Macon av (EM) Gross Nettie (c) maid Elberta Dress GrIoSshsopRur7b0y1 (c()11l7n)drsCor4w8a8nSh(EoMrt )av (V) Gross Rufus (c; Salatha) lab rllO (8) Orchard av Gross Sherman (c; Mollie) lab h370 3d av (U) Gross Whitt (c) lab r26 (205) Macon av (EM) Grcte Ernestine prof Wesleyan Coll r do Grotenstein Carl (Eva K; Reliable Cash Market) hi Rose pi Grove Cecelia A r525 College apt 1 Grovenstein Bertha C Mrs sis mgr W C Redding Lumber Co r411 Forest Hill Grover B Hudson (Mae) filling sta 3213 Houston av (SM) h do Grover Ernest (c; Clementine) lab r221 Chestnut Grover Jas (c) fctywkr Bibb Mfg Co r 442 Log Cabin dr Grover Sallie (c) h442 Log Cabin dr Grower Laura T (c) h98l Pio Nono av (V) Grubb Wynelle r871 2d Grubbs Alf L (Vera E) mgr J C Penney Co hl21 Vista cir Grubbs Clarence B furn repr r512 Hem- lock Grubbs Jas B (Jessie B) hlOl Highland av (LCHts) Gruhn Adolph elk Wm J Gruhn r302 Main (EM) Gruhn Gladys Mrs elk Wm J Gruhn r 302 Main (EM) Gruhn Louise elk Wm J Gruhn r302 Main (EM) Gruhn Wm J (Gladys) gro 302 Main (EM) h do Gruntley Sarah (c) maid rlOO Ell GUARANTEE MUTUAL LIFE CO, J Guy Jackson Genl Agent, 3d Floor First Natl Bank Bldg 409 2d, Tel 1142 (For further information see left top lines) Guaranty Life Insurance Co (c) Wm T T Barnes dist mgr 556 New R410-421 Guardian Finance Co Albert Holloway mgr loans 406 2d Guarrafa Quinto auto repr 444 Pine r 533 Orange apt 22 Guerardia Virgil r652% Cherry GuReys.t hL2e0w2isCHhu(rFclhore(nEcMe)) mach C of G Guiton Wm (Etta) mill wkr Bibb Mfg Co hl27 (31) Bellevue rd Gulari Louise elk r401 Walnut Gulari Tony (Kate) trav slsmn r401 Walnut Gulf Oil Corp filling sta 800 College 362 Hardeman av 301 Mulberry plant 210 Edgewood av Gullatt Wm E (c; Susie) shoe repr 1219 Broadwav h502 (712) Campbell av (S M) Gullins Sara (c) rl60 Elm Gunn Benj (c) r206 (523) Craft (V) Gunn Henry E (Mary T) collr Johnson Bros h258 Maple Gunn lone elk Dunlap-Peeler Hdw Co r258 Maple Gunn John B (c; Julia) lab h206 (523) Craft (V) Gunnell Walter (Irene) millwkr Atlan- tic Cotton Mills (V) h312 Pio Nono av (V) Gunnells Jas L (Lilly) carp r240 Roff Hoff av (V) Gunnels Alva L (Sophie) slsmn h812 Winton av Gunnels Louis Edgewood av W (Thelma) r812 Winton agvr1 o 802 Gunter Annie (wid Thos) rl05 Dixie av Gu(SnMter) Blanche (wid Dock) rllO New- berg (SM) Gunter Leon O (Estelle) barber Hotel Dempsey Barber Shoo r2418 2d Gunter Margt L smstrs Happ Bros Co rllO Newbeyg (SM) Gunter Tillman R (Grace) refnshr Empire Furn Co h4001 (4095) Houston av (SM) Gurganious Homer A (Willie M) mach h304 Rutherford av (SM) Gurr Lizzie (c) h527 Calhoun Guth Chas (Annie) auto mech r870 1st Guthman Sami agt Am Oil Co r315 ' Mulberry Guttenberger Ferdinand A (Mary B; Guttenberger Music Shop) rl29 Jefferson Guttenberger Lena tchr r525 Mulberry Guttenberger Mary R K (wid Curtis N) hllO Buford pi . Guttenberger Music Shop (Ferdinand A Guttenberger) 353 3d Guv Earl M (Ruth B) slsmn Bankers Health & Life Ins Co h312 Pierce av (V) Guy Jos A (Susie M) turner Natl Handle Co hll6 (152) DeBorde (SM) Guy Loyd G (Eva J) formn Macon Gas Co hl030 Clinton rd (EM) Guy Ralph S (Mary P) reprmn h430 Beech av Guyton Fred (c; Minnie) lab hl26 N Tatnall la Guyton John (c) lab hll7 Roff Home av (V) Guyton Leonard (c; Ola M) lab hl23 Army Lot Guyton Mary L Mrs slswn Burden Smith & Co r407 Forest av (V) Guyton Walter C (Leola) lab hll2 Brookdale av (B) Guyton Wm (c; Etta) lab h223 (220) Lynwood av (V) Guyton Wm B (c; Julia) lab hl06 (113) Davis la Gwaltney Eug C (Marion J) elk Bibb Mfg Co h322 College Gwaltney Eug C jr student r322 College Gwaltney Marion r322 College Gwynes Roy H, (Kathryn) inspr hl60o Vineville av (V) Haas Albert A (Olive) loco eng hl20 Cleveland av (V) Haas Leroy (Lucille) lab r758 Cherry Habb Thos J (Jessie) formn h398 Forest Haavber(Vsh)am Jake (Emma) ydmn Builders Lbr Co r RD 5 Hackett Minor r401 College apt 8B Hackett Frances dancing tchr r401 College apt 8B Hackett Frank L (Kathryn B) adv mgr h401 College apt 8B Hackett Geo trav slsmn h401 College apt 7H Hackett Hal slsmn r401 College apt 7HT_. Hackett Kathryn sec Mossee Apts r401 College apt 8B , , Hackett Wm M (Alice) h4 Astor pi (E M) Hackett Wm W (Isabel D) div pass agt Central of Georgia Railway h240 Hardeman av % 161 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Hackney Clement (Sallie M) trav slsmn rll4 Forsyth Hadarits Alex formn r3003 Houston av Hadarits Ernest student r3003 Houston av (SM) ,, HaLduamribtserJoCso)Ph3(0M03aryH; oMusitdodnleavGe(oSrMgia) Hadarits Louise sten r3003 Houston av (SM) Hadaway Geo (Wilma F) mach opr r 814 New Hadaway Geo M (Eula M) driver hl920 Broadway Hadaway Geo W (Cath) agcy organizer Mutual Life Ins Co of H V Hadaway Jack elk Crescent Lndry Co r Cross Keys Hadaway Richd D (Ruby I) lab h51l Hawthorne Hadden Laura (c) r203 (224) Turpin (T) Haddock Bessie (c) h6 Wall St la Haddock Emory porter Collins Baking Co rl45 Pecan av Haddock Ernest (c) lab rl03 (308) Spring la Haddock Gladys (c) student r517 (531) HaMddaoycnkardHe(EnrMy) (c) lab hl03 (308) Spring la Haddock J Willis (Lula) city policemn h 223 (24) Clinton (EM) Haddock Jas E (Louise D) asst ship elk Sterchi Bros Stores Inc r RD 4 Haddock John H (Miriam) bkpr Sou Crate & Veneer Co rl35 Habersham av Haddock Louise (c) student r517 (531) HMadadyonckardLo(uEisMe )D Mrs elk Macon Cigar & Tobacco Co r RD '4 Haddock Nora (wid Sami) rl35 Haber- sham av Haddock Otis porter S H Kress & Co r307 (419) Elizabeth Haddock Rachel (c) h517 (531) Maynard (EM) Haddock Wesley (c; Clifford) lab h232 Lynwood av (V) Haddox Harvey (c) lab rl06 (300) Spring la Haddox Thos (c; Cora L) lab hll8 Franklin Haden Annie F (wid Jas M) hl62 Jeff Davis (SM) Haden Inez Mrs slswn Peggie Hale Dress HSadheonp rJl3o8el LAamo(Fntloarevnce A) ptrnmkr TmaoynltoraIvron Wks & Sup Co hl38 LaHaden Thos W (Inez) adv solr Macon Teleg Pub Co hl38 Lamont av Hadley Tweedv (c; Dolly) lab h717 (611) HaPfrfienyceJas(SPM)(Mamie) loco eng h83 Ar- lington pi Hagan Ellis (c) cook h236 (221) Moore la Hagan Jos A (Beulah) slsmn A G Rhodes & Son r RD 2 Arlington pk Hagen Annie (c) maid h2047 E Ell Haight Lester W (Leona S) h907 New Haines see also Hanes Haines Annie (c) rl72 (124) Plummers al Haines Annie L fctywkr r702 1st Haines D C (c; Nancy) meat ctr hl35 Wood al Haines Deborah (c) cook r258 2d (U) Haines Hazel (c) r258 2d (U) Haines Mabel fctywkr Happ Bros Co r 702 1st Haines Mercedes (c) maid r258 2d (U) Haines P Eug (Martha) elk Ga Power Co r317 Vineville av Haines Villa (c) lab r258 2d (II) Haines Walker (c; Mamie) lab h258 2d (U) Hainline John L (Alice) wallpaper 521 Mulberry r Hotel Fickling Hair Geneva lab rl05 Lee (EM) 'Hair John (Mattie) hl05 Lee (EM) Hair John P (Nettie C) elk U S PO h 217 Coleman av (CH) Hair Nettie C Mrs sten The Letter Shop h217 Coleman aV (CH) HaliinregtoFnlorpinie P Mrs tchr P S r36 ArHale Bertha W Mrs dental asst R Holmes Mason h306 (320) Hillcrest av (CH) Hale Carlena (c) lab r552 Broad (EM) HaBleusEinveeslsynr3M31rs CinasrtlrinMg earrviman Sch of Hale Irene R (wid Robt) hlOl (50) Holt av (NHts) Hale Jas S (M Eva) h331 Carling av Hale Jesse L (Evelyn) slsmn Bankers Health & Life Ins Co h259 New HaTlerusLtouCisoe rE331elkCaFrilrisntg Naavtl Bank & Hale Rosa L millwkr Willingham Cotton Mill rlOl (50) Holt av (NHts) Hale Roy (Bertha W) elk h306 (320) Hill Crest av (CH) Hale Wm T (Evelyn S) carp h3020 Houston av (SM) Hales Annie M r622 Church (CH) Hales Leonard L (Irma L) lab h622 Church (CH) HaMleevt CLriafewfIonrds CJ o (Mh2a0r7gerCyheRro)keselsmavn (CH) Haley H Franklin (Margt) elk ColemanMeadows-Pate Drug Co h319 Buford pi Haley Mamie H (wid Herbert L) hl04 Buford pi Haley Margt L rl04 Buford pi Haley Wilson elk Tatnall Square Drug Store r936 College Hall Addie (c) lndrs hll (12) Paradise al Hall Albert (c) driver CofGaRy rl09 (7) Fultons la Hall Albert student rl09 Caboniss av (EM) Hall Algie waiter Chicken Grill r361 1st Hall Annie (c) lndrs h401 (735) Hall (EM) Hall Annie (c) maid rl017 Oglethorpe Hall Augustus M (Dollie M) carp hl510 3d Hall Basil W reporter Macon Telegraph r401 College apt 7F Hall Berry (c; Emma) lab h204 Gibson av (SM) Hall Bertha (c) h!5 Short St la (EM) Hall Bessie r223 (122) Cutters la (EM) Hall Bessie (c) cook rl03 Drew qtrs Hall Bessie (c) lndrs r308 Dover (B) Hall Cero G (Myrtle) hlpr Nehi Bottling Co hl922 Broadway Hall Chas E elk rl70 Virginia av Hall Chas H lawyer 516 Mulberry R619 h401 College apt 7F Hall Chas H (Mable) loco eng hlOl Hill Crest av (CH) Hall Chattie (c) fctywkr h319 Gilmer Hall Cicero (c; Mattie) h96 (103) Hazel Hall Cleo rl7 Bellevue rd Hall Clifford (c) emp Snow's Lndry & Dry Clng Co h12; Edgewood av Hall Clyde E (Mildred) millwkr Happ Bros Co h350 Edna pi Hall David A (c; Lena) driver h642 Hammond Hall Drue student SBT&TCo rl24 Merritt av (I) Hall Edna jr opr SBT&TCo rlOl Hill Crest av (CH) Hall Ella (c) cook r245 Tindall av (SM) Hall Ella (c) lndrs hl4 Gustin av Hall Emery (Betty) millwkr Bibb Mfg Co r!63 2d Hall Emma (wid Lucius M) r206 College pi YOUR CITY D I R C T O R Y MIRRORS the CIVIC Of Your CITY 162 D. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Go. Hall Emma Mrs rll55 Napier av Hall Ruth student rlOl Hill Crest av Hall Ernest (c; Christine) porter r651 Hazel (CH) Hall S Ann student r707 Holt av (N Hall Esmer M (Ida H) lab hl811 Broad- Hts) way Hall Sami (c; Bessie) lab h.1004 Col- Stodebaker Hall Ethel R Mrs elk McKesson-Riley Div rl99 Laurel av (NH) Hall Eug (Algie; Hall's Grocery) r239 HalellgeSiddrney (c) rl36 Middle (V) Hall Simeon G (Mamie) h669 2d Bond Hall Talmadge L (Louise M) slsmn Bur- Hall Fannie (c) maid rl36 Middle CV) den Smith & Co h764 Cherry Willys Hall Ferd L slswn Dannenberg Co r239 Hall Talmadge W (Mary B) carp Bibb Hupmoblle Bond Hall Ferol slswn r239 Bond Hall General S carp hl70 Virginia av Hall Georgia (c) cook rlOl Hicks al Mfg Co h2l8 (217) Maynard (EM) Hall Thos (c; Ola M) lab hill (215) Turpin (T) Hall Thos H (Marie) elk T M Raines Hall Harvey (c) lab r212 Plant (SM) Gro Co h723 Burton av Hall Hattie (c) maid r4;32 Monroe Hall Thos H (Mildred) slsmn h95 In- Hall Henry (c) la br536 Ocmulgee la gleside av (I) Hall Hubert H (Cora T) refnshr A G Hall Thos H (Carolie E), Specialist Rhodes & Son h239 Bond Eye, Ear, Nose and Throat, Suite 416 Sales Hall Ida (c) maid hl017 Oglethorpe Grand Bldg 617 Mulberry, Tel 4216, Service Hall Irving E (Pearl N) blr inspr h707 Holt av (NHts) Hall J Ellsworth (May K; Hall & Bloch) Office Hours 10:00 a m to 1:30 p m, 3:00 to 5:30 p m, Sunday by appointment, hll7 Oak Haven av, Tel 905 h231 High Hall Velma (c) student r642 Hammond Hall J Ellsworth jr (Louise; Hall & Hall Viola (c) lndrs rl37 Cemetery la Bloch) hill (193) Elizabeth pi (V) Hall Virgie (wid Herbert) h756 Mul- Hall Jas (c; Nellie) lab h214 Jeffer- berry 655-657 son Hall Virginia art tchr r35 Arlington pi Hall Jas B (Julia) h35 Arlington pi 'Hall W Lamar (Estell) h960 1st Third St. Hall Jas B jr student r35 Arlington pi Hall Warren (c; Lillie) lab h209 ColHall Jas L (c) delmn Ingleside Pharm- lege acy h754 Ocmulgee Hall Wm (c; Thelmon) hl63 Bay PHONE 2997 YOUR CITY D I R E C Hall Jas W blksmith hlpr CofGRy Hall Jessie (c) cook hl004 College dr Hall John A (Nora) agt The Power Oil Co hS73 Ingleside av Hall John I phys 516 Mulberry R818 h231 High Hall John K (Olive A) slsmn Ga Caro- lina Oil Co h855 Mulberry apt 301 Hall Julia (c) maid rl07 Buford pi Hall Kathleen (c) rl36 Middle (V) Hall Kenneth H (Ollie M) dept mgr Dannenberg's r560% Hillyer av Hall L Emmett (Drue B) slsmn Yates & Tabar Co hl24 Merritt av (I) Hall Laura (c) r228 Jones Hall Lenora (c) r341 Madison Hall Lou E (c) lab h307 (302) E 1st (E M) Hall Louise (c) hl0'8 (112) Magnolia la Hall Louise hygienist Dr Robt H Mur- phy r414 College Hall Louise M Mrs cash Burden Smith <& Co r764 Cherry HaslolnLu(SciMus) (c; Alice) lab hll2 JohnHall Lucius jr (c) student rll2 John- son (SM) Hall Wm (c) h54 Spring Hall Wm (c; Louise) janitor hll7 (31) Orchard av Hall Wm (c) porter Hotel Grady r611 3d av (V) Hall Wm F (c) r401 (735) Hall (EM) Hall Wm H (c; Julia) lab h652 Ross Hall Wm M Rev (c; Ethel) pastor Mt Moriah Baptist Church h529 Clinton (EM) Hall Wm O (Lillie) fctywkr hl7 Bellevue rd Hall Wm R (Ina) real est hl99 Laurel av (NH) Hall Wm R jr (Ethel R) dept hd McKesson-Riley Div rl99 Laurel av (N H) Hall Willie (c) lndrs r:1017 Oglethorpe Hall Willie C (wid Sami M) rl07 Ingleside av Hall Winkfield F (c; Lillie B) gro 1006 (1010) Main (EM) h do Hall & Bloch (J Ellsworth Hall; Chas J Bloch J Ellsworth Hall jr) lawyers 516 Mulberry R614 Hall's Grocery (Eug Hall) 1123 Oglethorpe Halliburton Camp slsmn Kent & Herin T HHaallll LLuuelallen(c) (ch)32h1l26PlaBnrtoa(dSM(E) M) r531 Georgia Halliburton Julian D student r259 Bou- Hall Mansfield P (Mamie L) lawyer hl50 levard (NH) O Georgia av Halliburton Minnie L (wid Thos) h259 Hall Marie (c) maid h242 (226) Elliott Boulevard (NH) (EM) Halliburton Regina opr SBT&TCo r531 R Hall Martha E (wid Isia A) hl743 Broad- Georgia way Halliburton Robt L (Mamie) slsmn h531 Hall Mary (c) r;100 (101) Thomas (EM) Georgia av Y Hall Mary E (wid Wm A) rl510 3d Halliburton Thos H slsmn Central City Hall Mary L (c) cook h803 Curd (SM) Bag Co r259 Boulevard (NH) MIRRORS Hall May K student r231 High Halligan & McLellan Inc Claude C Ar- Hall Morris W (Lillie M) lab hl27 Violet av (SM) nett mgr lmbr whol 403 Cherry R42021 file Hall Mulinda (c) cook r303 (583) Hall Hallmon L Y Mrs tchr PS r RD 3 (EM) Halloway Albert (Hildreth L) mgr Hall Norris C tableboy Macon's Pharm- Guardian Finance Co h.821 New f CIVIC acy rl03 StJames av (SM) Halls Hampton (c; Laura) hl04 (22) Hall O Marvin (Orrie) hlpr Stewart- Davis al (EM) Goette Electric Co h233 (235) Cedar Halsey Edna W (wid David P) hl28 Life (SM) Grady (SM) Of Your Hall Odessa (c) rll2 Johnson (SM) Ham Annie N Mrs h233 Washington av Hall Olive A Mrs slswn Darling Shop Ham Felix (Myrtle) slsmn hl506 2d h855 Mulberry apt 301 Ham Jack R (Edna M) fctywkr Happ CITY Hall Pearl (c) maid r803 Curd (SM) Bros Co r862 Hazel Hall Roosevelt (c; Vernessa) hl06 Smith Haman Julia Mrs waiter r252i Wash- (EM) ington av 163 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 Hamberg Walter (c) r317 Hammond HaJmacbkesrogner Emmett (Louise) pdlr h219 Hambrick Edw C (Bessie O) h20U Broadway Hambrick Evelyn elk rl411 Edgewood av apt 3 Hambrick Horace O (Myrtle) driver h Ha2m72brCicoklumJobsusS lab r2011 Broadway Hambrick Leo rllll Ash Hambrick Louise rllll Ash Hambrick Ludie '(wid John R) hl411 Edgewood av apt 3 Hambrick Martha tmkpr rl41!l Edge- wood av apt 3 Hambrick Myrtle Mrs (Artistic Beauty Shop) h272 Columbus Hambrick Paul C (Rebba) mech hl21 Knott (SM) Hambrick Sanford H (Annie) millwkr Bibb Mfg Co hllll Ash Hambry Ross (c; Maxie) porter r456 (460) Clinton (EM) Hamby Quillian P (Allene M) agt In- dustrial Life & Health Ins Co hi 10 Log Cabin dr Hamil Janet Mrs r221 Georgia av Hamilton Albert L (V Corinne) eng Fire Dept h620 Hemlock Hamilton Anna J (wid Andrew J) h494 Orange Hamilton Annie W (wid Geo E) h217 1st Hamilton Chas E (Patty) slsmn r70 Arlington pi Hamilton Clarence E (Loette) r3004 Houston av (SM) Hamilton Clifford (c; Pearl) lab h407 (307) Waterville rd Hamilton Daisy (wid Perry T) r243 Jeff Davis (SM) Hamilton Della (c) maid hl565 Monroe Hamilton Ella (c) maid rl06 (505) Campbell av (SM) Hamilton Emanuel (c; Mamie) h543 E 2d (EM) Hamilton Ethel (c) r407 (307) Waterville rd Hamilton Eug J (c; Mattie) lab h206 (308) Elizabeth (SM) Hamilton Eug J jr (c) lab r206 (308) Elizabeth (SM) Hamilton Eugenia G (c) tchr PS h55 Spring Hamilton Florence pdlr r620 Hemlock Hamilton Frank (c; Maggie) plstr h706 Hazel Hamilton Harry elk Bibb M-fg Co r217 1st Hamilton Jas (c) student r601 Broad (EM) Hamilton John R (Alice) ship elk Bibb Mfg Co h303 Clayton (V) Hamilton Martha L fctywkr Happ Bros Co r243 Jeff Davis (SM) Hamilton Mattie Mrs emp Snow's Lndry & Dry Clng Co h206 (308) Elizabeth (SM) Hamilton Noble R (Sara S) genl formn CofGaRy hl420 Oglethorpe Hamilton Savannah (c) r403 Charles (S M) Hamilton Walter V r243 Jeff Davis (S M) Hamilton Wilburn (c) lab r403 (731) Campbell av (SM) Hamilton Wm (c; Katie) h601 Broad (EM) HaCmoiltho2n43WJmeffT D(Ravuibsy)(SftMr )Macon Gas Hamlin Alberta (c) r444 Liberty (SM) Hamlin Annie L (c) maid rl65 (317) Nussbaum (SM) Hamlin Artis (Oretha) driver rll09 Napier av Hamlin Bessie Mrs fctywkr Happ Bros Co r952 Oglethorpe Hamlin C Herbert (Daisy) mach MD& SRR h3607 Houston av (SM) Hamlin Carl A instrumentmn City Engineer r RD 3 Hamlin Cecil (Hazel) fctywkr rll6 Richmond Hamlin Claribel tchr PS r RD 3 Hamlin Daisy Mrs sten Burney Bros Co h3607 Houston av Hamlin Earl driver rl315 2d Hamlin Elbridge millwkr Bibb Mfg Co r2615 2d Hamlin Ellavea bkpr Terrell Auto Elec Co r503 Bailey av (CH) Hamlin Emma (wid Horace A) hl30 Ha(1m26li)n GFrlaodreync(eSMti)lestr r440 New Hamlin Fred (Cath) pkr r3502 Houston av (SM) Hamlin Georgia (c) maid h444 Liberty (SM) Hamlin Gertrude (c) lab h722 Daisy (S M) Hamlin Gretchen (wid Otis) r609 Log Cabin blvd Hamlin Houston V (Nell) fctywkr hll6 Richmond Hamlin Hubert H (Daisy) stitener Mead- ers Mattress Co h417 Arch Hamlin Jas O (Jessie V) plmbr h271 College Hamlin Jasper H (Eula) emp CofGaRy h620 ( 5200 Mikado av Hamlin Jesse W (Ethel) mach hl35 Flamingo dr Hamlin Jessie V Mrs dept mgr Union Dry Gds Co h271 College Hamlin John E (Georgia A) carp r654 New Hamlin John L (Ruby A; Hamlin Sheet Metal Wks) r RD 3 Hamlin Jos W (Martha) sheet metal wkr h2615 2d Hamlin Josephine (wid Wm J) h'116 Ponce de Leon av (SM) Hamlin Julian E (Mabel; Hamlin Sheet Metal Wks) r RD 3 Hamlin Laura (c) r444 Liberty (SM) Hamlin Lewis (c; Ruby L) porter South- eastern Exp Co rl03 (251) Henrietta (SM) Hamlin Lovett C '(Daisy) hl670 3d Hamlin Myrtis student rl21 Grady (S M) Hamlin O Eug (Sadie J) radio sales & service A G Rhodes & Son r271 College Hamlin Pearl slswn Burden Smith & Co r99 Vineville av apt B4 Hamlin R Floyd (Fannie) cond hl21 Grady (SM) Hamlin iRobt L (Mary) carp h2908 Houston av (SM) Hamlin Sadie J Mrs beauty opr Robt S Freeman r271 College Hamlin Sheet Metal Works (John L and Julian E Hamlin) 27 Wall Hamlin Susan E (wid Jas L) h503 Bailey av (CH) Hamlin W Edw gro and meats 326 Main (JEM) r448 New Hamlin Zora N r417 Arch HHaammmm BJaesssieFm(iLlliwllkier) r3c1a9rpRobs3s19 Ross Hamm Jos (c; Carrie) driver h306 Willingham al Hamm Martha r319 Ross Hammack Bonnie Mrs gro 1106 Main (EM) h do Hammack Chas E (Emma) slsmn h467 Boulevard (NH) Hammack Emory C (Daphne) fctywkr Happ Bros Co h721 Hemlock Hammack Eunice Mrs beauty opr Genones Barber & Beauty Shop r620 Pine Hammack Francis L (Eunice) whsemn r620 Pine S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume II. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 164 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & CO. THIRD AT PINE GMC TRUCKS PHONE 5100 SMtoemckberEsxcNh.angYe. N.ExYc.haCnogteton ChicagoTraBdoeard of AssNoEc. ixaYcteh. aMnCgeuemrbbers Local Stocks and Bonds Government Bonds Hammack Henry W (Corine) dairy 110 (3308) Jersey av h do Hammack Gussie M Mrs hi 114 Walnut Hammack Lovia A Mrs sten Jones John- ston Russell & Sparks r414 Duncan HaLmexminergtoCnorn(eElMiu)s (c) lndrs r320 (720) Hammers Chester B (Alma B) mach C ofGaRy h860 Hemlock Hammett Jas T (Ophelia) millwkr h308 Atlantic av (B) Hammett John R (Victoria) confr 359 Broadway hl30 High Hammett Mary (wid Louis H) r308 At- lantic (B) Hampton Pearl maid r305 Blount Hampton Preston G jr appr CofGaRy r397 Belmont av Hampton Rutherford (c; Carrie) lab h 120 (117) Bell av Hampton Susie (c) hl23 (121) Tatnall Hampton Susie (c) r272 3d av (V) Hampton Wm H lab CofGaRy r215 Car- ling av Hamrick Horace C rl07 Napier av Hamrick Ida E (wid Horace C) hl07 Napier av Hamrick Raymond C watch repr The Watch Shop rl07 Napier av Hamsley J Wm (Ollie) carp r310 Cedar Hammock Ada (c) millwkr Bibb Mfg Co (SM) Home Owners Loan Corp. and Hahm22m4%ockPEofwfieellE ((Ec)Ms)tudent rl012 Main (EM) Hammock Evie (wid Geo) r813 Main Hanberry Richd L (Beulah; Holt & Hanberry) h808 Napier av Hancock Alf J (Linda) formn h869 Mulberry Fed. Farm Mortgage Corp. Bonds (EM) Hammock Geo (Annie) pntr r866 1st Hammock Jas P millwkr Willingham Cotton Mill r92 Dannenberg al Hammock Jas H millwkr Willingham Hancock Ashley A (Mathie L) millwkr Atlantic Cotton Mills r28 Atlantic Village Hancock Clarence H (Bertha) eng Fire Dept h421 Montpelier av Municipal Bonds Bank Stocks Cotton Mill r92 Dannenberg al Hammock Olin (Laura) millwkr Bibb Mfg Co r606 2d Hammock Patience (c) lndrs hl04 Smith (EM) Hammock Sara tchr PS Hancock David E (Bessie S) formn Carling Tile Co hl07 Ninadell dr Hancock Edith G Mrs private sec J Guy Jackson r433 Forest av (V) Hancock Ernest driver r459 New Hancock Hazel Mrs inspr Happ Bros Co 405 Ga. Casualty Bldg. Phone 1681 Hammock Wm T (Ethel) millwkr Bibb Mfg Co hl24 Culver ter (PM) Hammon Sami C (Anna) millwkr h40 Lake Hammond Albert L (Della) millwkr Bibb Mfg Co h659 Elm Hammond Andrew J (Julia A) piano tuner 283 Rutherford av (SM) h do Hammond Andrew J jr slsmn A G Rhodes & Son r283 Rutherford av (S M) Hammond Bruce (Lillie) prsr Crescent Lndry Co r313 1st av (Pleasant Hill) Hammond Claude (c) porter Geo W Hatfield jr r520 New Hammond Geo (c) lab r323 Hammond Hammond Jas student r312 Cleveland (SM) Hammond John r312 Cleveland (SM) Hammond Leola (c) maid h773 Moore al Hammond Montine r659 Elm Hammond Naomi sten City Bd of Water r905 Orange Hancock J Morgan student r315 John- son av (HH) Hancock Jas E plmbr appr Millirons Plmbg & Htg Co r Lizella Ga Hancock Jesse (c; Sallie J) appr h598 (1110) Norris (EM) Hancock Jessie M (Cora L) formn hl25 (121) Charles (SM) Hancock John slsmn Nu Icy Bottling Co Hancock John F student rl07 Ninadell dr Hancock John L (Ola) h459 New Hancock John M (Pearl M) lawyer 566 Mulberry R1 h315 Johnson av (HH) HANCOCK JOHN MUTUAL LIFE IN- SURANCE CO, Edwin S Davis Dist Agt, 3d Floor First Natl Bank Bldg 409 2d, Tel 1142 (For further information see left top lines) HANCOCK JOHN W (Emilu) (Bibb Printing Co), hll21 Walnut, Tel 2572J Comnrs r811 Poplar apt 9 Hammond Randolph driver r312 Cleve- land (SM) Hancock John W jr printer Bibb Printing Co rll21 Walnut Hancock Lizzie M r594 Duncan av Hammond Wm A (Gertrude E) sheet metalwkr h312 Cleveland (SM) Hammonds John O (Alberta M) hl34 Hancock Marvin (Hazel) driver h905 Orange Hancock Mary R (Wilburn C) cash Ster- Steele (SM) chi Bros Stores Inc r Lizella Ga Hammonds Paul (Louise) pntr h454 Ocmulgee Hampton Anna B (c) cook r603 Straight (U) Hancock Mattie r594 Duncan av Hancock Mirian elk S H Kress Co r459 New Hancock Sidney L student r315 Johnson Hampton Bessie M (wid Chas B) h215 Carling av Hampton Chas B lab CofGaRy r215 Carling av Hampton Prank (c; Mary) h905 Fort Hill (EM) Hampton Henry (c; Mattie E) gro 205 4th av (V) h272 3d av (V) Hampton Henry (c; Geneva) lab h507 (474) Alabama (SM) Hampton Lois E student r215 Carling av Hampton Mary (c; wid Jas) rl26 4th av (V) Hampton Mary Mrs (c) emp Barfield Feed Mills h905 Ft Hill (EM) Hampton Mattie E (c) lndrs h4 Clayton (V) Hampton Maude C (c) cook rl25 Bras- well la av (HH) Hancock Wilburn C (Mary) plmbr Geo F Yetter Inc r Lizella Ga Hancock Wm H (Louise) bkpr S Jones Co hl24 Pinson (SM) Hand Bertie M r612 Elm Hand Dempsey C (c) meat ctr John D Boone rllS Wood al Hand Frank student r612 Elm Hand Jefferson (Agnes) lab r612 Elm Hand Thos O jr (Cath) cash Morgan & Morgan Ins Agcy h21B Hines ter (V) Hand Tom hlpr Buck Ice & Coal Co Hand Twiman (c) roofer Ga Roofing & Sup Co rl34 Bostic la Hand Willie D (c) rl34 Bostic la Handley Clara F (wid Danl M) h2602 2d Handley Frances slswn F W Woolworth Hampton Minnie (wid Preston G) h397 Co r2602 2d Belmont av Hampton Noah (c; Lila M) ydmn hll4 Holt la (V) Handley Louise student r2602 2d Handley Louise (wid John) rl20' Grady (SM) 165 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Handley Melvin L (Eliz E) bartndr h761 Hemlock Handley Rota D (Minnie) mach CofGa Ry hlOl Richmond Hands Dempsey C (c; Nancy) meatctr r 156 Bay Hands Pearl (c) lndrs h85 Forest av (V) Handy Geo gro 203 5th hll4 Pearce (E Handy Josephine elk rll4 Pearce (EM) Handy Mamie slswn Geo Handy rll4 Pearce (EM) Hanes Ralph elk r852 Walnut HainngeshaSmamCiotRton(MEmillmhal):19mi(l4l1w)kHr oWlt iallv- (NHts) Hanks Jefferson (c; Viola) lab G Bernd Co hi26 (120) Powell (EM) Hanks Jesse (c; Viola) lab hl22 Powell (EM) Hanks John (Rosebud) lab G Bernd Co h619 Shoals al (EM) Hanks Lester F Rev (Mary K) hl53 Magnolia Hanks Lizzie (c) maid hlOl (1) Ala- bama (SM) Hanks Lot (c; Hattie P) porter Power Oil Co h247 5th av (V) Hanks Lucy (c) r613 Shoals al (EM) Hanks Mary K Mrs drsmkr 153 Mag- nolia r do Hanks Roberta (c) lab h212 Yates al (E M) Hanks Viola maid Hotel Macon rl26 (120) Powell (EM) HHaannlkesy WGmeo (c()Mral2rt6ha()120d)rivPeorwehlll44(EMEl)l (SM) Hanna Leone Mrs elk Union Dry Gds Co r811 Poplar apt 4 Hannah Andrew R (Mary) r328 Pio HaNnonnaohavCl(aVre)nce R millwkr h328 Pio Nono av (V) Hannah Ruth (c) lab h506 Fulton (EM) Hanner Cliff R (Lillian) millwkr Bibb Mfg Co h95 Green (PM) Hanner Minnie Mrs r759 Pine Hannock Hobson S (Renna) millwkr Bibb Mfg Co hl50 Comer ter (PM) Hannock Wm L (Dessie) millwkr Payne Mills rlOO Villa av (B) Hansard Evelyn J (beauty opr Betty's Beauty Shop rl27 Lawton av Hanse Carroll F (Gladys P) collr Ga Power Co r209 Clisby pi (V) Hanse Jerome C (Mary) inspr h213 Bu- ford pi Hanse Lee A (Zona) electn hl07 1st Hanse Nellie D (wid Geo A) h209 Clis- by pi (V) Hansford Louie D mach CofGaRy Hanson A Sidney (Bessie L) mgr h2503 Forsyth rd Hanson Corrinne S r409 Elm Hanson Ethel L student r409 Elm Hanson Geo W r409 Elm Hanson Hazel student r308 Cherokee av Hanson J Frank mech r409 Elm Hanson Jas W (Jennie L) genl mgr Southland Knitting Co h426 Forsyth Hanson Lemuel O carp r409 Elm Hanson Rota R (Mable L) driver h409 Elm Hanson Ruby L r409 Elm Hanson Sylvia L student r409 Elm Hanson Wesley L (Nettie) v-pres South- land Knitting Co h308 Cherokee av Hanson Wm F student r409 Elm Happ Bros Co (Lee M and Pinkus Happ Morris Michael) clo mfrs 670 Broadway Happ Building 150 Cotton av Happ Frank M (Velma) elk Carling Tile Co r766 Cherry Happ Frank R (Alma M) pres Art Furn Mfg Co h912 Vineville av (V) Happ Frank R jr student r9l2 Vineville av (V) Happ Josephine student r904 Vineville av (V) Happ Lee M (Tatum P; Happ Bros Co) h904 Vineville av (V) HaDpepmpPsienykus (Happ Bros Co) r Hotel Happoldt Bessie hi 120 Walnut Happoldt Chas E (Madeline) barber h 131 Tenney av (SM) Haralson E A slsmn r2514 Forsyth rd Haralson Jas V (Alice) msngr hl95 (207) Henry (L) Haralson Lillie rl4 Bellevue rd Haralson Linnie smstrs rl4 Bellevue rd Haralson Perry F (Lula) fctywkr hl4 HaBrealllseovnueWrmd student rl95 (207) Henry (L) Harber Dillard (Pinkie) phys h401 Col- lege apt 5D Harbin Dewey (Mae) h807 Cherry Harbin Wm student r629 Adams Harbour Wm (c; Mary) prsr h615 Hazel Harch Mary (c) cook h207 (1) 3d av (B) Hardaway Madge r321 Montpelier av Hardaway Ralph L (Long's Barber Shop) r321 Montpelier av Hardaway Richd G (Mary L) carp h321 Montpelier av Hardeman Barbara N sten A S Hatcher Co rl06 Clisby pi (V) Hardeman Building 105 Cotton av Hardeman Columbus (c; Bertha M) mech Central City Funeral Home) h 108 Tindall av (SM) Hardeman Daisy I (wid Wm G) rll4 Clayton (V) Hardeman Ellen G (wid Rota V) rl06 Clisby pi (V) Hardeman Eva (c) r28 Clayton (V) Hardeman Frank S jr elk r371 1st Hardeman G G Co Giles G Hardeman pres Isaac L Domingos sec-treas real est 563 Mulberry Hardeman Geo W (Emma) mgr hlOl Edna pi Hardeman Giles G pres G G Hardeman Co h305 Bond Hardeman Gordon I (Mamie J) sec- treas Southwestern RR Co hl06 Clisby pl (V) Hardeman Ira (c) lab rl42 Bay Hardeman John W (Irene) slsmn Home Furnishing Co h397 Morgan av (WH) Hardeman John W jr fctywkr Happ Bros Co r397 Morgan av (WH) Hardeman Jos F fctywkr Happ Bros Co r397 Morgan av (WH) Hardeman Lula h340 Hardeman av Hardeman Mable (c) student r28 Clayton (V) Hardeman Nelle student r461 Napier av Hardeman Oscar (c) lab rl42 Bay Hardeman Printice (c) lab rl25 Forest av (V) Hardeman Robt H (Bessie M) slsmn Standard Oil Co hl508 Vineville av (V) Hardeman Robt U (Nell C) ins inspr h 461 Napier av Hardeman Sebe (c) h485 Industrial Home rd H aidrdememananCWo mrllG4 (Ruth) elk G Clayton (V) G Har- Harden Amos (c; Annie B) lab Willing- ham Sash & Door Co plant h222 North (V) Harden Beatrice (c) maid r315 Dure (U) Harden Cecil S (Ruby) rl25 Willingham (EM) Harden Cora (wid Geo) r24 (87) Mill Harden Danl (c) lab Chambers Lbr Co Inc r RD 2 Thompson rd Harden Edith (c) maid r771 (770) Oc- mulgee Harden Ella (c) maid sr.167 May av (U) Wcn DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 166 z wQ Cm n Hoc a Academy for the Blind h527 Georgia av Hazlehurst Frank W (Carrie) mgr h'527 Georgia av Hazlehurst Wm slsmn Crane Co rl009 Clinton rd Hazzard Norma (c) maid r312 (344) Tin- dall av (SM) Hazzard Wm (c; Mamie) lab h312 (344) Tindall av (SM) Head Archie J elk r7 Rose pi Head Caroline W sten WPA r224 Geor- gia av Head Corrinne (c) maid r314 Elm Head Emily opr ISBT&TCo rl06 Ran- some av (V) Head Geo (c; Katie) lab h510 1st av (U) Head Geo W (Nettie) agt New York Life Ins Co hl06 Ransome av (V) Head Ida (c) r35S Church al (SM) HeGadranJadKaeetler(Maude) fanner hl29 W Head John H (Pauline) rl414 Edgewood Head Juliette (wid Jas !B) elk h7 Rose pi Head Marvin (Susie) trav slsmn h401 College apt 5A Head Wm (c) driver J W McCook Lbr Co h*319 Dure (U) Headden Bartow carp rl222 2d Headden Hardy H (Nellie) millwkr Wil- lingham Cotton Mill h213 (26) Holt av (NHts) Healey Paul '(c; Jessie M) lab h807 Fort Hill (EM) Heaps Hattie (wid Robt A) rl02 American blvd Heaps Louis F Dr '(Marucia) chiropractor Chiropractic Health Home h501 College Heaps Marucia Mrs physical therapist Chiropractic Health Home r501 College Heard Bros (J Milton Heard, T Hubert Mfacotsoerlyy 3a5n0dPoWpmlar TplaMntil8litchann)r Cchoettrorny Heard Hattie (wid Wm) fctywkr Happ Bros Co rl21 Knott (SM) Heard J Milton (Susan; Heard Bros) h 168 Laurel av (NH) Heard J Milton jr dentist 516 Mulberry R803 rl68 Laurel av (NH) Heard Jacob F (Eliz B) auto parts 610 Broadway hl98 Henry (SM) Heard Jas P (c; Irene) r516 Coleman al Heard John M (Martha) ins agt h705 Pio Nono av (V) Heard Margt L student r705 Pio Nono av '(V) Heard Pearl D (wid Virgil) sten h3809 Houston av (SM) Heard Sam (c; Bessie) r307 Blount Heard Susie rl68 Laurel av (NH) Heard Tom E (c; Lucille) r309 Blount Hearin see also Herin Hearin Ellis R (Bessie) dist traffic mgr SBT&TCo hi08 DeSota pi Hearin Leon student rl08 DeSota pi Hearn J Lester (Winona P) tube bender Dixie Neon Shop r690 College Hearn Paul (Sallie) h205 Ingleside av Hearn Robt (Madeline) elk r205 Ingle- side av Hearn Sallie T Mrs h409 Ridge av (V) Hearn Wilfred ship elk Bibb Mfg Co r409 Ridge av (V) Hearne John M mgr Doctors' Business Bureau & Collection Service hll5 Madden av Hearne John M jr student rll5 Madden Heat Golden (c) h519 Gilmer Heath Burena '(c) r707 (605) Prince (S M) Heath Clifford r308 Cutter's Green (E M) Heath Clyde (Beatrice) millwkr Willingham Cotton Mill r215 Carling av Heath Danl M (Mattie P) formn h330 Hanson (ISM) Heath Dollie millwkr Bibb Mfg Co h232 Jackson Heath Elbert (Julia) r574 DeBorde (S M) Heath Estelle Mrs t765 Walnut Heath Evabell nurse r765 Walnut Heath Fred L (Mattie) lab r*307 Fairmont av (B) Heath Geo (Alice) rl427 2d Heath Hubert (Mildred) driver r574 De IBorde (SM) Heath Hutton H (Leila M) mill wkr Willingham Cotton Mill hl43 Carling av Heath Ira C (Ruby M) pdlr h398 Morgan av (WH) Heath John (c) lab rl718 Dempsey av (U) Heath John R (Bedie) lab h307 Fairmont av (B) Heath John R (Louise) millwkr Atlantic Cotton Mills h8 Atlantic Village Heath Julius H rl43 Carling av Heath Leonard H pdlr r398 Morgan av (WH) Heath Linda E Mrs h308 Cutter's Green (EM) Heath Mildred Mrs millwkr Bibb Mfg Co r2162 2d Heath Ollie (Johnnie) millwkr Atlantic Cotton Mills h26 Atlantic Village Heath Sarah fctywkr Happ Bros Co h574 DeBorde (SM) 175 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Heath Wm (c; Ettie M) lab hl30 (5) Henderson Leo (c; Mary) greaser CofG Ry h202 Gantt City rd (SM) HeatonA N Mrs bkpr Reliable Outfitters. HeratBuelozoTmofnieyldr Hrdotel Gordon HHeedckemleaJnCLMenrnsietcMhrrsPSh.1r05501NVoirntehvialvle (aNv H) Hedgepath Frances M opr SBT&TCo r He3d10geHpaitnhes Jetearnet(tVe) (wid A L) h310 Hines ter (V) , ^,, Hedgepath Sami driver Leaptrot Dry Henderson Lester (c; Jessie) porter r921 Ash Henderson Levi (c; Vera) porter Vineville Barber Shop Henderson Lillie (wid Jas) r310 Randolph (EM) Henderson Lola (c) lndrs r326 Monroe Henderson Manoah F (Willie; Hender- son-Turner Co) h213 Belmont av Henderson Mary (c) maid r289 2d av (V) Henderson Mary (c; wid Wm) h289 2d Clng Co r*310 Hines ter (V) Hedrick Florence student r533 Orange apt 23 Hegidio Louis referee City Play Grounds Heanvde(Vrs)on Bay (c; Viola) h3 H,am.s a,l Henderson Raymond (c; Mozella) del- mn College Hill Pharmacy h rear 305 Supvr Hegmann Fred E rlOl Ormond ter Monroe Henderson Raymond (c) porter r326 Heidt Richd L (Ruby) h320 Spring Height Bennie (c) maid hll3 (161) Jones Monroe , Henderson Roy (Idell E) meter rdr City St la Height Jesse (c; Marie) lab CofGRy h 101 Tindall av (SM) Water Wks Shop rl03 Callaway (V) Henderson Ruth (c) maid r289 2d av (V) Henderson Ruth J (wid Danl T) h99 Height Wm J (c) lab rl'13 (161) Jones Vineville av apt Al St la Henderson Sarah (c) cook r326 Monroe Held's Dress Shop Mrs Lillie Sharp mgr Henderson Susie (wid Jas) r218 Ameri- clo 564 Cherry Helmly Bea R (Maude G) carp r99 Cole- Hecnadnebrlsvodn-Turner Co (Manoa,h _F Hen- man av (CH) derson and Russell Turner) gros 1000- Helmly Eva G opr SBT&TCo r99 Cole- 02 Napier av man av (CH) Henderson Wm (c; Essie) lab hl.331 1st Helms Jos E (Faustina B) mech L N Henderson Wm (c) lab r855 Willow Jordan r224 Georgia av Helms Susie (wid Will) r2344 2d He;(nBd)ley Jos C (Kate) elk h307 Melrose Helton Eloise (wid Joshua S) gro 826 Hendley Wm T (Gertrude F) gro 33 Montpelier av h824 do Bellevue rd h30O Atlantic av Hembree John A student r717 1st Hendley Wm T jr (Nellie) millwkr Bibb Hembree Marion D dentist Otis C An- Mfg Co hi03 Forest av (B) derson h717 1st Hendrick Ohas C (Hendrick's Grocery) Hembree Marion E r717 1st Hemingway Sami M (Helen D) cond h 155 Hendley (NHts) Hemingway Sarah L Mrs r200 Log Cabin dr h258 Niagara av Hendrick Matthew r258 Niagara av Hendrick's Grocery (Fitzhugh H Lee and Chas C Hendrick) 600 3d av (V) Hendricks Alice sten r317 Orange Hemmingway Wm L (Annie M) mech Hendricks Annie rl'34 Summit av (NH) Snow's Lndry & Dry Clng Co h850 Hendricks Annie (wid Edgar L) h317 Walnut Orange ,, Hencely Wiley B driver Yellow Cab Hendricks Dorothy student r533 Orange Trans & Baggage Co r334 Ross apt 6 Henderson Amelia (c) cook r226 (175) Hendricks Hollis H elk Piggly Wiggly Moore la Stores r317 Orange Henderson Andrew (c; Lavonia) grease Hendricks Lillian (wid Thos R) rl701 wiper CofGRy h86 Forest av (V) Vineville av (V) , _, Henderson Arth (c; Eleanor) lab h91 Hendricks Luther W steelwkx Taylor Forest av (V) Iron Wks & Sup Co r264 Winship (W Henderson Arth (c; Katie) lab rl27 (17) H) Franklin St la Hendricks Perry (c; Ella) lab h3 (144) Henderson Benj K (Eliz S) elk hi 12 Paradise al Ninadell dr Hendricks Sami (Grace) msngr r90 Henderson Bessie (c) maid r590 White- Lawton av hall Hendricks Zadie '(wid Berij L) r533 Henderson Buford A '(Annie M) elk h212 Orange apt 6 Ormond ter Hendrix Beatrice r531 Jackson Henderson Clayborn (c; Ella) lab h641 Hendrix Irene hlOl 1st Elm St la Hendrix Janie rlOl 1st Henderson Cran O (Grace) slsmn hl24 Hendrix Jesse (Georgia) h531 Jackson Inverness av Hendrix John (c; Annie M) plmbr hl37 Henderson Emma (c) lndrs h5 Cheat- (83) Long la ham al Hendrix Lillian rlOl 1st Henderson Eva (c) maid hl238 1st Henderson Fate (c; Pinky) r410 Ward Hendry Wm T (Louise) asst whse supt McKesson-Riley Div h253 Boulevard (V) (NH) Henderson Fred (c) r326 Monroe Henley Mary F (wid Wesley H) rlOO Henderson Henry p mach CofGRy Daisy Park Henderson Hersc'hel C (Dell) elk RyMS Henry Albert (c) rl3 (6) Witkowskis la r New Loraine rd Henry Albert H (Maggie M) pipeftr rl09 Henderson Howell H (Maggie) elk USPO hh310 College Henderson J B (c; Gertrude) porter h HeHneryardAlonzo (c) lab rl21 (25) Magnolia la 326 Monroe Henry Ann student rill Hill Crest av Henderson J Luther sec rl'144 Milledgeville rd (EM) Henderson Jesse L r3145 Houston av (S M) Henderson John P formn CofGRy He!(nSdMer)son Josie M (c) rill Tindall av (CH) Henry (Barney (c) lab rl21 (25) Mag- nolia la Henry Barney (c; Nora) lab h901 Taylor (EM) Henry Benj student r205 (185) Henry (L) Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES ; and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 176 EDWIN S. DAVIS, District Agent JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 Henry Bessie Mrs rll4 Napier av Henry C Elfe rl017 Walnut Henry Carrie C rl017 Walnut Henry Clara (c) maid r405 (126) 1st av 0} fmi <$d PX4U3) Qi 4n->s 1x3 *, lil _o HU1 Otis (c; Martha) porter DunlapHiPlleePleartkElddewp Csohehrii0f6f r(521257) CHolelnegderix al Hill Percy L (c) lab r404 (543) Eliza- beth (SM) Perry (c; Rena) dairymn hl06 4th Hill Rachel (c) cook rl027 Montpelier av HU Raymond L fcty wkr Happ Bros Co rl907 Broadway Hill Rena (c) h.225 Watson al (SM) HU1 Richd (c; Wilhebnina) bellmn Ho- tel Pickling r312 (344) Tindall av (S Hill Robt (c; Chattie M) lab h604 (111) Colquitt HUlRobt (cMEthel) lab hll8 (217) ElkHill Robt A (Tommie L; Hill Dry Clean- mg Co) h537 Hillyer av (CH) Hill Robt C rl222 2d HUl Robt L (c) tire repr Levine Tire & Service hllOO (920) Broad (EM) Hilliard Annie (wid Jesse) r608 1st Hilliard Clara (c) lndrs h203 Summit Hill Hilliard Ella (c) lndrs rl03 Brooklyn av Hi. ll.ia'rd Frank (c; Minnie) lab h901 (917) Cowan (EM) Hillman Edith student r736 Hillyer av (Cxi) Hillman Marjorie student r736 Hillver (CH) Hillman Robt H (Myrtle B) lmbr 736 Hillyer av (CH) h do Hills Howard (Mona) h250 College apt 2 ai2l5s0 MCoonllaegseten W D Griffith & Son r Hillsman Myrick reprmn L N Jordan r 158 High HHii-llLsoonGNroacoemryi ((cM) rcsoLoikllrie71T5hDoranistoyn()S5M1)6 Montpelier av Hilsman Martha Mrs r933 Vineville av o U OhT Jc3wC>a* lUMf3l HM)Rbt R (Mlldred) cond 11200 Lee (S Hill Rosie L (c) maid rl24 (21) Tinsley lEL HiLu3o1S2;0y(,3n1S0u) by)Gficletys w(kSrMH) app Bros Co HiU Russell student r961 Walnut Hill Sarah (c) cook h8 Gunn's la (V) Hill Shirley (c) cook rl06 4th av (B) (SM)1 (C' Pauline) lab h572 Chappell Hill Thos (c; Beulah) h321 Norris (EM) Hl(1i,4T3)h02^d 1205 (333) Bowman (E Hid Winnie B (c) r303 Edgewood av (S Hill Winnie M kindergarten 555 CourtHillalnardd aHvarrolddo B r818 3d Hillard Jas delmn Robt K McAfee r HiBllraorodklLyinzziaev (c()Strin31so0nEvil2led) (EM) Hillard May Mrs smstrs r867 2d Hillard S M Dray Line (Mrs Susie M HiHllailrldardS)us8ie18M3d(wid Smith M; S M HiHllbilelarrryd HDarnanyahLi(nce)) rlh28018(1135d) Gibson av (SM) Hilley Addie Mrs asst Otis C Anderson hl38 Academy Hilley Dean A (Grace L) teleg opr hl05 (372) 3d av (SM) Hilley Dozier A (Louise) driver h621 HiClleayrliEngarlavF (Sullivan & Hilley) rl38 Academy Hilley Henry G (Carolyn H) slsmn Sears Roebuck & Co r621 Carling av Hilley Jasper E elk r621 Carling av Hilley Wm (Estelle) auto mech h!533 3d HINES J CLAUDE (Eloise), Mgr Bibb Bsidroek),erTaegle 4C25o2rp-W, hi Drury av (Ingle- Hi(nSeMs )John (c; Grace) h240 Church la Hinneeys MavEd(wSM(F) annie B) carp rll9 TenHisnoens'sMraonwsie(S(Mc)) delmn r305 HenderHines Maud E hl58 High Hmes Ruth (c) lndrs hl:234 Broadway HM)S Saml (C> lab r12 (3C),7) Hanson (S Hines Thos W (Susie M) loco eng h707 2d Hinsley Josephine (c) lab r442 Mitchell (EM) Hinsley Sanford (c) lab r442 Mitchell (E M) Hinson Alton hlpr Sunshine Dairies r 311 Giles (SM) Hinson Bessie opr SBT&TCo r600 Wool- folk (EM) Hinson Emory F (Virginia D) genl formn Sunshine Dairies Hinson Fulton elk r205 Simmons Hinson Henry T (Minnie) carp h6O0 Woolfolk (EM) Hinson Homer (Beauty) millwkr Bibb Mfg Co h249 Church (EM) Hinson J Preston (Alma) millwkr Bibb Mfg Co hl25 Peachtree (EM) Hinson J Wilson (Eliz) steelwkr Taylor Iron Wks & Sup Co rl530 2d Hinson Jas A (Frances) shoe repr Alex Kell h915 Walnut apt 7 Hinson Jas W h205 Simmons Hinson John H (Cora) slsmn Buck Ice & Coal Co h311 Giles (SM) Hinson Mallory D elk r205 Simmons Hinson Mary E (wid Robt J) fctywkr Happ Bros Co rill Dixie av Hinson Mary R (wid Tilman) hllO Cal- houn Hinson Robt F elk Ethridge Bros r205 Simmons (SM) Hinson Robt J atndt Fred Balkcom Sin- clair Station rllil Dixie av (SM) 181 ROBERT O. THOMAS 569 Yz Cherry St. REALTOR Telephone 1067 Hinson Roger J hlpr Sunshine Dairies r312 (310) Giles (SM) Hi3n1s2on(3R1o0s)coGe ilhelspr(SSMun)shine Dairies r Hinson Roy D atndt People Oil Co Sta No 2 r602 Woolfolk (EM) Hinson Ruth slswn F W Woolworth Co Hinson T Harvey (Sadie) driver Sun- shine Dairies h312 (310) Giles (SM) Hinson Wm A (Rena) millwkr Happ Mfg Co h602 Woolfolk (EM) Hintley Wm (c) r71 (300) Hanson (SM) Hinton Allene (wid Chas C) h401 Col- lege apt 8G Hinton Bessie H (wid Jack C) millwkr r 415 New apt 1 Hinton Emma (wid J C) r401 College apt 8G Hinton Frank (Frankye) elk hl25 Acad- emy Hinton Harley J (Eliz) slsmn r275 Hill crest av (CH) Hinton Jas C prof Wesleyan College r401 College Hinton Marion (c; Annie) pdlr hl25 (8) Phillips la (EM) Hinton Wm N (Mary C) linemn h821 Cherry Hipp W R (Martha) mech Ry Exp Agcy Hirsch Emile I lawyer 566 Mulberry R9 r420 Forsyth Hirsch Helen R student r420 Forsyth Hirsch Isadore (Martha S) slsmn Jacob Hirsch h420 Forsyth Hirsch Jacob whol paper 352 Plum r363 Hi3rdsch Lillie r420 Forsyth Hirsh Geraldine (c) lndrs rl04 (4) Henry (SM) HiCrsoh JInocs Mh57(I4renHei)llyve-rpreasv C(oCpHla)n Junk Hirsh Leopold elk r Hotel Fickling Hitchcock Dewey slsmn rlOO Walker Hitchcock Lucile student r202 Crescent av (CH) Hitchcock Melvin R (Maude) mach hi00 Walker Hitchcock Melvin W servicemn The Stor- age Battery Co r Log Cabin Hts Hitchcock Roland M (Liza) supvr h202 Crescent av (CH) Hitchcock Ruby fctywkr Happ Bros Co r460 Carling av Hitchcock Ruth fctywkr Happ Bros Co r460 Carling av Hitson Wm R (Blanche) dry clnr hl06 Highland av (LCHts) Hix Bessie (c) lndrs r239 Morgan av (WH) Hixon Chas B (c) carp hl20 1st av CU) Hixon Wesley (c; Florine) brklyr hl05 1st av (U) Hoagland Raymond L (Julia H) bldg contr 2328 Forsyth rd h do Hobbs Agnes (c) rlOll Edgewood av Hobbs Allene millwkr Bibb Mfg Co h764 Plum Hobbs Bertha (c) maid h302 Madison Hobbs Bessie B (c) maid h612 Ross Hobbs Donie L (wid Wm) r764 Plum Hobbs Ella (wid Geo) h905 2d Hobbs Eunie (LaVerne) millwkr Atlantic Cotton Mills h40 Atlantic Village Hobbs Frances (c) h705 Guernsey la Hobbs Frank lab r518 Pine Hobbs Freeman (Alice) millwkr Atlantic Cotton Mills h20 Atlantic Village Hobbs Gertrude (c) cook r511 Edison (EM) Hobbs H Hamilton waiter Jas A Smith r225 Belmont av HoHbabrsdeHmeannry avJ (Pauline) formn h217 Hobbs Homer G (Bessie L) steelwkr Taylor Iron Wks & Sup Co h3036 Houston av (SM) Hobbs Ira (c) fctywkr r705 Guernsey la Hobbs John mach Bibb Mfg Co rl!7 2d Hobbs Leila A Mrs rl325 3d Hobbs Louise lab r764 Plum Hobbs Lula (c) cook hl34 Pecan av Hobbs Marjorie student r99 Daisy Park Hobbs Paul baker Collins Baking Co r516 Orange Hobbs Robt (c; Gladys) lab h205 3d (U) Hobbs Robt E (Jessie) blrmkr h99 Daisy HobfefSallie M Mrs printer h310 Peach- tree (EIM) _. _ , Hobbs Sarah (wid Arch) r99 Daisy Park Hobbs Thos J formn CofGaRy Hobbs Wm J elk r310 Peachtree (EM) Hobby Dovie (wid John P) rl07 (266) Pearce (EM) Hobby John P student rl07 (266) Pearce (EM) Hobby LaGrande G (Dorothy) slsmn r 840 Courtland av . Hobby Marion (Petrina) stonectr r264 Main (EM) , . ..... Hodge Frank (c) student xl43 1st av (V) Hodge Hazel (c) lndrs rl39 Culver (V) Hodge Isaac (c) lab r405 Chestnut Hodge Wm B (Maude) bge mstr hl61 3d Hodges Cecil (c) r408 (510) Maynard (EM) Hodges Cephus (c) lab r409 (340) May- nard (EM) Hodges Chas A (Emma) sign pntr r72I Pine Hodges Chas T (Lucile E) slsmn h704 Napier av Hodges Chas T jr student r704 Napier av Hodges David (c; Bessie) lab h409 (340) Maynard (EM) ,,,,,, Hodges Edwina (wid John M) nurse r308 Buford pi Hodges Eliz Mrs h417 Oak Hodges Elzey C (Marie) h227 Cedar (SM) Hodges Ernest (c; Lucy) lab h616 Ross Hodges Ernest (c) porter Worsham & Sherrill r404 (507) Prince Hodges Eug E driver r Hotel Fickling Hodges Geo (Louise) ins agt Interstate Life & Accdt Co r218 Georgia av Hodges Helen (c) rllO Middle (V) Hodges Isaac (c; Mary L) lab h764 Chap- pell la Hodges J Ollie jr (Loulie H) supt rl27 Summitt av (NH) Hodges Jas W student r704 Napier av Hodges Jerry H ,(c) porter Sami Gordan r904 3d av Hodges Loulie H student rl27 Summit av (NH) Hodges M B (c; Susie) lab Tmayl,or T Iron Wks & Sup Co hi 12 Long st la (SM) Hodges Mary (c) maid hll25 Napier av Hodges Naomi (c) r342 Long (SM) Hodges Nora (c) lndrs hl5 Buckner al Hodges Odessa (c) lab r415 Bay Hodges Odessa (c) maid rll2 Long st la (SM) Hodges Rex D (Myrtle) gro 940 Mont- pelier av h do Hodges Robt (c; Ella) lab r415 Bay Hodges Sam (c; Fannie L) rl9 Harris al Hodges Walter E (Jane) pres-genl mgr Empire-Dixie Coal Co r2601 Forsyth rd Hodgkins Mary E tchr PS r714 Napier av Hodo Acie (c; Grace) clo prsr rl22 Ross Hoffman F Richd (EUla) cranemn CofGa Ry h815 Main (EM) Hoffman Kath A cash Wisteria Cafe r716 Pine Hoffman R Henry (Christine) pntr h324 Pio Nono av (V) Hogan Anna (c) lndrs li322 Maple Hogan Austin (c; Alberta) lab h.150 (227) Roye (CH) Hogan David (c; Emmer K) lab Macon Gas Co h!07 Mulberry Hogan Hattie (c) millwkr Atlantic Cot- ton Mill h514 Coleman al HOGAN JAMES K, Executive V-Pres First National Bank & Trust Co, r New Clinton rd, Tel 5196-R Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 182 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Hogan Jasper T (Martha C) mgr Fenner & Beane hi 17 Clisby pi (V) Hogan Louis (c) lab CofGaRy Hogan Otis H sec-treas Yates & Tabor Co r208 Clisby pi (V) Hogan Paul (c) hlpr CofGaRy h537 Flanders (EM) Hogan Paul G (Jennie B; Macon Auto Exchange) h235 Stanislaus cir Hogan Roberta (c) lab hl019 Oglethorpe Homlloanntd Jaavs F (Belle) millwkr h410 BelHolland Jas L (c; Georgia) hlpr Fried's Garage r218 Jones Holland Jas W (Florence W) bkpr Jacob Hirsch h.121 Summit av (NH) Holland Jos (c; Clara) driver Johnson Bros h963 Oglethorpe Holland Lillie opr SBT&TCo r906 Cherry Holland Louise (c) lab rl08 Moughon Hogan Sarah (c) Indrs h649 Oglethorpe Hogan Steve (c) lab r322 Maple Hogan Timothy (c; Rosa) lab h203 (204) 3d av (U) Hogan Wm (c; Alma) lab hl06 (5) Cedar (U) Hogan Wm (Pimal R) mach h457 Vir- ginia av Hoge Gertrude (wid Jos T) h660 Hem- lock Hoge Jos S slsmn r660 Hemlock Hoge Julia h.126 High Holland Mattie (c) hl30 Ross Ho(lElaMn)d Mattie (c) Indrs r364 Flanders Holland Minter E (Mildred) driver h331 Winship (WH) Holland Nathaniel (c) driver rl08 Moughon Holland Ora E Mrs fetywkr Happ Bros Co h818 Hemlock Holland Oswald J student r619 1st Holland Sadie (c) cook r419 Douglas av (V) Hoge Kathryn sten r660 Hemlock Hoge M Eliz rl70 Virginia av Hogg Robt H (Mary B) pharm h672 Holland Thos (c; Amie) lab h364 Flanders (EM) Holland Veneda r818 Hemlock Hemlock Hogue Freeman J (Juliette) elk Sami B Holland Walker driver r240 Ross Holland Warren B (Opal) del slsmn Hogue r318 Dannenberg av Hogue Julia Mrs rl308 3d Hogue Sami B (Annie B) gro 320 Dan- nenberg av h318 do Hoke Wm A (Edith) car inspr h215 Wil- Dixie Dairies r915 Walnut apt 3 Holleman see also Holliman and Hollo- man Holleman Belle rl31 Academy Holleman Benj C student r211 Buford pi liams (SM) Holleman Cornelius B (Lilia H) trav Holbrook Clarabelle (c) h226 Chestnut Holbrook Georgia M (c) supvr Home- slsmn h'653 Forsyth Holleman Eliz rl03 Rogers av (V) making Sch r236 Chestnut Holleman Jas C (Vera) h211 Buford pi Holbrook Marion J (c) carrier USPO h Holleman Lena r325 Vineville av (V) 222 Chestnut Holleman Lewis B slsmn Corbin Supply Holbrook Robt L (Theodora M) h660 Hillyer av (CH) Holcomb Bryant (Florence) lab r357 Hydrolia (EM) Holcomb Clara C Mrs smstrs r766 2d Holcomb Esbon (Jessie M) pntr r517 Georgia av Holcomb Frank V (Sarah) pntr h2110 2d Holcomb Manning elk r2110 2d Holcomb Martha (wid Jos) h208 Wash- ington av Holcrow Robt (Ethel) millwkr rl325 3d Holdcroft F Spencer (Ethel C) director Macon Community Chest h563 College apt 9 Holden Jas (c; Hilda) lab hl634 1st Holder Fletcher L (Florine) millwkr Willingham Cotton Mills r52 (7) Roff Home pi Holder Gladys student r912 College Holder Henry N (Lucile) lab hl09 Forest av (B) HHoollddeerr IJsaobhenlla (L(woiisd) FmJi)llwhk9r12 ACtolallnetgice Cotton Mills h2 Ford la Holder John (Annie B) millwkr Willingham Cotton Mills r94 (324) Dannenberg al Holder Lois tchr PS r912 College Holder Thos (c; Minnie A) plmbr hlpr h211 Northwest Boundary Holding Commission Jesse B Hart sectreas 354 1st Holer Annie Indrs Crescent Lndry Co r 905 Elbert Holland Annie (c) r364 Flanders (EM) Holland Benj w (Mettie) carp h915 Walnut apt 3 HHoollllaanndd BBeessuileahL ((wc)idhOl0m8erMJ)ouhg6h1o9n 1st Holland Carey millwkr Bibb Mfg Co rl6 Brigham Holland Edna M fetywkr Happ Bros Co r8l8 Hemlock Holland Ernest (Mozelle) pntr rl703 2d Holland Frazier (c) porter Budrow Thompson r364 Flanders (EM) Holland J D Mrs tchr PS r218 Georgia av Holland Iduma Mrs fetywkr Happ Bros Co h868 1st Co rl03 Rogers av (V) Holleman Linton V rl03 Rogers av (V) Holleman Vera Mrs slswn Dannenberg Co r211 Buford pi Holley Barney D (Virlene) ftr Macon Gas Co r721 Pine Holley John C (c: Willie M) dentist 556 New R300 h236 2d av (V) Holley John J (Mary E) loco firemn hl34 Rembert av Holley Mamie (wid Wm S) r750 2d Holley Rupert S meatetr Rogers Stores Holley Willie M casewkr City Dept of Public Welfare r236 2d av (Pleasant Hills) Holliday Edw (c) lab hl24 Adams Holliday Peter O Hon (Martha) judge County Juvenile Court h216 Hines ter (V) Holliman see also Holleman and Holloman Holliman Annie (c) cook h333 Monroe Holliman Annie K (c) student r333 Monroe Holliman Annie L mus tchr 153 Summit av (NH) r do Holliman Arth (Rosa) lab hl03 1st av (U) Holliman Emmett (c) carp r333 Monroe Holliman John F (c) delmn College Hill Pharmacy r333 Monroe Holliman Julian C (c; Nancy) carp h216 Shamrock Holliman Katie (c) Indrs r333 Monroe Holliman Louise (c) cook r333 Monroe Holliman Mary (c) student r333 Monroe Holliman Myrtle Mrs office mgr Crescent Lndry Co hl31 Culver (V) Holliman Perl rl05 Pio Nono av Holliman Roy B (Myrtle) slsmn Crane Co hl31 Culver (V) Holliman Virginia tchr rl53 Summit av (NH) Hollingshead Caldona (c) cook hl02 Randall av (NH) Hollingshed Cora L (c) r201 Toombs (SM) Hollingshed John (c; Minnie) lab rl2 (104) Steins al Hollingshed Sylvester (c) millwkr Bibb Mfg Co r4 (553) Witkowskis la 183 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Hollingsworth Allen L (Eleanor) pntr HoClolifnGgaswRyorthhlB44enjMFagangotliLaife Ins Co of HoVllaingr2s4w0o5rth2dBerry (Emma) slsmn h Ho3l9l0i5ngsHwooursthtonCavJef(SfeMrs)on (Dorothy) slsmn hl43 Emily pi (I) Hollingsworth Dollie Mrs millwkr r224 Knott (SM) Hollingsworth Francis M (Allie) farmer Hohl4l0in1gsBwuorrttohn Farvancis M jr (Eliz F) mach r264 Washington av Hollingsworth Frank (Evelyn) ins agt r2405 2d Hollingsworth Frank D (Minnie L) lab HoCliltiyngshwl2o0rthKHnoetntry(SGM) (Louise) hl07 Buckingham pi (V) Hollingsworth Henry G (Gertrude) hlpr Ga Power Co rl205 Vineville av (V) Hollingsworth Lillian) matron Methodist HoOllripnhgaswnsortHhomMearrs2h0a1ll PiHerce(Lialvlie (VG)) plmbr Miller Bros h410 (409) Burton Hollingsworth Maxine sten Power Oil Co r310 Forsyth Hollingsworth P Ernest (Helen V) city Hofilrleinmgnswholr4th8SaTmeninRey(Eavva D(S)Ml)ab City h235 Cedar (SM) Hollomon Clinton (Viola) mach Bibb Mfg Co h515 Linden av Hollomon Collie V bkpr Mitchell & Wil- liams Inc h413 Ross Hollomon Ellis L (Eliz) car repr CofGa Ry -h River rd Hollomon Elvenia (c) Indrs hl79 Park HoHllootmelonal Howell L r556 A. sh Hollomon J C mgr Ga State Farmers Market Hollomon Janie (c) maid hl05 (921) Oe- Homlluolmgeoen lKa ate Mrs s,lswn Mangels of. HoGllaomInonc Lrliilll4ie (M13r0s) rC21h0a7rleBs ro(aSdMw)ay Hollomon Mabelle (c) Indrs h381 Middle (V) HHoolllloommoonn MPiangknioelia(c()c) r3r33841 HMaimddmleon(Vd) Hollomon Robt L bkpr r413 Ross Hollomon Susie r413 Ross Hollomon Tracey B jr slsmn Maxwell Bros Furn Co r413 Ross Hollomon Wilburn A carp r556 Ash Hollomon Zell (Kate) blrmkr hll4 (130) Charles (SM) Hollona Jas F (Clyde) cash Spiller's Restr ,, HHoolllloowwaayy AArnGoldlin(ecm) nlabGaCoPfoGwaeRry Co Holloway Benj T (Lennie) hi 16 Stratton w ROOFINGS Hollingsworth Thos F (Effie) elk Lester Grady hl08 (134) Colquitt Hollingsworth Thos F linemn SBT&TCo Holloway Bose (c) brklyr r297 1st av (V) Holloway Chas R (Ida B) cond h253 Ell EVERLOX SHINGLES r401 Burton av Hollins David (Mary) porter Firestone Auto Sup & Serv Stores r454 Hawthorne Hollins Hamp (c) lab CofGaRy Hollis Benj (Daisey) driver rl35 Highland av Hollis Chas B jr mach CofGaRy Hollis Chas F (c; Ada) lab h341 (277) Dempsey av (U) Hollis Estella (c) Indrs r230 Plant (SM) Hollis Ethel (c) maid h913 Pio Nono av (V) Hollis Jack (Edna) millwkr Bibb Mfg Co h820 Main (EM) Hollis Johnnie L (c) tchr PS h255 4th av (V) Hollis Lillie (c) Indrs r Coy Burton Hollis Louise typist WPA rl63 2d Ho(lUlis) Mabel (c) student rl07 Richard Hollis Maggie (c) rl09 Harris Hollis Mary (c) maid r454 Hawthorne Hollis Moses J (Callie) carp rl63 2d Hollis Nell waiter New Yorker r615 Walnut Holfoway Clark L (c) gro h319 3d av (V) Holloway E Hughes (Bessie) elk USPO h703 Woolfolk (EM) Holloway Eliz R Mrs sten Macon Credit Bureau h908 Napier av Holloway Frank (c; Lucinda) lab CofGa Ry h505 (472) Alabama (SM) Holloway Gustave J (Katie M) farmer h 432 Log Cabin dr Holloway J C bus opr Ga Power Co Holloway Jack M student r253 Ml (SM) Holloway Jas (c) cook r803 Ash Holloway Jas (c; Leila) lab Taylor Iron Wks & Sup Co rlI30 Broadway Holloway Jas jr (c) lab rll30 Broadway Holloway Jas C (c) porter Fred Balkcom Sinclair Station r407 (408) Crisp (SM) Holloway Jas C (Myrtle) fctywkr Happ Bros Co hl08 Montpelier av Holloway Jas J r301 Hendley (NHts) Holloway Jas M (Rosa) h771 Walnut Holloway Jessie (c; wid Bose) rl68 2d av (V) Holloway John M (Madge) genl mgr Macori Credit Bureau r Montgomery SHEARLIBDEARNT. EM. gr. YOUR CITY D I R E C Hollis Primrose (c) maid h522 (509) Middle (EM) Hollis Thos (c; Mabel) driver hi07 Richard (U) Hollis Thos jr (c) lab rl07 Richard (U) HHoolllliiss VVirigcitnoiraia(c()c)Indr2rs30r23C0aPlhlaonutn (SM) Hollman Alonzo (c; Fannie) lab r449 E HoAllcmadaenmyjas(EMF) (Clyde) waiter hell Holloway Julia tchr r703 Woolfolk (EM) Holloway Lamar elk r371 1st Holloway Lena (c) maid rl77 2d av (V) Holloway Lucius G (Eliz R) asst res mgr Macon Credit Bureau h908 Napier av Holloway M Mildred student r301 Hend- ley (NHts) Holloway M Tommie (wid Jos D) h477 Duncan av T O R Y Woolfolk (EM) Holloman see also Holleman and Holli- man Holloman Arvis V (Lula B) elk Jos Sa Holloway Margt r2615 Broadway Holloway Mattie (c) h203 Gantt City rd (SM) Holloway Maurice (Allene) slsmn South- MIRRORS loom r RD 2 land Coffee Co h302 Fort Hill (EM) Holloman Felix (c; Emma L) driver h Holloway Merle (c) student rl07 (956) the 708 (446) Charles (SM) Ocmulgee la Holloman Jim (c; Rosa) gro 98 Forest av Holloway Ollie E (wid Burrell) hl531 1st (V) h214 Grant av (V) Holloman John (c; Lucille) lab h409 Hoklelorwtoany sOilscar (Alice) rl05 (305) Pin- Industrial Charles (SM) Holloway Oscar (c) lab r203 Gantt City Holloman Lessie (c) Indrs r rear 280 rd (SM) LIFE Main (EM) Holloway Oscar (c) lab r527 (528) Middle Holloman OlUe (c) cook r212 Woodcliff (EM) Of Your Holloman Pearl rl05 Pio Nono av (V) Holloway Patk G h2615 Broadway Holloman Pinkie L (c) Indrs hl38 Pecan Holloman Reid (c; Nettie M) lab h711 Holloway Paul lab r2615 Broadway Holloway Porter (c; Lena) lab h87 Forest CITY Charles (SM) av (V) 184 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St, MACON Where To Buy? Consult the Classified Business Lists In This Directory ARLINGTON HOTEL FREE STORAGE BMRoOdeArDn WaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. Holloway Roland M (Mattie L; Macon HoBlluotwteary CRo)ubhy301(c)Hehn4d0le7y (4a0v8)(NCHritssp) (SM) Holloway Ruby slswn S H Kress & Co r253 Ell (SM) Holloway Sami (c) lab r772 Moore al Holloway Seagle (Ruth) pntr r233 (235) Cedar (SM) Holloway Thos H student r703 Woolfolk (EM) Holloway Wilbert J (c) cook r211 Madison Holloway Wm J (Ethel P) eng Natl Handle Co Holly A D (c) lab r264 Division st la Holly Millard H (Edna P) dept mgr Rogers Stores h287 Rutherford av (SM) Holmes Alfonso (c; Hattie) janitor r307 Wolmack (EM) Holmes Alicia (c) smstrs r93 Forest av (V) Holmes Amanda (c) maid h412 (125) Bartlett Holmes Anna T (wid John) h426 Johnson av (HH) Holmes Annie (c) lndrs hl55 (122) Duval (EM) Holmes Annie M Mrs tchr PS r702 Napier av Holmes Arlie (Estelle) fctywkr Bibb Mfg Co hl5 Lake City (EM) Holmes Arth (c) lab rl55 (122) Duval (EM) Holmes Bernice Mrs smstrs Union Dry Gds Co r620 1st Holmes Caura (c) smstrs r93 Forest av (V) HoWlmoeosdcCliflfayton (c; Rosa L) lab h241 Holmes Clayton jr (c) r241 Woodcliff Holmes Curley R (c; Maidie) loco flremn r201 (704) Henderson (SM) Holmes Edw (c; Dollie) hl25 Jordan (EM) Holmes Eliz (c) lndrs r383 Robinson rd Holmes Emma (c) cook r204 Green Holmes Fannie (c) h201 (704) Hender- son (SM) . Holmes Flora (c) cook r212 (216) Middle (V) Holmes Garrett (c; Sallie) plstr h473 Douglas av (V) Holmes Geo H (c; Fannie) porter J Backer Furn Co hl5 (4) Paradise al Holmes Hazel B r252 Overlook av Holmes Ida M (c) lndrs rl22 New Holmes Inez (c) lndrs h rear 211 Orange Holmes Jas fctywkr Bibb Mfg Co rl62 Jeftf Davis (SM) Holmes Jas (c) lab Willingham Sash & Door Co plant r Clinton rd RD 5 Holmes John (c; Eula) cook h914 Hazel Holmes John (c; Viola) lab CofGaRy r 307 Charles (SM) Holmes John (c; Doshia) porter MD& SRR h229 Orange Holmes John H (c; Hattie B) lab hl6 Gustin av Holmes John P (Gath B) phys 516 Mul- berry R204 h252 Overlook av Holmes John P jr r252 Overlook av Holmes Julian student rl29 Appleton Holmes Laura (c) lndrs r860 Foster's al Holmes Leon M (Maysie B) mech h201 Newberg (SM) Holmes Lillian (c) maid rl400 College dr Holmes Liza (c) lndrs r8 Reynolds al Holmes Lizzie (c) h405 (508) Prince (SM) Holmes Lizzie (c) lndrs r358 Ash Holmes Louis (c) lab rl27 Bartletts la Holmes Lucinda (c) hl27 Bartletts la Holmes Luther (c) r553 Hammond Holmes Mamie (c) maid r609 Ross Holmes Maria (c) cook h208 Middle (V) Holmes Marie (c) lndrs rl55 (122) Duval (EM) HoClmo ers73M5arBiolnacGkbsulrsnwn(NFHW) Woolworth Holmes Mary (C) lndrs r208 (218) Neal av (V) HoMlmoensroMe ary (wid John R) tchr PS r475 Holmes Mary E (wid Chas B) h475 Mon- roe Holmes Maysie L waiter r201 Newberg (SM) Holmes Minnie L R (wid Frank) h463 Orange Holmes Myra (c) cook rl400 College dr Holmes obie (c; Lump) h3 (6) West Boundary Holmes Ola M (c) r409 Peachtree (EM) Holmes Oliver C (Mamie L) mgr hl29 Appleton Holmes Oliver W (Hibernia) mach Tay- lor Iron Wks & Sup Co h735 Blackburn (NH) Holmes Ollie elk W Edw Hamlin r!5 Lake City (EM) Holmes Orcelia (c; Nancy) lab h331 Gilmer Holmes Pearl (c) smstrs h93 Forest av (V) Holmes Philip (c) butler r306 Wood al Holmes Polly L (c) cook rl53 Middle (V) Holmes Rosalie (c) r241 Woodcliff Holmes Ruth T (c) instr Ballard Normal Sch rl21 Chestnut Holmes Taylor (c; Henrietta) lab h375 Madison Holmes Taylor (c; Lizzie) restr 223 5th h do Holmes Thos M slsmn Dannenberg Co r 201 Newberg (SM) Holmes Tillie (wid Frank) h215 Chappell (SM) Holmes Walter (c) r201 (704) Henderson (SM) Holmes Walter (c) lab Willingham Sash & Door Co plant r RD 5 Holmes Wilder C welder CofGaRy Holmes Wm (c; Ethel) lab hl03 (211) Hawkins av Holmes Wm B (Ethel; Macon Dental Depot) dentist 556 Mulberry hl06 Vista cir Holmes Wm C (Merle L) welder r720 Forsyth Holmes Willie (c; Bertha) lab CofGaRy hl4 Parker av (V) Holmes Willie L (c) maid rl06 (158) Virgin (V) Holsenbeck Frank D (Mae) slsmn Strong Shoe Co hl97 Laurel av (NH) Holsenbeck Helen E (wid Wiley) rl97 Laurel av (NH) Holsenbeck Howard student rl97 Laurel av (NH) Holsenbeck Thos R (Maggie V) trav slsmn hl36 Winship (WH) Holsey Temple C M E Church (c) Rev Elisha B McNair pastor 261 Washington Holsonback Loyd student Ga Academy for the Blind r RD 1 Ranger Ga Holsten Eug lab r410 Cleveland (SM) Holster Della (c) h Bay cor Bay al Holster Fannie (c) lnddrs h22 Bertha- dale dr (V) Holster Jos (c) rlOlO Clinton rd (EM) Holston Alice A (wid Elza) h553 Main (EM) Holston Julian elk Bibb Mfg Co r553 Main (EM) Holston Mildred r553 Main (EM) Holt A Flewellyn r540 Washington av HOLT A FLEWELLYN JR (Aurelia), Pres A T Holt Co, h540 Washington av, Tel 4230-J 185 MILURONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 HOLT A T CO, A F Holt Jr Pres, R L Martin V-Pres, J W C Mathews SecTreas, Realtors, Real Estate and Renti(nFgorAfguertnhtser56in9foMrmulbateirorny, sTeeelrsig9h46t-t9o4p7 lines and page 28 Buyers' Guide) Holt Adam (c; Alice) coal roller City Water Wks h235 Roosevelt av (V) Holt Adam jr (c) r235 Roosevelt av (V) Holt Agnes tchr PS r RD 3 Holt Alma (wid Ira C) r321 New apt 2 Holt Annie M (c) lndrs rll7 Hicks al Holt Apartments 321 New Holt Beatrice (c) maid h411 Ward (V) Holt Benj (c) lab r518 E 2d (EM) Holt Claude elk Worsham & Sherrill r 500 Edgewood av (SM) Holt Cora (c) lndrs rl214 3d Holt Dan elk Hotel Southland r569 Broadway Hoalvt D(eVv)eraux (c) student r235 Roosevelt Holt Edw (c) lab rll (157) Bright al Holt Edw (c) lab rl232% Broadway HoFlot rEsylitzh L Mrs asst supvr WPA r210 Holton Henry P (Mattie) slsmn h619 Pine Holton John H (c) tailor hl3 Short St la Holton Josephine Mrs r855 New Holton Mae r619 Pine Holtzclaw Benj W (Mary M) eng Tay- lor Iron Wks & Sup Co h205 Clayton (V) Holtzclaw Eliz G bkpr r206 Clayton (V) Holtzclaw Essie smstrs r330 Shamrock Holtzclaw Garnett (Nettie) cond hl47 Vineville av Holtzclaw Mary M student r206 Clayton (V) Holtzclaw Vertis S (Pansy I) millwkr r 203 Duncan av Home Furnishing Co G Hugh Kemp mgr 1303 Broadway Home Market Co Bemon G McBride mgr meats 464 2d Homer Philip (c) lab r859 3d Homes Parrie L (c) h314 Harris la Hommack Lovia Mrs sten r414 Duncan Hone John H delmn Ga Power Co Honeycutt Bertha (c) lndrs r801 (814) Cowan (EM) Holt Ella (c) rll (157) Bright al Holt Fannie (c) probation officer Bibb County hl47 (210) Nussbaum (SM) Holt Frances M tchr PS hl09 Culver (V) HHooondsfoCrdSHa(zc)el p(owritderAr3M59) rH31a4zeFl orsyth Hood Cleveland (c; Susie) lab h359 Hazel Holt Frank (c; Stella) lab h304 (305) Hood Coach Lines Wm A Dix agt 320 Crisp (SM) Broadway Holt Hamilton T (Melva C) pres Clark Hood Esther (c) student r359 Hazel Memorials Inc h2502 Forsyth rd HoteltrsHonarri(sNH(ct;s)Dorothy) lab h222 Pat- Hood Hood Frank (e: Exie) Isaac (c: Eva M) h712 emp C3; dof av Ga (V) Ry h917 Ash Holt Ida (c) lndrs hl42 Brooklyn av (S) Hood J B (c; Irene) lab h515 Coleman Holt Jas (c; Bessie) lab hl047 Plo Nono av (V) Hoaol d Jack C (Ethel) auto mech South- Holt Jas (c; Virginia) orderly ril57 Ogle- eastern Greyhound Lines r258 Colum- thorpe Holt Jas I student rl40 Bacon Holt Jefferson (c; May) lab rl214 3d Holt Jesse R jr (Eliz) sign pntr Acme Sign Service r210 Forsyth Holt Jessie R (Olga) h631 Vineville av (V) Holt Jos (c) gro 310 Green h do Holt Jos L (c) r235 Roosevelt av (V) Holt Katie G rl40 Bacon Holt Lillian r2720 Forsyth rd Holt Mamie (c) student r411 Ward (V) Holt Mamie L tchr PS h728 Napier av Holt Miles F (Esther N) hl40 Bacon Holt Miles F jr (Bertha L) carrier US PO hl20 Bacon Ho(EltMM) innie (c) cook h611 (211) Edison Holt Nannie rl03 Florida av Holt Olga elk r870 2d Holt Olga A r631 Vineville av (V) Holt Ora (wid Jas H) h620 Main (EM) Holt Otis (c; Annie P) lab Chambers Lbr Co Inc rl047 Pio Nono av (V) Holt Rebecca (c) cook r753 3d Holt Ruth (c) smstrs h601 (1270) Elbert (SM) Holt Sami (c; Lillie) lab hl052 Pio Nono av (V) . _ ,_ _ Holt Silas (c; Fannie) prsr Snow's Lndry & Dry Clng Co h339 Monroe Holt Terrell tchr PS r728 Napier av Holt Walter A driver r628 Orange Holt Wardine r728 Napier av Holt Wm J (Orelia H) formn Heard Bros h656 New Holt Wm W (Volunteer Pharmacy) r212 Ho2ldt Willis C (Mollie) asst sta mgr in- gleside Oil Co r525 Mulberry Holt & Hanberry (Richd L Hanberry) bus Hood Jesse (c; Mamie) porter r359 Hazel Hood Marshall H (Miriam) loco eng h Ho1o09d FMlourriideal aevlk rl04 Ella (SM) Hood Robt A (Laura) fctywkr Bibb Mfg Co h22 (21) Lake City (EM) Hood Waulene student rl09 Florida av Hoodenpyle Julia E (Jas M) h22 Pro- gress Hooker Ernest O (Sadie D) collr Union Furn Co h252 Oakland av Hooker Henry C (Jennie M) swtchmn hll5 Capital av (Mikado pi) Hooker John P (Marjie) fctywkr rl02 Richmond . , Hooker Mabelle (wid John) r306 Wash- ington av Hooker Mildred W r258 Irving av Hooker Raymond F (Eunice) msngr C of G Ry h346 6th av (SM) Hooker Wm E (Lucy L) h258 Irving av Hooker Wm E (Bernice) fctywkr r205 Mikado av (SM) Hooks Chas (c) lab Willingham Sash & Door Co Plant r228 (721) Pear (EM) Hooks Clara B student r315 Bond Hooks Fannie (c) lndrs h rear 509 Monroe Hooks Henry J (Mattie L) millwkr rll5 Newberg (SM) Hooks Isaac (c: Mollie) h228 (721) Pear (EM) Hooks Jas B (Jennie L) hll5 Newberg Hooks Jas D (Kate) ins agt h315 Bond Hooks Jas F rl20 (48) Hydrolia (EM) Hooks Lucile (wid Fred F) millwkr Bibb Mfg Co hl20 (48) Hydrolia (EM) Hooks Margt sec r315 Bond Hooks Thos (c) lab r4 Buckner al printers 314 Broadway HOOKS THOS W (Hotel Lanier), h525 Holton Asa (c; Grade) hlpr Sharp's Mulberry, Tel 2771 Shoe Shop rl22 Ross Hooks W Glenn (Clara B) mgr Mut Holton Geo E (Marie) ehauf Safety Cab Benefit Life Ins Co h315 Bond Co h633 Plum Hooks Wm (c; Anna) hl58 Lynwood av Holton H Fredk (Sara S) driver Yellow (V) 13 Cab Trans & Baggage Co r327 Clinton (EM) Hooks Wm (c; Willie M) lab h255 Middle (V) 186 YATES MOTOR CO. I ** 707 THIRD ST. PHONES {\Z j PlyWOllth Hooks Wm O millwkr Bibb Mfg Co rl20 (48) Hydrolia (EM) Hooper Bertron T (c) agt North Carolina Mut Life Ins Co r201 Hawkins av (CH) Hooten Clifford R (Odell) prsmn Macon Evening News h675 Edgewood av Hoover Clyde H (Sara F") baker Am Bakeries Co r225 Adams Hoover Ellis rl235 2d Hoover Kate Mrs h213 Kemper av Hoover Tommie elk r213 Kemper av Hoover Woodrow W (Reba) auto mech r56 Worsham av Hope Della (c) rl45 Middle (V) Hope Edw (c) swtchmn hl45 Middle (V) Hope Prank B (Dorothy O) auditor U S Govt r661 New Hope John (c) student rl45 Middle (V) Hopkins Alma (c) cook rl06 Ruby (V) HHooppkkiinnss EAlnizgaie(c()e)lnr7d5r2s rC29e5ntMeros(EleMy )(U) Hopkins Eliz (c) lndrs rl20 (330) Bras- well la Hopkins Ernest (c; Mary) lab h8 White al (SM) Hopkins Geo (c) lndrs r240 Garden (E M) Hopkins Hazel (c) r228 McClain la HoVpikrginins J(oVs) (c; Fannie) lab rl28 (494) Hopkins Josephine (c) maid r302 (202) 2d av (U) Hopkins Julia (c) h478 Log Cabin dr Hopkins Katie (c) hill Mulberry Hopkins Milton (c) lab r812 Edgewood Hopkins Moody (c) lab h5 Bear's al Hopkins Nettie (c) cook h462 Chestnut Hopkins Obie (c; Gertrude) lab r762 (152) Whitehead al Hopkins Rhoda (c) h412 E 2d (EM) Hopper Albert (c) rl'12 (113) Bowman (EM) Hopper Chas P (Bertha M) mech Yellow Cab Trans & Baggage Co hllO Kemper av Hopper Dorothy waiter rllO Kemper av Hopper Eliz waiter DeLuxe Cafe rllO Kemper av Hopper Frank student Ga Academy for the Blind r RD 1 Clarkesville Ga Hordman Margt Mrs nurse County Bd of Health r Houston rd (Sh) HORGAN DAN C (Edith; Idle Hour Nurseries), h Forsyth rd nr Rivoli Sta, RD 2 Horn Horn Carrie Earl B (c) hi (Lona) Plant al formn SBT&TCo h 119 Grenada ter Horn Elma (wid Roe) millwkr Happ Mig Co r321 Randolph (EM) Horn Hannah (c) maid rl Plant al Horn Jas J student rl29 (101) Charles Horn John (c) lab r23 Malloy's al Horn Walter P (Arie L) mgr Liggett's Drug Store h210 Cherokee av Horn Will lab Citv Water Wks r6 Parker HoernngbuCckloef GAymRyer hPlOl(RHoibllert(aL)CHpotsw) er Hornbuckle Ruth sten Bankers Health & Life Ins Co rlOl Hill (LCHts) Horne Alex J (Lillie) carp h2531 2d Home Carrie (c) maid r314 Cedar (V) Horne Chas (Rosa A) millwkr Atlantic Cotton Mills h34 Atlantic Village Horne Christine r34 Atlantic Village Horne Danl W (Harriet B) slsmn hl06 OrBndiClSi tpr Horne Danl W .ir student rl06 Grenada Horne Edgar (Irene) formn r250 Washington av Horne Fkig (Velda) court reporter h772 (773) Winton av Horne Frank elk Sterchi Bros Stores Inc r RD 2 Columbus rd Horne Frank emp C of G Ry r RD 2 Bertdale av Horne Frank H (Pearl A) elk hlOl (108) Newberg av (SM) Horne Fredk B student r2I0 Cherokee Horne Geo H dept mgr Union Dry Gds Co r802 Mulberry Horne Gus E (Vina M) millwkr Atlantic Cotton Mills h27 Atlantic Village Home H Katharine rill Violet av (SM) Horne Hubert W (Eliz A) pntr hl06 Newberg (SM) Horne Jas (Mary) millwkr Bibb Mfg Co hl6 Bellevue rd Horne Joel H stockmn W R Werden & Co r859 Cherry Horne John elk Enrico Di Venuto rl08 Newberg av Horne John H (c; Evaline) driver hl23 DeBorde (SM) Horne Jos G (Mattie) benchmn Willing- ham Sash & Door Co Plant hl03 Mill av Horne Julia S student rl06 Grenada ter Horne Leila r391 Belmont av Horne Leila Mrs beauty opr Dannenberg Co rill Violet av (SM) Home Lela (c) maid r296 1st av (V) Horne Lillian (c) Indry wkr rl600 1st Horne Lillie (c) hl02 Bonaire Horne Lillie M millwkr Atlantic Cotton HoMmilelsLro3n4nAietlHan(tBicerVthilalaLge) lab Ga Car- olina Oil Co rl25 Daley (SM) Horne Louis (c; Laurine) h23 Parker av (V) Horne Louis J (c) lab hl600 1st Horne Lucille r210 Cherokee av Horne Margt J (wid Jas B) h646 Forsyth Horne Martha sten John W Barnett r 119 Corbin av (V) Home Martha J student rl08 Newberg Horne Marv tchr PS r553 Orange Horne Myrtle (c) 1-221 (134) Grant av Ho(Vm)e Nettie M Mrs r229 Tatnall Horne Philip (c; Louise) lab h256 Bright (SM) HoCrhnaepmRaanymrlo0n8d NFewsbtoerrge amvgr John A Horne Robt dist mgr Macon Evening News r555 2d Horne Stewart (c) greaser C of G Ry rl67 (319) Nussbaum (SM) Horne Viola (c) rl37 2d av (V) Horne Virginia Mrs rl812 3d Horne Virginia A student rl06 Grenada Horne W Fredk jr (Irene H) hl06 EU (SM) Horne Wm H (c) lab h358 Madison Horne Wm H jr (c) lab r358 Madison Horne Wm M (Lucy) mach Taylor Iron Wks & Sup Co hill Violet av (SM) HHoorrnnssbbyy FPraaunlce(sArnlnl6ie YMa)tesmailvlw(kErMB) ibb Mfg Co hi 16 Yates av (EM) Horseshaw Bertie L (c) maid rll2 (152) Clara (EM) .. , HHoorrttoonn AAnnnniae (Bc) c(owoikd rJlo25hnRMoc)khihll31 fctywkr hl534 2d Hudson Robt L (c) driver E Clifford Davis r613 Georgia av HHuuddssoonn RRoobbtt WW sttiuldewenktr r7rl83229Co3udrtland Hudson Rosa (c) lndrs hl205 1st Hudson Rosa (wid Walter) r782 Courtland av Hudson Ruby student r429 Ross Hudson Rufus (c) driver E Clifford Davis r613 Georgia av Hudson Sami (c; Lula) lab hl56 (420) Roye (CH) H2uddson Schiller R (Clifford) pntr hl015 Hudson Victoria (c) lndrs hlOl Mulberry Hudson Weymon (c; Pearl) lab Bibb Mfg Co h613 Georgia av Hudson W Allen (Eva M) wtchmn hi 10 Montpelier av Hudson Willard (Helen) millwkr Bibb Mfg Co h274 Willingham (EM) Hudson Wm (c; Melanee) butler h303 HuWdsaordn (WV)m (c) carp h241 Tindall av (SM) Hutodmson Wm (c) lab rl Bernhart's BotHudson Wm (c; Evaline) sawyer Natl HuHdasnodnleWCmo Ehimllillw(1k69r)rlD32e9Bo3rdde (SM) Hudson Wm R (Roxie P) carp h356 Hanson (SM) Hudson Willie Mrs fctywkr Happ Bros Co r649 Ash Hudson Wyolene elk r424 Johnson av (HH) Huey Luke M (Lena) slsmn Co-Operative Fire Ins Co h2510 Forsyth rd Huff Annie (c) cook r217 1st av (U) Huff Doris (Mary Ann Beauty Shop) r 408 Mikado av (SM) Huff Edna L elk rl226 College Huff Ella (c) cook h51 Parker av (V) Huff Eunice (c) rll5 Price (V) Huff Evelyn V slswn Darling Shop r408 Mikado av (SM) Huff Gertrude P (wid Newell) fctywkr Happ Bros Co h408 Mikado av (SM) HHuuffff JHuelliean (wc)ailtnedrrsr87rl103C1h3edrry Huff Lawrence (c; Lula B) lab h271 White al (SM) Huff Leola (c) maid h311 Coles al Huff Lucia slswn S H Kress & Co r408 HMufifkLaduociuasv P(S(MM)amie L) car reprmn h 3002 Houston av (SM) Huff Lula (c) maid hl03 (14) Orchard av Huff Marshall (c; Mamie L) lab G HuBfefrnMderCtoonh2(c2;9 M(1a1r3y) FM) oolarbe hL8a6neBay Huff Patsy elk r7 Rose pi Huff Ralph elk r3002 Houston av (SM) Huff Sami (c) lab r605 4th av (WH) Huff Vanderbilt (c; Christine) plstr h 102 Price (V) Huff Vertice (c) cook hll5 Price (V) Huff Viola (c) lndrs r271 White al (S M) Huff Wm (c) porter rl03 (14) Orchard Huff Wm L (Eva M) store mgr Rogers HSuftforWesmh7P09 (HRoulbt ya)v c(oNnHtrts)1226 College h do Huff Wm T student r3002 Houston av (SM) Huff Wylis (c; Annie) lab h Forsyth rd Hughely Aubie (c; Annie) lab h300 Penn av (V) Hughens Wm J (Myrtice) steelwkr h704 Mikado av Hughes Augustus L (Hattie) capt Fire Dept h335 Ross Hughes Augustus L Jr student r335 Ross Hughes Clara (c) r201 (162) peacock (S M) Hughes Clyde (c) maid r201 (162) Pea- cock (SM) Hughes Dora (c) lndrs hll3 Stripling al (EM) Hughes Dudley (c; Cornelia) lab h201 (122) Railroad av (V) Hughes Edith (c) lndrs rl20 Neal av (V) Hughes Edw lab r335 Ross Hughes Ellen (c) maid rl45 Pecan av Hughes Eloise tchr r625 Adams Hughes Elrvin (c; Susie M) lab h311 (420') Elizabeth (SM) Hughes Fred (c) lab r388 Boardman's al Hughes Geo W (c) lab r215 Braswell la Hughes Gussie (c) maid r822 Montpelier Hughes Helen (c) maid r208 (306) Eliz- abeth (SM) Hughes J D (Pauline L) lawyer h625 Adams Hu(SghMe)s J T (c) lab r201 (162) Peacock Hughes Jas (c; Eva) lab h904 Elbert (SM) Hutegrhe(sV)Jas W (Eula) slsmn h348 Hines Hughes John (c; Sallie) shoe repr h303 Penn av (V) Hughes John jr (c; Lavancy) lab h302 Penn av (V) Hughes John H (Margarette) mldr Tay- lor Iron Wks & Sup Co hl03 Kenmore Hupgl hes John W (Inez) auto mech h601 Plum Hughes John W (c; Sally) lab hl20 Neal av (V) Macon Federal Savings & Loan Ass'n Loans on City Heal Estate 417 Broadway PHONE 5036 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 Hughes John W (c) shoe repr 122 Neal av (V) h do Hughes Kittie C (wid Edw) fctywkr Happ Bros Co hlOl StJohn (EM) Hughes Leonard lab Natl Handle Co Hughes Leonard (c) lab r314 Elm Hughes Lizzie (c) hl20 (8) Fulton al Hughes Lucile (c) cook rl02 (208) Green HuhgihllesMLayucius (c; Ida) lab CofGaRy HuRgahilersoaMd aagvgi(eV) (c) maid r201 (122) Hughes Marie (c) r204 Gantt City rd (SM) Hughes Mattie B (c) rl02 (208) Green (V) Hughes Moses (c; Bessie C) h905 Edge- wood av Hughes Nathaniel (c; Evelena) lab h6 P&rk Hotel 9/1 Hughes Nellie (c) r201 (162) Peacock (S M) Hughes Opal tchr r625 Adams Hughes Oscar C (c) lab r201 (162) Pea- cock (SM) Hughes Otis (c; Minnie L) lab r311 Edgewood av (SM) Hughes Otis F (Gladys) supt Kinnett- Odom Co hl95 Boulevard (NH) Hughes Pauline P opr SBT&TCo r625 Adams Hughes Pennie (c) tchr r414 E 2d (E M) Hughes Percy (c) lab r235 Collins pi Hughes Rachel (c) h2 White al (SM) Hughes Richd (c; Rosa) h426 Flanders (EM) Hughes Robt L (c; Clara) lab hl08 (953) Ocmulgee la Hughes Roosevelt (c) lab r201 (122) Railroad av (V) Hughes Rosa M (c) lndrs rl78 Park Hotel al Hughes Sami (c) lab h!78 Park Hotel al HHuugghheess TThiolms a(nc) (lac;b rI2s3a5beCl)olllianbs phi23a Hughes8Walter (c; Lucile) hl02 (208) Green (V) Hughes Wesley (c; Mollie) h201 (162) Peacock (SM) _ , ,_ . Hughes Wesley (c) firemn Central Sash & Door Co' h307 (831) Plummer's al Hughes Wm H (Virginia L) atndt Letcher B Hunt . ... Hughley Chas (c; Pearlie) lab h648 4th av (WH) . , Hughley Constance (c) rl09 (197) Rich- ard (U) Hughley Wesley (c; Ora L) lab r311 Blount Hughley Wm (c; Annie L) lab hl8 El- bert la (SM) Huguley Minter J (Lucinda) policemn r Hu6g19ulely* Virginia (wid Mason J,,) r3,,2,,8,, Buford pi (V) Huhn C & Son (Walter M and Julius Huhn) hdw 408 Mulberry Huhn G Christian bkpr r840 College HUGHuNn Han&d HLoRck, sHmeitnhrsy, RReHpuaihrnersMgorf, Guns, Safes, Locks, Etc, Keys Made to Order, 419 2d, Tel 187 Huhn Henry R (Margt) mgr H & H R Huhn hl06 Laurel (NH) Huhn Herman (Rita) locksmith H & H R Huhn rllO (5) Holt av Huhn Jeannette sten Happ Bros Co r840 College Huhn Julius (C Huhn & Son) r452 Walnut Huhn Sadie M (wid Herman) r840 Col- lege Huhn Walter M (C Huhn & Son) h452 Walnut Hulgan Horace M (Gaynelle) asst mgr Liberty Natl Life Ins Co h302 Cherokee av Hulgan Jos L (Margt) supvr rl46 Mag- nolia Hulgan Jos L .ir rl46 Magnolia Hulin John H (c) agt Afro-American Life Ins Co r659 Spring Hull Prank I paymstr WPA r403 Hill Crest av (CH) Hullet Geo C (Rose) millwkr Bibb Mfg Co h90-91 Green (PM) HuvmeretoCwhnriSsttoorpehserr84G0 CeloklleGgoeodrich Sil- Hume Robt D instr Wesleyan Coll r401 College Hummel Albert N elk h321 New apt 3 Hummel Ethel E elk Happ Bros Co r321 New apt 3 Hummel Sigmund B elk Birdsey Flour HuMmilmlserl37W1 m1stR r321 New apt 3 Humphrey A G (Helen) lino opr Macon Teleg Pub Co r560 Plum HHuummpphhrreeyy JJaonhine Ch80(8c;3dFlorence) driver h4 Sparks al , Humphrev Mary (c) maid h317 (341) 1st av (V) HUMPHREYS CHARLES H, City Electa City of Macon, h681 College, Tel 610 Humphreys Floyd H (Mary; Humphreys & Lamb Service Sta) rlOl Ridge av (V) Humphreys Floyd H (Martha T) frt traf rep Sou Ry System hlOl Ridge av (V) Humphreys M Cannuett nurse 101 Ridge av h do , . Humphreys Thos H (Lois S) v-pres Macon Supply Co h247 Belvadier dr Humphreys & Lamb Service Station (Floyd H Humphreys, Julian K Lamb) 507 Vineville av (V) Humphries Adolphus (c; Pearl) lab W PA Whse hl09 (541) Tinsley la Humphries Albert A store mgr GtA&P TeaCo r236 (136) Capitol av (Mikado pl) Humphries Annie (wid Jos C) h236 (136) Capitol av (Mikado pl) . Humphries Chas C (Mattie W) lmbrmn Huh2m7p2hCrioelsleCgehas L (Ida) hl014 Clinton rd Humphries Doris G waiter F W Wood- HuwmoprthhriCeso Erlu4g5 TPie(dGmlaodnyts)avcollr Right Way Finance Co hl021 Clinton rd (E M) Humphries Fanny (c) lab rl05 Bonaire Humphries Hazel student r272 College Humphries Josie (c) maid h206 (2) N Tatnall la Humphries Louis (c; Ethel M) lab h458 City Hall la . , Humphries Mamie smstrs Snyder s Ready-To-Wear rlOlS Clinton rd (E M) Humphries Media (c; Marie) lab Natl Handle Co h318 (319) Williams (EM) Humphries Paul (c; Fannie V) lab Natl Handle Co r354 Pine Humphries R Sami (Minnie L) carp h Hu1m45pPhireiedsmRontSaamv i jr dist mgr Macon Evening News rl45 Piedmont av Humphries Ruth (wid Homer) h281 Masonic Home rd (NH) Humphries Sami T (c; Lily) millwkr HuBmibpbhrMiefsgSCaorahhllJ5 (c(2)27h)50E3llGioitltm(eErM) Humphries Silas (c; Ollie M) lab Natl Handle Co h501 (471) Crisp (SM) Humphries Wm (c; Pearlene) lab rll7 Tindall av (SM) Hunley Lee lab rl21 Steele (SM) Hunnicutt Anna (wid Jos) r2642 Hous- ton av (SM) 193 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Hunnicutt Annie (wid Thos) r210 Davis Hunnicutt Bernice sten r205 Mikado av Hunnicutt Burney L (Sallie M) mgr Dunlap Chevrolet Co hl23 Charles HCunhneircruytt Clarence H (Mam,,ie R) r758 Hunnicutt Clarice J slswn Dannenberg HuCnonirc2u4t5t DHoarridsemslaswn navr42(7V)College Hunnicutt Eliz B Mrs r861 Hemlock Hunnicutt Eliz W sten Met Life Ins Co r476 College apt 14 Hunnicutt Eloise Mrs smstrs r512 HemHunnicutt Emma (wid Jas P) furn rms 754 Cherry h do Hunnicutt Ethel I rl07 3d av (SM) Hunnicutt Eug millwkr Bibb Mfg Co r 7 Water (PM) Hunnicutt Helen jr opr SBT&TCo r427 College Hunnicutt Henry D (Sarah) r2325 2d Hunnicutt Irene smstrs rl525 Broadway Hunnicutt Irma L (wid Chas H) h445 College Hunnicutt J Prank (Lennah) tinner CofGaRy h501 Mikado av Hunnicutt Jack elk rl05 Womack (EM) Hunnicutt Jacob R (Gladys) formn h 103 (137) Colquitt Huhnl0n7icu3dtt aJvas(SCM)(Mildred R) loco eng Hunnicutt Jas T (Estelle) cabtmkr h 1105 Oglethorpe Hunnicutt John C mech Firestone Sup & Serv Stores r2325 2d Hunnicutt Kath rl068 Ash Hunnicutt Lucille rll05 Oglethorpe Hunnicutt Luther H (Annie) pntr Cof GaRy hl05 Womack (EM) Hunnicutt Mamie R Mrs fctywkr Happ Bros Co r758 Cherry Hunnicutt Mary (wid C Cicero) h245 Hardeman av (V) Hunnicutt Mollie (wid H C) hl068 Ash Hunnicutt Ola slswn Central Ga Baking Co rlOOS Ash Hunnicutt Oliver (Olivia) student r2325 2d Hunnicutt Prentice student r2325 2d Hunnicutt Ruby wrapper Swift & Co r 2642 Houston av (SM) Hunnicutt Sarah (e) lndrs h426 Lawton Hu&nnLicauctktayThhols09P A(Eysetreslleb)lvedlk Lackay Hunnicutt Thos J appr C of G Ry rl85 Magnolia Hunnicutt Wm O (Florence) h2325 2d Hunnicutt Wm S (Wylene) flagmn hl06 Mill av Hunt Abe (c) lab r242 Garden (EM) Hunt Addie (c) lndrs hl72 Astor (EM) Hunt Albert (c; Lilia) r359 (355) North (V) Hunt Beni (c; Lottie B) h300 Short (E M) Hunt Bertha (c) r417 Hazel Hunt Buster (c) lab hlOO Kitchens HuCnlnt gClaCroa (rcl3)1e5mp1sStnow's Lndry & Dry Hunt Clara r709 Adams Hunt Earl (Mildred) baker American Bakeries Co h806 1st Hunt Eliz sten Yates & Tabor Co rl98 Crescent av (CH) Huennt AEplmpaerrel(cr)l2p4orCteorwManays(oEnM's) WomHunt Essie (c) lndrs rll5 Glen (EM) Hunt Estella (c) smstrs rl08 Gustin av Hunt Eunice J (wid Thos W) bkpr Yates & Tabor Co hl98 Crescent av (CH) HuMn)t Fannie (c) h236 (140) Cowan (E Hunt Frances (c) lndrs h429 Douglas av (V)' > Hunt Geo C wldr City Welding Co r304 Telfair Hunt Henry (c) lab r312 Womack (EM) Hunt Herbert (c; Ola) lab rl74% Astor (EM) Hunt J Carver (Martha L) slsmn Macon Gas Co r251 (350) Blackburn (NH) Hunt Jacob (c; Laura) hll9 (126) Phil- lips la (EM) Hunt Jas A collr Empire Furn Co h801 HuPniot JNaosnHa eanvry (V(c)) lab rll2 Woolfolk (EM) Hunt Jas R Rev (Mattie) h294 Cedar (SM) Hunt Janie (c) r306 (121) 1st av CD) HuRnidt gJeefafevrso(Vn)B (Lena) loco eng h211 Hunt John (c; Lucius) carp h401 (342) Maynard (EM) Hunt John (c) hlpr Terminal Service Station h417 Hazel Hunt John (c; Rilla) porter r321 Mid- dle (V) Hunt John (c) prsr Hill Dry Clng Co h 223 (130) Grant av (V) Hunt John A (Lona) elk h220 Macon Hunt Johnson (c) oven hd Central Ga Baking Co Hunt Katie (c) lndrs rll9 (126) Phillips la (EM) Hunt Letcher B filling sta 3300 Hous- ton av (SM) hlOO Villa Esta HuCnatmLpetrclOhOer VBillajr Emstgar Hunt Tourist Hunt Lilia M (c) maid r359 (355) North (V) Hunt Lizzie (c) hl68% (169) Astor (EM) Hunt Lizzie (c) r4l8 Elliott (EM) Hunt Loraine (c) rll9 (126) Phillips la (EM) Hunt Lucy (wid Robt H) hll4% Rogers av (V)' Hunt Maggie (c) r417 Hazel Hunt Melvina (c) emp Snow's Lndry & Dry Clng Co rl301 (123) Woolfolk (EM)' Hunt Minnie (c) maid h204 Green Hunt Mollie L rill Pio Nono av (V) Hunt Nan ins agt Murphey Taylor & Ellis Inc rll4% Rogers av (V) Hunt Nancy (c) lndrs r857 3d Hunt Nicie (c) h359 (355) North (V) Hunt Obie B (c; Lizzie' fctywkr hl4 Spring Hunt Olin S (Johnnie) slsmn rl40 High Hunt Robt (c; Cora) lab h312 Womack (EM) Hunt Sylvester (c; Mary) porter Dun- lap Chevrolet Co r321 Middle (V) Hunt Thos B (Emory) millwkr Atlantic Cotton Mills h234 Oak Haven av Hunt Thos C (Dossie M) trav slsmn The Southern Cotton Oil Co h251 (350) Blackburn av (NH) Hu3ndt aTvho(sV)J (c; Elnora E) barber h705 Hunt Tourist Camp (Letcher B Hunt) 3300 Houston av (SM) Hunt Wm (c; Nettie) millwkr Bibb Mfg HuCnot Wh2m45AC(oMwaamn ie(ELM) )credit mgr Taylor Furn Co rl21 1st Hunt Wm F r866 1st Hunt Wm G (Annie B) eng h709 Adams Hunt Wm H (c; Mary) lab Bibb Mfg Co h407 (348) Maynard (EM) Hunter Mary (c) lndrs h421 Hazel Hunter Roosevelt (c) student rl05 (102) Amos (V) Hunter Sami B lawyer 316% 2d r RD 5 Hunter Sylvester (c; Easter L) lab hl67 Waterville rd Hunter Wm (c; Mary) lab h413 (324) Elizabeth (SM) HuMnftgerCWo mh20(2c; MRiotcbheerltla)(EmMil)lwkr Bibb MERRITT GCAL GO. 1414 FIRST Cor. Ash YOUR CITY D I R C T O R Y MIRRORS the CIVIC Life Of Your CITY 194 D. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Go. Studebaker Willys Hupmobile Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D I R P T O R Y MIRRORS the GIVIG Lite Of Your CITY Huntney Mildred (c) lndrs hl44 (246) Forsyth la Hupp Lorine (c) lab h611 Elliott (EM) Hurley Electric Co (Robt W Hurley) 452 Cotton av Hurley Eliz sten American Bakeries Co x Shirley Hills Hurley Leila M (c) lndrs hl49 2d av (V) Hurley Madge. hl27 High Hurley Robt W (Ruth; Hurley Elec Co) h255 Bond Hurley Thos A (Mary) phys 567 Walnut r Shirley Hills Hurnby Hollie J (wid Sam) rll5 New- berg av Hurst Frank C baker American Baker- ies Co r554 1st Hurst Hunter student rl219 Oglethorpe Hurst J Harry dist supvr WPA Whse r 181 Magnolia Hurst John F (Clyde) elk US FO hl4 Marion pi (WH) Hurst Lois service rep SBT&TCo r209 1st Hurst Morgan (c) hlpr CoofGaRy r212 Roosevelt av (V) Hurst Needham W (Ethel) h204 Ridge av (V) Hurst R F elk Ga Power Co Hu2rdst Ruth elk Union Dry Gds Co r763 Hurst Stanford slsmn r204 Ridge av (V) Hurst Walter E (Louise) elk h224 Ayers rd Hurt Eliz Mrs nurse rl322 2d Hurt 'Ellis Q (Eliz) asst mgr Mack Pur- chasing Co hl322 2d HHuurrttt GJuewsseiell (Mc)rshmllgrBuMckilnaedry aCl lnrs r 258 College Hurtt Kolin (Jewell) asst mgr Milady Clnrs h258 College Huston Alf student r713 2d Huston Myron A (Frances) r713 2d Hutchen Lila M (c) hl02 (6) Clara (E M) Hutchens Lillie (c) lndrs r645 4th av (W H) Hutchens Minter (c; Olene) lab hl05 (5) Alabama (SM) HuAtlcahbeanmsaWm(SM(c); Emma) lab h404 (465) Hutcherson Dudley R asst prof Wesley- an Coll r University Miss Hutcheson Blanche Mrs smstrs rl315 2d Hutcheson Pearl (wid Lingo) h869 2d Hutcheson Royce bar tndr Green Front r869 2d Hutchings. BertJha (c) r428 Monroe HUFuTnCeHraINl GHSomCeH),AhS23H9 2(dc;avHu(tVch),inTgesl' 1528 Hutchings Clarence P (Mary S) chf opr hSll Poplar apt 1 Hutchings Danl (c; Mittie) lab h867 Oc- mulgee Hutchings Edw R student r811 Poplar apt 1 Hutchings Emma K (c) lndrs h428 Mon- roe Hutchings Ernest elk Coleman-Meadows- Pate Drug Co r285 Orange HUTCHINGS FRANK J (c; Carita; Hutchings' Funeral Home), h523 Monroe, Tel 3439 Hutchings G Ernest (Eugenia N) dist mgr Macon Telegraph r285 Orange Hutchings Lucy M (c) h2434 Strayers al (SM) Hutchings Martha (c) lndrs h224 (557) Moore la Hutchings Richd (c; Hattie) lab h226 Plant (SM) Hu(Vtc)hings Susie B (c) bkpr r239 2d av Hutchings Virgil R (Irene) elk h303 Mi- kado av (SM) Hutchings Wm C elk Macon Teleg Pub Co r811 Poplar apt 1 HUTCHINGS WM P (c; Essie; Hutchings' Funeral Home), h200 College, Tel 3728 HUTCHINGS' FUNERAL HOME (c; Charles H, William P and Frank J Hutchings), Undertakers and Embalmers 518 New, Tel 2044, Night Tels 2044, 3439 and 3728 (For further information see left top lines and page 15 Buyers' Guide) Hutchins Alma (c) nurse r390 (102) Lexington (EM) Hutchins Beatrice Mrs forwn Southland Knitting Mills rl91 Oakland av Hutchins Daisy (c) maid h390 (102) Lexington (EM) Hutchins Herbert (Beatrice) millwkr Southland Knitting Mills rl91 Oakland av HuMtc)hins Jas (c; Lillie) h803 Elbert (S Hutchins Jas (c) lab r390 (102) Lex- ington (EM) Hutchins Lucy (c) hl53 (157) Broad (E M) Hutchins Lula (c) lndrs hll6 Franklin. St la Hutchins Lutitia (c) maid xlOS (7-8) Hawkins av Hutchins Minter (c) lab CofGaRy Hutchins Nettie (c) millwkr Bibb Mfg Co h710 Hawthorne Hutchins Roxey (c) lab Central City Bag Co Hutchins Washington (c; Bessie) janitor r302 Dure (U) Hutchins Wm (c) lab CofGaRy rll6 Franklin St la Hutchinson Florence Mrs r711 Walnut Hutchinson Maurine student 221 Geor- gia av Hutchison Florence dental asst Gilliam Clark rl29 Flamingo dr Hutchison Helen waiter rl29 Flamingo dr Hutchison Henry E millwkr Bibb Mfg Co r883 Hazel Hutchison Jesse L millwkr Bibb Mfg Co r833 Hazel Hutchison John H (Carrie) millwkr Bibb Mfg Co h833 Hazel Hutchison Leon A (Elsie V) sta mgr Power Oil Co hl29 Flamingo dr HuIgtghlgnance Alice C (wid Edw) h747 Col- Huthnance Annie (wid Frank) hl22 Log Cabin blvd Huthnance Edw mach rl22 Log Cabin blvd Huthnance Frank elk RyMIS Huthnance Jodie r800 Orange Huthnance Lena elk Union Dry Gds Co r80O Orange Huthnance Martha beauty opr Mary Ann Beauty Shop rl22 Log Cabin blvd Hutson Effa W Mrs rllO Corbin av (V) Hutto Annie millwkr rlll3 Napier av Hutto Garfield (Drudie Y) h301 Ruth- erford av (SM) Hutto John B (Willa) auto mech h977 Montpelier av Hutto Lillie lab r2020 Broadway Hutto Lomus r310 Cedar (SM) Hutto Martha F r711 Main (EM) Hutto Monroe (Ola !H) lab h2020 Broad- way Hutton Thos T (Florence) gro 942 (940) Elbeirt (SM) h do Hutts Jos L (Nina) millwkr Bibb Mfg Co hlO8-109 Green (PM) Hyatt Evelyn slswn r2403 2d Hyatt Hadv C (Katie) linemn Ga Power Co hill Garden (EM) Hyatt Herman E (Sallie C) mail elk Ma- con Teleg Pub Co h204 Church (EM) Hyatt Jas P (Susie B) h2403 2d 195 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL- 4401 Hyatt Jas P jr (Mildred P) bkpr G Bernd Co h254 College Hyde Betty (wid Thos) r865 Mulberry Hyde Mary B sten-bkpr McKesson- Riley Div r865 Mulberry Hydrick Prank (c; Ida) r222 Thomas (EM) Hylie Wm (c) porter Calloway Service Station Hyman Geneva Mrs smstrs r619 Walnut apt 8 Hyman Wm (c) carp h228 (127) Grant av (V) HyLmoeasn E&mTanruueslt C(co) hja8n5i5toSrmWitihllmrogwham Hysler Eliz (wid Thos L) r303 Chappell Hysler Nora Mrs millwkr Willingham Cotton Mill rll20 Oglethorpe Hy1s3l0e4r V2dollie P millwkr Bibb Mfg Co h Hysler Wm H (Marie) bldg supt County Court House hl25 Dixie av (SM) IdBearlowSn,toRraaglpeh L& DGavaernapgoert) (JautoPsra2n5k6 2d IIDdlLeEHHoOurURClNubURFSoErsRyItEhS rd(Dan C Hor- gan), 169 Cotton av, Tels 223-224, Greenhouses Forsyth rd nr Rivoli, Ga, Tel 875-J (For further information see top stencil and page 13 Buyers' Guide) Idlet Jas (c) r315 Coles al Idlett Wm (c; Eula) lab h206 Green Independent Funeral Home (c; Andrew INWDEPBEarNroDwE)NT457LACUoNttDonRYavCO, Arber S Hertz Trustee (Cleveland, Ohio), Isaac Flatau V-Pres, Andrew W Voight Sec-Treas, Charles H Campbell Genl Mgr and Supt, 452 2d, Tels 1000-10011002 (For further information see right side lines and page 22 Buyers' Guide) INdDeEpPenEdNeDntENLTaunLdIrNyENCo)S, EIRsaVaIcCEFla(tIanuJr Mgr 452 2d, Tels 1000-1001-1002 (For further information see right side lines and page 22 Buyers' Guide) Indinegpe9n1d5en2tdOrder Odd Fellows BuildIndependent Sons & Daughters of Jerusalem (c) 405 (384) Gantt City rd (S M) Industrial Life & Health Insurance Co S B Kinard mgr 409 2d R414 Industrial Loan & Investment Co Inc John W Ramsey pres J Lamar Edwards v-pres Mrs Alma L Stuckey sec Jas P Ramsey treas 156 Cotton av and 355 2d Ives Walter D waiter r258 1st Ingham Cath student r254 Masonic Home rd Ingham Jas W student r254 Masonic Home rd Ingham Louise student r254 Masonic Home rd (NH) Ingham Ralph E (Annie L) chf chemist P S Royster Guano Co h254 Masonic Home rd (NH) Ingle Jas B power eng CofGaRy r533 Orange apt 23 Ingle Robt B (Roberta Z) mgr Macon Gas Co h748, Hillyer av (CH) Ing(OleHR)1 obt B jr student r748 Hillyer av Ingle Roberta W tchr r748 Hillyer av (CH) Ingle Ruth B student r748 Hillyer av (CH) Ingleside Electric Co (Peter S Crambes) 1909 Vineville av (V) Ingleside Kindergarten 102 Woodland av (I) Ing42le7siRdeidgMe eatvhod(Vis)t Church (South.) Ingfillelsinidge sOtail 2C1o30JoFelorEsyTthharmdes sta mgr Ingleside Pharmacy (Geo K Faircloth) 2103 Vineville av (V) Ingleside Shoe Shop (Glenn E Blank- enship) 1920 Vineville av (V) Ingram Annie (c) maid r968 Ocmulgee Ingram Annie B (c) cook rl50 5th Ingram B S School (c) Percy H Wil- liams (c) prin 425 Telfair Ingram Carrie Z (c) student r454 Broad I (EM) Ingram Oath (c) lab h437 Middle (EM) Ingram Chas D (c; Willie) carp h852 (854) 3d av (V) TInngcrrnamm DCahvaiss H(clUhSlNOlr3(7216)1Wst alls al (N H) Ingram Earl (c) lab h93 Bay Ingram Earlstine (c) r437 Middle (EM) Ingram Early bell boy Hotel Lanier Ingram Elleii E Mrs teller Ga Power Co ho33 Orange apt 7 Ingram Elmer C r58 (13) Roff Home pi InTg,,rac- mCnEmViOmO*a7 a(lcl-), agt Guaranty Life Ingram Emma (c) lndrs hl52 Sycamore (V) Ingram Emmett (c) porter Macon Feed & Seed Store InSgrteawmarHt'asywalood (c) lab rll3 (235) Ingram Herman (c) carp r852 (854) 3d Inagvram(V)Jas K (Margt) elk WPA Whse Inhglr7a0m RJeilsesyie av(c) maid h220 Orange Ingram John (c) porter Burghard-Con- nally rl38 (208) Lincoln av (V) Ingram Joshua (c; Cora) hlpr CofGa Ry h206 (620) Williams (EM) Ingram Leila W (c) tchr PS r356 Mon- roe Ingram Louisiana (c) lndrs h36 Gas House al Ingram Margt (c) cook r9'53 Hazel Ingram Morton S (c; Mary) janitor h 105 Wise av (V) Ingcoralnm aOv sc(Var) (c) lab rl38 (208) LinIngram Ruth (c) maid (hll6 (230) Stew- art's al Ingram Sami (c; Easter) restir 429 Cot- ton av h439 Madison Ingram Thelma (c) student r852 (854) Ing3dramav T(hVo)s (c; Lula) lab hl316 1st Ingram Thos (c) student rll3 (235) Stewart's a' Ingram Wm (c; Ella) lab rl50 5th Ingram Wm C (c) porter r220 Orange Ingram Wm H (c; Zelena) carrier US InPgrOamh4W54m BHrojard(c)(EsMtu)dent r454 Broad Ingram Zelena M (c) tohr PS r454 E Broad (EM) Innis Raymond L (Ruth B) mgr Swift's Ice Cream hl422 Oglethorpe Interior Painters & Decorators Union meets Thursday 7:30 p m 408 Poplar INTERNAL REVENUE COLLECTOR (See United States Government) International Association of Machinists meet 2d and 4th Monday 7:45 p m 408 Poplar International Printing Pressman & Assn Union No 214 meets 1st Wednesday 5:30 p m 408 Poplar Interstate Bond Co Jos K Daly corres finance 617 Mulberry R311 Interstate Life & Accident Co Jasper L Coggin dist mgr 617 Mulberry R608 Investors' Syndicate John A Brown agey Irbme,ygr J4e0s9sie2delkR401424 Charles Irby B Ray (M Ella) sec-treas Irby Bros Inc h2324 2d S 0 u T H L A N D HOTEL "Macon's Newest** 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 196 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. THIRD AT PINE GMC TRUCKS PHONE 5100 MStoemckberEsxcNh.anYge. Irby Belle (wid A B) rll8 (124) Charles Isabell Mose (c; Willie) wtchmn hl21 N.ExYc.hCanogtteon Chicago Board of Trade AssNoEc. ixaYcteh. aMnCgeuemrbbers (SM) Irby Benj P millwkr r2215 Broadway Irby Bros Inc Frank E Irby pres B Bay Irby sec-treas plmbrs 569 Mulberry Irby Chas M sawyer r2837 Houston av (SM) Irby Evatna H Mrs slswn Dannenberg Edgewood av Isabell Pemble (c) porter Peeples Oil Co Sta 2 Isabell Thos (c) porter Standard Oil Co r207 Ocmulgee la Isaf Annie Mrs hl998 3d Isaf Najeeb T (Emmaline; Bibb Shoe Local Stocks and Bonds Co _hl01 Charles Shop) h667 Hemlock Irby Prank E (Willie M) pres Irby Bros Isaf S Jos pres Standard Paper & Pa- Inc h269 Ell (SM) per Stock Co rll98 3d Irby Gilbert J delmn Rollin P Middle- Isler Chas S .ir student rl401 Oglethorpe Government brooks x2837 Houston av (SM) Isom Sami (c; Bessie) lab rll28 Broad- Bonds Irby Grace V student r604 Montpelier Irby H Clifford (Evatna H) sta mgr way Israel Fred (c; Rachel) h239 (241) Far- Standard Oil Co hlOl (151) Charles garson (V) Home Owners (SM) Israel Geo M (Lillie H) trav slsmn hl237 Loan Gorp. and Irby Irene Mrs fctywkr McAfee Candy College dr Co r South Macon Israel Geo M .ir student rl237 College dr Irby Jack sash mkr Willingham Sash & Israel Rosa H rl237 College dr Fed. Farm Mortgage Door Co plant r2837 Houston av (SM) Israel Walter elk John C Meadows r Irby Jas (Mildred) r717 Cherry Irby Janie M (wid Gilbert J) mach opr 1237 College dr Ittik Anna L Mrs lndrs h2750 Forsyth Corp. Bonds h2837 Houston av (SM) rd Irby Johnnie V student r604 Montpelier Iverson Alice (wid Robt) h520 Ocmul- Municipal Bonds Irby Julius driver O F Dovis Truck Line Irby Louis R (Jessie) driver O F Davis Truck Line hll8 (124) Charles (SM) gee Iverson Jas (Joan A) tchr PS rl21 Cole- man av (CH) Irby Mary K Mrs wrapper Liberty Can- Ivery Nellie r445 Boulevard (NH) Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 dy Co hll9 Cedar (SM) Irby Mattie (wid Marion) r807 Cherry Irby Maybelle Mrs smstrs Crescent Lndry Co r258 Washington av Irby Nora (wid Homer F) h2215 Broad- way Irby Robt (Irene) plmbr hll7 Williams (SM) Irby Thos J (Maybelle) atndt Standard Oil Co r258 Washington av Irby Wm (c; Lillian) lab hl38 (112) Bay Irby Wm O (Mary E) car inspr h604 Montpelier av Irby Wm W (Mary K) millwright hll9 Cedar (SM) Irvin Chas (c) r441 Chestnut Ives Claudia H (wid Walter D) r258 1st Ives Maude B Mrs fctywkr Happ Bros Co r826 Main (EtM) Ives Wm M meat ctr r258 1st Ivey Alise B Mrs dental asst Chas L Toole r314 Ridge av (V) Ivey Aubrey del mn rl065 Hazel Ivey Chas P (Mildred E; Dixie Shoe Re- pair Shop) rl346 College Ivey Claud rllll Ash Ivey Edw (c; Ethel) restr 123 Middle (V) rl31 do Ivey Ernest N (Annie) lab h809 Wool- folk (EM) Ivey Gladys M slswn r735 Anderson (S M) Who Sells It? Irvin Leila (c) r388 (381) Melrose (EM) Irvin Louise Oc) lndrs r220 Pear (EM) Irvin Mary (c) maid r412 Hawthorne Irvin Randolph (c; Mary) lab h201 Coles al Irvin Wallace (c; Ida) loco firemn h239 Calhoun Irvin Wm (c; Carrie) porter Ry Exp Agcy r50 Martha (EM) Irvin Wm (c) lab CofGaRy h214 Mutual av (V) Irvin Wm (c: Annie B) lab h326 Tindall av (SM) Irvine Lee (Annie; Belle Millinery Co) h51 Forsyth Irvine Margt P student r2214 Forsyth rd Irvine Wm S (Ruth B) asst supvr WmPA Ivey Henry (c; Lacey) firemn Natl HanIvedyleJeCsoseh4(c3;6 AOn'nHiea)ralalba r357 Chestnut Ivey Lester W elk Ethridge Bros rl065 Hazel Ivey Mildred Mrs slswn F W Woolworth Co rl346 College Ivey Otis (Alice) formn h2009 2d Ivey Pink P (Mae) slsmn r98 Nelson (SM ) Ivey Robt (c; Myrtice) lab h306 (603) Prince (SM) Ivey Rufus L (Iva M) bus opr Ga Pow- er Co h246 Winship (WH) Ivey Susan (wid Chas P) h735 Ander- son (SM) Ivey T Lanier (Willie W) meat ctr Leap- Is Whse h2214 Forsyth xd Irving Arth L (c) delmn r8 (123) Para- dise al trot's Mkt r258 Columbus Ivey Thos H (Mattie) store mgr Rogers Stores h757 Anderson (SM) Irving Beatrice (c) cook r8 Buckner al Ivey-Tumer Ice Cream Co (Wm C Ivey) Answered Irving Delia (c) midwife 231 Norris (E 635 Oglethorpe M) h do Ivey Walter (c) drivr 210 Moughon (V) By the Irving Eural (c; Mana) cook hl053 Ogle- Ivey Walter O (Nellie) hl065 Hazel thorpe Ivey Wm C (Gladys L; Ivey-Turner Ice Irving Henrietta (c) r231 Norris (EM) Cream Co) hll5 (118) Crisp (SM) Classified Irving Sallie M (c) maid hi 13 Tatnall Irving Sidney R (c) elk rll5 Jones Ivory Jesse (Anna B) hlpr Packard Macon Co r357 Chestnut Irwin see also Erwin Ivory Wm (c; Drucilla) lab hl32 Pecan Business Irwin Harold D usher Capitol Theatre r Ivy Dennis (c) h228 Long St la (SM) 371 1st Ivy Ernest N guard City Stockade Irwin Jas D (Laura) mgr rental dept Ivy Henry (c; Lillie) lab h332 Monroe Lists Kenmore Bums Inc hll7 Lamar (V) Ivy John H (c) r435 Elbert (SM) Isaac Zella M (c) maid r569 Monroe Ivy Lemon (c) student r332 Monroe Isaacs A McAllister buyer rl20 (149) Ivy Louise (c) r435 Elbert (SM) In this Pierce av (V) Ivy Wm (c) r435 Elbert (SM) Isaacs Dorothy cash Burns Boot Shoppe Jabo Thos (Mary) gro 670 Poplar h.805 Inc X818 Cherry apt 3 Main (EM) Directory Isaacs Jessie (wid Edw A) rl20 (149) Jabo Tobey A elk Thomas Jabo r805 Pierce av (V) Main (EM) Isabell Jas (c; Gussie) lab Macon Sup- Jacks Lee H (Alice) signalmn hl25 Rog- ply Co hl28 Williams la ers av (V) 197 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Jackson A Luneal rl05 (147) Charles (SM) Jackson Aaron (c) rl04 (6) Toombs (S M) Jackson Ada W (wid Wm A) 5h200 Buxton av Jackson Albert (c; Rena) h704 (616) Prince (SM) Jackson Albert (Dannie D) slsmn Met Life Ins Co h864 Mulberry apt 2C Jackson Albert P (c) pntr r205 Ward Jac(Vks)on Alf (c) delmn rll4 (123) Kahn's al Jackson Alice (c) rl04 Adams Jackson Alice (c) r458 Bay" Jackson Alonzo (c; Mollie) lab h325 (311) Corbin av (V) Jackson Andrew (c; Willie M) h225 (130) Fargason (V) Jacdkosnon Andrew (c) bellmn Hotel GorJackson Andrew (c; Mary) porter Leon B Parker hl04 Ruby (V) Jackson Angeline (c) h245 (649) Wo- mack (EM) Jackson Anna (c) h208 Lynwood av (V) Jackson Anna (c) lndrs h407 Forest av (V) Jackson Annie (c) r2 (350) Hanson (S M) Jackson Annie (c) lab r408 (334) An- thony (U) Jackson Annie (c) lndrs h'120 Broad- way Jackson Annie (c) maid h803 (789) Crisp (SM) Jackson Annie B (wid Joshua G) hll7 Virginia av Jackson Annie M (c) lndrs hl28 (241) Jackson Chas (c; Johnny M) lab King- man & Burnette hll N Tatnall la Jackson Chas (c) porter r72 Schofield (V) Jackson Chas W (c) lab r301 Blount Jackson Charlie M (c) cook rl52 Bay Jackson Clarence E (c; Lula) exp 858 Ocmulgee h do Jackson Claudia (c) h855 Edgewood av Jackson Claudia (c) maid r&03 (789) Crisp (SM) Jackson Cleo (e) h3 3d St la Jackson Cleone student rllO Summit av Jalc('kNsHo)n Clifford (c; Bertha) lab rl23 Bowman (EM) Jackson Clifford (c; Wilma) lab h320 (720) Lexington (EM) Jackson Clifford (c) lab r207 (104) Rob- erts (11) Jackson Cornelius (c; Mattie) carp hl21 Middle (V) Jackson Daisy (c) lndrs hl2 Graham's Lot . Jackson Danl (c; Hattie) lab r769 >(766) Ocmulgee . Jackson David (c; Gussie) h316 Cal- houn ., ,, Jackson David (c) porter Marvin s Gro Jarclkls5onTiDnodlalilel Mav ((cS)Mr)l21 Middle (V) Jackson Dora (c) r320 (318) Patterson (TvIjHts) Jackson Doreva (c) r253 Broad (EM) Jackson Doris (c) maid r328 Madison JJaacckkssoonn DDoorriiss E(c)rls0t5ude(1n4t7)r30C5haGrlreesen(IS M) Jackson Dorothy M (c) maid h305 (606) Colquitt Railroad av (V) Jackson Dosh J (c; Lillie) carrier USPO Jackson Annie M (c) maid rl242 Long hl56 Lincoln av (V) (SM) Jackson Douglas J (Margt) slsmn Jar- Jackson Annie S office sec C A Yarbrough r352 Central av (SM) Jackson Aralus (c) r2 (351) Hanson (S M) rett Paint & Glass Co hlOlT Clinton, rd ('KMD Jackson ODrennon (c) student r2 (350) Hanson (SM) =,, Jackson Ardelia (c) lndrs h20 O'Hara Jackson E S (c) earner USPO r511 la Jackson Arth (c) rl23 Washington (E M) (478) Alabama (SMI) Jackson Edgar (c) lab r309 (602) Col- quitt Jackson Arth (c) cook rlOl Tinsley la Jackson Edith waiter rl65 Spring apt 7 Jackson Arth (c: Alberta) lab Bibb Mfg Jackson Edw (c; Annie B) delmn Jas >B >CO h424 Peachtree (EM) Jackson Beni (c; Hattie) porter rl21 Middle (V) JaBckasronnesErdlw30 (c(;5) GHruadcseo)n lather h204 (167) Elizabeth (SM) Jackson Bertha (c) student rl30 (5) Jackson Edw (c; Nell) porter J Backer Hudson Fuim Co h212 Grant av (V)' Jackson Bessie (c) h317 Hammond Jackson Edw jr (c; Lee) porter rl30 (5) Jackson Bessie (c) maid hl77 2d av (V) Hudson Jackson Blanche nurse 554 Orange r do Jackson Eli (c; Beatrice) h301 Bowman Jackson Browder F mach Taylor Iron (EM) Wks & Sup Co h352 Central av (SM) Jackson Eloise sec Chiropractic Health Jascoknsonal B(uSdMdy) (c) fctywkr hl053 Wat- Home r765 Pine Jackson Eloise (wid Robt T) smstrs h Jackson Campbell N instr Ga Natl 1416 Oglethorpe Guard h401 College apt 5C Jackson Elwood electn r815 Orange Jackson Carrie (c) h208 Industrial Jackson Emma (c) hl04 Sapp av (U) Home rd Jackson Carrie (c) cook Benj F Lyles Jackson Emma (c) cook rll22 Montpelier av rl49 Hill Jackson Emma (c) cook hl36 (404) Jackson Carrie (c) lndrs hl027 Mont- Tinsley la pelier av Jackson Emmett L (Ethel L; Jackson & Jackson Carrie slswn rl411 Edgewood av Jackson) hl05 Roycrest dr apt 4 Jackson Ernest (c) delmn Moore & Jackson Carrie (c) student r354 Monroe Jackson Cassie (c) lndrs hl38 2d av (V) Boone r72 Schofield (V) Jackson Ernest (Nellie M) lab rl529 3d Jackson Cath (c) student r212 Grant av Jackson Essie M (c) r413 Peachtree (E (V) M) Jackson Chas (c) hl79 4th av (V) Jackson Estelle student r203 Fulton (S Jackson Chas (c) atndt Jas A Gordon r301 Blunt M) Jackson Ethel (c) maid h209 ( 227) Jackson Chas (c) fctywkr rl4 (750) Grant av (U) Stein's al Jackson Ettie B (c) maid r2 (350) Han- Jackson Chas (c; Sarah) lab hl09 (217) son (SM) Hawkins av Jackson Chas (c; Julia) lab rl24 Syca- more (V) Jackson Eug (c: Claudie) cook hill (10) Orchard av Jackson Eug (c) lab r862 Foster's al DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 198 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Jackson Eug (c; Annie) lab hi02 4th (B) Jackson Eug (c; Anna) porter rT70 Ash Jackson Eug W driver Yellow Cab Trans & Baggage Co r858 New Jackson Eula (c) lab h02 (516) Cowan (EM) Jackson Eula (c) lndrs rl06 (150) Eliza- beth (SM) Jackson Everett (c; Rosa B) hi 19 E Ell Jackson Everett (c) lab r305 Green Jackson Fannie (c) hl89 Gordon (CH) Jackson Fannie M (c) maid hll3 E Ell Jackson Florence (c) maid rl027 Mont- pelier av Jackson Florine C (c) tchr Green St Sch h232 3d av Jackson Florine M (c) elk r232 3d av (V) Jackson Floyd (Rosa) auto mech h619 Spring Jackson Floyd jr student r619 Spring Jackson Frances (c) lndrs hi Coleman al Jackson Frank (c) lab rl206 Broadway Jackson Frank G (c) r232 3d av (V) Jackson Fred (c; Nettie) lab h52 (62) Schofield (V) Jackson Fred A (Bessie) mach hl23 Parkwood av Jackson Gene (Anna L) baker Collins Baking Co r216 Telfair Jackson Geo (c; Lizzie) r321 McClain la Jackson Geo (c) rl81 (173) North av (NH) Jackson J Elwood (Macon Neon Sign Co) r815 Orange JACKSON J GUY (Ruth), Genl Agent Guarantee Mutual Life Co, 3d Floor First Natl Bank Bldg 409 2d, Tel 1142, h785 Hillyer av, Tel 640-R (For further information see left top lines) Jackson J M student r815 Orange JacJakcskosnonJ) Mrlill7larVdirg(Linoiuaisea;v J(aVc)kson & Jackson Jas (c) rl79 4th av (V) Jackson Jas (c) dish washer Sami In- gram r75 Spring Jackson Jas (c) ins agt r412 (716) Campbell av (SM) Jackson Jas (Bessie) lab h647 Pebble (S Ml) Jackson Jas (c; Vivian) millwkr Bibb Mfg Co rl45 Forsyth la Jackson Jas jr student r647 Pebble (S M) Jackson Jas B (Ruth) cond h783 Patter- son (NHts) Jackson Jas E (Annie) carp hlOl RuthJaecrkfsoornd Jaavs O(SMre)prmn Ga Power Co Jackson Jas O (Marguerite) slsmn hl23 Lamar (.V) Jackson Janie (c) student r445 Douglas av (V) Jackson Jennie r204 (203) Main (EM) Jackson Jennie (c) r364 Bay Jackson Jenny (c) r204 (305) Norris (E M) Jackson Jesse (c; Rilla) h205 Booker's Jackson Geo (c) hl08 Wise av (V) Jackson Jesse (c) rl04 (724) Wayne's al Jackson Geo (c) lab h7 Cheatham al Jackson Geo (c) lab rl30 (5) Hudson Jackson Geo C (Nora) trav slsmn h201 New Jackson Geo G ftr Macon Gas Co r620 (SM) Jackson Jesse (c) chauf r367 Madison Jackson Jesse (Annie) emp Riverside Cemetery h72 Schofield (V) Jackson Jesse L (Mattie S) driver h210 2d (300) Dempsey av (U) Jackson Geo L r925 (926) Cherry Jackson Geo W (c; Mary) r509 Edison Jackson Jessie M (c) student r72 Schofield (V) (EM) Jackson Georgia (wid Jos B) h212 Adams Jackson Geraldine tchr PS rl23 ParkJawckosoodn aGvertrude (c) tchr PS rl22 Green Jackson John (c; Dora) h862 Foster's al Jackson John (c; Eugenia) millwkr Bibb Mfg Co hl02 Wise av (V) Jackson John (c; Ruby) orderly h318 Calhoun Jackson John (c) pdlr r300 Waterville rd Jackson Gladys sten r860 Mulberry Jackson Gordon L (Sarah B) slsmn Taylor Iron Wks & Sup Co h218 (216) [Berkley dr Jackson Gracie (c) r366 Robinson rd Jackson Gussie lndrs Crescent Lndry Co r316 Calhoun Jackson Harriet r426 Jackson Jackson Hattie (c) hlQ25 3d Jackson Hattie (c) maid hi Bear's al Jackson Hattie (c) maid h801 (701) crisp (SM) Jackson Helen (c) lndrs rl79 4th av (V) Jackson Henrietta (c) r606 (321) Charles (SM) Jackson Henry (c; Gertrude) lab CofGa Rv h400 (531) Hall (EM) Jackson Henry (c; Julia) lab h328 Madison Jackson Henry (c) shoe shiner O K Shoe Shop r831 Academy (EM) Jackson Henry G (Mattie L) hl05 (147) Charles (SM) Jackson Henna (c) smstrs WPA rl Bear's al (V) Jackson Ida (c) maid r214 Gantt pi Jackson Ida M (c) maid rl27 Park Hotel al Jackson Ira M (c) r305 (606) Colquitt Jackson Irene (c) lndrs h2l6 (556) Moore la Jackson Irvin (c) lab rll5 Tindall av (S M) Jackson J Andrew (Lena) pres JacksonWynn Co hllO Summit av (NH) Jackson John (c; Willie) porter r210 (153) 2d (U) Jackson John student r401 College apt 5C Jackson John F (Mattie B) policemn h 443 Jackson Jackson John H (c; Clara) h345 Bright '(:SM) Jackson John L (Evelyn) asst store mgr Rogers Stores r930 Walnut Jackson John L (c; Millie) lab r702 i(320) Colquitt Jackson John R (c) lab r70 Schofield (V) Jackson John S (Gladys A) formn Ga Power Co h33`7 Carling av Jackson John S jr student r33T Carling av Jackson John W (c; Rosie) h367 Madison Jackson John W ir (c) cook r367 Madison Jackson Jos (c; Margt) lab Barfield JaFckeseodnMJiollss (hcl;07InPezri)ngploert(eErMrl)lS (254) Railroad av (V) Jackson Jos E (Helen) emp 'CofGaRy h425 Winship (WH) Jackson Joshua R (Ostell) restr 806 Hazel hl411 Edgewood av Jackson Julia (c) lndrs rlOO Mutual av (V) Jackson Katie (c) fctywkr h52 Haw- tihame Jackson L J (c; Mary I) lab r862 Fos- ter's al 199 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 Jackson Larkin (c; Florida) janitor h 509 Edison (EM). Jackson Laura (wid J Milford) r225 High Jackson Leila (c) h263 Madison Jackson Leila (c) drsmkr 104 (4) Or- chard av h do Jackson Lela M (c) hl06 (301) Magnolia Jackson Lena (c) lndrs rlT9 4th av (V) Jackson Lena B rll7 Virginia av Jackson Lenus (c; Sellie) hlOl (403) Randall av (NH) Jackson Leonard (c; Annie) lab h325 Ernest (CH) Jackson LeRoy (c; Lorena) porter hl22 (260) Singleton's la Jackson Lessie (c) cook r221 Moughon (V!) Jackson Lewis (c) hi Parker s la Jackson Lewis (c) lab rl08 Ruby (V) Jackson Lillie (c) cook rll2 Edgewood av Jackson Lillie (c) lndrs hllo Tindall av (SM) Jackson Lillie M (c) r222 Orange Jackson Lizzie (c) lndrs h354 Monroe Jackson Lloyd (Evelyn) elk r930 Wal- nut Jackson Lloyd student Ga Academy for the Blind r RD 1 Moultriel Jackson Lonnie (c; Jeanie M) lab h300 Waterville rd Jackson Lonnie (c; Ellen) lab h307 Gil- mer JacHkasnosnonLo(uSiMs )(c; Carrie B) h2 (350) Jackson Louis L (Hattie) eng h850 Courtland av Jackson Louise (c) r36 Clayton (V) Jackson Louise (c) r79 Forest av (V) Jackson Jackson Lovie Lucille (c) maid (c) rl52 hB34a0y1 Gilmer Jackson Lucille (c) rill (10) Orchard av Jackson Lucy (c) rl21 Edgewood av Jackson Luev (c) lndrs hll6 (16) Ala- bama (SM) Jackson Lucy (c) lndrs hl29 Wood al Jackson Lula (c) maid r217 Orange Jackson Lydie (c) h!52 Bay Jackson Maggie (c) h237 (243) Fargason Jackson Malinda (c) cook r328 Madison Jackson Mallory P mgr Douglass The- atre h717 1st Jackson Malsena (c) lndrs rl42 Brook- lyn av (S) Jackson Mamie (c) rl02 5th av (B) Jackson Mamie (c) cook r333 Monroe Jackson Mamie (c) maid hl20 Franklin Jackson Mamie student r208 (293) Bur- ton av Jackson Marguerite L office sec Sam S JaCckhsaonndlMeraIrniash A(gc)cyhr2l59317BrColaindto(nEMrd) Jackson Marie (c) r305 (606) Colquitt Jackson Marietta r204 (203) Main (EM) Jackson Marion agt Liberty Natl Life Ins Co r226 College Jacr2k0s2on(1M02a)rshBaalllkcmoimllwakvr B('iEbMb )Mfg Co Jackson Martha (c) lndrs h237 (121) Moore la Jackson Martha (c) lndrs r rear 819 Oc- mulgee Jackson Mary (c) h305 Green Jackson Mary (c) lndrs hl436 Broadway Jackson Mary (c) maid r300 Waterville rd Jac(NksHo)n Mary student rllO Summit av Jackson Mary J (c) cook r2 Sparks al Jackson Matthew (c) lab rl206 Broad- wlay Jackson Matthew (c) student r858 Oc- mulgee Jackson Mattie (c) r371 Robinson rd Jackson Mattie J (c) lndrs h371 Robinson rd Jackson Maude (c) rl313 1st Jackson McKinley (c; Camilla) lab h421 Liberty (SM) Jackson Mead (c; Minnie) lab h2 Sparks al Jackson Mead jr (c) lab r2 Sparks al Jackson Mildred (c) lndrs Crescent Lndry Co rlOl (119) New Street al Jackson Milton M r324 Forsyth Jackson Minette (c) hairdrsr r308 Clarks av (V) Jackson Minnie (c) maid rl63 Coles al Jackson Mitchell J (c; Mary) hlOlO Clinton rd (EM) Jackson Monroe (c; Alberta) lab r316 Walnut Jackson Monroe (c; Hazel) lab h203 Ward (V) Jackson Moses (o) lab' h3'66 Robinson rd Jackson Nehemiah (c) dairywkr Dixie Dairies rl77 2d av (V) Jackson Nehemiah (c; Rosie) lab h264 Madison Jackson Nora B (c) hl39 Roosevelt av (V) Jackson Ola M (c) rl21 (120) Orchard av Jackson Ollie R (c) tchr rl04 (164) Bartlett Jackson Oscar F (Rosa M) mech Steve M Solomon jr r619 Spring Jackson Ossie (c) lndrywkr r208 (306) Elizabeth (SM) Jackson Ostell Mrs smstrs Gds Co hl411 Edgewood Uavn1 ion Dry Jackson Otis (c; Lula) lab h570 Chappell (SM) Jackson Otis (Dorothy) millwkr Bibb Mfg Co hl36 Comer ter (M) Jackson Otis (c; Mattie) shoe repr r421 Liberty (SM) JJaacckkssoonn POettiesr M(c;maFcrahncCeos)fGalRaby h413 Peachtree (EM) Jackson Queen (c) lndrs hl2 Plant al Jackson Redmon (Helen) elk r860 Mulberry Jackson Rentha (c) r740 Edgewood av Jackson Richd (c; Vallie) lab hl53 For- syth la Jackson Richd (c; Jessie) lab hll22 Montpelier av Jackson Robt (c; Annie) rl24 (126) Ce- dar (U) Jackson Robt (c; Laverne) lab r7 Buck- ner al Jackson Robt L (c) hll8 (114) Gibson av (SM) Jackson Robt T student rl416 Ogle- thorpe Jackson Roberta (c) lndrs hll31 (1225) Napier av Jackson Rosalie (c) maid rlOO Johnson (SM) Jackson Rosie (c) tchr r367 Madison Jackson Ruby (c; Sarah) lab r587 (20) Siam (EM) Jackson Rubv (c) lndrs rl22 Brooklyn av (S) Jackson Ruby (c) maid rl30 (5) Hudson Jackson Sarri bell boy Hotel Macon rll5 JaJcoknsoens Sami (c; Annie) lab CofGaRy h415 (356) Maynard (EM) Jackson Sami (c) rl52 Biay Jackson Shuler L Rev (c; Ella) h522 Calhoun Jackson Sol (c; Tee) porter hll5 (298) Craft (V) Jackson Stokely (c; Lillie) porter Arcade Billiard Parior h321 Jefferson Jackson Susie (c) h501 (401) Gantt City rd (SM) Jackson Susie (c) h460 Hazel Jackson Susie M (c) maid rl47 (210) Nussbaum (SM) Snow's Laundry and Dry Gleaning Go. Licensed "Sanitone" Gleaner Phone 6000 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES BURKE'S 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L, Polk & Go. Publishers 431 Howard St. Detroit 354 4th Are. New York 200 AUTHORIZED DEALER R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 Jackson Sylvester L (Fannie M) carp h 222 Knott (SM) Jackson Terrell J (c; Cornelia) hl244 Jac(7k7s0o)n BTrhooasd (c(;EMLi)zzie) h215 Roosevelt av (V) Jackson Thos (c; Mattie) lab h80O Cow- an (EM) Jackson Victoria (c) smstrs r305 (606) Colquitt Jackson Viola (c) rll4 (113) Powell (E Ml) Jackson W E inspr Fire Dept r560 Ogle- thorpe Jackson W P elk Hotel Macon r315 Mul- berry Jackson W Gladstone (Lillian B) sec- treas Macon Milling Co h204 Burton Jackson Walter (c; Johnny O) rll2 Spring Jackson Walter (c; Saxilla) lab hl21 (120) Orchard av Jackson Walter B (c) r237 (243) Farga- son (V) Jackson Wesley (c; Lula) carp h631 Fort Hill (EM) Jackson Wiley P trav slsmn h401 College apt 4C Jackson Wm (c) h606 (321) Charles (S M) Jackson Wm (c) rll3 'Clara (EM) Jackson Wm (c; Willie B) hl02 (2) Fulton al Jackson Wm (c) r303 (205) Waterville rd Jackson Wm (c; Mary) lab h510 E Academy (EM) Jackson Wm (c) lab h223 (564) Disroon al Jackson Wm (c; Mary) lab h626 (26) Gilmer Jackson Wm (c) lab r30 (27) Reid (S M) Jackson Wm P (c; Ida) carp hllO (266) Brief (V) Jackson Wm R office 617 Mulberry R303 Jackson Wm W (c; Carrie M) lab hl005 3d I Jackson Willie (c) r253 Broad (CM) Jackson Willie M (c) maid r606 (321) Charles (SM) Jackson Willis (c) solr h445 Douglas av (V) Jackson-Wynn Co J Andrew Jackson pres Geo O Wynn sec-treas whol dry gds 301 Poplar Jackson Zadie (c; Fannie) lab CofGa Ry hl94 Gordon (CH) JACKSON & JACKSON (J Millard and Emmett L Jackson), Lawyers 201 Bibb Bldg 403 Cherry, Tel 2241 Jacobowitz Abr E (Nettie; Jake's Shoe Store) hl37 Nottingham dr (NH) Jacobowitz Sadie Z slswn Darling Shop r 961 Cherry Jacobowitz Sara (wid Jake) r961 Cherry Jacobs Edwin G (Virginia F; Jacobs Pharmacy) h318 Vineville av (V) Jacobs Edwin G ir elk r318 Vineville av (V) Jacobs John J student rll'5 Buford pi JACOBS PHARMACY (Edwin G Jacobs), 502 Mulberry, Tel 1271 Jabcoebrts STmhaorst AClo(tAhilnicge CGo) Invc-phrells5HBeur-fotrd pi Jacobs Thos A jr (Mildred) lawyer 566 Mulberry R14 hl26 Buford pi Jacobs Virginia tchr r318 Vineville av (V) Jainer Claude (Gwendolyn) court reporter h311 Buford pi Jake's Shoe Store (Abr Jacobowitz) 568 Poplar Jamerson Sallie L (wid Earl) r671 2d Jamerson Walker (Lillian) driver Power Oil Co r720 1st James A J (c) ins agt r314 (326) E 2d (EM) James Ada A rl03 North av (NH) JaOmleivseAr leaxv (c(S; MA)lthie) driver h71 (130) James Amos (c; Bessie) lab rl27 (543) Railroad av (V) James Andrew (c) agt Afro-American Life Ins Co r326 2d (EM) James Andrew (c) lab r230 (233) Cedar (U) James Annie (c) Indrs h228 Jordan's al (SM) James Annie (c) Indrs r409 Richard (W H) James Annie D r340 Vineville av (V) James Annie D (wid Wm E) h340 Vine- ville av (V) James Benj W (Evelyn) elk h660 For- syth James Chas carp Ga Academy for the Blind r Log Cabin Heights James Cherry (c) Indrs h321 5th av (V) James Clara (c) maid r5 Violet av (S M) James Claude (c) lab r246 Dempsey av (M) James Coleman (c; Bertha L) lab r rear 22 (243) New Street la James Corinne (c) maid r321 5th av (V) James Dorothy (c) cook rl09 Key (U) James Earlie (c) maid hl68 (136) Nuss- baum (SM) James Erastus fctywkr r500 Edgewood av (SM) James Eva (c) Indrs rl30 Roosevelt av (V) James Eva (c) maid hl30 Roosevelt av (V) James Evelyn (c) cook rl20 (212) Rail- road av (V) James Evelyn Mrs elk Union Dry Gds Co r660 Forsyth James Fannie (c) cook h212 Fargason (V) James Florence (wid Wm B) millwkr Atlantic Cotton Mill rl20 Roye (CH) James Gary (c) r226 Powell (EM) James Hattie (c) maid hlO (78) De Borde (SM) James Hazel (c) Indrs rllO 10th av James Helen smstrs Union Dry Gds Co xl55 2d James Henry (c; Ida L) porter Ry Exp Agcy hl59 Lincoln av James Henry (c; Marzella) sta firemn h 441 Chestnut James Homer E carp h722 Walnut James Howard (c; Tommie) plstr h211 5th av (V) James J E (Bessie) millwkr Bibb Mfg Co r722 Walnut James Jesse (c) lab h209 Patterson (N iHts) James Jimmie millwkr Bibb Mfg Co r 722 Walnut James John hlpr Buck Ice & COal Co r 221 Patterson (NHts) JaMmeest JLoifhen IHns (RCoosahl9in6d OMsb)oransest pmi gr James John R (c) r303 Gordon (CH) James John W (Minnie S) battery mgr Goodyear Service Stores h215 Virginia James John W (Lucie) millwkr Bibb Mfg Co hl63-64 Gardner (PM) James Julius (c; Salie) lab r253 Moughon (V) James Laura (c) Indrs h315 Burnett (E M) James Lewis (c) rl44 E Ell James Lizzie L (c) h307 Womack (EM) James Louise (c) Indrs rail (1004) Dempsey av (N) James Louise (c) maid r500 Edison (E JaMme) s Louise J Mrs sec-treas James & Kingman Lbr Co MILLIONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 James Lucien L (Vivian) supt Happ Bros Co hl08 Boulevard (NH) James Lucille (c) lndrs h329' Barfield al James Lucinda (c) h226 Powell (EM) James Lumber Co Robt L James mgr mill ft Poplar James Mabel (c) presser Snow's Lndry & Dry Clng Co rll3 (529) Campbell av (ISM) James Mack (c) lab r962 Ocmulgee James Malinda (c) h207 Patterson (N Hts) James Malinda (c) maid r323 Green James Marvin (c; Ruby L) lab h213 (143) Virgin la (V) James Mary (c) h311 Hazel James Mary (c) lndrs rl30 Roosevelt av Jam(Ve)s Mary L Mrs (c) emp Snow's Lndry & Dry Clng Co rl63 (231) Elbert ' (SM) Jamgeees Maybelle (c) maid r962 OcmulJames Minnie Mrs millwkr Atlantic Cotton Mills hll4 (109) Dewitt (EM) James Moses S (c; Ella) carp h303 Gordon (CH) Jam(2e46s) NCobolwe aJn (c(;JIMM)ary) blksmitti h247 James Oscar (c) porter hl6 Pulton al James Patsy (e) lndrs rl30 Roosevelt av (V) James Paul (c) blksmith 3707 Houston av (SM) r Tamworth James Perry L ship elk Bibb Mfg Co r 106 (111) Balkcom av (EM) James Ralph (c; Mary L) hl025 College dr James Raymon L (Effie) mill wkr Bibb Mfg Co hl67 Gardner (PM) James Robt L mgr James Lbr Co r Gray James Rome (c; Lucy) rl44 E Ell James Ross (c) porter American Oil Co r Ocmulgee la James Sharp (c; Claudie M) r212 Mutual av (V) James T Cleveland (Mabel) supt hl03 North av (NH) James Thos (c) lab hlC8 3d av (U) James Vera cash Ritz Theatre rl08 Boulevard (NH) Jamales(NWHa)lker (c; Katie) lab rll3 Walls James Walter (c; Estelle) hl014 Elbert (SM) James Walter W (Aline M) policemn h415 Virginia av James Wesley (c; Mary L) lab rl63 (231) Elbert (SM) James Wm A (Lucy M) bkpr Burden Smith & CO hl06 (111) Balkcom av JamClensgWCmo Arl0jr6el(k11S1n)owB'salLkcnodmry &avDry Jam(Ve)s Wm E (Sarah) elk hll6 Pierce av James & Kingman Lumber Co Mrs Louise J Thames sec-treas whol ft Poplar Jamison Ella (c) cook r204 Cedar (U) Jamison Lillian (c) lndrs h215 Collins Japml ison Sarah (c) h513 E 2d (EM) Janes Carrie M (c) cook r539 Plant al Janney Clara B r637 Forsyth Janney Earl H elk Happ Bros Co r637 Forsyth Janney Geo W (Lula M) h637 Forsyth Janney Hazel e slswn F W Woolworth Co r637 Forsyth Janney Helen M waiter F W Woolworth Co r637 Forsyth Janney Lamerle student r637 Forsyth Janney Mary F nurse 637 Forsyth r do Janney Virginia L student r637 Forsyth Janney W Durwood (Martha) r511 Vineville av (V) Jaques Building 407 Broadway JaqCuoesr SSRhiarlnedyolHphillpsres Juliette Milling Jardon Chas J (Louise B) loco firemn h2503 Broadway Jarratt Jas P (Dorothy) elk h701 Walnut Jarratt Margt private sec WPA rl34 Magnolia Jarratt W Devereaux (Eliz) hl34 Magnolia Jarratt W Devereaux jr student rl34 Magnolia Jarrel John A (c; Annie J) driver h465 Log Cabin dr Jarrell Albert A (Dora) loco firemn h417 Chappell (SM) Jarrell Dorothy r417 Chappell (SM) Jarrell Jas (c: Valie) farmer r490 Log Cabin dr Jarrell Johnnie L waiter Spiller's Restr r 208 2d Jarrell Martin L (c) rl06 Price (V) Jarrell Minnie L (c) tchr rl06 Price (V) Jarrell Robt pdlr r555 2d Jarrell S J (Salleylu) wtchmn Ga Aca- demy for the Blind rl501 Vineville av Jarrell Salleylu Mrs supvr Ga Academy for the Blind rl501 Vineville av Jarrell Thos J Rev (c; Nancy) hl06 Price (V) Jarrett Addie (c) r330 Dempsey av (U) Jarrett Arth (c; Leola) carp hllOl Log Cabin blvd Jarrett Chas K (Cora L S) mgr Wofford Oil Co plant hll4 Nelson (SM) Jarrett Curtis (c; Cynthia) r502 Charles (SM) Jarrett Hattie (c) lndrs h513 E Academy (EM) Jarrett Hattie (c) lndrs hll4 (113) Powell l(EM) JARRETT HENRY K (Ida G; Jarrett Paint & Glass Co), h2505 Forsyth rd, Tel 6550 JJAarRreRtEt TJTerPryAIN(ITda&) Gr2L50A5SSFoCrOsyt(hHerndry K Jarrett), Home of Sun-Proof Paint and Proof Products 320 3d, Tels 22002201 (For further information see right side lines and page 25 Buyers' Guide) Jarrett Walter (c; Emma) hll03 Lgg Oabin blvd Jarvis Arth L mech Firestone Auto Sup & Serv Stores r Central Hotel Jarvis Dorothy student rl53 Crescent av (CH) Jarvis Elmer L (Nell M) food inspr County Bd of Health hl53 Crescent av (O H) Jeeter Seaton (c; Della) lab hll8 Rock av Jefferson Adolphus (c) r602 3d av (U) apt 3 Jefferson Annie (c) hl48 (146) Bay Jefferson Annie M (c) lndrs r318 1st av (V) Jefferson Apartments 605 Orange Jefferson Bertha (c) cook rl232% Broadway Jefferson Bessie (c) student r552 Monroe Jefferson Chas (c; Lillie) lab hlOl (437) North Street la Jefferson Cleveland (c: Frankie M) lab r rear 104'Bookers al Jefferson Elbert (c) lab h410 Chestnut Jefferson Eloise (c) r212 Powell (EM) Jefferson lEnos (c: Louise) lab r552 Monroe Jefferson Geo (c; Anna) mill wkr Bibb Mfg Co rl76 (160) Plummers al Jefferson Graham atndt Wofford Oil Co r697 Hillyer av Jefferson J Albert (c) lab r500 (451) Alabama (SM) Jefferson Lewis (c) porter Jas A Braswell Jefferson Lillian (c) maid rlOl (437) North Street la Jefferson Lois (c) rl48 (146) Bay Jefferson Mary (c; wid Elijah) h260 2d av (V) Jefferson Millie (c) lab h319 Division (T) YOUR CITY D I R JE C T O R Y MIRRORS the SOCIAL Life Of Your CITY 202 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES 11445 Plymouth Jefferson Richd G (Myrtle C) formn C of G Ry h697 Hillyer av (CH) Jefferson Riley (c) rl48 (146) Bay Jefferson Robt J Rev (c; Evlena) pastor MtMoriah Baptist Church h212 Powell (EM) Jefferson Robt L (c) rlOll Elbert (SM) Jefferson Sol (c: Mary) lab h500 (451) Alabama (SM) JEFFERSON STANDARD LIFE INSURANCE CO, Wm Worth Williams Mgr, A Jefferson Standard Policy Is A Declaration of Independence for The Family, 310 First National Bank Bldg, 409 2d, Tel 64 Jefferson Walter (c) student r520 Calhoun Jefferson Willie M (c) maid rl21 Army Lot Jeffrey Robt (c; Mary) hl24 (262) Singleton's la Jeffreys Edw G v-pres-treas JeffreysMcElrath Mfg Co h548 Ridge av (V) Jeffreys-McElrath Mfg Co Wm H Jeffreys jr (Chase City Va) pres Edw G Jseecffrbeoyxs vm-pfrress-rteraears2J3o0h0nFMorMsycthElrradth Jeffries Ike (c) lab r317 Hammond Jelks Albert A (Doris O) ostephathic phys 516 Mulberry R519 h219 Nottingham dr (NH) Jelks Alf (c: Louise) labh813 (856) Cowan (EM) Jelks Doris O Mrs tchr Weslyan Conservatory h219 Nottingham dr (NH) Jelks Lenora rll4 Hines ter (V) Jelks Mary S (wid Jas O) hll4 Hines ter (V) Jemison Demelia (c) lndrs rlOO 1st av (V) Jemison Eliz rl223 Oglethorpe Jemison Helen (c) r314 Jefferson Jemison Jeannette (wid Wm F) hl223 Oglethorpe Jemison Lannie H (wid Robt W) h687 College Jemison Lola M (c) r314 Jefferson Jemison Lola M (c) maid rlOO 1st av (V) Jemison Mary L (e) lndrs rl37 (139) 4th av (V) Jemison Mims student rl223 Oglethorpe Jemison Wm (c; Carrie) lab hl37 (139) 4th av (V) Jenkins Agnes (wid Robt) rll8 Willingham (EM) Jenkins Alvin student rl26 Knott (SM) Jenkins Andus H (Pauline H) slsmn Collins Baking Co r378 Orange Jenkins Annie maid Hotel Southland r 113 Ash Jenkins Annie student rl707 2d Jenkins Annie waiter The Polar Bear r 1707 2d Jenkins Berta r2555 Broadway Jenkins Carrie E (wid Thos J) r291 Rutherford av (SM) Jenkins Chas R waiter Spider's Restr r 2337 2d Jenkins Earl F (Maude) cond h2931 Houston av (SM) Jenkins Elbert (Rita L; Bearings Supply Co) hl22 Merritt av (I) Jenkins Elbert jr elk Crescent Lndry Co rl22 Merritt av (I) Jenkins Emma C r2555 Broadway Jenkins Ernest L (Eula) live stock dir h 1707 2d Jenkins Fannie (c) h485 Chestnut Jenkins Frances beauty opr Billie Tyler r663 Walnut Jenkins Frances C' Mrs fctywkr Happ Bros Co rl26 Knott (SM) Jenkins Glenn (Annie M) fctywkr Happ Bros Co r233 Chappell (SM) Jenkins Grady L (Clyde) mach CofGRy h877 Orange Jenkins Grover L fctywkr Happ Bros Co trll8 Willingham (EM) Jenkins Hannah (c) r555 Monroe Jenkins Henry (c; Alma) hlpr CofGRy hll2 (145) Railroad av (V) Jenkins Henry jr (c) lab CofGRy rll2 (l45)Railroad av (V) Jenkins Henry A (Birdie) cond h3001 Houston av (SM) Jenkins Homer L (Mattie) dept mgr The Storage Battery Co h206 Ridge av (V) Jenkins Horace (c) rll22 Broadway Jenkins Jacob (c: Lula) lab h703 (207) Colquitt Jenkins Jane (c) h401 (415) Mitched al Jenkins John (c: Anna) h206 Douglas av (V) Jenkins Jos elk r422 Ross Jenkins Jos H car inspr MD&SRR h2555 Broadway Jenkins Josephine (c) h4 (315) Hanson (SM) Jenkins Lon (c; Della) pdlr h480 Log Cabin dr Jenkins Louise (c) lndrs h357 Chestnut Jenkins Lucide (c) cook rl35 Middle (V) Jenkins Luther A (Frances C) elk hl26 Knott OSM) Jenkins Mabel (c) lndrs r4 (315) Hanson (ISM) Jenkins Maggie (c) confr 515 Cotton av r356 Patterson Jennektitn-sOMdoamjorC(oc; hD2a7is7y)thice puller KinJenkins Marvin W (Mary L) pntr hl02 Rocky Creek rd Jenkins Mary (c) t314 4th av (VD Jenkins Maude Mrs cash Citizens Loan Co r2931 Houston av Jenkins Oscar J emp CofGRy Jenkins P L (Ruth C) baker Collins Bak- ing Co r RD 2 Jenkins Pinkie r2555 Broadway Jenkins Robt (c) lab hll6 (10) Fulton al Jenkins Rufus F elk r422 Ross Jenkins Sami G (Josephine P) wtchmn h 2003 Broadway Jenkins Selma (c) fety wkr r,107 Rose Crest av (SM) Jenkins Thos (c) r409 Colquitt Jenkins Thos A car repr CofGRy Jenkins Thos J (Verna H) h291 Ruther- ford av (SM) Jenkins Thos J driver John A Chapman r291 Rutherford av (SM) Jenkins Wilde E (Mary) h207 Ridge av (V) Jenkins Wilde E (Mabel P) elk South- eastern Exp Co h233 Bond apt 2 Jenkins Wm (c: Lillie M) lab h710 Charles (SM) Jenkins Wm A dentist 516 Mulberry R608 h401 College apt 3H Jenkins Wm J (Leila) cond h246 Ell (S M) Jenkins Willie (c) maid rl44 (246) For- syth la Jennings Albert H mgr Adams-Buchanan Motor Co rl06 Cleveland av Jennings Bertha (c) cook r335 Monroe Jennings Dorothy slswn F W Woolworth Co r414 Vineville av (V) Jennings Eliz elk r416 Montpelier av Jennings lEva H (c) hl09 2d av (V) Jennings Frances sten Central City Bag Co r414 Vineville av (V) Jennings Mansfield M (Grace R) dep elk County Municipal Ct hl34 Virginia av Jennings Robt G (Evelyn) h414 Vineville av (V) Jergensen Axel J chemist r201 Vista cir Jerkins Agnes (wid Robt L) rll8 Willing- ham (EM) Jerkins Grover L prsr Happ Bros Co rll8 Willingham (EM) Jerkins Lula A rl21 Willingham (EM) Jerles T Elmer (Sallie) dept mgr rj.53 Hugenin Jerry Carrie (c) lndrs h220 Green Jesse Dorothy (c) student r379 Board- man's al 203 WILLINGHAM SASH & DOOR CO. Lime - Roofing Cement -- Plaster 457 Third St. Phones 277-278-279 Jesse Robt (c; Annie) lab h379 Board- man's al , , ,,,,,, _ Jessie Avania (c: Louisa) lab hi17 Bras- well la ,, Jessie Minnie L (c) cook rll7 Braswell Jessup C Plickman (Mary L) mldr Taylor Iron Wks & Sup Co hl30 Daley (SM) Jessup Lucius (c; Marie) lab rl21 (10) Tinsley pi Jessup Lula (c) maid h305 Blount JesGsurepnaSdhaeptheerrd J (Lillie) slsmn hl33 W Jessup Stella F (wid Wm M) r421 For- syth Jeter Mattie (wid Danl W) hllO Mag- nolia , , Jetter Otha rl017 Pio Nono av (V) Jewell Alven (c) maid rl43 Moore al Jewr5i1n MLioloiare (cla) cook Kitchen's Kitchen Jinks Janie (c) h732 Hazel Jinks Lula (c) lndrs h921 Fort Hill (E M) Joanis Marian Mrs nurse 125 Curry pi '(NH) h do Joanis Wm C (Marian) dentist 617 Mul- berry R208 hl25 Curry pi (NH) Jobson Arth B (Lillie) hl07 McGee (C JobPs)on Lillie J Mrs slswn Burden Smith & Co hl07 McGee (CP) Jochson Jas W agt Pilgrim Health & Life Ins Co r716 Campbell av Joc&hsLoinfeWInilslisC(oOhp4a4l)5 aDgtouPgillgasrsim Health Johannesen Otto (Pauline) slsmn r215 Balkcom av (EM) Johns Bartow (Rose) carp h280 Main (E M) Johns Dewey (Pauline) h533 Orange apt 10 Johns J Clyde (Beatrice E) auto mech h 153 Hugenin av Johns Rosa (c) lndrs r706 (205) Colquitt Johns W Dewey (Carr & Johns) r53'3 Or- ange apt 10A JJoohhnnssoWn mA (cA:lbSetretlla()Lulalab hG20) Mprueslb-mergryr Johnson Bros hl06 Osborne pi Johnson A Bernard (Lucille) trav slsmn r911 Orange Johnson Abner J (Clebie) trav slsmn Dunlap-Peeler Hdw Co h712 Vineville av (V) Johnson Ada (c) cook r309 Middle (V) Johnson Adam (c; Adeline) lab rSO Wil- der (SM) JoNhnussosnbauAmdeli(nSeM)(c) maid rl53 (218) Johnson Adeline (c) mill wkr Bibb Mfg Co hl4 (563) Witkowskis la Johnson Albert (c: Louise) rl35 Brooklyn av (S) Johnson Albert (c) lab rll6 Edwards (U) Johnson Albert (c) lab r325 Madison Johnson Albert (c) lab CofGRy JoPhenasroln Albert R (Frankie E) mach hl25 Johnson Alberta (c) lndrs h23 (110) New Street la Johnson Aldene electn Morris Putzel r252 Church Johnson Alf (c; Cora) chauf hl56 4th av TVl) Joh(SnMso)n Alice (wid John R) rl33 Gordon Johnson Allen D (Tempie) loco firemn h 1108 Napier av Johnson Allene (c) r403 (100) Texas (S M) Johnson Alton A (Emmie) rl7 Hill Park Joh(EnMso)n Amelia (c) hill (3) O'Neal's al Johnson Amy (c: East Side Funeral Home) h601 (600) Fort Hill OEM) Johnson Andrew L (c; Rosa) plstr h36 (536) Clayton (V) JoWhnassohninAgntodrnewavT (Johnnie C) carp h206 Johnson Anna (c) hl2 Harris al Johnson Anna (c) h240 Harris al Johnson Annie (c) h259 Walnut Johnson Annie (c) cook rl20 Park (U) Johnson Annie (c) maid r314 2d av (V) Johnson Annie slswn rl29 Virginia av Johnson Annie I tailor Karl V Zemlich r Joh12n9soVnirAgninniiae Kav(c) r451 E Academy (E M) Johnson Annie L smstrs r525 Jackson Johnson Anthony (Susie) driver Taylor Iron Wks & Sup Co rill Walls al (N H) Johnson Arth (c) delmn Oscar H McAfee r231 Jefferson Johnson Arth (c: Mazie) lab h201 Camp- bell av (SM) Johnson Arth (c; Ola) lab h6 Grahams Lot Johnson Arth (c: Bessie) lab h204 (622) Williams (EM) Johnson Arth L mill wkr rl04 (11) Dun- can av , ,, Johnson Arth M real est 105 Cotton av R Joh15nsholn02AMrtharRsha(lcl; aPvearl) brklyr h257 Woodcliff Johnson Aurelia (wid Chas B)s rl02 Mar- Joshhnaslol navBarney L ship elk American Bakeries Co r460 New Johnson Beatrice (c) maid h204 Woodcliff Johnson Bemon (c; Mamie) lab hl34 Moughon (V) Johnson Beni (c; Clara) lab Bibb Mfg Co h227 (217)' Elliott (EM) Johnson Beni (Annie B) lab Taylor Iron Wks & Sup Co h641 Pebble (SM) Johnson Ben) A (Dorothea M) v-pres- treas Johnson Bros h361 Orange Johnson Bennie (c: Eva) lab h582 Whitehall Johnson Berner R (Frances) agt Natl Life & Accdt Ins Co h280 Orange Johnson Bertha (c) r215 Middle (V) Johnson Bertha (c) cook h201 Grant av (V) Johnson Bertha (wid Edgar M) h718 Hemlock Johnson Bessie r760 1st Johnson Bessie (c) lndrs h722 (353) JoWhnhsiotneheBaodnnaile D Mrs hl28 Knott (S M) Johnson Booker T (c) fctywkr r403 (100) Texas (SM) Johnson Bromer L (Estelle Z) mill wkr Willingham Cotton Mill hl4 (86) Randolph pi Johnson Bros A Albert Johnson presmgr Beni A Johnson v-pres-treas Blanche Leary sec furn dlrs 461 2d Johnson C Finley (Gertrude C) bgemstr h310 Beech av Johnson Calder B pipe ftr hill 2d' Johnson Camilla (c) rl233 Dempsey av (U) Johnson Carrie (c) cook r699 Ocmulgee Johnson Carrie (c) lndrs h337 Board- man's al Joahlnson Carrie (c) lndrs h20 Cheatham Johnson Carrie (c) maid h222 Orange Johnson Carrie (c) maid rl South Boundary Johhinllsolna Carrie B (c) cook hl22 Rock- Johnson Cath (c) maid r214 Tindall av (SM) Johnson Cecil (c: Cleva M) hill Harris Johnson Chas (c: Mable) driver h220 Hilliard al Johnson Chas (EvelyiD fctywkr Bibb Mfg Co h6 (5) Lake City (EM) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume it. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 204 oo Q U bJ UJ GO Tf tcoo s- zU sH? 3B S ft* e o -wV V. k >> FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Johnson Chas (c; Cora) janitor Hotel Macon 1x236 Orange Johnson Chas lab r753 3d Johnson Chas (c: Cora L) lab Central Sash & Door Co 1x297 Harris Johnson Chas (Maxie) mill wkr Bibb Mfg Co h2 Schell av (EM) Johnson Chas W sec-treas Dunlap-Peeler Hdw Co rl04 Alabama av (V)' Johnson Chas W (Bonnie I) trav slsmn Johnson Edw J sta mgr Liberty Service Sta rl09 Oak av Johnson Edw L driver Mrs Beulah M Poppell Johnson Effie (c) lndrs rl60 College Johnson Effie (c) maid rlO Sparks al Johnson Ella (c) lab r437 Middle (EM) Johnson Ella Mrs h714 3d Johnson Ellen Mrs smstrs r665 Ash Johnson Elnora (c) lndrs r920 Pio Nono h518 Napier av av (V) <2 Joh(Uns) on Cherry (c) lndrs hll6 Edwards Johnson Emma (c) lndrs h440 (453) Shook al (EM) E*J 0 14 >* *55 - Xsow ittnoo Johnson Christine student r507 Beech av Johnson Cladice (c) maid rll8 (83) Bay Johnson Clara Mrs r213 Applewood (E M) JoMhnfsgonCCo lahr4e0n3ce(4(c0:1)LuBlaa)ymill wkr Bibb Johnson Clarence student r371 1st Johnson Clarence E bkpr James A Smith r371 1st Johnson Clarence E (Lucille) firemn M D & S RR h213 Peachtree (EM) Johnson Clayton T (Dovie) driver r652 Pine Johnson Clebie Mrs mus tchr 554% Mul- berry h712 Vineville av (U) Johnson Cleo (c) lndrs r201 Grant av (V) Johnson Clevie M (c) maid rl215 3d Johnson Clinton (Thelma) mach opr r 1704 2d Johnson Clyde D (Magdalene) mill wkr Johnson Emma (c) maid hl06 (147) Holt la (V) Johnson Emma G (c) student rl60 2d av (V) Johnson Emma M (c) maid Suzanne Dress Shop rl (7) Spring Johnson Emmie Mrs checker rl7 Hill Pk Johnson Ernest (c: Cleo) lab 1x303 Gil- mer Johnson Ernestine (wid John W) gro 412% Montpelier av h412 do Johnson Erwin student r207 Ridge av (V) Johnson Esther tel opr Happ Bros Co r RD 1 Johnson Ethel (c) lndrs h809 (223) Crisp (SM) Johnson Ethel (wid Homer) mill wkr Bibb Mfg Co rl022 2d Johnson Ethel M (c) r6Q2 3d av (V) apt 4 Willingham Cotton Mill r3 (2) Kinnett (V) Johnson Clyde P (Agnes) slsmn h226 Edna pi Johnson Eunice (c) lndrs r308 (601) Prince (SM) Johnson Eva (c) maid h240 4th av (V) Johnson Evelyn (c) tchr Green St Sch r Johnson Clyde Y (Lois) elk Dunlap- 160 2d av (V) Peeler Hdw Co r506 Church (EM) Johnson Ezell (c) janitor County Court Johnson Colquitt C (Mary) bkpr, Happ House Bros Co rl24 Log Cabin blvd Johnson Fannie (c) h218 Gantt pi Johnson Cora (c) cook hl21 (21) Wil- Johnson Fanny (c) h337 Booker's al liams la Johnson Fate (c; Charsie) lab h519 Ross Johnson Cora C (c) prin Antioch School Johnson Felix (c) porter rl07 (121) Long rl56 4th av (V) la Johnson Corinne (c) maid r245 2d (U) Johnson Cornelius (c) delmn r231 Jeffer- son Johnson Ferrell N (Willena S) sec-treas Meaders Mattress Co r Overlook blvd Johnson Florene (c) lndrs rl Buckner Johnson Curtis L rl28 Knott (SM) al Johnson Daisey (c) lndrs hlOll Ogle- Johnson Floyd (c; Amanda) lab h707 (3) Who Sells thorpe Johnson Daisy B (c) r421 E 2d (EM) Johnson Danl (c: Bessie) lab h803 Oc- mulgee Johnson David (c: Nellie) lab 1x811 (854) Crisp (SM) Johnson Foster (c; Matilda) lab h279 2d av (V) Johnson Frances (c) student rl06 (147) Holt la (V) Cowan (EM) Johnson Frances Mrs bkpr The Storage It? Johnson Delbert fctywkr Bibb Mfg Co r Battery Co h280 Orange 358 Spring Johnson Frank student r412 Montpelier Johnson Delia (c) pantry girl Hotel Johnson Frank Rev (c; Mattie) pastor Lanier rlOl Franklin Robinson Tabernacle A M E Church h Johnson Della (c) maid 1x213 Ocmulgee 32 (532) Clayton (V) Johnson Dennis (c) lab r951 Pio Nono av Johnson Frank H (Macon Optical Co) b (V)' 120 Forest Hill av IS Johnson DeWitt (Mary) electn h618 Main Johnson Frank J (c; Lizzie) lab hlOS (EM) Curd's al Johnson Dimon (c; May B) h402 Peach- Johnson G Everett (Margt) mach opr Answered tree (EM) Macon Butter Co rlll5 (1114) Napier Johnson Dollie (wid Wm O) rl06 Enter- Johnsoix Gains M (Myrtice) auto mech r By the prise (SM) 121 School (SM) Johnson Dora (c) cook h217 (857) Moore Johnson General (c; Ella) lab hl53 (218) la Classified Johnson Doris (c) r9 Berthadale dr (V) Johnson Douie opr SBT&TCo r652 Pine Nussbaum (SM) Johnson General (c; Minnie) lab rill (543) Tinsley la Johnson Earl (c) lab r226 (43) Virgin la Johnson General (c; Sarah L) millwkr Business (V) Johnson Earl student r356 Fairview av Bibb Mfg Co h241 4th av (V) Johnson Geo (c) r718 3d av (V) (EM) Johnson Geo (c; Edna) lab hlOO E Ell Lists Johnson Edgar (c) cook Chas S Smith r 14 (563) Witkowskis la Johnson Edgar (e; Minnie) lab h205 Lin- Johnson Geo (c) lab rl06 (147) Holt la (VI) Johnson Geo (c) porter Horace L Dixon In this coln av (V) r9 (1) Moore al Johnson Edgar (c; Lillie M) porter r306 Johnson Geo (c) porter Weldon W Brown Directory 1st av (V) Johnson Edna waiter rill 2d Johnson Edw (c: Lula) lab h821 3d Johnson Edw F (Nellie) carp hl35 Park r5 Murray al Johnson Geo E student rll08 Napier av Johnson Geo F (Julia) mach hl974 3d Johnson Geo M (Louise) slsmn hll3 Bu- Pi ford pi 205 A. T. HOLT CO. >- c n REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Johnson Geo M jr order picker McKesson-Riley Div rll3 Buford pi Johnson Geo W (c; Naomi) porter Flynt's Barber Shop h614 Washington av Johnson Geraldine elk r369 (349) Hydrolia (EM) Johnson Gifton (c; Leitha) r506 E Academy (EM) Johnson Gilbert msngr r665 Ash Johnson Gladys student rl7 Hill Park av Johnson Grace (c) lndry wkr rl075 Pio Nono av (V) Johnson Grant (c) lab hl54 Brooklyn av Joh(Sn)son Gus H (c; Lillie P) millwkr Bibb Mfg Co h47 (44) Green's la Johnson Gussie (c) maid hi 14 Bostic la Johnson H Albert (Dorothy) slsmn r223 Joh(2n5s7o)n PHeaLcehetre(Jeoe(EEM) )carp h202 Nina- dell dr Johnson H Vernon mgr Rialto Theatre r 104 Pierce av (V) Johnson Hanna (c) hl24 Walker la Johnson Hanna (c) lndrs hll4 (123) Kohn's al Johnson Hannah (c) h364 Elm Johnson Hannah (c) cook h325 Madison Johnson Hardy (c) lab h911 (908) Ocmul- gee Johnson Harvey L (Maude) atndt rl52 High Johnson Hattie (c) r403 (100) Texas (S M) Johnson Helen r415 Oak Johnson Helen (c) maid r328 Monroe JJoohhnnssoonn HHeelleenn (sct)udsteundternlt0r927R9e2mdbaevrt(Vav) Johnson Henry (c) rl46 E Academy (EM) Johnson Henry (c; Lillian) driver B F Merritt Coal Co h405 (406) Crisp (SM) Johnson Henry (c) lab r646 4th av (W H) Johnson Herman (c: Bessie) lab r22l8 Mc- Clain la Johnson Herschel W (c: Herschel Mer- chant Tailor) h821 3d av (V) Johnson Hodge (c) student r508 (526) Maynard (EM) Johnson Holley L (Cora) carp hl338 2d Johnson Homer (c; Jessie) lab r458 City Hah la Johnson Howard H student r275 Boule- vard (NH) Johnson Howard L slsmn The Kuhn Mfg Co r660 Walnut Johnson Howard M (Laura) pres Nu Icy Bottling Co Inc h275 Boulevard (NH) Johnson Ida (c) h307 (604) Colquitt Johnson Ida (c) cook r602 3d av (V) apt 4 Johnson Ida (c) lndrs hl06 2d av (V) Johnson Ida (c) maid h209 5th av (V) Johnson Ida (c) maid r408 E 1st (EM) Johnson Ida B (wid Jas) smstrs h315 Columbus Johnson Ida F (c) student rl24 (226) Green (V) Johnson Ida G (c) tchr PS hl24 (226) Green (V) JJoohhnnssoonn InIneezz(c()c)colonkdhrs25h82O58ranHgiell ISatlla Johnson Irene Mrs millwkr Atlantic Cot- ton Mills r38 Atlantic Village Johnson Isaac (c) lab r543 Mitchell (E M) JoNhnsToantnIasallacla(c; P Mae) lab h214 (128) Johnson Isaac K (c; Annie) lab h506 Fort Hill (EM) Johnson Iva (c) cook r920 Pio Nono av Johnson J E (Myrtle V) designer Idle Hour Nurseries r218 Spring Johnson J Harry (Mamie) hi04 Pierce av Johnson J Herbert student r456 Carling Johnson j Howard (Ethel) auto mech. h Johnson J Howard (Helen) auto mech Bibb Body & Fender Wks h552 Pine Johnson J Lison (Ida) h764 Anderson (S M) Johnson Jacob (c) lab r718 3d av (V) Johnson Jacob (c; Mamie) lab Macon Supply Co h351 Church al (SM) Johnson Jas (c; Rachel) car washer Steve M Solomon Jr h727 Ocmulgee Johnson Jas (c) lab r473 Chestnut Johnson Jas (c: Eloise) lab rll9 (112) Green (V) Johnson Jas (c: Mary) lab hl27 (5439 Railroad av (V) Johnson Jas (c) lab r401 Waterville rd Johnson Jas (c) pntr r231 Jefferson Johnson Jas D (Lillian) framemkr Cen- tral Sash & Door Co h356 Fairview av (EM) Johnson Jas L r231 Washington av Joh(EnMso)n Jas W (Pennie) h304 (303) JOHNSON JAMES W JR (Ruth), SecTreas Macon Telegraph Publishing Co, hl24 Birch (N Hts), Tel 1155-W Johnson Jerusha Mrs r467 Cotton av Johnson Jessie (c) lndrs h805 (804) Ballard (EM) Johnson Jessie (c) maid r460 City Hall la Johnson Joe E Mrs sec Police h202 Ninad'ell dr Joahlnson John (c) lab rl3 (131) Malloy's Johnson John (c; Tessie M) lab hl016 Ocmulgee JJoohhnnssoonn JJoohhnn ((cc;) Llaizbzieh)24m5 il2lwd k(rUB) ibb Mfg Co hl49 Ballard (EM) 'Johnson John (c) porter Clark Drug Co r803 Willow Johnson John B (Lillian) hlpr MD&SRR r820 2d Johnson John C (Ethel) mach CofGRy hl009 Montpelier av Johnson John C jr student rl009 Montpelier av Johnson John D (Nettie) slsmn h223 (257) Peachtree (EM) Johnson John G msngr Postal Tel-Cable Co r605 Ash Johnson John H (c; Theo) lab h2 Alexander Jodhnr son John H (c) ydmn h222 Berkley Johnson John L student r255 Orange Johnson Johnnie (Clellie; Johnnie John- son Beauty Supply Co) h650 Ridge av to MAILING LISTS Complete Accurate for Any Locality Johnson Johnnie Beauty Supply Co (Johnnie Johnson) 511 2d Write for Johnson Jos (c) r204 Texas (SM) Johnson Jos (c) butler 951 Pio Nono av Catalog (V) Johnson Jos (c) lab h504 (505) Edison (E "Mailing Lists M) Johnson Jos (c: Phoebie) lab h951 Pio That Pull" Nono av (V) JoMhn)son Jos (c) lab r728 (638) Prince (S It's Free Johnson Jos (c) lab r718 3d av (V) Johnson Jos (c: Willa) pkr Willingham Sash & Door Co h451 E Academy (E M) R. L. POLK Johnson Jos jr (c) lab r951 Pio Nono av (V) & GO. Johnson Jos B millwkr Atlantic Cotton Mills h38 Atlantic Village Directory Johnson Jos E (Marie) hl04 Marshall Johnson Jos E (c; Mattie) lab CofGRy h'528 Monroe Publishers Detroit, Mich. Johnson Josephine (c) rl06 (913) Walls al (NH) Johnson Jule porter Frank Roberts r224 J Chappell la Johnson Julia r852 1st Johnson Julius (c: Lennett) swtchmn h We make up Special Lists 460 Broad (EM) I, 206 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Johnson Julius M elk Crescent Lndry Co Jorhln9s5onEnJgulilsiuhs aSv ((VE)llene) slsmn rl95 English av (V) Johnson Kate (c) waiter r224 Jefferson Johnson Kath S (c) tchr Ingram B S Sell r304 Cedar (U) Johnson L Hilton (Lutie; Johnson Phar- macy) h99 Vineville av apt PI Johnson LaFayette H (Bessie B) chf elk Ga Power Co h809 Beech av Johnson Langley C millwkr Willingham Cotton Mill rll8 (9) Holt av (NHts) Johnson Laura (c) cook hl04 Randall al (NH) Johnson Laura (c) lndrs hll6 Rockhill la Johnson Laura (c) maid r207 Clayton (V)' Johnson Laverne r276 Willingham (EM) Johnson Lee (c; Emma; formn h638 Hammond Johnson Lee hlpr MD&SRR r352 Fairview av (EM) Johnson Lee (c; Ida) lab City h312 (311) Short (EM) Johnson Lee J (c; Clifford) barber Ger- trude Smith h301 (300) Crisp (SM) Johnson Lelia (c) h304 Cedar (U) Johnson Lelia (c) lndrs r432 Coles al Johnson Leonard (c) lab rl208 Broadway Johnson LeRoy (c; Aurelia) h402 Pea- cock (SM) Johnson Leroy R (Mildred) millwkr Bibb Mfg Co hi27 Comer ter (PM) Johnson Leslie (Cora B) elk rl670' 3d Johnson Letha (c) cook r225 Roosevelt av Joh(Vns) on Lewis C (c) lab r245 2d OJ) Johnson Lewis C (Maggie) trav slsmn h 139 Oakland av Johnson Lillian (c) fctywkr r233 Telfair Johnson Lillie (c) cook r855 Smith row Johnson Lillie B (c) h65 New Johnson Lillie M (c) lndrs hl08 (119) Cedar (U) Johnson Lillv (c) lndrs rl06 Grant av !(S) Johnson Lizzie M (c) lndrs h207 Coles al Johnson Lois (c) student rlOl Armond av (U) Johnson Lonnie elk r460 New Johnson Lonnie (Lula) lab h525 Jackson Johnson Lonnie millwkr Bibb Mfg Co r Joh12n7soCnomLoenrntieerH(P(MM)ary L) hl04 (11) Duncan av Johnson Lora (c) maid rl06 2d av (V) Johnson Louise tchr PS rl22 Jefferson Johnson Lucille (c) cook hll4 (557) Mag- nolia la Johnson Lucille E Mrs fctywkr Happ Bros Co r20O7 3d Johnson Lucinda (c) h920 Pio Nono av (V) Johnson Lucius (c: Arnita) porter Macon Teleg Pub Co h321 Middle (V) Johnson Lucius L (Lula) sawyer r276 Wil- lingham (EM) Johnson Luella L emp Snow's Lndry & Dry Clng Co r437 Middle (EM) Johnson Lugenia (c) lndrs r412 (331) Elizabeth (SM) Johnson Lula M r559 2d Johnson Luther (c) lab h204 Texas (S M) ' Johnson Lynwood K (Elsie G) designer Idle Hour Nurseries h89 Osborne pi Johnson Maggie (c) h403 (188) Texas (S M) Johnson Maizie r2632 Broadway Johnson Major (c) lab r88 Wilder (SM) Johnson Malcolm (c) r859 Edgewood av Johnson Mallye sec to pres Wesleyan Coll Forsyth rd at Wesleyan Sta Johnson Mamie (c) cook r435 North (V) Johnson Margt opr Ethel B Davis Beauty Shop r232 Georgia av Johnson Margt Mrs millwkr rills (1114) JoNhnaspoienr Mavargt Mrs waiter P W Wool- worth Co Johnson Marguerite r468 New Johnson Marian fctywkr Carstaphen r 181 (182) 'Clinton (1EM) Johnson Marie dish washer P W Wool- worth Co Johnson Mark (Ella) confr 550 Pine h do Johnson Marshall H atndt Tip Top Serv- ice Sta rl31 Gordon (SM) Johnson Martha (c) r751 Ash Johnson Martha (c) hllO New Johnson Martha r223 (257) Peachtree (E M) Johnson Martha (c) h404 E 2d (EM) Johnson Martha L (c) student r245 2d (U) Johnson Mary (c) h256 4th av (V) Johnson Mary (c) cook r245 2d (U) Johnson Mary (c) lndrs hl28 (494) Vir- gin (V) Johnson Mary (wid Zacharias) r652 New Johnson Mary L (c) maid rl8 Sparks al Johnson Mary M student r255 Orange Johnson Mary N Mrs slswn Burden Smith & Co rl24 Log Cabin blvd Johnson Matilda W (c) tchr Hazel St Seh r279 2d av (V) Johnson Mattie (c) hl63 (231) Elbert (S M) Johnson Mattie (c) tchr Ga Academy for the Blind Johnson Maurine priv sec WPA r RD 2 JoShnmsiothn Mrdaxie Mrs millwkr Bibb Mfg Co h2 Schell av (EM) Johnson May (c) cook r267 (367) Rail- road av (V) Johnson May (c) lndrs r420 Peachtree (E M) Johnson Millie (wid Francis M) r358 Spring Johnson Minnie (c) h748 Edgewood av Johnson Minnie (c) lndrs h226 (126) Edi- son (EM) Johnson Minnie (c) maid h224 Jefferson Johnson Miriam student r456 Carling av Johnson Mitchell (c: Lilia) lather hll5 (98) Long la/ Johnson Molly (c) hl88 Sapp av (U) Johnson Morris (c: Marie) lab hl82 Mu- tual av (V) Johnson Moses (c) lab rl63 (231) Elbert l(SM) Johnson Mozie M (c) dish washer Benj F Lyles r258 Hill al Johnson Nancy H student rl25 Pearl Johnson Naomi waiter rl231 2d JoThninsdoanllNaavtha(nSiMel) (c: Aurora) lab hl98 Johnson Nellie fctywkr Happ Bros Co r 135 Park pi Johnson Nellie (c) maid 951 Pio Nono av (V) Johnson Nettie (c) student rl07 (121) Long la Johnson Nina F (wid Chester) r533 Or- ange apt 5 Johnson Nonnie (c) maid rl215 3d Johnson Nora Mrs h.660 Walnut Johnson Obie (c: Ambrosia) firemn h554 Hazel Johnson Odessa L (c) tchr PS rill Wood- cliff Johnson Opal M Mrs r207 (11) Dannen- berg av Johnson Ophelia (c) cook r rear 2336 For- syth Johnson Orman E (Laura) brklyr r565 De Borde OSM) Johnson Oscar electn hlpr Morris Putzel r RD 4 Johnson Paul (c) lab rl86 (28) Clara (E M) Johnson Paul (Pearl) loco eng hll6 Mag- nolia 207 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Johnson Paul E meat ctr Home Market JoChnosorln2i3P1et2edr (c) h432 Peters al (EM) Johnson Pharmacy (L Hilton Johnson) Jo3h6n0soHn aPrhdielmipaEn a(Fvrances) lab hl!9 Ell (SM) Johnson R Aldean (Mary) electn h214 Joh(2n6s4o)n CRhuFrlcehmi(nEgM()Fleta H; Ruan & Co) r Shirley Hills Johnson Rachel F (c) lndrs h.718 3d av (V) Johnson Ralph (c) lab r26 Buckner al Johnson Raymond A (Virginia B) sec- treas C'orbin Supply Co r RD 3 Johnson Rebecca (c) maid h243 2d av (V) Johnson Richd (c) lab h610 (54) Crisp (SM) Johnson Richd student r280 Orange Johnson Richd W student r255 Orange Johnson Riley (c; Lucille) lab rill Tin- dall av Johnson Robt (c) rll4 Gaillard (V) JoshenysoanvRo(Ubt) (c; Anna) lab hl716 DempJohnson Robt (c) lab rll6 Edwards (U) Johnson Robt (c; Marie) lab r232 Wood- cliff Johnson Robt (c) loco firemn h712 (127) Hall (EM) JoShonlsoomnoRnoJbrt (rC61a7rriDeeBm)pspenytravSteve M Johnson Robt D msngr CofGRy Johnson Robt H (Thelma D) mach h624 JoDhnusnocnanRaovbt L (c) h339 Gilmer Johnson Rosa (e) 200 Industrial Home rd Johnson Rosa (c) lab rl65 May av (U) Johnson Rosa (c) lndrs h309 Middle (V) Johnson Rosa B (c) maid r611 Hazel Johnson Rosalie (c) lndrs h65 Forest av (V) Johnson Roy E (Berta M) lab h903 Clin- ton (EM) Johnson Ruby L (c) h31l (504) Plummers al Johnson Rufus (c) lab rl03 Neel (IT) JoMhnfsgonCoRhulf3u6s ((1B3e1s)sieM) amynilalrdwk(rEMB)ibb Johnson S Guy (Lelia) meat ctr General M Harp r99 Clayton (V) Johnson Sallie (c) cook h407 (167) Craft la (V) Johnson Sallie (wid Aug R) r669 Court- land av Johnson Sami (c) auto mech r243 2d av (Vf) Johnson Sami (c; Mary) lab h201 Neel Johnson Sami (c) lab Delk Saw & Knife Works r214 Jones Johnson Sami (c: Willie) lab Willingham Sash & Door Co r216 Fulton (EM) Johnson Sami trav slsmn r375 College JJoohhnnssoonn SSaarraa ((cc)) mmaaiidd r3h1502 CNoelwes al Johnson Sara F student r518 Napier av Johnson Sara W opr SBT&TCo h355 New Johnson Sarah (c) maid r753 3d JJoohhnnssoonn SSeialabsieRselvsm(nHer2le6n9') Hpaarsdtoemr vaninaev- ville Methodist Church (South) h247 Vineville av (V) Johnson Sonnie (c; Mabel) porter Taylor Furn Co h610 4th av (V) Johnson Steph (c; Susie) lab Citv h3!71 Flanders (EM) Johnson Susie R Mrs beautician Flynt's Barber Shop h305 Forsyth Johnson Susie W Mrs slswn 255 Orange Johnson Suzanna (c) lndrs rl20 (213) Frank al Johnson Sylvester B (Eva R) millwkr Bibb Mfg Co h207 American blvd Johnson Thelma Mrs r455 Carling av Jochlnifsfon Theresa (c) maid rl08 Wood- Johnson Thos (c; Rosina) lab hl22 Brooklyn av (S) Johnson Thos (c; Ollie) lab h207 (205) Campbell av (SM) Johnson Thos (c) lab h rea rl23 Washington (EM) Johnson Thos (Lessie) meat ctr hl231 2d JoGhnRsyonhTilhloBs uAck(iEngdhnaam) mpsi tr(Vm) ech Cof Johnson Thos C (Daisy D) trav slsmn h 507 Beech av Johnson Thos R (Mamie L) slsmn Arn- old's Shoe Parlor h456 Carling av Johnson Verna M r3 (2) Kinnett (V) Johnson Virginia (c) maid r524 (497) Hill Crest av (CH) Johnson Voline (c) cook r202 Woodcliff Johnson Walter N (c: Evelyn) tailor 425 Cotton av hl60 2d av (V) Johnson Walter T (Clara: Moore John- son & Thomas) hl22 Jefferson Jorh3n7s1on1sWt ayne J distr elk Ga Power Co Johnson Wiley M (Mamie) millwkr Wil- lingham Cotton Mill h54 Holt av (N Hts) Johnson Willena S office sec Equitable Life Assur Soc of the U S r Overlook blvd Johnson Wm (c; Evelyn) h652 Coleman al Johnson Wm (c) h29 Reid (SM) Johnson Wm (c) lab rl54 Brooklyn av (S) Johnson Wm (c; Queen) lab h304 (450) Elizabeth (SM) Johnson Wm (c: Eva) lab r231 Jefferson JJoohhnnssoonn WWmm ((cc:) Mlaablirnld0a7) (l1a2b1)hlL65onMg alya av (U) Johnson Wm (c: Hattie) lab h24 7th Johnson Wm (c: Virginia) lab hi South Boundiary Johnson Wm (c: Mattie) lab Barfield Feed Mills h3 5th av (V) Johnson Wm (Annie) lab Builders Lbr Co r257 Yates al Johnson Wm (c) lab CofGaRy r213 OcJohmnuslogneeWm (c; Sarah) lab Macon Gas Co hl06 (6) Alabama (SM) Johnson Wm (c) millwkr Bibb Mfg Co r 4.7 (44) Green's 1st Johnson Wm (c: Charlotte) porter h203 JoNhnosrothnwWestmB(ocu:ndLaerlyia) porter Dunlap Chevrolet Co r200 Bowman (EM) Johnson Wm pres Phi Delta Theta Fraternity 1219 Oglethorpe Johalns(oEnMW) m (c) student rill (3) O'Neal's Johnson Wm B (c) lab r412 (331) Elizabeth (SM) Johnson Wm C (Minnie) slsmn r269 Hardeman av omnium! wm jr icusie; wruer nzoo ange Johnson Wm G (Bessie) city policemn h 1421 2d Johnson Wm H r813 Main (EM) Johnson Wm H (c: Willie) lab hll6 Raff Home av (V) Johnson Wm I millwkr Bibb Mfg Co h 128 (52) Hydrolia (EM) Joh60n9so3nd Wavm j(V()c: Lillian) carrier PO h Johnson Wm J (c) lab r245 2d (U) Johnson Wm J (Addie) millwkr Willingham Cotton Mill h3 (2) Kinnett (V) Johnson Wm L (c) lab rl60O 1st Johnson Wm L (Leila) mill wkr rl02 Brookdale av (B) Johnson Wm P rl04 (11) Duncan av Johnson Wm P (Rebecca) carp h506 Church (EM) Johnson Willie delmn Kinnett-Odom Co Johnson Willie restr 176 Hazel h do Johnson Willie Mrs h460 New JoMhnfsgonCoWhilllile6 (c(:13L4)auHrao)ltmliallw(kVr) Bibb DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 208 g ' *, --, Leslie Edw D (c; Annie) Jab h2Sft233) . Cedar (U) Xu Leslie Eva (c) h974\ Pio , Ncjjfuf. dv (V) Lester Maurice A (Mary L) slsmn h720 Anderson (SM) Lester Robt M (Annabel) chf dispr Sou Ry System h707 Birch (NHts) Lester gobt R Rev (c; Mary F) h981 Fort Hill ('EM) Lester Robt W printer rl26 Mill av Lester Rosa (c) cook h917 Clinton rd (EM) Lester Rosa L (c) lndrs hl21 Lexington / (EM) /Lester Rufus E (Sarah E) sta mgr Gulf "iefg Co h505 Duncan ay, Lelter Thos (c) rll29 (1226) Napier av Lester Walter E wood 819 Broadway h 8l9% do Lester Wm (c; Minnie) atndt h784 Rey- nolds? ttl Lesbef Wm (c; Mattie C) porter Gulf - Oil- Cork h699 Ocmulgee LiSsfer Willie D (c) elev opr Hotel Grady vLetSiluleuWr aCshPingrt3o0n1 (CEhMe)rry ILeSueur Margt (wid Napoleon B) r520 i.--, 'Orange apt 5-6 Letson Will firemn Ga Academy for the Blind rl501 Vineville av Lett Wm J (Irene T) agt Natl Life & Leslie Geo H ( lie B)jtliickmn City Water Wi op r^ff Willingham LeMslifeg HCoomehr22L9 ((G52l)ennMiea)ynfiarredmn(EBMi)bb Leslie Howard (c) r244 1st av (V) LeLsleiee I(rEeMne) mill wkr Bibb Mfg Co rl56 Leslie Jas (c) delmn Ross Bros h244 1st av (V) Leslie Jas (Anna L) emp CofGaRy r244 1st av (Pleasant Hill) Leslie Jos (Mary) millwkr Bibb Mfg Co r301 Center (EM) Leslie Lena R Mrs h96 (95) Yates av (EM) Leslie Maggie (c) student r244 1st av (V) Leslie Oscar lab r96 (95) Yates av (E M) Leslie Paul millwkr Bibb Mfg Co r716 Main (EM) ... , LeMslifeg WCaoltehr24L2 (HByedrrthoali)a m(EilMlw)kr Bibb Lester Chas (c) rl47 Forsyth la Lester Chester A (Maude L) h58 (13) RQff Home pi Lester Cora (c) hl04 Bookers al Lester Daisy (c) cook hl02 (1-2) Haw- kins av Lester Daisy (c) cook hl40 Jones Lester Ella (c) lndrs rl96 Elliott (EM) Lester Essie (c)' student r812 Ocmulgee Lester Etta M (c) maid r814 Ocmulgee Lester Eug (c) delmn r324 1st av (V) Lester Felton (c; Hannah) lab hl03 Bookers al .... Lester Frank (c) r981 Fort Hill (EM) Lester Geo (c) porter r812 Ocmulgee Lester Glenn R (Evelin L) formn Collins Baking Co rl62 Magnolia Lester H Effie (wid Marvin L) h717 Courtland av Lester Henry (c) hlpr Moffett Transit Line r812 Ocmulgee Accdt Ins Co h221 Tatnall Letter Shop The Clifford A McKay pres 563% Mulberry Lettice Edwin (Mattie M) elk Happ Mfg Co hl30 Summit av (NH) Levens Lance (Delaine) sub sta opr h 1076 Walnut Leverett C Moran slsmn Dannenbearg Co rlll4 Oglethorpe Leverett C Preston rlll4 Oglethorpe Leverett Carlton A h340 White (SM) Leverett Cullen C (Minnie L) capt Fire Dept hlll4 Oglethorpe Leverett Edw (Annie A) lab hl09 Capi- tal av Leverett Geo r340 White (SM) Leverett Jas L driver Sterchi Bros Stores Inc r208 Grenada ter Leverett John A (Sarah E) agt Indus- trial Life & Health Ins Co hlOl Lamar (V) Leverett Metta V (wid Chas) r208 GrencLdcL ter Leverett Walter B (Bertha M) bus opr Ga Power Co h213 Henry (SM) Leverette Lucius (Rose) ship elk Dixie Dairies h3900 Houston av (SM) Leverette Mary E tchr r696 Courtland av Leverette Oscar C bartndr Hotel Dempsey Tap Room r696 Courtland av Leverette Oscar E (Mary E) bkpr Dunlap-Peeler Hdw Co h696 Courtland av Levie Otis H cotton broker 516 Mulberry R406 h401 College apt 7-1 Levine David P (Lena; Levine Tire & Parts Service) h!19 Boulevard (NH) Levine Helen opr SBT&TCo rll9 Boulevard (NH) LeHvi)ne Isaac student rll9 Boulevard (N Levine Jos (Mary) r406 Forsyth Levine Lillian recording elk Superior Court r310 Cherokee av f 73 O t BO pi 2a9T apjMo. 73 W m CL C/S *g a > r us 5! pi 73 3 a n w DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in. formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 230 CO p a U g ft* gen jI 5r m m<5i ro\ < CO A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Levine Tire & Parts Service (David P Levine) 100 5th Levison Robt L (Julia E) asst mgr Friedman's Jewelers h533 Orange apt Lewis Jefferson (c) elk r406 Robinson rd Lewis Jefferson (c; Leila M) hlpr h675 Dunlap al Lewis Jennie (c) maid h319 2d av (V) Leviston Perry (c) r716 3d av (V) Lewis A Belle (wid Aaron) rl70 Virginia av Lewis Albert (c) porter Morris Putzel r 218 Jefferson Lewis Amanda (c) cook rll5 Tindall av (SM) Lewis Anna (wid Robt) r311 Main (E M) Lewis John (c; Lula M) lab r455 E Academy (EM) Lewis John (c; Katie) lab h606 4th av (WH) Lewis John (c; Lillian) lab hl24 (2) Spring la Lewis John (c; Josephine) millwkr Bibb Mfg Co h21S Gantt pi Lewis John E pntr h915 Elm Lewis John H (c; Julia L) lab hllO Lewis Annie (c) student r216 Division (T) Lew(NisH)Annie B (c) cook hl06 Randall al Lewis Annie M (c) lndrs h322 E 2d (E M) Lewis Arth (c; Mary) lab Builders Lmbr Co hl04 (248) Johnson's al Lewis Arth (c; Viola) millwkr Bibb Mfg Co h531 Flanders (EM) Lerw2isWBoeoddfoclridff (c) porter Minute Lunch Lewis Bernard M slsmn Johnson Bros h 209 Oak Haven av Lewis Bessie (wid Wm T) rl09 3d Lewis Bessie V (c) maid hl50 New Ward (V) Lewis John H pntr r518 Pine Lewis John W (Ruby E) formn hl73 Vir- ginia av Lewis John W jr student rl73 Virginia Lewis Jos (c) r316 (321) Bowman (EM) Lewis Jos (c) h207A Division (T) Lewis Jos (c) hl2 Ross St pi Lewis Jos (c) delmn Wm J Gruhn rl46 Astor Lewis Jos pntr rll5 5th av (SM) Lewis Josephine (c) r407 (330) Elizabeth (ISM) LebweirsryJulRia2n10S h(7J1o7hnVniieneLv)illiensa5v16 (MV)ulLewis Katheline r321 Shamrock Lewis C Arth (Martha A) lawyer 566 Mulberry R3 h930 College apt 4 Lewis Carrie B (c) maid r rear 342 Bookers al Lewis Christian (c) r322 E 2d (EM) Lewis Lee (c) janitor Sou Mortgage Co Inc r953 Ocmulgee Lewis Leonard (c; Maggie) lab h405 (305) Waterville rd Lewis Lessie (c) hll28 Broadway Lewis Clarence H (Ida) pntr hll5 5th av (SM) Lewis Claude M (Ruby L) elk hl04 1st (SM) Lewis Levi L (c) h309 Broadway Lewis Lillie B (c) rl05 Fulton (EM) Lewis Lilly B (c) prsr Snow's Lndry & Dry Clng Co r440 Dunlap (EM) Lewis Cleo (c) maid r753 3d Lewis Clyde R student rll5 5th av (S M) Lewis David (c) r620 Pebble (SM) Lewis Edw C (Annie C) mech Otis Ele- vator Co hl2i Appleton av Lewis Eliz (q) smstrs r748 Edgewood av Lewis Emma (c) h406 Robinson rd Lewis Esther B Mrs sten Sam S Chand- ler Ins Agency r866 Mulberry Lewis Ethel (e) cook rl034% Broadway Lewis Eulis (c; Viola) lab CofGaRy h604 (518) Cowan (EM) Lewis Evelyn student rl73 Virginia av Lewis Fannie (c) maid rl45 Middle (V) Lewis Fanny (c) h91 (107) Hazel Lewis Geo (c; Eliz) h852 Norris (EM) Lewis Geo W (Carolyn) elk r321 1st Lewis Geo W (Dallas) plmbr T L Wood Plumbing & Heating r273 Ell (SM) Lewis Harvey Rev (c; Laura) pastor St LMu)ke's Baptist Church hl05 Fulton (E Lewis Lizzie (c) lndrs h315 (45) E 2d (EM) LEWIS LOGAN & CO (N Logan Lewis), Investment Bankers, Stocks, Bonds and Securities, 605 Georgia Casualty Bldg 516 Mulberry, Tel 738 (For further information see right side lines and page 20 Buyers' Guide) Lewis Lorenzo (c; Mary L) gdnr h396 Telfair Lewis Lorien W (Ella R) tchr Lanier High Sch for Boys hl31 Beech av Lewis Maggie (c) smstrs WPA h422 Liberty (SM) Lewis Marion W (Ruby) rl248 2d Lewis Martha (c) hll4 Tatnall Lewis Martha student r209 Oak Haven av Lewis Mary (c) cook rl400 College dr Lewis Mary (c) lndrs h207 Holmes av (V) Lewis Mattie (c) maid rl20 Rockhill la Lewis Hazel tchr Public Sch r209 Oak Lewis Mattie R (wid Ernest L) slswn Haven av Dannenberg Co r647 Forsyth Lewis Helen (c) r925 Pio Nono av (V) Lewis Maybelle (c) maid hl48 (461) Lewis Henry (c; Annie) lab h538 Dunlap Army Lot al Lewis Henry (c) lab rl06 Randall al (N H) Lewis Honor (c) r506 Fort Hill (EM) Lewis Inez (c) student r604 (518) Cowan (EM) Lewis Inez L (c) hl23 Glen (EM) Lewis Isaac N (Lilia E) fum wkr r296 Belmont av Lewis Isaiah (c; Lorene) baker h41 Green's la Lewis Jas (c; Naomi) lab h432 (415) E Academy (EM) Lewis Jas (c) lab rl025 Broadway LLeewwiiss JJaass ((cc); lMabarhy22B5)Jolarbdahnls20al R(oScMk)- hill la Lewis Jas (c) student rl05 Fulton (EM) Lewis Jas L (c; Bertha) lab h620 Pebble (SM) Lewis Jeff (c) soft drinks 134 Roye (CH) rl38 (274) do Lewis Minnie (c) cook h475 Chestnut Lewis N Logan (Lewis Logan & Co) r 717 Vineville av (V) Lewis Nancy (c) lndrs hl9 Buckner al Lewis Nelle (wid Elman M) h rear 157 Bailey av (CH) Lewis Otis B (Eliz) mach h817 Beech av Lewis Paul elk Winton E Bloodworth r 109 3d Lew(CisH)Paul tinner r rear 157 Bailey av Lewis Pauline (c) lndrs rl36 Woodcliff Lewis Pecan Co Lewis I Waxelbaum mgr nut dlrs 455 Broadway Lewis Perry (c; Maggie) lab h246 3d av (V) Lewis Preston (c; Clara) hllO (231) Tur- pin (T) Lewis Ray (c; Alva) lab h931 Fort Hill (EM) Lewis Ray L (Annie) lab r229 Roff Home av (V) 231 LUTHER WILLIAMS" SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 LeMwiislleRdgoebvtilLle srldsmnRDStr4ong Shoe Co r LeBwrisenRtwoobotdWav(Myrtle) tel opr h200 Lewis Rosie (c) lab r rear 353 (14) 7th Lewis Ruth (c) maid rl215 3d Lewis Sallie (c) lndrs hll8 (177) Bell av Le'wRiasilrSoaamd i a(ve; (RVo)se B) lab hl22 (227) Lewis Sannie (c) lndrs r207 Holmes av (V) Lewis W Chapman office 403 Cherry R524 r Daytona Beach Fla Lewis W Earl student rl31 Beech av Lewis Walker M (Carrie) wtchmn rl09 3d Lewis Walter (c; Pauline) driver h400 Industrial Home rd LeMwiuslbWerraylter H (Esther) slsmn r866 LLeewwiiss WWaalltteerr JL ((LEomuimsea)) pdellkr r8R1o7btNeGw Stripling r Milledgeville rd (EM) Lewis Wm (c; Lucille) hl44 Pecan av Leswioisn W(mT) (c; Josephine) lab r216 Divilewis Wm (c) porter rl20 Rockhill la Lewis Willie (c) lndrs r207 Holmes av (V) Lewis Willie (c) maid h'365 Chestnut Liberty Candy Co Inc Chas O McAfee pres Mrs Mattie K Smith sec-treas confrs mfrs 461 5th Liberty National Life Insurance Co Ernest Redd jr mgr 409 2d R523-25 Liberty Service Station filling sta 2226 Forsyth rd Life Andrew (c) millwkr Bibb Mfg Co r 425 E 2d (EM) Life Insurance Co of Virginia Ralph W Hawkins dist mgr 617 Mulberry R508 LIFE & CASUALTY INSURANCE CO OF TENNESSEE, E L Moore District Mgr, 315-316-317 Bibb Bldg 403 Cherry, Tel 4821 Lifsey Chas L (Alice) h279 College Lifsey Emma (wid John A) r861 Hillyer av (CH) Lifsey Hewlitt M nurse 215 Clisby pi (V) r do Lifsey Irene T (wid Maston L) hl08 1st av (CP) Lifsey M Eliz sten Swift & Co r279 Col- lege Lifsey Virginia opr SiBT&TCo rl08 1st av Liggett Drag Co Walter P Horn mgr 512 Cherry Lightfoot Alma (c) r200 3d (U) Lightfoot David (c; Capers) lab h771 Edgewood av Lightfoot Henry (Edna) lab hll5 Lee (E M) Lightfoot Jas (c) r771 Edgewood av Lightfoot Leola (c) cook h586 Whitehall Lightfoot Minnie (c) lndrs h200 3d (U) Lightfoot Robt (c; Susie) barber 1213 Broadway hl31 Telfair Ligon Anna (c) h230 Roosevelt av (V) Ligon Geo r615 Anderson (SM) Ligon Hugh L h615 Anderson (SM) Ligon Lula (c) cook r230 Roosevelt av (V) Ligon Roy (Ruby) auto mech r615 An- derson (SM) Ligon Ruby Mrs sten Day's r615 Ander- son (SM) Liles Danl L rl24 Fort Hill (EM) Liles Jas D (Julia) formn Willingham Sash & Door Co hl24 Fort Hill (EM) Liles Jas W (Mary A) mill wkr Bibb Mfg Co r306 Peachtree (EM) Liles Jas W (Adelaide) drftsmn r814 (812) Woolfolk (EM) Liles Joel rl28 Fort Hill (EM) Liles John A (Edna) rl24 FPrt Hill (E M) Liles John A (Mary A) hl28 Fort Hill (EM) LILES MARION H (Mary F), Pres First Nloaotkionaavl B(Ianngkle&sidTer)u, sTt eClo,3h937162 Over- Liles Wiley W (Lilia) lab h814 (812) Woolfolk (EM) Liles Wm C (Lucile) gro 803 Main (E M) h606 do Lillian Lodge of Rebecca's Mrs Lillian Howard sec meets 1st and 3d Mondays at 8 p m 515 2d Lilly Patricia home economist Ga Power Co Limerick Beni C (Kate H) supvr hl705 Vineville av (V) Limerick Reba student rl705 Vineville av (V) LIN LOUISE, Teacher Wesleyan Conservatory, r451 College Linch E Irdell sten Carl Bloch h612 Oglethorpe Linch Howard L (Esther) sub sta opr Ga Power Co h319 Cherry av Linch Lula r612 Oglethorpe Linden Apartments 316 Linden av Linder Ferrell H jr (Barbara F) slswn Sears Roebuck & Co h916 Oglethorpe Linder Maggie W (wid Jas W) rll9 Ponce de Leon av (SM) LLiinnddeerrmTahnosAGmbsrtousdeen(tSrt9e1ll6a)Ogmleiltlhowrpker Atlantic Cotton Mills r25 Atlantic Village Linderman Ardis W lab City Linderman Ella (wid J N) mill wkr Atllaagnetic Cotton Mills h25 Atlantic VilLinderman J C mill wkr Atlantic Cotton Mills r25 Atlantic Village Linderman Norine millwkr Atlantic Cotton Mills r25 Atlantic Village Lindler Wm p (Alma) flagmn hll2 (117) Crisp (SM) Lindsay Andrew (c; Alice) lab h909 (993) Cowan (EM) Lindsay Chas E r2415 2d Lindsay Eliz (c) maid r909 (993) Cowan (EM) Lindsay Geo R cond h2415 2d Lindsay Harry (c) r503 Edison (EM) Lindsay Howard (c; Mattie) lab h232 Powell (EM) Lindsay Ina M (c) student r503 Edison (EM) Lindsay Jas (c; Mildred) lab r rear 426 Main (EM) Lindsay Lucinda (c) lndrs h422 Telfair Lindsay Lula (c) lab r909 (993) Cowan (EM) Lindsay Lyda (wid Victor E) r2415 2d Lindsay Mildred (c) h503 Edison (EM) Lindsay Siney (c) maid hl3 Buckner al Lindsay Washington (c) student r503 Edison (EM) Lindsey Anne r20 Arlington pi Lindsey Bee (Ola) loco eng h256 Jeff Davis (SM) Lindsey Buford H (Jimmie) barber Du Pree Barber Shop r701 Plum Lindsey Cecil V (Edna B) driver r2080 3d Lindsey Charity (c) h.014 Flanlders (E IM) Lindsey Ohehry (wid Rolbt) r2609 Broadway Linid'sey Dempsey L CSuidie) h!85 Cedar KSIM> Lindsey Ellen (c) N314 FretWell al Lindsey Emanuel M (c; Aulrelia) mill wkr Bibb Mfg Co h520 Fllanderts (E M> Lindsey Hansel E fctywkr r207 Kemper av Lindsey Ida (wid John T) r416 Calhoun Lindsey John L (Ida) car insipr CofGa Ry W207 Kemper avi Snow's Laundry and Dry Gleaning Go. Licensed "Sanifone" Gleaner Phone 6000 232 AUTHORIZED DEALER PRINTING BINDING McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Lindsey Joyce M student r256 Jeff Davis Little Anderson ,(c; Clara) porter h2S2 '(SIM) (Franklin Li(nRdosbeiynsLonuciruds: (c; Rosa) fctywkr hS60 Lindsey Martha Mrs milllwkr r305 Ross Little Andrew 'Cc; Irene) r52l3 Coleman al Little Annie (c) h5(29 ((528) 3d av IV) Lindsey Martha S r296 Jeff D'avds (S Little Annie ((c) Indrs tr7 :(3'566) Duf- tM) ifey's al Lindsey P C (Ruby) figlmn h'21'1 Henry Little Annie C '(wid Waiter A) hSO IBu- i (SIM) fotd pi Lilnadsey Tiios (c) lab hl3t2 (3416) Brigiht Little Annie P (c) r801 (810) Maynard KEM) Lindsey Wm P (Talullah E) driver h Little Beeman )(c; Emma L) h'410 AHh J101 (96) Crisp (ISIM) St la Lineberger Eli J (Rosa H) test fooardmn Little Benj (c) lab r7 (3565) Duffey's al iSBT&TCo hl202 Boulevard! av (NtH) Little Chas i(c) lab CoflGRy Linenkolhii Boyce (Vida B) auto mech Little Chas '(c; iBva) lab h714 Daisy i(s r2640 Houston av (SIM)) M) LinenkoM Henry K (Ella; Linenkotol Little Chas (c) student r714 (Maynard IE tSboe Shop) rJSol Hemlock' M) Linenkohl's Shoe Shop (Henry K Iin- Little Clarence (c; Bessie) lab !h260 enkohl) reprs 214 Cotton aV iMadison Lines Chas W (Mildred) elk Ga Power Little (Claudia student ri20 Rogers av Co r220 Adams Lines Mildred Mrs sten Arch s Grin- Little Collins (c; Frances) lab h378 aids 1220 Adams Flanders '(EM) Lines Morton S bkpr Eves Elec Co r348 Little David T r814 2dl Columbus Little Edith tchr PS rl26 (Summit av (Lines Rayfield (Gertrude) pntr h.348 J(N1H) Columbus Little lEdw W i (Maty) store mgr Rogers Lines Rayfield B r34(8 Columbus Stores hl707 Vineville av IV) (Lingo Annie M sten Central Bedding Little Elmer .(c) student rlilO ((17) Wise Co r286 Winship (W|H) av !(V)i Lingo David (c; Estella) lab h'269 Willingham la (EM) Lingo Ediw W r31!7 (216) Hydrolia (E M) Lingo Eliz I (wid Wm) hl286 Winship KWH) Little Emma i(e) h(254 Bd av (V) Little Emma >(c) hlpr Snow's (Lndry & Dry Clng Co r643' Calhoun Little Essie M 1(c) t721 Daisy i(StM) Little Eug `(c; Mary M) porter h216 Wpodeliff LiCngoo rFl'o23uzo121(L2)ulaE) llliaobtt B(EuMil)d(ers Lbr Little Fannie (c) Indrs hil'16 0130) Ocmulgee Lingo Helen r286 Winship (iWIH) Little Fleming '(c; Flora OB) lab r230 Lingo Helen matron Hephzibah Orphan- Jones age r Forsyth rd Box 222 Little Frank (c; Kate) h'101 '(206) Lingo Ida M (c) r24!8 Plant row Toombs (BM) (Lingo Jennie (wid Jesse) hl01 Wood Little Geo B ((Charlotte) elk MD&SRR KSIM) Lingo Lovick P (Klath) slsmn h40O Vineville av (V) Lingo Maude M (wid Geo W) h'1'105 (Walnut Lingo Nettie (wid1 Eminett) r(217 (216) Hydirolia (EM) Lingo Robt (Mattie) lab Builders' Lbr Co rl23 (212) Elliott (EM) Lins Hattie M (c) mlaid 423 (474) 3d av (V) Lions Club Geo Clark sete Hotel Dempsey 363 3d Liipford Ediw M (Margt) bodywkr Geor- gia Auto Co r Houston rd RD 3 Li'psey Jos (c) gro 207 Forest av (V) h do Lipsom David (Arlene) mgr H L Green Co Inc h99 Vineville av apt D1 Lisenfoy Andrew T (Mildred L) maeh Irl95 3d Lisenby El-nest L (Beatrice) lab h4'16 Elm Lisenby Jas D dk rt[993 3d! Lisenby Jasper M (Sailie) wtchmn h 1993 3d Lisenby Mable C r416 Elm h6 Rose pi' Little Harriett (c) cook iTI24 (ID Hud- son Little Hattie (c) h4123 (518) Eliziabeth :(S(M) Little Herbert (c) r7 (3565) Duffey's al Little Howard' A i(Mina) h'126 Summit av |(NH)Little Irene 1(c) maid t444 Liberty '(SIM) Little Irene D (c) tchr PS r206 Madison Little J C :(c) r740 EdigeWood av Little Jas (c; 'Ella) l'ab h02O Ocmulgee (LWittloeoJderrurfyf (c; Lillie) sta firemn hi03 little Jesse )(c) lab r2l80 (Madison Little John (c) lab r444 liberty i(SIM) little John (c) lab r>866 Ocmulgee' little John H (c; Annie F) lab h760 Whitehead' al Little Jos ((c) lab r861 Ocmulgee Little Leslie H '(Annie B) idhf elk to asst 'genl mgr (MD&ISRR hl20 Rogers av i(V) little Lewis (c; Viola) lab COfGRR r801 i (810) Maynaird ('EM) Little Louis '(c) driver rllS) 1(17) Wise 'av l(V)' little Marion !(c; Hencena) wtchmn r315 Lisenby Sadie P r416 Elm Lister Gilbert H (Leona) sta eng h306 Hines ter Little W H (.C'ath) sl'smn Ga Roofing & Sup Co r cordele Ga; Little Wm i(c; Dora) lab rldl (111) Alabama IBM) Little Wm (c; Coira) lab h65 Odmulgee Little Wm C (c) lab r3'72 ad av (V) Little Win. IL (Myrtle) mach Macon Teleg Pub Co hil25 Pierce av (V) Little Wm N elk rr20 Rogers av i(V) Little Willie M tchr W1I2I9 Summit av l(NH) Little Willis Mirs slswn Sears Roebuck & Co r RJD 2 Littlefield JOs N rTOB Cherry Littlejohn Chas R elk Ard pash Grocery h854 Clherry Linttelettt-oOndoOmKasCoD r(LCucroilsles) Kselsymsin Kin- Littleton Chas 'G Littleton H (Mattie A) h603 Duncan ealvk1 Dewey Littleton Daisy C d'k Dewey G Littleton -T603 Duncan av , , Littleton Dewey G gro 614 Poplar t62B Duncan av Littleton Geo L (Viirgie M) depot agt RyExpA'gcy W539 Boulevard (NtH) Littleton Lucile Mrs slswn W T Grant CO r RID 4 Livingston Annie M .(c) maid r324 2d av (VI Livinglston Betty (c) maid Burden Smith i& CO r9l3 Forest av (V) Livingiston Donald P '(Mary H) supt Ga Power Co MI5H4 Vinevdlle av (V) Livingston Grady C ('Path)' millwkr Willingham Patton Mill h!201 Duncan Livingston Henry rlBO Pedlar (SIM) Livingston Kate fctywkr Happ Bros Co r 250 Washington av Livingston Mabel (c) slswn nl04 Spring Livingston Martha student 168 Log Cabin Mvdl Livingston Perry hlpr Empire Furn Co Lloyd Gladys M!rs slswn x4)19 Montpelier av Lloyd Guy (Rosa L) millwkr Atlantic Cotton Mills hl36 Atlantic Village Lloyd Herbert C slsmn h64 Mulberry apt 5IG Lloyd Irene (c) cook r11714 (1516) Dempsey av (U) Lloyd John F pntr MOOT Walnut Lloyd Josephine (c) maid rl37 Adams LLOYDS AMERICA Earle H Strick- land Agt, Ins 201 Georgia Casualty fBuldrtgh,er516in-2f2ormMautliboenrrys,eeTeblac2k36co(vFeorr and page 19 Buyers' Guide) Ldbetti Geo E hlpr Swift & Co rl06 Catherine efts Locke Walter G slsmn American Bakeries CO r505 Mulberry Lockerman Alma E Mrs (Jozel's Permanent Wave & Beauty Salon) (hi349 Central av (SM) Lockerman Ernest C (Alma E) optician lAim Optical Co hl349 Central av Lotockweerrmarndi Ethel opr SBITI&ITCo r HighLocket Mary (c) maid MOB Mitchell I0EM) Locket Susie A (c) h202 (403) Plummers al Locket Willie (c) lndirs Crescent Lndlry Co hBI32 Calhoun Lockett Albr (c) lab r309 Henderson's row (SM) Lockett Agnes (c) maid hl226 (132) Grant av (V)i Lockett Amand'a (c) student r405 (SOB) Prince (SM) Lockett Art'h (c; Beulah) h01S Mutual av !(V)' Lockett Arth (c; Lillie) chauf 11105 Ward (V)' Lockett Arth (c; Ruth E) embalmer h 100 Pond (V)i Lockett Carrie (c) maid rB20 Edgewood Lockett Charles (c) lab r52 (62) Schofield (V) Lockett Clarence (c) shoe shiner Macon Hat Cleaning Co r205 (132) Grant l(PH) Lockett Clifford (c) r248 BWad (EM) Lockett Dock (c; Bertha) lab Builders Lbr Co h209' Telfair Lockett EckeT (c) lab rlOB (341) Rock LOekett Edgar (c; Boots) lab h'108 Ell Lockett Edgar (c) lab r406 (SOB) Prince I(EIM) Lockett Emmett (c) porter Clark Drug Co rt3 Rose la) Lockett Everett (c) lab r405 ( 508) Prince (SM) W16 3d av ((Pleasant Hill) Livinglston Roscoe i(Sild'a) millwkr Will- ingham Cotton Mill r'lOo'7 Elm Lockett Fannie (c) hlO`81 Pio Nono av l(V) Lockett Fannie (c) student r226 (132) Livingston Sladlie Mrs bi620 Walnut ^ Grant av Livingston Wm C '(Bessie W) SMmn Lockett Floyd (,c) maid r820 Edgewood Hatcher & McCrary 'Inc 1H5B8 Log Cab- Lockett G Bertha (c) maid r820 Edge- in blvd wdod Livingston Willoughby elk J W McCook Lbr CO rSS'8 Log Cabin blvd Livington Reesa '(c) rB'817 Edigelwood av Lockett Hattie (c) maid r820 Edgewood Lockett row (SIMda)1 (c) maid r309 Henderson Lizalboro Baptist Church (c) 106 Davis Lockett Jas (c) d'elmn McDaniels Gro- I (MED , . , ,, cery rSOB Henderson's row (SM) LLewallyn Clyde V (Hazel) millwkr h7 Lockett Jessie M (c) cook Second Street Melrose '(IB)* Cafe D120 Linwoad av (PH) 16 Lldriens (Emanuel B (Jessie J) mech Steve M Solomon jr h533 Orange apt B Lloyd Alva (Ruth) millwkr Bibb Mffg Co hl837 Hazel ,,. , _,, Iiloyd Carrie (wid John F) fctywkr Happ Bros Co mo Calhoun Lloyd Edw i(c) lab rl'14 Salpp av (U) Ifloyd Geo (c) hBTOVi Hazell Lloyd Geo lab h2C4 0208) Main (SBD Lloyd Geo T jir (Alma M) driver rW7 (Walnut Lockett John (c; Mattie) janitor r420 1(2014) Bartlett Lockett Leonard (LUciie) porter H Mar- shall Furn Co hl'2 (202) Magnolia la Lockett Levi (c) sll'l Tindall av (SM) Lockett Mack (c) B248 Broad OEM) Lo1c0k16e'tt MMuatumaile a(vc) (nVu)rse StLUke Hosp Lockett Mamie L (c) lndirs hl868 Willow Lockett Marie (c) cook h'3 Rose la Lockett more M(Va)1rtha '(c) nurse MI2I8 Syca- SIGNATURE ONLY SAME DAY Macon Trading. & Investment Go, 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Of Your CITY 234 YATES MOTOR CO. DeSoto 707 THIRD ST. phones (US Plymouth o 2 < fe 3 ,,U 2 kP<$ < 03 <8 MORE GOODS -arebought --AND-- SOLD THROUGH THE Classified Business Directory than by Any Other Medium on Earth Lockett Mary (c) cook h!H54 Sycamore Lockett Mary (c) maid h!268 3d1 av (V) Lockett Milton (c; Mary) lab MOB Ha- zel! Lockett Minnie '(c) r20 Edge wood av Lockett Ocie L (c) student r559 Monroe Lockett Oscar (c) 'h20 Edgewoad av Lockett Richd (c) Mb rBl'5 Mutual av Lockett Sallie (c) lndrs h420 (204) Bartlett Lockett Sallie R (c) maid r03il 2d av Sarah (c) ihSJO (Henderson's row ((SIM) Lockett Sarah (c) Mb r40& (508) Prince 1(0) Lockett Susie '(c) 1-21215 (132) Grant av Lockett Susie (c) lndrs rl'4S (46(9) Army (Lot '(SIM)' (c) Till Tindall av Lockett Wm (c; Mamie) Mb bll4 Tins- ley la Lockett Willie M (c) maid t309 Hender- son's rotw .(SIM)' Lockhart Annie (c) h!284 list av (V) Lockhart Pay sten T920 'College apt 3 Lockhart pleton Gelston av I (-Claudia 1C) (hilOS Avp- Locklhiart Geo i(c) Ih29' WoOdlcliifif! Lockhart -Geo w, iformn rffllO Walnut l(wid 'John W) (h235 Locklrart 'Jias )(c; iMittie) lab !hl3'9 Green's Lockhart Was 1(c) lab rl33; 1(2029 Magnolia la Lockhart John W -'(Nina) bairtndir Weibb's -Place x80;2 Cherry Locklhiart Leah G i(wid Lafayette) mgr (Mercer Univ h'920 (College apt 2 LOcktert iRi'Chd ,B slsmn r20 College apt 2; Lockhart RUby waiter r2!25 (Knott i(SM) Lockhart Verd-ell i(c) r340 (Booker's al Locklin Anne M (c) maid rl231 3d Locklin Essie L (c) maid rl231 3d Locklin (Sami H KSairiah !B) linemn BBT !&ITCo h2'50 College apt 4 Locklin Thos E KMvie C) meat ctr Leon A Brown b41'9 Duncan av Lockm-an Andrew W (driver Tatnall Square Dry Clng Co r High-tower rd Lodge INo 1 IK -of M meets '402% (Mul- berry Lofttin -Clyde -H i ((Dorothy) (driver rS54 !Pio INono av (V) Lofton Gertrude L 1(c) lndrs hi09 Brook- lyn av ((S) Log Cabin Presbyterian Church 144 K19B) Log Cabin dir Log cabin Service (Station KLaidler c Won-e-s) il'1418 Milled-geville rd ((EM) Logan -A (Evelyn student ml!21 Beech av Logan iArt-h -M i(Sc'hoola) ins slsinn (In- taevrstate Life -& lAcodt (Co hl!21 Beech Logan -Clarence S i(c; Tru-die) 1-ab h-708 LoCglainntConlau(d(EeIM1)(c) maid h5i28 Calhoun Logan (Gus '(c) lab b:4H4 Mitchell al I,MSfng Ceonrhy vB'e(lMleaveueB)rdSc-tywkr Bibb LOg-n Ida L (c) Indirs hl35 Brooklyn -av ((S') Logan Lawrence IW elk rl014 (Ash' Logan Lee (c) clo prsr Milady Cleaners T328 Calhoun Logan Lela i(c) maid hl2(07 Davis al Logan 'Lonnie IN l(Edna) -emp CofGRv h477 Spring Logan Martha 1(c) tchr (PIS W257 3d av i(V> Logan Mary T312- 3-d Logan R A l(EMz) cabtmk-r h9U0 (Clinton rd ('EM) Logan Sara -(c) -lndrs hlO Turpin la !(T> Logan Sarah 'Mrs r6S4% 3dl Logue Amanda (A -(wid iCIhas IH) Ml 3d Logue Arfh 'H -(Helen) h;l5 Spring apt 7 Lo(g52u1e '(C50a(l4v) inE-(cA)ictar'duecmkyer (MEMD-)&SIRIR h Logue iChas L -(Willa) lab h42-0 (Ei-m Logue John W '(Lilia B) 'lab mil lEim Logue Kathleen A r-420 IKl-mLoh- iBd'w slsmn Buck Ice (& Coal Co IT2SI3 New Loh Julius L waiter Wm IS -Simmons r 053 New Loh Lawrence (M K Vivian B) m-gr Dun- l-app Chevrolet Co h32(5 Riverdiale dr IjOh M Vivian r!2i2(5 Riverdiale dt Loh Ma-ry W '(wid Prank) h'748 College Loh- Verna tchr (FIS ir74l8 Ooll-ege Lolos Gus -waiter -Nu Way Weiner Stand r Southland Hotel Lom-an (Garfield (c; lEula IM) lab WK18 Hicks a-1 LOgMis AGX-HLAomRaRxISPrPeAs,INPT TOrOa,cyMrHs aRrreis- V-Pres 415 3d, Tel 5151 Lomax Regis 'G ((wid Udh-n H) pres Lo- toax-Harris Paint (Co -r34l Vista cir Long 'Adrian IL -(Annie M) -driver r200 Newlberg -(SIM) LoRnhgodAelsber&t CSo(n(MWin1nI5ie8 ICE)oleslsmn A G Long -Alf IP (Annie P) troUblemn Ga (Power Co rl33 3d' Long Augustine J (Kath) h838 College LcSSR^RJ?afh?-1''e3y50^C(o(Mlleagreian) yd con-d- MD& Lopn-egliBerenanVett A Rev i(Mary) L821 MontLong Bertha smstrs r-K14 (Cole apt 3 Long -Bessie (wid IHaTry W) hl'14 Cole iapt 3' Long Carroll -E ((Mary IE) millwkr WpllinghiaJm Cotton Mill MS (83) Mill Long Catlh waiter Thos -H (Watson rl'14 Cole apt 3 Long Blliotte i(Le-ah) millwkr Bibb IMfg Co h-215 Bibb av Long Prances (wid Robt L) slswn Peg- Lognieg HPar-la-enk-DrsetsusdSenhtoprr381- 0 CWolilengtoen av Long Georgia M ffctywkr riBlS Cole Lon-g Harry (c) Mb rlOSO Pio Nono av Kvy Long Hattie B (c) T2H1 ILinlden av' Lon-g Howard r2-l(2 Calhoun Long J 1C (Ellen -M) hll-23 -(8) Myrtle K-EIM) Long Jaspar N Gdello) millwkr Atlantic Cotton (Mills h234 Oak Haven av Long John W (Ruby) poli-oeimn h245 Bond Long Kate U Kwid Oscar L) hl(2S Coleman av -(OH)' Long Laura (c) m-ai-d hlBO N Tatnall la Long -Lillian (c)< student -T10O N Tatnall la Long Lizzie 1(c) cook r21S Green Long M-aiggie (c) m-aid Tl(20 N Tatnall 1'al Lotinsig Long Ma-rgt Cir Margt M (M ((wid (wid1 Prank E) W202 VisGeo H) h208 Clisby LoPnig Marian L Mrs -tchr iFS bl05O Col- lege Long Mark (c; M-a-mie) porter Dunlap- IPeeler Hd'w ICo h418 North (V) Long Marvin l(Maxin-e) barber T1'29 High- land av Long Mary r838 College Long Mary (c) lndrs MJ5 1(5) Witkowskis la 235 WILLINGHAM SASH & DOOR CO. Lime - Roofing - Cement - Plaster 457 Third St. Phones 277-278-279 Long Mary E '(wid Geo W) r250 1st, Long Maude (c) Indrs hl8 Ross St pi Long Minnie L (c) r405 Chestnut Long Oscar !L isolr City Court off Ma- con trl2o Coleman av <(OH) Long Ralph (Ethel) r2C6 College pi Long fRichl J Oc) laJb rl2Hil Linden av Long IRoy W (Mary L; Long's Barber Shop) h'920 Dundan aV Long Sarah E tchr PS rl26 Coleman av KOH)' LoHngavTenabiatvh1 a l(wid 'Henry N) r'234 Oak Long Wesley H lAddie K) elk rlBS Cole-* man av KCH) Long Wiley C KWiHa B) eng City Water' Wks h'209 Hines ter Long's Barber Shoip :CRoy W Long, IRal'plh Hardaway) 1005 Broadway Longenecker Hilton M ((Gladys) eng h 607 Flamingo dr Longley Mary ,0 (wid Fredl r821 New Longstreet Wm (c; Hattie B) washer (Orescent Lndry iOo h!3`07 Wood al Lonnineck Bartow OPearl) lab hll7 Gar- den (EM) Looney Lillie (wid Emery B) smstrs r 744) Anderson (SM) Loose-Wiles Biscuit Co whse '098 Broad- way Loipeman Allie (wid Frank) nl04 Hill- crest av (CfH)l Loper J Lloyid '(Mary M) elk Adams Mfg Co r RID 4 Love Maude H Mrs slswn h Georgia av apt 3 Love Win lab irtllTO Ash Lovein Hubert C bkpr MdKesson-Riley Div r268 College Lovein Nan H '(wid Ctoials W) r207 Ad- aims Lovejoy Dora N student rlBS Cleveland av (V) Love'joy (Emma beauty opr 104 'Cleve- land av (V) 1+108 doi Love'joy (Frances beauty olpr 1011 Cleve- land av IV) rl36 do Love'joy Iverson J (Nellie) W10S Cleve- land av (V) Lovejoy Iverson J jr student ri06 Cleve- land av (VI Lovejoy Lenora waiter rl08 Cleveland av icvy Lovelace (Edwin P Cc; Anna W) brkimn IhilOO New Lovelace John Cherry h01'3 WBo((nDdaisayptT)B'dl! entist 005 Lovelace Ralph A '(Alice) lmb dir 408 (Plummers al hl(44 Hines ter (V) Loveless (Wm L '(Bertha M) H2B8 Knott l(EM)l Lovett Anderson (c; Hattie) loco fireimn h75'9` Ash Lovett Clarence (c; Pearl) lab h613 (211) Edison (EM) Lovett Jack (c) h702 Hammond ((SM) Lovett Mozelle '(c) r18 (2111) Edison l(EM) Lopez Luis M student r37ll 1st Lovett Voile A rl04 Grand av Loran-ce Katie (c) Indrs M.I21 1(26) Magnolia la Lord Clyde lOExilou) meeh r820 New Lovett Wm F ((Joiner A) millwltr h!04 Grand av Lovitt Annie W (c) r408 E 2d ((EM) Lord Earl V if521 Johnson av '(HIH) Lord Evelyn r03'8 American blvd LoKvEitMt )Hamp (Oc; Cornelia) hi408 E 2d Lord H B Mrs rlOlT iClin'ton Ird >(BM) Lord Harold elk r37il list Lovitt Ha'mip jr (c) millwkr Bibb Mfg Co r408 E 2d '(EM) Lord Hugh T (Martha W) pipeftr City Lovitt Hattie L (c) r408 E 2d (EM) LoWrda1 tJeorhWn kEs Shop r321 North av (NtH) (Clara) dept mgr Burden Lovitt Wallace i(c) r408 E 2d (E M) Low Cora L (c) Indrs h310 Mutual av (Smith & Co hi238 American blvd! Lord Laura elk J J Newberry Co r238 lAmerican blvd l(V)' Lo(w Farris elk r'16'1 Low John C (Lucille) 2d1 driver rl:51 2d lord Loton Johnson E av K(MHIaHf)gt S) polieemn roBl Losey John Kc; Mattie) lab (h'109 Bonaire Low John D (c) delmn r3H4 Industrial Home rd Low Lizzie (c) maid ih'l;13 ,(286) Stew- Losey Luve'mis ((c) rl09 Bonaire art's al Lott Alice tchr PS rOI8 Wlalnut Low Louisa (c) r800' Maynard (EM) Lott Clarence L ((Florence D) office Low Wm G (c) student r2'l(2 Mutual av mglr SBT&TCo tf720 Forsyth KV)' Lott Grace t700 Forsyth) Lowden Eliz S Mrs slswn Darling Shop Lott Gus K student if7(20 Fdrsythl r Central Hotel Lott (Gus O '(Lena R) loco eng hl720 For- Lowe Ada (c) r444 Liberty (SM) tsyth Lowe Ada (c) (c) r21(2 Madison Louis El'la M (c) l'a'b rl06 (211) Elliott I (EM) Louis Wim (c) lab rlOS (011) Elliott IE M) Loui's Wm ;(c; Nannie M) millwkr Bibb (Mfg Co rB3B Powell CBM) Louisville & Nashville R R Jesse P_ Gil- man coml agt 201 Terminal Station Love Cleopatria '(c) tchr r3(7'l Monroe Love Edna (c) Inidlrs H1205 Broadway Love Edw (c; Dora) cook Dixie Cafe & Commissary h'903 Elbert (SM); Love Geo L (c; Cora L) cook DelLuxe 'Cafe h01'8 Telfair KV)' LomwoereBig(Vus)1 C (c; Sava'na) hl43 Syca- Lowe Olias '(c) delmn Mitc'hell Williams Inc 18 Plant al Lowe Collis (c; Alice) lab hlli22 1st Lowe Lowe Dave L Dollie B (c) (c) choSoSkil1 U209 -(1414) Madison Bright la Lowe Edw M (Jim'mie L) sec-treas Lowe Elec Co h323 Buford pi LOWE ELECTRIC CO (Henry E Lowe Jr), Wholesale Electrical and Refrig- eration Supplies, Stokers 181 Cotton Loawve, Tel 0300 (Elijah (c; Florence) loco firemn Love Henry A ((Clara) h420 Rid'ge av lOV) hl37 Spring Lowe Ellis H '(Tommy G) driver h'131 Love Lucy (c) maid r218 5th av ,(V) Piedmont av Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume fi. L. Folk & Go, Publishers 431 Howard St. Detroit 354 4th Ave. New York 236 LOANS ARRANGED FINANCE SERVICE OF MACON on s z OO EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING Furniture Automobiles Endorsed Note 05 * s TELEPHONE 366 Single Signature UJ M Lowe Florence pres'ser Orescent Lridry Co rS30 COtton av Lowe Frances C home demonstration LOYAiLL JENNIE, Alumnae Sec Wesleyan College, Tel 6371, rI79 North av (NH) iagt U S Aglr Extension riOS Roycrest to Loyall Thos D h!179 North av (NtH) Loyd Albert A (Lola M) blrmkr h862 L Lowe Francis J (Maggie M) spl agt FrU' denti'al Ins Co of Aim h'136 C16I7) Hines ICtoerry Loyd Ethel S opr SRT&TCo rl'27 Vir- ter (V) ginia av co iLolwe Geo (c) hlpr East Side Funeral Loyd Horace C (Mary E) c'alrp M07 Home (iH4)5'2 (25) Mitchell (EM) Virginia av I Lowe Hattie (c) lab Central City Bag Co Loyd Howard C chtauf Safety Cab Co r 1127 Virginia Lowg Henry E jr (Martha P) pres Lowe Loyd Ida M slswn W T Grant Co rtl27 Elec ,Co hMS Beverly jpli Virginia av & Lowe Hubert Kcl porter Dunlap Chevrolet Co r420 Hazel Loyd J Lewis lino opr Macon Teleg Pub Co r'30'1 Cherry Lowe Ida (c) student rH83' (121) Wood al Loyd Thos E (Ethel) RyMIS hl302 Ridge Lowe Jas (c) lab rBOO MaynaJrd (EM) av (V) Lowe Jas E Kc; Mary) cook hJlHSIT O'gel Loynd Agnes sten rl07 Stonewall pi KV) thorpe Loynd Gertrude E ri07 Stonewall pi (V) Lowe Jas T slsmn Lowe Elec Co r Shirley Hills Lowe John A (Essie) private detective n67 2di Lowe John A jr (Viola F) h!2!47 WinShop (WH) Lowe John T (Josie L) lab h402 Fi/m Lowe- :Lawrence W (Nannie) carp rl40 Piedmont av Lowe Leila (c) cook h Clinton nr River rd (EM) L oMw)e Leo (c) h10 (230%) Bowman (E Lowe Leon (c; Orie) e'hauf h'303 `(310) IBoWman (EM) Lowe Lige (c) lab CofGaRy Loynd Herbert A (Alice) auditor bl07 Stonewall pi (V) Loynd Lillian B sten Mrs EH'aime E League rl07 Stonewiall pi (V)' Lubach Anthony P (Mamie) veterin- arian 519 Cotton av rtl47 Vineville av Lubel Benj (Esther) mgr Macon Linen Supply Co Locus Albert (hc6;76SlaHlliiel)lyeprntarvrl'3(O1 K(9)10) Clayton (V) Lucas Alice (wid Cllias P) W741 Ridge av Lucas 'Celia S sten First Natl Bank & Trust CO r25 Progress/ Lucas Ch'as (c) gro 215 ( 363) Elizabeth av (SM) Ih218 (363) Campbell av (S M) Lowe Lulberta (c) maid ri9 Plant al Lowe Mary (c) r338 Jackson/ Lucas Chas (c) lab M25 (730) NusSbaum KSM) Lowe Mattie (e)- cook hl7O0 (128) Cowan KEM) Ludas Ohas (c) porter r40S Ward (V) Lucas Charlotte (c) rS6 Shamrock Lowe Nimrod (c; Mumeater) .blksmith h Lawton av (B) Luca/s Eugene (EStelle) lab Methodist Orphan Home ri201 Pierce av KV) Lowe Randall (c) giro 498 (28) Mitchell KEIM) h do Lubas Fred D (c) lab r237 KH21) Moore la Lowe Reuben F student r46B Eton Lucas Henry W (c; Erna) carrier UBFO Who Sells It? Loiwe Robt (c) porter r4l20 Hazel ILowe Robt A (Slara B) atndt Wilder & (Jones rllO Park pli Lowe Robt F millwkir Bibb Mifg Co r 1136 Hines ter (V) Lowe Rogers (c; Clara) lab ril38 Broad- way Lowe Sami (c; Maybelle) carp Packer Adv Corp h242 Nona (EM) Lowe T Jackson student rl35 Hines ter KV) Lowe Wm (c) lab Abel Ice Co rI15 Hicks al Lowe Wm (c) laJb r800 Maynard (EM) Lowe Wm (c; Laura) lab h!209 Roose- velt av (V)\ Lowe Wtm T (c; Alma) hell Fort win KEM) M16 Neal av (V) Lu'oas Herbert (c) l'ab rlB5 ( 732) Nussbaum (SM) Lucas Jas W eng Ga Power 'Co r:3'H6 Lin- den av apt D Lucias John (c; Dovie) h3!4 (490) White KSIMV Lucias Lee Kc) lab r Lawton av (B) Lucas Linda E (wid Jas H) L3I1 Linden av apt D Lucas Lucille dietitian Clinic b557 Walnut Lucas Margt Kc) rl09 (54) Tinsley la Lucias Mary (c) maid 1408 Lawton av Lucas Mary B (wid Jonathan) rl3B Rem- bert Luleas av Mattie D Kwidi C Marion) h!26 Progress IS Answered By the Classified Business Lists In this Directory Lowentha! Marcus (Siadie) loco ena h 04122 2d) Lowery Elbert (c; Carrie) lab h222 Lyn- wood av (V) Lowery Jos (c; Hester) driver MOB (165) (Davis la Lowery Jos (c) -lab Yates & Tabor Co irlia Neal av Lowery Olbie N (Ursie L) millwkr Bibb tMfg Co h!30U Lowery W'allaoe -((3c0)0)coFolkan9derSstPaul1 Lowery Wjm T (Wylene O) fctywkr rKM 3d Lowranee Jas L i(Minnie L) pres Dixie Roll & Cot Co Inc hS7 Courtland av Lowranee Roy E (Lillian) mgr Carling Tile Co hfi Vista cir Lowtrey Jas A jr (Louise; Miller & Low- rey) r275 Orange Lowry Annie (c) lndts h`2120 Pear (EM) Lowry Claudia r8 Parkers la, Lowry John T (Annie) h0 Barkers la Lowther Frank R (Sarah) hlOl (2123) Fai'rview av (EM) Lucas Osca-r (c; Hazel) lab hl92'4 1st Lucas Robt E (Annye M) supt ICotton States Fertilizer Co W570 Orange aipt 4 Lucas Sally maid r910 Clayton l(V) Lucas Solomon W (c) lab Taylor Iron Wks & Slip Co MI40 Broadway Lucas Susie M (c) t'chr PS H3I20 Middle (V)' Lucas Viola (c) cook M1 Pecan av Lucas Wm (c) la)b rli54 Ernest la Lucas Wm (c) lab rl2 Parker av (V) Lucas & Jenkins Inc Arthur p B'arry mgr theatre oprs 368 2d! Lucky Strike Bowling Alleys (Jo B Mas- sey) 369 Cotton avi Lucree Anthony C Power Co hfiilO (LaWama) Oakland alivn1 eimn Ga Ludlow Annice r!2014 2d Ludlow Cleveland L elk r2014 2d Ludlow Riaiph P (Celsie) lab 'City h0214 2d! Ludwig Victotine r17 Walnut Lueree Beauty Shop (Mrs Lula M Sapp) 572% Cherry 237 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Lugand A Emile sismn Ga Power Co r S3I3 Orange apt 2 Luggage Shop The (Ralph Morris) 364 2d Luke Willie M (c) maid r222 Gilmer lumbermens mutual casualty CO, Earle H Strickland Agt 291 Georgia Casualty Bldg, 516-22 Mulberry, Tel 236 (For further information see back cover and page 19 Buyers' Guide) Lunsford Clifford M (Susie E) filling Lusntasfo1r8d 5Mthaub'd39ie3< (He;ydErollleian (ME)M)porter Stephens Barber Ishop h'3'93 Green Lunsford Wm H atndt C M Lunsford r 303 Hydrolia OJM) Luster Frances (e) rl09' (7) Fulton al Luster Ida (c) cook h'8 Buckner al Luster Pearl (c) lndrs h Bartlett lav Lutheran Church of the Redeemer 723 LUMBERMENS MUTUAL FIRE INSURANCE CO, Earle H Strickland Agt Holt av (NIHts) Lutsky Benj slsmn Dannenberg Co r820 291 Georgia Casualty Bldg, 516-22 Mulberry Tel 236 (For further information 2d Lutsky Meyer confir 8129 2d' h dt see back cover and page 19 Buyers' Guide) Lyle Mary (c) maid rSOO (801) Charles ICSM) Lum'ley Jas W mgr Motor Contract Co Lyles Annie L picker Macon Peanut & tr2l24 Georgia av Lumley Newman elk rt21i06 2d Lumpkin Daisy (wid Geo) tfl'212 (153) Pierce av (v)\ Lumpkin Evelyn slswn IF W iWoolwontih ICo r'4iri Forsyth) Lumpkin Evie (wid Wm O) rlOl Clayton Lui(mV>pkin Geo (Hazel) cotton das'ser LuAmttphkiJn KGeeloleyB h(iMmarBthuaf)ordblkpdimitlh Col tge Co r2H0 Willinghlam (EM) Lyles Benj F (Julia D) restr 554 Mul- berry MOO (191) Crisp (SM) Lyles Cora Bros Co (rwid)1 Wm 2dl R) fctywkr Happ Lyles Duke (c; Susanne) Mil (3419) Woolfoik CBM) Lyles Edgar CEliz) detain IKinnett-Odom Co rl`27 Park l'a Lyles Frank C (Annie B; The Brown Jug) h903 2d GaRy h411 Forsyth Lyles Herman L (Eugenia) plstr hil'97'4 Lumpkin Hlaflry E atndt Ingleside Oil Co rlOl Clayton (V) Lumpkin J Quinton (Mary) student r 512 Hillyer av (CH) Lumpkin Jack G (Olene) elk Hotel Gra- 2d' Lyles Ike (Edith) 1050 Hydrolia (EM)' Lyles 'J Rufus (Mary B) lab hl524 (562) Ogelthorpe Lyles Jas F wtatoh re>pr John F Sher- dy irBOl C'herty wood) iWl College d!r! Lumpkin Jas Q (Louise) loco eng h5'12 Hillyer av (OH) Lumpkin JOs r4H'l Forsyth Lyll(eEisMJ)ohn L '(Minnie) h210 Willingham Lyles Lula (c) Mill Spring Lulmpkin Lila sten Bibb Mfg Co rt2H Lyles M Ella (wid Wm N) hl'341 Col- 1(115) Pierce av (V)' lege dr Lumpkin Olene Mrs sten Hotel Lanier iBOl Cherry Lumpkin Wallace student r4ll!l Forsyth Lyles Nancy (wid Robt) r709 Main (E !M) Lyles J Obediah .baJrtndr Night Owl r Lumpkin Wm B agt Nlatl Life & AcCdit 626 Edgewood av (SM) Ins Co ra 1st Lumpkin Zora L (wid Wm O) hll91 (Clayton (V) Lyles Paul W chauf Safety Cab Co r 11241 College dr Lyles Robt L (Bessie) millwklr Bibb Mfg Luncelford Clifford E '('Susie) hSOIl (303) Co h34 (35) Taylor av (EM) Cutter's Green (EM) Lunceford Hugh A r391 (303) Cutter's Lyles Rube H (Nellie) millwklr Bibb Mffe Co h.220 (223) Applewoold (EJM) Green ('EM) Lyles Rufus lab City Luncefard Wm M ir01 ('393') Cutter's Green (EM) Lundy Andrew (c; Ossie) porter E C McMillan Paint & Glass ICo h'1120 Forest av (V)' Lundy Bright W (Iva) ship elk CoffiGa IRy h348 Pierce av Lyles Stewart l(Hiattie) milliwkr Bibb Mfg Co MO07 Hazell Lyles Win J waiter Spiller's Relstr r 1097 Hazel Lyles Wim IS (Elberta) giro 3185 Monroe hi 709' Main (EM) Lyles Wylie W (Lilia L) ftr Macon Glas Co rSH2 Woolfolk (EJM) Lundy Cauley (c; Mattie) r228 Lexington ('EM) Lynch Lyndh see also Bernice C Ltcihnrchhll!3 Piedmont av Lundy Chas (c; Mabel) lab r228 Lexington OHM) Lynch C Mrs asst hsekpr Hotel Lanier h505 Mulberry Lundy Edigar (c) lab 10931 (498) Thomp- Lynch C'aston L (c; Louise) sulpt Aflro- son al Amerioan Life Ins Co rl04 Spring Lundy Eva '(e) tchr hSlB Green Lundy Ida (c) h40 E 1st OEM)' Lundy J W (c; Susie) lab h!H19 Brook- lyn av (S> Lynch Eliz student rl'2 Richmond Lynch Grief R (Ina C) sulpt Willinghlam Cotton Mill hl2'23 (54) Holt av (NHts) Lynch Joel L (Adelle) h16 Dannenberg Lundy John W (c; Annie) driver Buck Lynch Julia F Mrs hi586 Pine 'Ice & Coal Co li46'3 Douglas av (V) Lynch Letitia (wid Wm) slswn W T Lundy Laura (c) h20O Bowman (EM) 'Grant Co MBS Richmond av! Lundy Laura (c) h22ll Division St l'a Lynch Lois E tchr rl'l Piedmont av Lundy Marv (c) lndrs Crescent Lndry Co r408 E 1st (EM) Lundy Maybelle (c) r6'12 Maynard (E Lyndh Jjucille L tdhr nil Piedmont av Lyn'ch Margt (wid Henry T) r75'3 Hem- M) Lynch Ruel W x56l5 Pine) Lundy Melissa E (wid Abnelr) rHBI3 Ylates av ' (EM) Lundy Rotot L (e; Oveda) lab hi304 Charles (SM) Lundy Robt L much oipr Dixie Roll fc Cot Co Me rH03 Yates av (iEM) Lundy Wm (c; Ola) l'ab 1009 (2'4I8) Thompson al) Lundy Wm W (c; Lula) carp h)333 Rob- Lyndh Wm J asst county eng Bibb County r8'5 Cherry Lynch Willie F rl'l Piedmont av Lyndon Andrew J (Annie M) d'iv rep (Phoenix Life Ins Co h'9'30 Vineville av (V) Lyndon Andrew J ir student rl9Q0 Vineville av (V) Lyndon Twiggs M student r9t30 Vine- inson rd ville av (V)i MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 238 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go, Publishers 431 Howard St. Detroit 1 354 4th Ave. New York Lynn Ethel millwkir Willingham Cotton Mill r'19- (66) Mill Eynn Wm R student rl401 Ogelthorpe Lynwood Cemetery (c) end Lynwood av Mack Helen J sec-treas Alf Mack's Pharmacy Inc r!05 Hill Orest av Mack Ida (c) lndrs h'101 (173) North av (N/H) Lyon Clarence student r205 Miklaido av l(S!M> Lyon Hariris & Brooks (W|m J Lyon, H Earl Harris and R Frank Brooks) printers 560 Mulberry Lyon Mamie M (wid Clarence) h-206- Mikado av '(SIM) Lyon Wm J (Ruth; Lyon Harris & IBrooks) M2B1 (220) Log Cabin d'r TjrMis Annie B (c) T456 E Academy (E Mack J M r Hotel Fickling Mack Jas (c) driver r314 Eta Mack Jeannette (wid Alf) pres Alf (Mack's Pharmacy Inc hl06 Hill Crest (av (CH) Mack Jesse (c) lab r314 Elm Mack John (c; Tessie) lab h!129 Ritchey K:EM) Mack Julia (c) student r56!9 Monroe Mack Julius rl22 Cedar (SM) Mack Mamie (c) asst Dr D T Walton h Lyons ass Cash Market (Wm Washington av A Lyons) g8 ro Lyons Eug L (c; Ehim-a L) lab h853 '(8t>4) 3d av (V) Lyons Moira nurse r36 Masonic Home rd 42d (472) 3d av (V) Mack Nora (c) lab h rear 350 Edna pi (LCHts) MlaicakmsP)urlcohaanssing411C%o 3(Rdobt S McWilMack Rhetta rlG6 Hill Orest av Lyons Jlas (c; Ethel) driver E Clifford LyDonasvisJuha2n0i3ta (1) Kc) 3d av ironer (B) h rear 3012 ^MI Tessie (c) 1,6111 (2llll) Ed'ison (E Tommie (c) r324 Edge-wood av (S Forsyth rd Lyons Nepoleon (c) r45S E Academy (E M^SM)Wm (C' Mary I) r405 Henderson Lyons Walter (c; Alice) hl455 E Aeald- Mack's Alf Pharmacy Inc Mrs Jeannette Mack pres Helen J Mack sec- treas 401 Cherry Lysf 3deona: Lyons 0asb M,ar- MaJbel Lodge No 265 F&iAIM meets 710 Mulberry Mabray Inez (c) cook rl03 Price (V) Mabray Stella (c) cook rl03> price (V) Mabry Herbert student hTO Winton av Mabry Miabry Hugh student rM9 Winton Ida (c) h83 3d av (V) av Miabry Julia (c) maid h2ll'8k Mutual av !(V) Mabry Lemuel (c) porter D H Adams Motor Co 218313 3d XV) Mabry Lucius (c) chauf rS33 3d av (V) Miabry Paul (c; Essie) lab h'103 '(HI) Magnolia la Mabry Robt H (Eula L) dentist 409 2d Macken Dorothy student ri804 Napier av Macken Jas E (Mary M) slsmn Free- man-Dent-Sullivan Co h278 College Macken John E (Kath-) supvr CofIGRy hOI4 Napier av Mac-key Lora (c) r302 (315) Henrietta l(SM)Ma-ckey Ludes-sa (c) h!755 Eta Mackey Mildred L Mrs bkpr Toole Furr. ICo r210 Rutherford av (SIM)I Mackey Thos M (Mildred L) collr Em- pire Furn Co r01O Rutherford av (S M)' MacMillan Donald M i(Lillian) vulc 352 -1st 1124)7 Hardeman avi MacMillan Donald M jr genl mgr Donald M MadMill-an r-2417 Hardeman av MRab5r4yC-R11ubby74c9ashWSinetaorns Raov'ebuck & Co r749 Winton av Mabry Wm (c; Salomie) lab h207 3d av )(V) MacMillan Wm S student r247 HardeImian av Macon Academy Music Co David G Phillip mgr 617 Mulberry R513 Macon Alex (c; Lelia) lab Happ Bros MacDonell Alan M (Laura T) local adv Co r!216 Fretiweh al mgr Macon Teleg Pub Co hlllllO Ridge Ma-con Allen B (Jeanette) slsmn Max- av (V) MacDonell Gene student rlllO Ridge av well Macon Bros Auto Furn Co Exchange r:8(P07auCl hGerrHyogan) l(V) used cars 3-62 1st Mace Wm A (c; K9I28) Montpelier Eatvh1 el) cook hl028 Macon Bar Association Augustus C Dlaley sec meets Court House Macedonia Baptist Church (c) 16(4 Macon Beverage Distributors ((Harry Hazel and Isador-e Ohanin) whol wines 359 MadEwen Harry A archt r47S College athi apt 4 Macon Butter Co (Roland M Holloway) MadEwen College Harry apt 4 L (Sue W;) acet h476 6117-119 Linden av Macon Cabinet Works Carl Dohn pres MacEwen Wilson M elk Ga Power Co Mrs Julia K Dohn v-pres Philip H M7S College apt 4 Dohn sec-treas Poplar nr 8th) Macey Jos M (Kiatie R) hl234 Tatnall Ma-con Cafeteria (Jos A Flournoy) 415 Mack Annie M (c) r354 Church' a! (S Cherry (M)i Macon Carrie (wid Junius M) h4)12 Mack Benj (c) r900 Cowan ('EM) IRi-dge av (V)i Mack Ch-as (c) restr 119 (1418) Hudson Macon Casket Co (Claud W Dooley) rlil(7 (147) dO 15011-1603- Broadway Mack Daisy (c) maid r'4112 E 2d (EM) Mack Dorothy (c) maid rlilS Tindall av Mack Edw (c; Willie B) lab Jh2117 Wydhe's al Mack Edw (c) student rl29- Ritchey (E MiMack Bffie (c) maid r56!9' Monroe Mack Ernest E (Argie C) sup-wr Ga Power Co h206 Buford pi Mack Essie M -(c) r309 Edgewood av (S M) Mack Geo (c; Rebecca) MJ4S Evergreen la (SM) Mack Geo (c) h)168 Plummers al MACON CHAMBER OF COMMERCE, Lee -S Trimble Exec V-Pres-Mgr, G iGlen Toole iSec, Mrs Lucille IL Mar- shall Information Sec, Municipal Au- ditorium, Tel 1767 (For further in- formation see page Y) Macon Cigar & Tobacco Co Lewis A Walker pres Rufus D Sands sec-treas 653 Broadway Macon Circus A Fox pres 5E16quMipumlbeenrtryCoR3I!0n)8c John MACON CITY DIRECTORY, R L Polk & -Co Publishers, Martin (Bldg, [Bir- mingham, Ala 239 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 MACON--CITY OF CITY HALL, Poplar Bet Cotton av and 1st, Tel 1880 (Airport ((Miller Field) 4 mi ne of city AToTnOMRNilEleYr , FEieliljdahrdWl Maynard, 150 Cotton av, R403 Auditorium Edwin C Vandiergriff mgr 401-03 1st BOARD OF HEARTH, Dr (Jos D Applewhite Health Officer, 720 New, Tel 1880 BOARD OF WATER COMMISSIONERS, Jesse A Mitchell Chairman, Cliff T Williamson V-Chairman, John T Moore Commissioner, Richard E Findlay Sec-Treas, City Hall, Tel 1880 CLERK, Viola Ross Napier, City Hall, Tel 1880 Council Chamber, City Hall ELECTRICIAN, Charles H Humphreys, George P Rankin Jr Asst, City Hall, Tel 1880 ENGINEER, Watson Walker, City Hall MACON COCA-COLA BOTTLING CO, W Thos Williford Sec-Treas, 416-420 Oinafko,rmTaetlison32s6e6e anledft32s6i7de(Floirnefsurtahnedr page 7 Buyers' Guide) Macon Community Chest F Spencer Holdcroft dir 516 Mulberry R218 Macon Consistory A'&ABRafHM meets 7(10 Mulberry Macon Cooperage Co Geo W Hubbell pres W Allen RouSh v-pres-treas 620 Division MACON CREDIT BUREAU, John M Holloway (Montgomery, Ala) Genl Mgr, W Comer Cherry Res Mgr, L G Holloway Asst Res Mgr, Dependable Credit Reports 'and Collection Service, 316 Georgia Casualty Bldg 316-22 Mulberry, Tels 881-882-883 (For further information see right side lines and page 11 Buyers' Guide) Macon David ((Edna) elk First Natl Bank & Trust Co h4i68 Napier av Macon Dental Depot (Wm B Holmes) M5a5c0onMDurlubmerr&y Bugle Corps 614% Pop- lar ' FIRE DEPARTMENT Volley C Shepard tdhief, John E Dellinger 1st asst dhief, Guy Moseley 2d asst chief, re'ar City Hall, Tel Call Fire Department Macon Dublin & savannah- Railroad Co com! agt office and firt agt office Broadway asst genl fcngr and roadtnaster's office ft of Walnut shops 8th nir Walnut! AuMto) Pump Co No 1 137 (Garden (E MI aPchoanrmEadcgya)r Bhl22(2JoMsepaghninoeliaC; Macon's Auto Puimp Co No 2 Monroe and Georgia Auto Pump Co No 3 rear City IHall Auto Pump Co No 4 rear City Hall Auto Pump Co No 5 2233-2245 2d Auto Pump Co No 6 303 Pio Nono av Auto Truck Co No 1 rear City Hall Auto Truck Co (No 2 Monroe and Georgia Auto Truck Co No 3 rear City Hall Incinerator Poplar nr 8th. Macon Electric Co (Geo B Slmith, Fred'k MAWCORNeichEeVrtE)NIcNoGnt'rsNE3(W15 SS,id. Chas J Bayne Editor, P T Anderson Genl Mgr, P T Anderson Jr [Bus Mgr, Geo W Griffin Managing Editor, R I Neal Advertising Mgr, J T Webb Jr Circulation Mgr, The Macon (Telegraph Publishing Co Publishers, 450-452 Cherry, Tel 6500 (For further information see opposite title page) INSPECTOR OF BUILDINGS, F Joe Macon y 414 4108 1rs0t ad~ Macon Wm E (Ida P) slsmn h`205 Bel- mont av Macon Womens Clulb Mrs Hate Booth, pres 200 Baconfield (NH) MX40?2nO1h.pabrrayllma'0y d'gar B Macon) ^c4oo3nCOhieprtrieyal Co (Frank H Johnson) iMacon Paper Co Jas T MdGebee jr o'13 ot'h1 Nell S MidGedree v-iptres ^M3acon Peanut & Storage Co Jo(hn H Alanndder4s5o7n Psience-t'refas-mgr wfhse 213 5tth 62O1^ PCleUaiteirnrgy 'Shop (Lewis M Brown) Macon Plumbing & Heating CO (HOw- M'fcon 'piSSie M Mrs tcllllr P*3 i3 ArlinigMacy Jasper J (Beslsie) interior dec- orator n53` Arlington pi Madden Albert C baker Central Ga (Baking Co 11563 Wlalnut Madden Darrel (Marguerite) slsmn h207 Lynmore av Madden Leonard J baker American Bakeries Co r708 Cherry Maddison Irene (c) nurse 995 Hazel r do Where To Buy? PoplS- ROller and Geo H Kin:g) 1015 B Wi. lPliraomdsuct(iHoanddcorcekditGaA)issonresWRalotebrt iL Knight ( Waldon Ga) v-pres Wm h Watson sec-treas 4117 Broadway Macon Ralph (Sarah) supvt W32I2 Bond Macon Savings Bank Edwin W Copelan agt 150 ctton av RI4Q8 ^t&piaf10016 SJ:l0lp (Bdw L Jones) 055 Macon Slhirley J ('Mary) slsmn. h'025 Carling av Maddox A G troublemn Ga Power Co Maddox Albert (D Ella) blksmitlh John A Herndon r916 New Maddox Arth millwkt Bibb Mfg Co r 1012 Hazel Maddox Ada (Lea) pntr h8S0 Woolfolk (EM) Maddox Barney B (Floy) blrmkr CoflG Ry h'23'9 Jeff Davis (SM)/ Maddox Bessie r850 Woolfolk (EM) Maddox Carrol (Mildred) electn ri204 (Edgewood av Maddox Ohas W millwkr Bibb Mfg Co MACON SHOE ICO, H D Russell Pres, Harlan E Bussey Sec-Treas, 301 3d, ri'23 (8) Myrtle (EM) Maddox Clam (wid Gus) h7`30 1st Tel 740 Maddox Claude L (Verna) lab r36ll Macon Supply Co [W Abel Slmith pres Flanders (EM) Consult the Classified Busin Lists Thos H Humphreys v-pres Jas A Wynne sec-treas mill supplies 25 5th MACON TELEGRAPH PUBLISHING 'OO THE, W T Anderson Pres, P T Anderson V-Pres-Genl Mgr, P T Anderson Jr Bus Mgr, J W Johnson Jr Sec-Treas, Publishers The Macon Telegraph and The Macon Evening News, 450-452 Cherry, Tel 6500 (For further information see opposite title page) MACON TELEGRAPH THE, W T Anderson Editor, P T Anderson Genl Mgr, P T Anderson Jr Bus Mgr, Ben B Johnston `Managing Editor, Roy I Neal Adv Mgr, J T Webb Jr Circulation Mgr, The Macon Telegraph Publishing Co Publishers, 450-452 Cherry, Tel 6500 (For further information see opposite title page) MACON TERMINAL CO, Wm F Wippler Station Master, Terminal Station 5th at Cherry, Tel 4728 Maddox Danl M (Hannah W) hl01!2 'Hazel Maddox Dolie (c) lndtrs hil'04 (73) Brooklyn av (S) Maddox Edgar M (Delone) h'3'74 Clinton I (EM) Maddox Edw ('Emma) ir860 Woolfolk (E M) Maddox Ed'w L (Nancy) slsmn hilUB Lamar (V) (Maddox EVa (c) bllOO Elim Maddox Heywood' (c; Claim) flreimn (Willingham Sash & Door Co plant h 317 (47) Plumtree (EM) Maddox Hugo L sl'smn Snow's Lnidry & (Dry Clng Co r40il Montpelier av Maddox J Atticus (Annie) con'd h!40a Montpelier av Maddox J Lamiar ('Myrtle M) fitter A B Lhvee (PShMnt)og & Htg Co hl2iOI3 Newberg Maddox Jesse E (c; Ella) carrier UIS 'FO h205 Roosevelt av (V) Maddox Katie M (c) cook rl'13 Morris 241 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 Maddox Kessley (Lessie W) Bibb Mfg Co rl23 (8) Myrtle m(EilMlw)t1 or Maddox Lester (c) lab r843 ( 800) Port Hill (EM) Maddox Lizzie (c) h61 Craigs la '(SM) Maddox Louise (c) maid rl31 (123) Phil- lips la (EM) Maddox Mark millwkr Bibb Mfg Co r916 New Maddox Marshall W (Mildred L) pntr r 1063 Elm Maddox Mary (c) lndrs h280 Madison Maddox Mary nurse 216 Adams r do Maddox Nathan (c; Sarah) fctywkr h 113 Morris Maddox Neal D (Berla) millwkr Bibb Mfg Co h916 New Maddox Opal r351 Flanders (EM) Maddox Ovid (Ruth L) electn hl063 Mahone W Perry sec-treas Jos N Neel Co r247 Boulevard av (NH) Mahone Wm P (Rosa L; Hotel Arcadia) h663 Mulberry Mailey John L slsmn rl'5 Atlantic Village Mailey Junius S (Lois) slsmn h7I9 College Mailey Sami F (Daisy) mstr mech Atlantic Cotton Mills hl5 Atlantic Village Mainor Daisy student r749 Hillyer av (C H) Mainor H Bruce elk r749 Hillyer av (C H) Mainor Jas T (Iva) agt h749 Hillyer av (CH) Mainor Jas T jr (Doris) elk Southeastern Exp Co r211 (210) Log Cabin dr Mainor Mary B student r749 Hillyer av Maddox 'Palmer (c) driver r205 Roosevelt av (V) Maddox Rosa (c) cook rll8 Tindall av (SM) Maddox S Fleetwood (Martha D) slsmn h212 (220) Hillcrest av (CH) Maddox Sims (c; Jessie) lab h4 Gunn's la (V) Maddox Thos C (Myrtice) cementwkr h 659 2d Maddox Thos L slsmn r760 1st Maddox W Reid electn Ga Power Co r 107 (167) Cherokee av Maddox Wm (c) lab h429 Chestnut Maddux Julian R (Ruby) v-pres Georg- (CH) Mainor Nell student r749 Hillyer av (C MHai)nor Olivia (c) maid r204 (212) Far- gason (V) Mainor W B (Vera) elk Southeastern Exp Co r514 Linden av MMaaijrozr LCuhcaisanTr2(1M7aNryo)ttminggrhaHmotedlrG(rNaHdy) r301 Cherry Malavar Annie smstrs r4004 (3910) Hous- ton av (SM) Malcolm Agnes waiter rll36 Milledge- ville rd (EM) Malcolm Barney (Emma L) r"510 Orange ia-Carolina Oil Co Inc h211 Stanislaus Circle Malcolm Emmie L elk r510 Orange Malcolm Ernest M (Ida) linemn Ga Maddux Kathleen beauty opr Artistic Power Co hll36 Milledgeville rd (EM) Beauty Shop h709 Courtland av Malcolm Guy A (Bernice) service mgr Maddux Mamie T (wid Robt) h413 rl85 Laurel (NH) Spring Malcolm Judida (wid Ganaway) r952 Maddux Marguerite office sec Martin Elm Martin & Snow r709 Courtland av Malcolm Odessa lndrs Crescent Lndry Maddux Robt D student tr211 Stanis- Co r RD 5 Milledgeville rd laus cir Malcolm Sampson bus boy New Yorker Maderia Linen Shop (Gabriel S Shrem) rl016 Fort Hill (EM) 466 Cherry Malcom Elbert (c) hlpr Douglas Hotel Madison Robt hall boy Hotel Lanier r Grill r363 Broadway 757 Ash Malcom Otis C (Mary L) cond h320 Mae Ruth (c) h8 Plant al Newberg (SM) MAERZ GLENN P MRS, Teacher Wes- Mallard Emma L Mrs fety wkr Happ leyan Conservatory, h217 Nottingham Bros Co r854 Cherry dr (NH), Tel 1973-J Mallard John J (Macon Mirror Works) MAERZ JOSEPH (Glenn P), Director Wesleyan Conservatory, h217 Nottingham dr (NH), Tel 1973-J T616 1st Mallard Jos elk rl427 2d Mallard Mattie Mrs fety wkr Happ Bros Magahee Louise student rl6 Bibb av Magahee Naomi rl6 Bibb av Magahee Thos (Ruby) millwkr Bibb Mfg Co hl6 Bibb av Magee see also McGee Magee Esalena student r410 Forsyth Magee Jas S (Marjorie) cond h410 For- syth Magee Jas S jr student r410 Forsyth Magnolia Baptist Church (c) Rev Na- thaniel S Cephus pastor services 3pm and 8pm Sunday school 10 a m 316 Jackson Magnolia Camp No 88 WOW Geo Williams sec meets 1st and 3d Fridays 8 p m 408 Poplar Magnolia Inn (Mrs Mattie A Smith) Co h3;17 Chappell (SM) Mallard Pauline (wid (Robt L) rl08 Mad- den av Mallard Richd (c; Esther) lab hll7 Tin- dall av (SM) Mallard Wm D (Marie E) elk US PO h 108 Madden av Mallary Caroline student rll7 Callaway (V) Mallary Chas (c; Ruby) porter Brad Wall irl021 Edgewood av Mallary Edgar Y (Martha) mill wkr h Anola pi (V) Mallary Georgia Mrs elk r452 Spring Mallary John B Rev (c; Evangeline) pastor Seventh Day Adventist Church H501 Center (EM) furn rms 55'5 2d Mallary Louise Mrs rl20 Lamar (V) Magwood Robt (c; Gertrude) hlpr Cof Mallary Lucile (wid Frank L) r99 Vine- GRy h855 Ash ville av apt F2 Mhahio14gonGyfTJ6odsi H Rev (c; Lillian) pastor Mallary Marie (c) lndrs hlOO (186) Turpin la (T) Mahone Harrison (c; Julia) lab h'58 New Mahone Mary tchr PS r RD 3 Mahone Norman A elk Hotel Arcadia r 663 Mulberry Mallary Nelson D (Willie E) mgr loan dept Hatcher & McCrary Inc hi 17 Callaway (V) Mallary Willie E Mrs agt Mutual Life Mahone Roland T (Ruth) see-treas Willingham Cotton Mill rl40 Georgia av Mahone Ruth student rl40 Georgia av Mahone Sami (c) lab Natl Handle Co r 342 Hammond Ins Co of N Y hll7 Calloway Mallory Albert (c) lab r721 (613) Prince (SM) Mallory Annie M (c) cook r721 (613) Prince (SM) We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety L 310-12 First National Bank Bldg. -pej W 0 0 Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st Mallory Baptist Church 219 Roff Home av (V) Mallory Betty (c) h201 Gantt City rd (SM) Mallory Borie (c) lab r201 Gantt City rd (SM) * Mallory Buford (c) lab r201 Gantt City rd (SM) Mallory Camilla (c) Indrs r35& (456) Ala- bama (SM) Mallory Daisy (c) student r505 Fulton (EM) Mallory Early (c; Louise) lab h303 Charles (SM) Mallory Eddie M (c) student ro05 Fulton (EM) Mallory Elbert (c) r409 (410) Crisp (SM) Mallory Howard (c) r409 (410) Crisp (S M) Mallory Jas (c; Loraine) lab hl87 Hat- field al (SM) Mallory Louise (c) r355 (456) Alabama (SM) Mallory Maggie (c) Indrs h409 (410) Crisp (SM) Mallory Minnie (c) maid r721 (613) Prince (SM) Mallory Robt (c) lab r721 (613) Prince (SM) Mallory Ruth (c) maid r974 Pio Nono av (V) Mallory Sami (c; Lula) lab h721 (613) Prince (SM) Manderson Maggie fcty wkr Happ Bros Co rlS Willingham (EM) Manderson Otis (Ruth) fcty wkr Hann Bros Co h201 StJohn (EM) MRanitdzersTohneaSttreeverDll2(0MiWldarelnduRt ) doormn Manderson W Steph (Mabel) his Wil- lingham (EM) Maner Grace W opr SBT&TCo rl04 La- mont av Maner Roy C (Norma) dispr Ga Power Co hl04 Lamont av Mangels of Georgia Inc Mrs Anna Stubbs mgr women's furngs 420 3d Manget Victor (Nell H) examiner h317 Corbin av (V) Mangham Billie sten h2:13 Bond apt B3 Manghum Geo (c) lab hl02 (150) Tur- pin (T) Manley Jas (c; Eva) lab CofGaRy hl07 Short la (EM) Manley Jesse tchr Ga Academy for the Blind rl501 Vineville av Mann Adam (c; Annie M) chauf h623 3d av (V) Mann Chas O (Julia) slsmn Taylor Iron MWankns D&avSiudp GCoRhe2v17(GCeorllterugede) h420 Forest av (V) Mann E LeRoy (Martha) elk Ga Market House r RD 3 Mann Hazel B Mrs bkpr h321 1st Mann Horace J (Florrie) mill wkr Bibb Malone Berta Mrs smstrs r662 Walnut Mfg Co h301 Applewood (EM) TEL. Malone Booker (c; Leona) lab CofGaRy Mann Ivan H jr mach CofGaRy rlO (69) Walls al (NH) Mann Jack Battery Co (Jack N Manm 529 Malone C Reynolds (Mattie M) mach h 669 3d 106 Heard (SM) Mann Jack N (Hazel B; Jack Mann Malone Carrie (wid J Frank) smstrs Battery Co) h321 1st Union Dry Gds Co hl42 Laurel av (N Mann John (Eula) h342 White (SM) H) Mann Jos W (Ruby) lab h38 (212) Mel- DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Praotieally Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere calf on us R. L. POLK & CO. DETROIT Malone Cleveland (c; Julia) lab hl33 Wilson (EM) Malone Coile (Ola M) supvr r2129 Broadway Malone Comer R tinner CofGaRy Malone Elma (Inez) eng r727 Orange Malone Frances slswn r324 Jenkins (S M) Malone Gordon E (Lucile) driver Ernest C Porter rl02 Marshall av Malone Grover S (Susie) agt h!17 Buena Vista av Malone Hodge H (Claudia) lab h224 Chappell (SM) Malone Howard E (Lillian S) bkpr R H Matthews Inc x664 Napier av Malone Jas C (Addie) lab hl25 Steele (SM) Malone Jas R delmn Arth B Moore rl25 Steele (SM) Malone Julia r324 Jenkins (SM) Malone Kate C Mrs tchr PS r436 Wash- ington av Malone Lanceford r324 Jenkins (SM) Malone Leonora tchr Mt de Sales Acad- emy r653 Hemlock Malone Lillian waiter Bon Ton Cafe r 324 Jenkins (SM) Malone Lillius cond r865 Orange Malone Minnie fcty wkr Happ Bros Co rl25 Steele (SM) Malone Myrtle Mrs interior decorator r 324 Jenkins (SM) Malone O Kelly lab r809 Clinton (EM) Malone Pearl (c) hl215 3d Malone Polly slswn rllO Nisbet pi Malone Robt (c) lab rl215 3d Malone Robt H (Sara) loco eng h288 1(292) Cherry av Malone Robt H jr r288 (292) Cherry av Malone Violette C Mrs elk r509 Ameri- can blvd Malone Wm J (Annie C) mgr National Finance Co r2834 Houston av (SM) Manard Chas H (c; Louise S) lab hU03 Dempsey av (U) rose (B) Mann Julia C Mrs bkpr E Tris Napier Co r217 College Mann Larkin (c; Sara) h'304 Ward (V) Mann Leroy (Georgia Market House) r 4110 Houston av (SM) Mann Nannie Mrs h4110 Houston av (S M) Mann Pearl S (wid Thos B) r4 Gustin pi (V) Mann Raymond elk Ga Market House r 4110 Houston av Mann Robt E jr (Cornell; Coggin & Mann) h217 College Mann Wm J (Mattie L) ctr S M Watson Mfg Co h555 Elm Mannheim Edw student rll3 Dixie av (S M) Mannheim Jos formn hll3 Dixie av (S M) Mannheim Josephine rll3 Dixie av (S M) Mannheim Martha rll3 Dixie av (SM) Mannheim Sarah rll3 Dixie av (SM) Manning Bruce E (Jeannette B) instal- ler SBT&TCo hl03 Log Cabin dr Manning Mamie (c) cook h218 Jefferson Manning Paul W (Estelle W) driver h 107 Pineview av Manning Robt (c) rllO (231) Turpin (T) Manning Manning Sami slsmn Wm (c) lab rGl0a9R(a2d1i5a)toMr ilCl oavr 216 Mutual av (V) Manning Wm (c) porter Frieds Garage Mrasnl4r0yO WComllegce (dRruth B) mgr Royal T(NyHpe)writer Agcy hill Nottingham dr Mansfield Addison rl59 Broadway Mansfield Dray Line (Mrs Minnie L R Hill) trucking 225 Walnut Mansfield John (Thelma) cond 1x619 (611) Johnson av (HH) Mansfield Lizzie (wid Isaac) hl59 Broadway Mansfield Willis S (Ethel) gro 397 American blvd r RD 2 243 Manson Anna (c) lndrs r209 (207) Ocmulgee Manson Booker (c; Orman) mill wkr MBanibsbonMCfagrrCieo h(cl)09coSohkorrltl6laPr(EicMe )(V) Manson Clinton (c; Elvenia) h604 Broad (EM) Manson DeWitt lab Macon Milling Co Mhaln0s3o9n 3Jdohn W (c; Willie) lab h604 Center (EM) Manson John W (c; Hattie) lab h307 (306) Crisp (SM) Manson Mack (c; Beulah) lab h504 Pul- ton (EM) Manson Monroe (c; Mary) lab Macon Milling Co rl039 3d Manuel Cora (c) lndrs h608 (308) Smith (EM) Manuel Fannie M (c) maid r608 (308) Smith (EM) Manuel Henry (c; Janie) lab h361 Chest- nut Manuel Rosa, (c) h rear 368 Flanders (E M) Manuel Wilbert (c; Mary) hoi Parker av CV) Manus Walter formn r201 Simmons Mapes Ada A (wid Silas W) h547 Geor- gia av Maple Chester A electn CofGaRy Maple Chester A student rl85t Laurel (N H) Maple Dorothy (c) maid r325 Maple Maple Orlie E (Pearl) hl85 Laurel (N H) Mapp Edw (c; Falvia) lab h861 (867) Broadway Mapp Emily (c) smstrs Dixie Jobbing House Mapp Lula (c) cook r;108 Holt la (V) Mapp Susie (c) h4 Harris al Mapp Wm (c; Julia) lab hll3 (122) Marlow Nathan (c; Ella) lab rl50 Lincoln av (V) Marlowe Ella W Mrs cash Burden Smith & Co h.852 New Marlowe Lizzie (c) lndrs hlOl (57) Davis la Marquess John student rl08 Rogers av (V) MARQUESS WM H JR (Leila R), Dist Mgr Equitable Life Assurance Society of the United States, hi98 Rogers av (V), Tel 2921 Marquess Wm H III student rl08 Rogers av (V) Marquis Wm S mgr Wilmer M Cox r3403 Houston av (SM) Marron Frank (c) rl40 (128) Army Lot Marsden Alice H (wid Geo) r810 Mul- berry apt 6 Marsden Ethel sec h8l0' Mulberry apt 6 Marsh Essie opr SBT&TCo r208 Peach- tree (EM) Marsh Geo H (Violet) h207 Peachtree (EM) Marsh Jos E (Wilhelmina) lab h63 (117) Cedar (SM) Marsh Lem C (Thelma C) proof reader Macon Evening News rll8 (9) Holt av (NH) Marsh Oscar H student r212 Clisby pi (V) Marsh Sallie A (wid John S) h208 Peachtree (EM) Marsh Wade W student rll8 (9) Holt av (NHts) Marshal Frances student rllo Forest av (B) Marshal Frank carp rl!6 Grady (SM) Marshall A Roy (Lucille) h680 Courtland av Marshall Adeline (c) H105 (222) Hendrix al Marshall Allen W (Pearl) printer h:186 Tracy's la Marchant Walter student r254 New Marchman Leola (c) lndrs h200 (400) Roye (CH) Laurel av (NH) Marshall Allen W jr (Ellen) rl86 Laurel av (NH) Marshall Alvah R mach CofGaRy Marchman Raymond atndt American Oil Co rl68 Spring Marchman Robt W (Ruth) bus opr Ga Power Co h257 Orange Marcier Harry P displaymn Sears Roe- buck & Co r Macon Hotel Marcus John (c; Lillian) lab rlO'51 Pio Nono av (V) Marcuson Isaac E Rev (Rose T) rabbi Temple Beth Israel h204 Buford pi Marillus Bertha (c) maid r301 Green Marilyn Slipper Shop Lewis Berger mgr shoes 578 Cherry Marinello Beauty Shop (Mrs Lucy RobMbaerirotsn) A4r0t3h (Cch; eNrreyllieR)31l8aIb-2h0 ll5 4th av (U) Marion Claudia (c) cook h235 Jefferson Marion Ella M (c) r235 Jefferson Marion Estelle (c) maid r422 Liberty (S M) Marion Jas (c; Mary) hll7 2d av (V) Marion Jas jr (c) student rll7 2d av Ma(Vri)on Lamar (c) lab r422 Liberty (S M) Marion Mable (c) maid r422 Liberty (S M) Marion Ola M (c) maid rl04 (171) Elk- ton pi (SM) ^ Marion Rosa (c) r422 Liberty (SM) Marion Rosa L (c) lndrs h921 Clmton rd (EM) Marion Zenoria (c) r422 Liberty (SM) Markert F Earle (Emmie) slsmn h813 Hillyer av (CH) _ ,, Markinz Louise (wid Harry S) r23il Roff Home av (V) , ,_ Markwalter Geo E (Theresa) cash The Southern Cotton Oil Co h237 Notting- ham dr (NH) Marshall Annie L (c) smstrs rll6 (188) Tindall av (SM) Marshall Apartments 232 High Marshall Augusta sten WPA r Lizella Marshall Beatrice Mrs cash Walgreen Co r320 Spring Marshall Chas (c; Eva) lab hl07 Drews qtrs Marshall Chas G collr Swift & Co r Ho- tel Fickling Marshall Chas G (Beatrice) ins slsmn Interstate Life & Accdt Co r320 Spring MMaarrsshhaallll Ccllearoa G(c) (hL2il1lie()16)meSchhorSt oSutthla- eastern Greyhound Lines r457 New Marshall Dorothy student rl91 Belmont Marshall Douglas (Lillian E) supvr Cof GaRy h737 Blackburn (NH) Marshall Evelyn H Mrs sten Fust Natl Bank & Trust Co rl86 Laurel av Marshall Fannie (c) maid hl7 (6) Para- dise al Marshall Furniture Co (Hyman Mar- shall), Complete House Furnishers 55658 Poplar, Tel 3926 Marshall H C partsmn McCormick Deering Store r Bellevue Marshall H T student r98 Mercer ter Marshall Harry E reporter Macon Evening News rl49 North av (NH) Marshall Harry L ins slsmn Interstate Life & Accdt Co r320 Spring Marshall Henry C jr elk r302 Mercer Marshall Hialmer D (Mildred; Highland Pharmacy) hll5 Nottingham dr (NH) Marshall Hymann (Annie; Marshall Furniture Co) h255 Hill Crest av (CH) Marshall Ira (c; Lula) lab hl60 Elm Marshall Joe L (Kathryn) car repr Cof GaRy h617 Arch Marshall John (c; Mamie) lab r616 Ross 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 244 DIRECTORY LIBRARIES We Halve on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City In the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere eall on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 Marshall Larkin (c; Margt) medicine mfrs il57 5th h do MmARatSioHnALSLec LMUaCcIoLnLEChaLmbMeRr So,f ICnfoomr-merce, h680 Courtland av, Tel 3202-M Marshall Mary rl24 Cole Marshall Mary (c) rll5 Price (V) Mcaersrhall Mattie (wid Rofat H) r302 MerMarshall Mattie L (wid Prank R) rl924 Broadway Marshall Milton student r255 Hill Crest av (CH) Marshall O Roy (Alma) whsemn Natl Handle Co h325i Reid (SM) Marshall O Wesley jr student r840 Courtland av (CH) Marshall Obediah M (Wilhelmina; Ex- change Pharmacy) h.149 North av (N H) Marshall Onan E (Clara E) elk hl91 Belmont av Marshall Onan W (Jessie) slsmn Yates & Tabor Co h840 Courtland av Marshall Onie E (Clara E) slsmn Dannenberg Co rl91 Belmont av Marshall Paralee (c) h508 (458) Hall (E M) Martin Emmett E (Imogene C) h766 Cherry Martin Emory student rl03 StJohn (E M) Martin Ernest R student r223 Tatnall Martin Essie fety wkr Happ Bros Co r 132 Stratton (SM) Martin Ethel cash rl03 StJohn (EM) Martin Fleta r220 1st Martin Florence P (wid Oscar L) h223 Tatnall Martin Frances E student r506 Beech av Martin Frankie (c) maid rll3 Mulberry Martin Fred R (Minnie B; Martin, Mar- tin & Snow) r Rivoli Martin Garry B (Mildred) slsmn G R Kinney & Co rllO 3d Martin Geo (c) loco firemn rl325 Broad- way Martin Geo T elk GtA&PTeaCo r|453 Boulevard (NH) Martin Grace student r871 Mulberry Martin Haidee mus tchr 702 Napier av h do Martin Harry cabtmkr Union Dry Gds Co r616 1st Martin Hattie (c) maid r325\ Maple Martin Hattie Mrs rfil5 Spring Marshall Rebecca smstrs r325 Reid (SM) Marshall Robt (c) mill wkr Bibb Mfg Co rl60 Elm Marshall Robt J driver Henry C Mar- Martin Henry M prof Mercer Univ rl30 Coleman av (CH) Martin Horace (Edna) flagmn hl406 2d Martin Ida student rl36 Cole shall r302 Mercer Marshall Roosevelt (c) lab rll6 (188) Martin Ira L (Ruth) barber Commercial Barber Shop hll52 Milledgeville Tindall av (SM) Marshall Sarah (wid Robt) fety wkr r211 Reid (SM) Marshall Thos (c; Eula M) lab h708 rd (EM) Martin J J (Isabelle W) saw filer Cen- tral Sash & Door Co r RD 5 Martin J Oscar (Viola) barber Genones Hawthorne Barber & Beauty Shop h871 Mulberry Marshall Uriah (c; Belle) lab hll6 (188) Martin Jas A meatetr Andrew L Harris Tindall av (SM) Marshall W Leon (Cora) elk Ruan & Co h861 Hillyer av (CH) r248 Main (EM) Martin Jas M (Maggie) fctywkr h rear 2336 Forsyth rd Marshall Wm (c) lab rl630 1st Martin Jas P elk r223 Tatnall Marshall Wm (c; Dora) lab 1x121 Woodcliff Martin Jas W student r302 Jones av (E M) MParieshrcaell aWvm(VJ) (Bessie) tchr PS hl08 Marshall Wm J jr student rl08 Pierce Martin Jessie (c) lndrs hl08 (131) Elizabeth (SM) Martin John R (Maxie J) mech Frank av (V) Marshall Wm L (Veda P) hl30 Virginia Marshall Wm N (c) hlpr CofGaRy Marshall Willie B (c) cook h25-26 7th Marstella Howard (Ida V) driver r3311 Houston av (SM) Martin A Clifton elk Bibb Mfg Co r302 Jones av (EM) Martin Albert (Julia) pntr r706 1st Martin Anne Mrs supvr Ga Academy for the Blind rl501 Vineville av Martin Annie (c) maid h.221 Moughon (V) Martin Anthia (wid Jesse) mill wkr Wil- lingham Cotton Mill 1159 Holt av (N Hts) Martin Benj P (Margt) elk rl808 2d Martin Bertha (c) h781 Reynolds al Martin Carrie (c) lndrs hi 13 Mulberry Martin Chas (c; Ella) janitor h326 3d av (V) Martin Chas (c; Laura) lab h229 Jefferson Martin Chas I (Fannie L) vending machines 664 Cherry 1x506 Beech av Martin Claudie (c) cook h385 Melrose (EM) Martin (Cora (c) lndrs hl413 1st Martin Cora E (wid P Webster) 1x32 Progress Martin David (c; Effie) porter Dunlap MRarotibnerJtsohhn30S26(EHliozuCst)onconadv h(lS3M6 )Cole Martin John W (Minnie F) phys 403 Cherry R718 h214 Clisby pi (V) Martin John W jr inspr State Hwy Bd Div No 2 r214 Clisby pi (V) Martin Johnnie (c) maid rl5|6 Hill Martin Julian L elk McKesson-Riley Div r371 1st Martin Leila (c) lndrs hl6 Graham's Lot Martin Lenora P Mrs smstrs r819 Wal- nut Martin Lila (c) smstrs r453 Arch Martin Lillie (wid Jas M) h452% Mul- berry Martin Lillie M Mrs r816 3d Martin Lonnie (c; Ruth) lab hl29 (522) Army Lot Martin Lucille r404 Forsyth Martin Luther (c; Beulah) lab hl028 College dr Martin Lyndon J (Mary) wtchmn 1x250 Washington av Martin Marcella D student r263 Bond Martin Marion M mill wkr Bibb Mfg Co r302 Jones av (EM) MARTIN, MARTIN & SNOW (Fred R and T Baldwin Martin and Cubbedge Snow), Lawyers 618-626 Bibb Bldg 403 Cherry, Tel 4731 Chevrolet Co h955 Broad (EM) Martin Domingo S (Emma L) elk Harry Martin Matchen L mill wkr Willingham Cotton Mill r61 (12) Dannenberg al Wright hi03 StJohn (EM) Martin Mildred E (wid Frank) office sec Martin Edw (c) waiter Hotel Lanier r Jos W Popper r925 ( 926) Cherry 1120 Broadway Martin Nannie E (wid L Jackson) hl03 Martin Eliz r856 Mulberry Rocky Creek rd Martin Ella M (c) student r326 3d av Martin P Webster W (Roma B) elk Cot (V) GaRy hl30 Napier av 245 ROBERT O. THOMAS 569% Cherry St. REALTOR Telephone 1067 Martin Pearl (c) cook r504 (455) Ala- Martin' Rachel Mrs mill wkr Willingham Cotton Mill h309 Vine (NHts) MARTIN RALPH L, V-Pres A T Holt Co, h515 Linden av, Tel 985-M Martin Roht D (Margt) sis rep h305 College apt 3 , ,,^ . _ Martin Robt M (Eliz A) trav frt agt C ofGaRy h7 Glynn av Martin Rosa (c) h228 Harris Martin Rose E student rll09 Vmeville Martin Rufus (c) r453 Arch Martin Ruth student rl03 StJohn (EM) Martin Sarah (c) cook rll3 Mulberry Martin Sarah S (wid Jas H) r702 Napier Martin Smith A elk US PO ro33 Orange apt 2 Martin Steph D (Claudie M) lino opr Macon Evening News [h.421 New Martin Susie (wid Harry) matron Meth- odist Orphans Home r201 Pierce av i(V) Martin Susie B (wid Chas C) elk r856 Mulberry Martin T Baldwin (Mary B; Martin, Martin & Snow) hll09 Vineville av Ma(Vrt)in W Wesley (Kathryn P) elk Pigelv Wiggly Store rll5 Beech av MAardtianmsW-BiullcahrdanaRn M(LotoourisCe o Bh)301mOecrhMmarotinnd Wtemr (c) r20,,,,1 _Telfai. r Martin Wm (c) lab Lee & Smith Mule Co Martin Wm (c) porter rl03 (26) Waynes Mason Frank (Emily) welder hl22 Ponce de Leon av (SM) MlaisnognhaFmredCLott(oBnonMniiellJ)h2m19ill (w23k)r WHoill-t Mason ^Fred* L jr student r219 (13) Holt Mason gIoS)(c; Laura) chauf hl62 Col- Mason Geo (c) confr 512 3d av (V) h Mason Geo (c) lab Mason Geo (c) lab ^301 Plant (SM) Mason Geo L (c) lab r405 Charles (SM) Mason Geo W (c; Lillian) reprmn John- son Bros h512 3d av (V) Mason Hazel elk Kenmore Burns Inc r533 Orange , , . Mason Irene waiter New Yorker r36l 1st Mason Jas D lab r612 Hawthorne Mason Janie (c) lndrs r513 Forsyth Mason Jos (c; Leila) porter h308 Madi- Mason John W (Frances A) supvr CofGa Ry h717 Hemlock Mason Lexie beauty opr Union Dry Gds MCasoonr2L51illiNanew(c) tchr PS r512 3d av Mason Lillie B (c) lndrs h403 Mason (S M) Mason Louisa (wid Marion) r205 (2) Dannenberg av Mason Newell tchr PS hl'51 2d Mason R Holmes (Estelle S) dentist 499 2d R406 hI19 Beverly pi Mason Robt (c; Luella) lab r237 Jones Mason Theodosia (c) student r512 3d av Ma(Vso)n Thos L student r301 Blackburn Marthf'wm student r819 Walnut Martin Wm A (Sarah J) elk h302 Jones MartiuhWm A filling sta 1143 Milledge- ville rd (EM) Martin Wm B r do (Gladys) mgr Tmat. nal,,l Square Drug Store r!04 Culver (V) MmaritsinsioWnemr hE26(3MaBrocneldla G) U S Com- Martin Wm M (Bessie) hll5 Florence Maavrtin(SWMm) N (Mammie) emp C_ofGa_Ry hl50 Mill av Martin Willie (Nora) mill wkr hl05 (Riley Martin Zora (c) r527 Calhoun Marvin's Grocery (Marvin Z Bailey) 2105 Vineville av (V) Mary Ann Beauty Shop (Mrs Martha H Pettey, Doris Huff) 620% Cherry Mary Lou Shop Sarah Chanin mgr clo 468 Cherry Mashburn Zula (wid John) r335 College Masivic Club meets 710 Mulberry Mason Albert (c; Eunice) brklyr h202 (220) Fargason (V) Mason Alice (wid Jas) r1336 2d Mason Aug (c; Susie M) lab h528 (498) Hill Crest av (CH) Mason Bonylin E mill wkr Willingham Cotton Mill r219 (23) Holt ay (NHts) Mason Clem (Lillian) mill wkr Bibb Mfg Co hi 18 Comer ter (PM) Mason Clifford (Connie) mill wkr Willingham Cotton Mill r213 Carling av Mason Dalzie beauty opr Union Dry Gds Co r251 New Mason Danl mill wkr Willingham Cotton Mill r205 (2) Dannenberg av Mason Effie (c) cook r857 3d Mason Eliz (wid Leo H) cash h251 New Mason Emily E rll9 Beverly pi Mason Emma Mrs smstrs rl023 Ash Mason Ernest (c) lab r541 Pio Nono av (V) Mason Ernest B bus opr Ga Power Co 111336 2d Mason Ethel J (c) r405 Charles (SM) Mason Eva (c) maid rl06 (5) Cedar (U) Mason'* Wiley A (Olice M) agt h206 Pierce av Mason Wm E (Julia H) inspr CofGaRy h801 Adams Mason Wm F blksmith CofGaRy Mason Wm H student r301 Blackburn Mason'* Willie B (c) maid r217 (218) Cedar (U) Mason Wilson G (Minnie L) spl agt Ga Inspection & Rating Bureau hll3 Avon rd Masonic Hall 111 Cotton av Masonic Hall (c) 411% Cotton av Masonic Home of Georgia Harrison Daugherty supt Masonic Home rd (N H) Masonic Temple 710 Mulberry Massee see also Massey Massee Apartments 401-05 College Massee Wm J (Ethel) v-pres Standard Brick & Tile Co h558 College Massee Wm J jr student r568 College Massenburg Geo G (Dorothy) phys 567 Walnut r Shirley Hills Massenburg Rosa 116 Hines ter Massengale Wm A (Gladys) cable splicer h709 Main (EM) Massengill Margt sten Dunlap Chevrolet Co r706 Pine Massey see also Massee Massey Alma A (wid Orren W) h255 Hardeman av . , ,,,,,, Massey Andrew (c; Sarah) h807 Willow Massey Carl rl02 Cleveland av (V) Massey Celia (c) cook rl06 (300) Spring la Massey Daisy M (wid Chas O) h224 Georgia av . ,,, , Massey Dawson G (Frances) agt Liberty Natl Life Ins Co rl520 2d Massey Edmond C elk Central Ga Bak- ing Co r RD 4 , , Massey Edmond C jr (Jewel G) slsmn Collins Baking Co rll05 Walnut Massey Edw (Pearl) mill wkr Bibb Mfg Co r322 (364) Center (EM) w 00 Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy f 246 OTf'it OT A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Massey Eug M (Eliz) slsmn hl05 Clayton (V) Massey Eva mill wkr Bibb Mfg Co rl06 Emerald (EM) Massey Evelyn Mrs dept mgr Helds Dress Shop r2403 2d Massey Geo (Annie R) farmer hll55 (2) Milledgeville rd (EM) Massey Hattie P Mrs h234 (8) Clinton (EM) Massey Henry S (Susan M) eng Kinnett-Odom Co r94 Lawton av Massey Herman B (Minnie L) mill wkr Bibb Mfg Co hlO Schell av (EM) Massey Irvin B (Willie) h627 Main (E M) Massey J Morgan (Martha) slsmn rl03 (165) Cherokee av Massey Jo B (Eliz; Lucky Strike Bowling Alleys) h476 College apt 5 Massey Jody (wid H Benton) r476 College apt 5 Massey John P (Mary L) slsmn Maxwell Bros Furn Co h604 Main (EM) Massey Mabel M (wid Wm H) rllO Beverly pi Massey Minnie L Mrs mill wkr Bibb Mfg Co rlO Schell av (EM) Massey Myrtice mill wkr Bibb Mfg-Co r 234 (8) Clinton (EM) Massey Nathaniel W collr rl03 (165). Cherokee av Massey Ralph C (Hazel) fety wkr h2 Mathews Marion student r204 Center (E M) Mathews Martha (c) maid r364 Elm Mathews Mary (c) Indrs h704 Guernsey la Mathews Mary A (wid Pierce W) slswn hl07 (110) Crisp (SM) Mathews Mary F rl43 Rose pk Mathews Mattie (c) Indrs r2Q9 Roye la Mathews Meckie (wid Hardy) smstrs Dannenberg Co hl43 Rose pk Mathews Odessa (c) lab r320 Hammond Mathews Remella (wid Holton) h858 New Mathews Robt L (c) lab rlOO Adams Mathews Roy (Margt) elk rl43 Rose pk Mathews Rufus (c; Irene) lab h454 Bav Mathews Ruth opr SBT&TCo r203 Ful- ton (SM) Mathews Stewart complaint del Macon Evening News r858 New Mathews Thornton L (Louise) slsmn h 315 Buford pi (V) Mathews Toisie (c; Corinne) atndt h42 Harris al Mathis C Buford bkpr Fenner & Beane x507 College Mathis Carl C (Hazel) mech h467 Spring Mathis Chas (c) confr 334 Monroe r363 * -do Mathis Chas P h677 Edgewood av MJaothhinssoCnlau(SdMe ) (c; Nettie) lab hll6 Bond (B) . . .. - . \ Mathis David' ,(c; Mary) h9 (II) Short Massey Wm W (Alma) eng dispr CofGa St la -> Ry hi02 Cleveland av CV) Massie Anne C (wid Marion) b239 Col-. lege Massie Cleveland r239 College MMat>his Eliz (c) student rl52 Fulton (E Mathis- Evelyn (c) maid rll03 (803) Woolfoik (EM) Massie Marion slsmn r239 College * Mathis Evelyn (c) student r363 Monroe Masters Warring R (Nannie; Shorty's Mathis Frank (c) restr 336 Monroe h do Tavern) r2909 Houston av (SM) Matheny J A1 (Ruth) slsmn Coleman- Meadows-Pate Drug Co h631 Vineville av (V) Matherly Spencer J farmer Hephzibah Orphanage r Forsyth rd P OBox 222 Matherson Clara (c) hl34 Army Lot Mathes Camilla (c) h852 Foster's al Mathes Frank (c) rllO (158) DeBorde (SM) Mathes Isaac (c) lab CofGaRy Mathes Wm (c; Mentrous) lab hllO K15|8) DeBorde (SM) Mathews see also Matthews Mathews Alice (c) r624 Chapman al Mathews Chas (c; Millie) h.320 Hammond Mathews Donald (Martha) elk h2322 2d Mathews Dorothy r315 Buford pi (V) Mathews Emma J r455 Carling av Mathews Erma nurse 262 Columbus r do Mathews Gladys (c) cook rll4 Morris MSatphreiwngs Henry (c; Ella) cook h62 Mathews Irene beautician Dannenberg Co r667 2d MATHEWS J W C (Myrtice), Sec-Treas A T Holt Co, h328 Buford Place, Tel 4075-J Mathis Harvey A (Nannie) optometrist Dannenberg Co rl40 High Mathis Hattie (c) maid r225 Watson al (SM) Mathis Hazel Mrs cash Union Dry Gds Co h467 Spring MFatrhainskJa3,s1 (c; Mary L) lab hl31 (20) Mathis John (c) pntr r240 Woodcliff Mathis Jos (c) lab rlOO Phillips al (S M) Mathis Jos (c) slsmn r363 Monroe Mathis L C (c; Elnora) mach hl09 Johnson (SM) Mathis Mary L (c) Indrs h505 Moore av Mathis Ruby (c) cook r411 Madison Mathis Susie (c) r202 Woodcliff Mathis Wiley S (c; Annie M) lab h617 3d av (V) Mathis Wm L (c; Katie B) gro 325 Mon- roe h363 do Mathis Wm L jr (c) elk Wm L Mathis r363 Monroe Matson Robt G (Willieu) dept mgr Goodrich Silvertown Stores h823 Patterson (NH) Matterson Clara (c) hll2 E Ell Matthew Arth (c; Annie L) lab r359 Hazel Matthew Claude A mach r221 Jones av Mathews Jas M r328 Buford pi (V) (EM) Mathews Jas W student rl09 (107) Log Cabin dr Mathews John B (Willie) elk American Bakeries Co r203 Fulton (SM) Mathews John N (Helen) mach CofGa Ry hl09 (107) Log Cabin dr Mathews John W driver Yellow Cab Trans & Baggage Co r58 New Mathews Lemuel F (Janie) city firemn h204 Center (EM) MMath) ews Lillian student r204 Center (E Mathews Lucile student r204 Center (E M) Mathews Macy sten Maxwell Bros Furn Co r262 Columbus Matthew Cleo L (Doris) supt Morris Putzel h208 (248) Church (EM) Matthew John A (Jennie M) formn Macon Milling Co h221 Jones av (EM) Matthew Lillian Mrs bkpr Standard Brick & Tile Co rll6 Seminole Matthew Newton r221 Jones av (EM) Matthews see also Mathews Matthews Adeline (c) Indrs r601 (269) Prince (SM) Matthews Allen R jr reporter Macon Telegraph h221 Coleman av (CH) Matthews Arth L (c) delmn John Tim- othy) r356 Madison Matthews Benj F (Emma) v-pres Safety Cab Co h766 New 247 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Matthews C Mason (Era I) slsmn Bank- ers Health & Life Ins Co h'576 Boule- vard (NH) ^ ^ Matthews C Mason jr student r576 Boulevard (NH) Matthews Carrie (c) maid hll2 May Matthews Clara B (c) lndrs h406 (150) Bartlett Matthews Claude A mach CofGaRy Matthews Cora (wid Jos E) rl33 Hines ter (V) Matthews Curtis B (Marion C) ship elk Matthews R H Inc Robt H Matthews sec-treas jwlrs 409 Broadway Matthews Rebecca (c) r642 4th av (W H) Matthews Robt r710 Anderson (SM) Matthews Robt (c) lab r365 (342) 3d av (U) Matthews Robt H (Ann B) sec-treas R H Matthews Inc hU2 (192) Buckingham pi (V) Matthews Roy (Margt) elk r451 Spring Matthews Saloma (c) cook rl82 Davis A G Rhodes & Son h319 Johnson av (HH) Matthews Dee (Haseltine) mgr P W Woolworth Co h305 College apt 4 (U) Matthews Theo B (Lillian C) slsmn hll6 Ninadeil dr Matthews W Cobb student rl08 Corbm Matthews Duffey (c; Pearl) lab r857 3d Matthews E Geo lab City Matthews Edw (c) lab r365 (342) 3d av (U) Matthews Edw (c; Annie) h365 (342) 3d av (U) Matthews Efford C (Alice B) slsmn r459 Carling av av (V) Matthews Willie L (c) r356 Madison Mattox Addie (c) lndrs h304 Womack (E M) Mattricks Sallie N (c) lndrs h925 (959) Ocmulgee Matut Abr rl24 (102) Bay Matut Esther (wid Nathan) rl24 (102) Matthews Eldredge driver rl45 Academy Matthews Emory C (Helen H) asst sec- tNreoatstinCgihtyamBddrof (WNHa)ter Com,,nrs hl23 Matthews Ernest (c; Annie) lab hl.7T Lincoln av (V) Matthews Etna D tchr PS Matthews Evelyn elk r309 (HH) Matthews P Theo (Margt-M>-aSkt mg/ Citizens Loan Co Vljc Ninadeil dr ,, Matthews Fannie W sch tchr r221 Cole-T Bay Matut- Jos (Freida; Bay Street Cash GrbceryX hl24 (102) Bay c'fflkuloan John D (Clara L) mach CofGa TNw nl03 Putnam tyauncy John (Maggie) lab rl74 Pal- ace av \ Maund EMltta* F rl09 3d Maund Johh (c) lab hl08 Pranklm unfdl- LMyadriya C(c)r4l5n6drCsenrlt0er8 (FErMan)klin S Frances (wid A Preston) h456 m ROOFINGS EVERLOX SHINGLES man av (CH) * , Matthews Prances student rlQJ Buck- aundf A&essie V receptionist City Dept ingham pi (V) t\ N Matthews Geo bell bQjfc,Hotea Maccion r% 244 Garden (EM) \ ' Matthews Harry stud^it /i'576 BoufOyard ?jVmlaix~PNuobrlaich W(c;elMfaraeryrlL09) y3ddmn h rear 355 Edna pi Maxwell Annie M lab rl04 Emerald (E M) Matthews Henry (c) lab r872% Hazel Matthews Henry (c; Mary) lab hll7 Maxwell Bert jr bkpr Maxwell Bros Furn Co h316 Linden av apt B SHEARLIBDEARNT, EM. gr. YOUR Sapp av (U) . . . MAXWELL BROS FURNITURE CO, CITY Matthews Isaac (c; Ruth) lab h619 4th av (WH) Matthews J Oscar (Daisy L) coremkr WFurGnisBhelarcskw45e5ll2Md, gTr,elC4o4m01ple(tFeoHr ofuusrether information see right top lines Taylor Iron Wks & Sup Co hl07 (266) and page 15 Buyers' Guide) Pearce (EM) Maxwell Bros Inc C Rosa Miller v-pres Matthews J Paul (Marie) electn Morris iPutzel h614 Broad (EM) box mfrs ft Poplar Maxwell Chas (Ida) lab hl04 Emerald Matthews Jack B student rl08 Corbin av (V) Matthews Jas (c) lab r406 (150) Bartlett (EM) Maxwell Chas (c) lab h935 Montpelier Maxwell Chas jr (c) lab r935 Montpelier Matthews Jas M student rll2 Bucking- Maxwell Evelyn lab rl04 Emerald (EM) ham pi (V) Maxwell J C (Ruth) mill wkr Bibb Mfg Matthews (HH) Matthews Jas Jas W elk h309 W jr (Linme Johnson av L) dJ ept mgr Co hi 12 (44) Hydrolia (EM) Maxwell Jas h210 (5)2) Clinton (EM) Maxwell Louise (c) cook r935 Montpelier Huckabee Auto Co r309 Johnson av (H Maxwell Marvin B (Alice) formn CofGa H) Ry hl'81 Cedar (SM) Matthews John T (Anna R) supt The Southern Cotton Oil Co hl08 Corbin Maxwell Oscar N (Christine) slsmn h429 Duncan av av (V) Maxwell Ruth mill wkr Bibb Mfg Co r Matthews M Bedford (Lillian P) hl05 Pierce av (V) Matthews Mabel lndrs Crescent Lndry Co r4 Stewart's la Matthews Malachi (c; Annie) lab hl433 Broadway Matthews Margt tchr PS r221 Coleman av (CH) Matthews Margt M Mrs beauty opr Union Dry Gds Co rll6 Ninadeil dr 112 (44) Hydrolia (EM) May Agnes E (c) tchr Hudson Industrial Sch r302 (303) Clarks av ((V) May Carrall (c) rl2 Parker av (V: May Charity (c) h95 Harris al May Chas (c; Irene) lab hll6 Green (V? May E Wm driver rl06 Academy May Eliz (wid Harry C) rllS Academy May Emmie L Mrs hi06 Academy May Evelyn dept mgr Burden Smith & MIRRORS the Matthews Margt S (wid Benj B) h.710 Co r53 Arlington pi Anderson (SM) May Geo A 1x312 Carling av Industrial Matthews Martha L tchr PS r221 Cole- May Geo A jr student r312 Carling av man av (CH) May John (c) lab hl04 Cutro al Matthews Mary C rll6 Ninadeil dr Matthews Mildred (c) r365 (342) 3d av (U) May Lucius J (c; Mary) shoe repr 660 Poplar h302 (303) Clarks av (V) May Manda Mrs sten Buckeye Cotton LIFE Of Your Matthews Miles E chauf Safety Cab Co h710 Anderson (SM) ,,,, ,, . Matthews Paul W (c) student r606 Fort Hill (EM) Oil Co r!20 DeSoto pi May Nathan D h215 Boulevard (NH) May Nathan D jr (Amanda) acct Buck- eye Cotton Oil Co hl20 DeSoto pi (V) CITY 248 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES Where To Buy? Consult the Classified Business Lists In This Directory ARLINGTON HOTEL FREE STORAGE BMRoOdeArDn WaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep' THOMAS O. MOSELEY, Prop. May Ralph E (Odessa) slsmn h99 Vineville av apt A2 May Sami J (Julia G) dept mgr R S Thorpe & Sons h21l Boulevard (NH) May Thos (c; Fannie) porter h855 Ocmulgee May Zella (c) cook r569 Monroe Mayberry Jas A slsmn h401 College apt 8A Maye Jas C rl421 3d Maye Robt E (Bernice) mill wkr Bibb Mfg Co hl421 3d Mayer Arrabelle W Mrs cash r718 Mul- berry Mayes Clarence A (Cecelia) slsmn h463 Orange Mayfield Allie Mrs hl04 Whitehead (S M) Mayfield Clay rl04 Whitehead (SM) Mayfield Guy rl04 Whitehead (SM) Mayfield Julius (c) porter T M Raines Gro Co r903 Pio Nono av (V) MraoyofineldalMamie (c) lndrs h221 (6) DisMayfield Rosa L (c) maid r903 Pio Nono av (V) Mayfield Wm (c; Emma) lab h903 (Pio Nono av (V) Maynard Alice (c) drsmkr 110 Middle (V) h do Maynard Amanda (c) cook h646 4th av (WH) Maynard Angeline (c) cook h208 3d CCD Maynard Apartments 109 Washington av Maynard Boren B rl275 Montpelier av Maynard C Adison slsmn rl275 Montpe- lier av Maynard Daisy J rl275 Montpelier av Maynard Elijah (c; Mary) lab h432 Chestnut Maynard Elijah W city atty and lawyer ISO Cotton av R403 r Central Hotel Maynard Gertrude (c) lndrs r646 4th av (WH) Maynard Gladys (c) rl33 Ritohey (EM) Maynard Irene (c) nursemaid r rear 7 Rose pi Maynard Bessie F rl27S Montpelier av Maynard Lois tchr PS rl275 Montpelier Maynard Louise tchr PS rl275 Montpe- lier av Maynard Silas (c; Mandie) lab hl33 Ritchey (EM) Maynard Thos (c; Willie) carp hll27 Napier av Maynard Thos (c; Julia) chauf r806 3d av (V) Maynard Victoria (wid Thos) rl09 Washington av apt 3-4 Maynard W Lawson elk rl275 Montpe- lier av Maynard Wm (c) lab r206 (320) Hawkins Maynard Wm B (Vera) driver r514 Lin- den av Maynard Wm M (Eldora) hl275 Mont- pelier av Mayo Benj T (Ethel M) mill wkr Will- ingham Cotton Mill hi 13 (44) Holt av (NHts) Mayo Earl driver Dixie Dairies r804 Orange Mayo Geo W (Annie M) slsmn Co-Operative Fire Ins Co r342 North av (NH) Mayo Georgia (c) fety wkr r354 Ash Mayo Herman mill wkr Willingham Cotton Mill rll3 (44) Holt av (NHts) Mayo Mary (c) lndrs h.755 Center (EM) Mayo Willey (c; Ethel) porter Sami Shier r82 (133) Forest av (V) Mayo Wm J lab Natl Handle Co rl36 Pecan av Mayo Willie M (c) r310 (124) Bright la Mayo's Murray Zarett mgr clo 604 Cherry MAYOR'S OFFICE (See Macon--City of) Mays Annie E asst librarian Mercer Univ rll55 Ash Mays Dollie (c) r86 Bay Mays Evelyn rl23% Cotton av Mays Geo (c) lab r89 Cheatham al Mays J Crowder Rev (Susie S) supvr h 1156 Ash Mays John (c; Bessie) porter h237 Mid- dle (V) Mays John H (c) r29 Reid (SM) Mays Jos (c; Emma) h314 Norris (EM) Mays Lillian (c) asst cook Douglas Ho- tel Grill rl52 Spring Mays Lillie M Mrs r750 Pine Mays Lucius (c; Ruth) driver hl36 Pe- can av Mays Rachael J music tchr 1155 Ash r do Mays Thos L (Opal G) agt Progressive Life Ins Co h901 New Mays Thos L jr student r901 New Mays Wilbon rl23% Cotton av Mays Wm (c; Eliza) lab r2 Ross St pi Mayson's Women Apparel Sidney L Friedman mgr 359 3d Maze Beulah M mill wkr Bibb Mfg Co rl414 3d McAbee Augustus N (Isabelle) lab h64 Roff Home av (I) McAfee Candy Co (Chas O McAfee) 657 Poplar McAfee Chas O (Lucy M; McAfee Candy Co) hl23 Crescent av (CH) McAfee Eula R (wid John C) h618 For- syth McAfee John C phys r618 Forsyth McAfee Linton C phys 567 Walnut r616 FOrsyth McAfee Louise sten Bibb Mfg Co r561 Hillyer av (CH) McAfee Mary (c) maid rl78 Park Hotel al McAfee Mattie (wid Sami T) r561 Hill- yer av (CH) McAfee Maude M asst mgr Robt K Mc- Afee r914 Napier av McAfee Oscar H (Frances) gro 205 Hardeman av hl02 Florida av (V) McAfee Robt K (Maude M) gro 2101 Vineville av (V) h914 Napier av McAfee Wm A student r618 Forsyth McAlister Andrew T slsmn Taylor Iron Wks & Sup Co r311 (312) Adams McAlister Chas A (Fannie M) pres Tay- lor Iron Wks & Sup Co h311 (312) Adams McAllister Annie M Mrs mill wkr Willingham Cotton Mill hl5 Randolph pi McAllister Beckey mill wkr Willingham Cotton Mill rl5 Randolph pi McAn Thom Edw M Messervey mgr shoes 576 Cherry McArrell Jas T surfacemn Southeastern Optical Co r718 Mulberry McArthur Henry (c; Mary) driver h474 Clinton (EM) McArthur Lucile W Mrs physio therapist 363 1st r do McArthur Paul A (Lucile W) sec YMCA h3'53 1st McArthur Thos E (Fannie D) cond h 756% New McAvoy Margt r926 College McBrearty Chas (Mary E) barber Genone's Barber & Beauty Shop h216 College McBrearty Chas jr student r216 College McBrearty John F (Margt) h849 Pine McBrearty John F jr (Plantation Lunch) r849 Pine McBrearty May r216 College McBrearty Ruth student r216 College McBride Almeta (c) ins slswn r700 (702) 3d av (V) McBride Alonzo (c; Mary) hl310 Broadway McBride Archie (c) driver h513 (114) Elliott (EM) McBride Bemon G (Ethel L) mgr Home Market Co h332 Hanson (SM) 249 MILURONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 McBride Elnora (c) MOO (702) 3d av (V) McBride Howard G (c; Jewel) lab h315 Forest av (V) _ McBRIDE JOHN E (EHz), Sec-Treas The Dannenberg Co, hll3 Boulevard McCanns C W (e) r316 (321) Bowman (EM) McCanns Ida M (c) r316 (321) BowMcmCaannns(ERMo)sebud (c) r316 (321) Bow- man (EM) McBride Lethia F (wid John E) tel opr WUTelCo rll2 Boulevard (NH) McBride Mamie maid Union Dry Gds Co rl717 Dempsey av (U) McBride Ritta (c) student rl28 (227) Norris (EM) Mc&BrDidreyRCoblntgE Cdoryr7c6l6nr CShneorwry's Lndry McBride Sidney (c; Laura) compressmn hl28 (227) Norris (EM) McBride Thos F (Rosalie) pntr h97 Vio- let av (SM) McBride W Howard (c) lab rl717 Dempsey av (U) McBride Wm r301 Cherry McBride Wm R (c; Mamie) carp hl717 MDcBemrypasnety Aalvme(tUa ) (c) agt Afro-Ameri- can Life Ins Co r702 3d av (V) McBryant Obie L (Eliz) tmkpr WFA x 100 Daisy pk McBryant Ollie C (Doris S) carp r424 Cleveland (SM) McCahill Tinus gro 99 Rutherford av (S M) r2998 Houston av (SM) McCain Helen slswn Dannenberg Co r 774 Mulberry McCain Wayne E mgr W T Grant Co r 341 Hardeman av McCaleb Dee (Myrtice) signalmn hl21 Log Cabin dr McCall Alf (c) student rl38 1st av (V) McCall Arth W (Elsie) mech r204 Washington av McCardell Jas B (Winnell) pkr rl22 1st McCarley Dorothy Mrs r308 Ridge av (V) McCarren Crescent Chas C Lndry C(oHer3le8n9l G) routemn Orange McCarren Helen G Mrs mus tchr 389 Orange r do McCarthy Alene (c) lndrs h22 (19) Mul- berry la McCarthy Beldin (c) rl29 Wood al McCarthy Chas (c) hlll3 (222) Wool- folk (EM) McCarthy Chas (c) lab Riverside Ceme- tery r323 Green McCarthy Clarence J (c; Clifford B) pntr h263 3d av (V) McCarthy Gordon (c) grease wiper Cof GaRy h548 Hazel McCarthy Henry (c) lab rlll3 (222) Woolfolk (EM) McCarthy John F elk h417 Cleveland . (SM) McCarthy Jos A (Eleanor) mach CofGa Ry hl46 Magnolia McCarthy Julian W (Eliz P) lab r305 Rutherford av (SM) McCarthy Raymond A (Gwendolyn) h 94 Osborne pi McCarthy Reddick (c; Mary) lab h323 Green McCarty A P r229 Grant Chapel al (S M) McCarty Clarence (c) lab Macon Gas Co h220 Jordan al (SM) McCall Carrie (c) lndrs hl38 1st av (V) McCall Herman (c) student r403 Tay- lor (EM) McCall Jas F (Thelma S) civ eng rl55 Mc1Cstall John (Carry) emp Nehi Bottling Co McCall Jos (c; Mattie B) barber MBcCroawllnJ'os seBpahribneer MShrsoprers2t7r21234d1 aBvroa(Vd)- way h do MLcCogartCy aEbimnordyr A (Rosa) farmer h507 McCarty Guy S (Opal K) linemn SBT& TCo rl31 Cole McCarty Julia smstrs r507 Log Cabin dr McCarty Lula (c) maid rl326 1st McCary Donald M (c; Rosalie) lab h618 Monroe McCary Robt (c; Luella) lab h505 Mon- roe McCaskill K Alex student r708 Napier McCall .Mary (c) rllO Tindall av (SM) McCall Pennie (c) h406 Short (EM) Mc'Oall R Wm (Josephine) rl241 Broad- way McCall Robt (c) r406 Short (EM) McCall Robt B (c; Rosa) carp h502 (520) Maynard (EM) McCall Thelma S Mrs sten Frank Rob- erts rl55 1st McCall Wm M (c; Mary) barber Brown's Barber Shop h403 Taylor (E M) av McCaw Dellie R Mrs tchr Wesleyan Conservatory h274 Georgia aV McCaw Eliz bkpr r274 Georgia av1 McCaw Jas N (Dellie R) agt Mut Life Ins Co of N Y h274 Georgia av McCaw Mary D tchr PS r274 Georgia MCChesney Willie M Mrs opr Ethel B Davis Beauty Shop rll9 Plant (SM) McClain Ira (c; Marie) h215 (327) Turpin (T) McClain Jerry millwkr Bibb Mfg Co r McCallister T T (Eunice O) slsmn Dunlap Chevrolet Co rl94 Laurel av (N 35-37 Bibb av McClain John H (c; Florrie) millwkr H) Bibb Mfg Co h207 (2) 3d av (B) McCallum Chas L (Mattie M) h778 Blackburn (NHts) McCColari2n15Ma(3ri2e7)mTaurkreprinCr(eTs)cent Lndry McCallum Danl E metalwkr Bibb Body McClamroch Camer B (Jennye) mgr & Fender Wks r778 Blackburn (NH) Goodrich Silvertown Stores to-118 Oak McCallum Homer (Ida E) blksmith Kin- Haven av nett-Odom Co r732: Montpelier av McClanaham Trevie M (wid Jas F) r McCallum Hubert B auto xepr 444 Pine 219 Claring av r778 Blackburn (NH) McClanahan Geo A (Ona) h626 Church McCallum J C city firemn r2454 2d (CH) ,,, , McCallum L Bernard (Orrie) detective McClanahan Lester (Etta M) fctywkr Police h2810 Houston av Happ Bros Co r452 Elm MCCallum Mayme G floor walker r778 McClanahan Paul (Mattie L) h624 Blackburn (NH) Church (CH) McCallum Robt (Ida) elk hlOO Enter- McClay Wm (c) waiter r337 Maple prise (SM) McClellan Carlton L (Ethel M) slsmn McCallum Tillman H driver r778 Blackfoulrn (NHts) rlOl StJohn (EM) McClellan Lizzie (c) r416 (464) E 2d (E McCallum Wm J car repr CofGaRy McCamv Jos R (Eva) elk h650 Pio Nono McClellan Wm A Hon (Fraser B) judge 17 av (V) McCamy Lucile E office sec Dr Rhea W Richardson r650 Pio Nono av (V) MScCupleelrlaionr WComurAt hj2r27(KNaothrtrhyna)v la(wNyHe)r 566 Mulberry R8 h252 Orange 250 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES {PlyiDOllth McClelland Carlton L agt Life Ins Co of Va rlOl StJohn (EM) McClelland Clovis H (Beatrice) flagmn hl515 2d MMccCClleenlldaonnd BMenarj(ocr)iehlrpl5r1C5of2GdaRy McClendon Berry B Rev (c; Minnie) pastor Tremont Temple Baptist Ch li217 Telfair McClendon Chas D (Eva) agt Natl Life & Accdt Ins Co r31 Progress McClendon Geo (c) tchr Ga Academy for the Blind r247 Madison McClendon Ida (c) maid 135 Beverly pi McClendon Jack (c) r7 (308) Hanson (SM) McClendon Lorene (c) lndrs r7 (308) Hanson (SM) McClendon Mittie (c) r314 Telfair McClendon Morris (c) delmn r7 (308) Hanson (SM) McClendon Walter (c) lab MD&SRR r 217 Telfair McClennan Wm (c) lab hl09 Johnson's al McClerry Remus (c; Fannie) elev boy Georgia Casualty bldg h35T5 Madison McClintock John (Virginia) h407 Ingleside av McClinton Evelyn lndrs Crescent Lndry Co r401 (300) Elizabeth (SM) McCloud Adam (c) delmn r809 Edgewood av McCloud Blanche (c) maid h809 Edgewood av McCloud Washington (c; Mattie) lab h 482 Chestnut McClue Elmer millwkr Bibb Mfg Co r740 Oglethorpe McCommon Geo W (Rebecca R) pres Atlantic Cotton Mills hll8 (196) Buckingham pi (V) McCCoommmmoonn BJroCs)larhe5n0c9e B(eAeclmhaaJv; McMcCommon Jewett A (Rozelle W) slsmn r684 Hillyer av (CH) McCommon Lavonia r419 Montpelier av McCommon Rebecca R Mrs sec Atlan- tic Cotton Mills hi 16 (196) Buckingham pi McCommon Robt L (Lessie S; McCommon Bros) h501 Beech av McCommon Sarah R (wid Clayton) h 419 Montpelier av McCommon Thos J (Mary W) jailer Bibb County r Court House McConnell Columbus A (Laura) gro 317 Giles (SM) h do McConnell Harold H (Maxine B) vehicle mn Ry Exp Agcy r605 Carling av McConnell Harriet R Mrs slswn Burden Smith & Co h414 (425) Burton av McConnell Odessa S (wid Harley) h605 Carling av McConnell Reynolds (Harriet R) h414 (425) Burton av McConnell Thos H (Visie) h605 Main (EM) McConnell Verdie L r317 Giles (SM) McConnell Virginia r605 Main (EM) McCoo Gertrude (c) maid r335 Madison McCook Charlie B (Margt) lino opr Lyon-Hartris & Brooks r Lizella La McCook Clyde F (Inez L) beer 321 Broadway hll7 5th av (SM) McCook Danl O (Kath R) ship elk J W McCook Lbr Co h437 (403) Forest av McClue Mildred millwkr Bibb Mfg Co r 740 Oglethorpe McClung Edna student rl230 College McClung Edwin L student rl230 College McClung Plinie J (Florence) bus opr Ga Power Co hl230 College McClure Andrew W (Julia D) pres-treas McClure Office Equip Co hlio Cleveland av (V) McClure Benj slsmn r369 1st McClure Francis M (Ethel) elk hi 16 McCook Floyd smstrs r&64 Elm McCook G N slsmn Toole Furn Co rl09 Appleton av McCook J W Lumber 'Co (Jas W Mc- Cook) Broadway se cor Ash McCook Jas W (Essie S; J W McCook Lumber Co) h520 College McCook Jas W jr (Betty H) slsmn J W McCook Lbr Co rl26 DeSoto pi Mc(SCMoo)k Lula (wid Andrew J) hll9 5th Clayton (V) McClure Hilton B (Ellen L) slsmn h715 Montpelier av McClure John B rec elk Sears Roebuck McCord Cajah R (Willie M; McCord Used Auto Parts) hl08 Crumps Park McCord Cajaih R jr driver rl08 Crumps Park & Co r530' College McCord Caroline tchr PS r205 Hines ter McClure Mattie Mrs rl310 3d McClure Office Equipment Co Andrew W McClure pres-treas Chas W BaldwMiunlbve-rpryres Russell F Briggs sec 560 MtcrCialul reLiRfeobt&E H(Ceharlitshtinei)nsagtCoIndhul0s9- (V) MScCihoardh CTheamspRle (AHAaOttiNeMCS) hre2c2o0rdHerinAesl ter (V) McCord Chas R jr (Laurie) h215 Hines ter (V) McCord Fletcher (Caroline) tchr r205 Ponce de Leon av (SM) McCluster Shoat (c; Maggie) lab h3l8 Edgewood av (SM) MeClyde Frank (c) rll4 May av (U) McCollum Anna (c) cook >hl01 (456) Simmons av McCollum Herman (Ola) pdlr h317 Hines ter (V) McCord J Alf (Fannie) sheet metal wkr h2l9 Duncan av McCord J Eug r219 Duncan av" McCord John S (Lawson) h505 Court- land av McCord John W student r220 Hines ter White (SM) McCollum Howard P (Cordelia) mech MCacbCinormdirck Deering Store hi16 Log McCollum Sally (c) lndrs xl08 (148) Bartlett MlcaCollumn Burdell (c) cook hl54 Ernest McCombs fernery (c) student rl55 Middle MwcCelolrdBaJrobserCSh(ocp) rbl0a9rbe(r111W) ilBlirsieBf r(aVs)McCord Marjorie rl08 Crumps Park McCord Polly (c) maid h423 (474) 3d av (V) McCORD R A MOTOR CO, R A McCord (Atlanta) Pres, R A McCord jr V-Pres, H Pink Persons Sec-Treas, Authorized Ford and Lincoln Dealer 215-221 McCombs Sami (c) shoe repr rl55 Middle (V) Mc(CVo) mbs Virginia (c) cook hl55 Middle McCommon Alma J Mrs bkpr City Bd of Water Comnrs h509 Beech av McCommon Bros (Robt L, J Clarence and Geo W) dept store 456 3d 2d, Tel 11 (For further information see left top lines and page 4 Buyers' Guide) McCord Robt A jr v-pres R A McCord Motor Co r505 Courtland av McCord Budicill (McCord Used Auto Parts) rl08 Crumps Park McCord Used Auto Parts ('Cajah R and Rudicill McCord) 667 Broadway 251 WILLINGHAM SASH & DOOR CO. Lime - Roofing - Cement -- Plaster 457 Third St. Phones 277-278-279 s McCord Wm E (Zula) cond MD&SRR h 623 Vineville av (V) McCoy Sarah (wid Danl W) r720 1st McCoy Simon (c; Mary L) porter h209 McCord Zula Mrs policewn h623 Vineville av (V) McCordle Jas M elk r371 1st McCorkel Wm T (Audrey) r228 Ameri- McCoy Sol (c; Mamie) hl25 Hall (EM) McCoy Walter R (Bessie) blrmkr CofGa Ry h418 Plum . , ,, McCoy Willa T (c) lab Central City Bag McCorkle Emma Mrs millwkr willing' ham Cotton Mill h52 Holt av (NHts) MCcCoracklen Lula (c) maid rl07 Tindall McCorkle Jas D millwkr Willingham Cotton Mill r52 Holt av (NHts) McCorkle R Vernell millwkr Willing- McCrae Betty (c) maid h52 Smith row McCrary Alex (c; Nora) lab hl02 (85) ham Cotton Mill r52 Holt av (NHts) McCormack Lillie (c) cook h225 Orange McCormack Wm C (Ruth) roofer h553 McCrary (Betty C Mrs (Betty's Beauty Shop) hl27 Lawton av McCrary Chas G (c) hi 129 Broad (EM) McCormack Wilmer L (Ruth) roofer h 1504 2d McCormick Deering Store (,I,n4ternat.io.n.al Harvester Co) Fred J Morgan mgr McCrary Dennie L (Marguerite) slsmn h467 Monroe ,, _ McCrary DeWitt (Dora) v-pres McCrary DeWitt Drug Co Inc h304 Hydrolia (E agrl implements 760 3d MMccCCoorrmmiicckk PErdannak ((cc)) rp9o04rteHr aSztealndard Oil Co r430 Madison McCormick John E (Johnnie L) formn h314 College . McCormick John T (c; Alice) cotton classer h293 2d av (V) McCormick Julius B prsmn J W Burke McCCoorrmlli5ck CLeadmarar (lSaMb )rl05 Yates av (E M) McCormick Margt student rl07 Rogers av (V) McCormick Mary (c) cook h430 Madison McCormick Robt (c) agt Afro-Ameri- can Life Ins Co r430 Madison McCormick Sami (c; Mary) lab hlOO (144) Elizabeth (SM) McCormick Thos student rl07 Rogers av (V)- McCormick Wardlaw L (Lena) mgr Copeland Sales Co hl07 Rogers av (V) McCormick Zeke (c; Clara) lab r61 Craigs la (SM) McCowan Aurelia (c) cook h324 1st av Mc(VC)owan Cleo (c) lab r324 1st av (V) McCowan Henry (c; Lillie M) hl31 Mitchell la (V) McCowan Jas C (Ada D) meter reader City Water Wks Shop hi 15 Calhoun McCowan Jas C jr (Alma V) mech rll5 Calhoun McCrary DeWitt Drug Co Inc Bryant J Balkcom pres DeWitt McCrary v-pres 336 Main (EM) McCrary Duckworth (c) farmer h479 Log Cabin dr ,, McCrary Eliz (wid Andrew J) h804 Elm McCrary Ella (c) h316 Division (T) McCrary Fanny r276 Willingham (EM) McCrary Felton D (Betty C; O K Shoe Shop) hl27 Lawton av McCrary Geo C (Anna) h276 Willing- MhcCamrary(EMG)eo D (Mary) gro 406A Church (EM) h480 Orange McCrary Grace (c) cook rl 14 Tatnall McCrary Henry (c; Lottie) orderly hll MRcCosrasryStHepribert (c) r401 Colquitt McCrary Jas (c; Mary) h206 Harris McCrary Jas (c; Susie) lab hl37 Hazel McCrary John (c; Hattie) porter h435 Liberty (SM) McCrary Julia (c) r221 Carters al McCrary Julia ins 569 Mulberry r668 1st McCrary Katie (c) waiter Frank Mathis rllO (8) Orchard av McCrary Leila (c) lab h509 Harris McCrary Lena M slswn Dannenberg Co Mrc4C56rarWy aLlinlluiet M (c) maid hl33 Mag- nolia'la . . McCrary Louise (c) hl2 (104) Stems al McCowell Lizzie smstrs h621 Pine McCowen Albert I (Prances S) bkpr McCRARY LUTHER A (Clyde W), SecTreas Hatcher & McCrary Inc, Pres Bibb Mfg Co h418 Duncan av Ga Underwriters Inc, Sec-Treas Co- MchC35o9weOn raCnlgaerence D (Lena M) slsmn McCowen Geo S (Dans) slsmn h708 Operative Fire Ins Co of the State of Ga, r Southland Hotel McCrary Mack (Mary) mech r530 Col- Courtland av McCowen Mamie Mrs h724 Napier av lege McCrary Margt student r276 Willingham McCowen Marietta student r805 Mikado McCowen Ray N (Alta H) cond hl02 (EM) McCrary Marguerite Mrs sten Otis Elev StJames av (SM) McCowen Richd B (Margt R) lawyer Co h467 Monroe McCrary Mary (c) h210 . ,, Tindall ay (/rS,M,,.) 566 Mulberry R5 h805 Mikado av McCrary Mary Mrs slswn Peggie Hale McCoy McCoy CBoelnliinsCWlab(DoGra)BeerlnkdiJ7C20o 1st McCoy Eli millwkr x865 3d McCoy Florence (c) h620 Spring MDcCrerassrySMhoapryr5M30rs CsotellnegeHarri.s Harris Russell & Weaver h480 Orange _ McCrary Minus (c; Mary) hll31 (1135) McCoy Gus (c; Rena) lab rll5 Armond av (XT) McCoy Henry T millwkr Bibb Mfg Co r865 3d McCoy Jack (c; Annie B) h612 4th av Broad (EM) McCrary Nolen (Winifred) pharm Cher- okee Pharmacy h717 Date av McCrary Rollie mach CofGaRy McCrary Rosa r304 Hydrolia (EM) (V)' McCoy Julia E r720 1st MMccCCooyy LLearouyra(cr:71J5ose2pdhine) porter Ben- McCrary Smith T (c; Drucilla) lab h 234 (223) Moore la McCrary Vashtie (c) rl2 (104) Stmes al McCrary Willard L (Lillian L) pntr h nett A Joiner h758 Ocmulgee McCoy Louise S millwkr Bibb Mfg Co r 132 Knott (SM) 1017 Hazel McCrary Wm (c; Daisy) lab h606 (110) Colquitt McCoy Martha L r720 1st McCoy Mollie (wid Green H) r865 3d McCoy S Julia h715 2d McCoy Sampson (c; Sereatha) lab h2118 McCrary Wm B (c) rl2 (104) Stems al McCraw Evelyn r346 Flanders (EM) McCray Jos (c; Lizzie) lab h316 Burnett (EM) Wyches al McCrea Wm K (Clyde) hi 10 2d \\ % i%gUp a and Linen Service 'o DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want Information you are unable to procure elsewhere, call on us R. L. POLK & CO. DETROIT 252 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 McCreary Clara (c) rl05 May McDaniel Oscar P (Avaleen) policemn McCREARY JOHN J (Teresa L), Law- h720 Pine yer 3 Washington Block 566 Mulberry, Tel 5626, h753 Hemlock, Tel 2880-J McDaniel Powell student r720 Pine McDaniel Susie (c) rll4 Ballard (EM) McCreary Josephine (c) lndrs rl028 Col- McDaniel Van H (Mable) lab h206 Col- lege dr lege pi McCreary Lizzie (c) rll3 Linden av McDaniel Wm (Ruth) fctywkr hl778 3d McCreary Raleigh B (Frances) maCh h McDaniel Wm F (Mattie L) gro 1015 2212 2d Log Cabin blvd h do McCreary Wm T (Sadie) gro 1002 Ogle- McDaniel's Grocery (Mrs Gladys Mc- thorpe hl24 Appleton av Daniel) 127 (111) Colquitt McCrey see also McRee McDaniels Henry V emp CofGaRy McCrey Albert (c; Bernice) porter MD &SRR h234 (138) Cowan (EM) McDermid Robt C millwkr Atlantic Cotton Mills rl8 Atlantic Village McCrey Emily V (c) instr City Play McDermott Sarah (wid Wm) nurse 206 Grounds Supvr r234 (138) Cowan (E Rutherford av (SM) r206 do M) McDonald Annie (c) lndrs h233 (115) McCrimmon Lester M (Myrtle) slsmn h 110 Emory av (DM) Hurley la McDonald Betty rlOOl Napier av1 McCrum Barton A student rl21 Stonewall pi (V) McDonald Clotha M fctywkr Bibb Mfg Co McCrum Robt W (Isabel H) civ eng McDonald Eliza (c) maid h257 4th av State Hwy Bd Div No 2 hl21 Stone- (V) wall pi (V) MoCuen J Vascoe (Edna L) electn hl20 McDonald Elnora Oc) cook hl066 Ocmulgee MPcCieudlmlaronAt nadvrew T elk r371 1st McDonald Emory (c) tailor Mayo's r RD 4 McCullough Clara (c) cook h216 Hilliard McDonald Fannie (wid J E) rl05 Rogers al av (V) McCullough teva student r756 Mulberry McDonald Gordon L (Viola) elk h808 McCullough Frank C (Lois) dep sheriff Hemlock County Municipal Court r RD 6 Rec- McDonald Jas (Esther) window clnr h reation Park 231 Washington av McCullough Geo (Marie L) millwkr r716 McDonald Jas H slsmn r201 (127) James 2d McDonald John B (Lucy H) jr eng MCcCoulrl2ougFhlanGdreorvser(EmMi)llwkr Bibb Mfg Macon Gas Co r221 Georgia av McDonald John R (Ellen) waiter Craw- McCullough Howard (Lushian) lab h300 ford's Barbecue Lunch r319 Montpelier Center (EM) McDonald John W (Goldie M) swtchmn McCullough Hulett (Naomi) formn h713 h314 Plant (SM) Main (EM) McDonald M Donald (Frances D) news Mc6C06ullHouoglth aJvas (NCH(tEs)mma) loco eng h editor Macon Evening News hl90> Ehglish av McCullough Jas C jr (Jimmie) elk C1sotleman-Meadows-Pate Drug Co h659 McDonald Mason B (Patti) elk hl31 High McDonald Mildred r201 (127) James McCullough hll5 Feb Joel av S (Mary R) slsmn h McCullough Leon O student r606 Holt av (NHts) McDonald Ruth Mrs r611 Duncan av McoDf oMnaalcdonSamhOiOHl N(Eapuineircea)v"electn City McDonald Sami S student rlOOl Napier MMcC)ullough Louise sten r327 Hanson (S McCullough Lucy (wid Chas) h327 Han- son (SM) MMccCCuullllouumghHeRnurythCr3(2A7nHniaen) sro7n32(SMMo)ntpelier av McCune John M (Susie) mach hl535 1st McDaniel Bessie millwkr rl778 3d McDaniel Chas A (Mary F) mach Cof GaRy hl04 Newberg (SM) McDaniel Fannie textilewkr rl015 Log Cabin blvd McDaniel Gladys Mrs (McDaniel's Gro- cery) hl21 (115) Colquitt McDaniel Harmon C (Mabel F; CresMcceDnatniRelesJtauBrrauncte) h(J3e9w9 eBl)elwmtocnhtmakvr S L Orr Co hl04 Vista cir McDaniel J Robt (Edna) lab h538 Tel- fair McDaniel Jane L libr Ballard Normal Sch r50 Forest av (V) McDaniel John C (Prances) r321 Lake McDaniel John C (Mary) millwkr Bibb Mfg Co rl38 Comer ter (PM) McDaniel Jos D (Eliz) mech Ernest Evans rl531 2d McDaniel Julius A (L Ophelia) hdw 462 Poplar h205 College pi McDaniel LaVada slswn r720 Pine McDaniel Lonnie (Gladys) hl21 (115) Colquitt McDonald T Fletcher (Edna) miller Barfield Feed Mills hl23 Fort Hill (E M) MrclD04onaEldmpVireeraav(c)(Vc)ar clnr CofGaRy McDonald Vernon E (Ruth A) barber Commercial Barber Shop hll2 (108) Pineview av McDonald Wm T (Dirlie) r201 (127) James MacvDon(Val)d Wonza (c) musician r257 4th McDonald Viola Mrs sten Heard Bros h808 Hemlock McDonell Maude student rl35 Dixie av (SM) McDonell Roy elk rl35 Dixie av (SM) McDonell Wm S inspr CofGaRy hl35 Dixie av (SM) McDonnell Peter Rev pastor StJoseph Catholic Church h814 Poplar McDonnell Raymond M elk rl921 3d McDonnell Teresa (wid John M) hl921 3d McDougal Ralph (Lula) millwkr Bibb Mfg Co hl48 Comer ter (PM) McDougald Geo R (Lunie) millwkr Bibb Mfg Co hl79-80 Gardner (PM) McDougald Kathleen millwkr Bibb Mfg Co rl79-80 Gardner (PM) McDougald Lamar millwkr Bibb Mfg Co rl79-80 Gardner (PM) McDougald Thelma millwkr Bibb Mfg Co rl79-80 Gardner (PM) McDaniel M Eleanor elk r5l9 Johnson av (HH) McDaniel Mackey L (Estelle) emp Cof GaRy h213 Applewood (EM) McDow Wyatt (c; Mary) chauf hlOO Forest av (V) McDowell David (c) presser Ernest C Porter 253 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 McDowell Evalan tchr PS rlOO Vineville av (V) McDowell Lizzie (c) maid rl68% (169) Astor (EM) McDowell Louise (c) hl22 Ross McDowell Lucius (c) lab rl68% (169) Astor (EM) McDowell Viola (c) maid r206 Wood- McDowell Win (c) porter r227 Wood- McDowen John (c; Mattie) atndt Wof- MfcoDrudffeOyil BCeornihcle24mCacohwaonpr(Er4M6)7 Elm McDuffie J D elk r206 Pierce av McDuffie Louis R elk WPA rl81 Mag- nolia McDuffie Marie (c) h5 Mitchell (EM) McDuffie Sarah nurse 213 Bond apt B4 li do McDuffie Walter B (Janie) h419 Beech McDuffie Wilbur E (Villa) cond h329 Buford pi (V) . _ McDuffie Wilbur E jr student r329 Bu- ford pi (V) ,, ,, McWEaAsChHbuErRnNStHoAraRgRe ECLoL, r3W06, HSeince-Ts rteears, Tel 1219-J McEACHERN LLOYD F (Louisa), V- Pterre,s TWeal sh1b2u19rn-JStorage Co, h306 Hines McElhaney Robt (c; Katie) lab h236 Telfair McElheney Jas T hlpr Macon Shop r 259 Church (EM) McElheney John W (Nellie) pipeftr Cof GaRy h259 Church (EM) McElheney Mildred student r259 Church (EM) McElheny Duffie L (Velma W) asst acct S(1t6a4t)e CHhweyrokBeeoaarvd Div No 2 hl02 McElheny Martha, student rl02 (164) Cherokee av McElmurray Albert student r518 John- son av (HH) MCElmurray Amos (c; Eliz) hl015 Pio Nono av (V) McElmurray Jeffie C (wid Herman) h 518 Johnson av (HH) McElrath Florence (wid Hugh M) hlOO Cleveland av (V) McElrath John Me (Eliz) sec Jeffereys- McElrath Mfg Co h224 Albermarle pi McElrath Wm M student rlOO Cleveland av (V) McElroy Chas B (Jennie L) asst postmstr PO h201 Buford pi McElroy Corene (c) r314 Norris (EM) McElroy Edw M teleg opr CofGRy McElroy Eliz tchr PS rl'5 Progress McEliroy Ellie (c; Willie) rllO Tindall MchEil1r2oyPFrirnagnlke ((cE; MM)ary) lab MD&SRR McElroy Jack Rev (Itol) pastor Central Church of Christ h726 Date av McElroy Margt tchr PS r201 Buford pi McElroy Maude E elk Prudential Ins Co of Am r22 Progress McmEalrnoy(ENMa)than B (c) r320 (84) BowMcPEplorgoryesSs arah tchr Whittle Sch rl5 McElroy Walter (c) rll2 Pringle (EM) McElroy Wm J (Emma) hl5 Progress McElwee Pearl Mrs h812 3d McEvoy Wm (c; Annie) brklyr h310 Middle (V) McFadden Richd A (Mary L) auto repr 2104 Vineville av (V) h rear 2110 Vineville av (V) McFarland Jas (c) lab r907 Dempsey av (U) McFarland Jas F (Marjorie F) slsmn Burden Smith & Co h.786 Holt av (N H) Mc(UFa) rland Mabel (c) h907 Dempsey av McFerrin Frances C rl07 Elizabeth pi Mc(VFe) rrin Jas M acct 403 Cherry R604 MhcFl0e7rriEnliJzaasbeMth irpisls(mVn) rl07 Elizabeth pi (V) McGahee Bernard B (Maggie M) po- licemn hi 12 Rutherford aV McGahee Chas (Lilly) millwkr Bibb Mfg Co h235 (5-6) Clinton (EM) McGahee Lonnie J Bibb Mfg Co hi2 (Annie M) Lake City (fEcMty)w1 kr McGahee Nina (wid D C) r746 Walnut McGalliard Melba student r201 Pierce av (V) MDcGooarr WCoestrl(0c3) laDbouWgliallsingavham Sash & McGarr 'Ella (c) h314 E' 1st (EM) McGarr Willie M marker Crescent Lndy MCcGo arr3ra1h4 AEnn1iset L (wid Sami) hl27 Steele (SM) McGarrah Fabin Q (Goldie) meat ctr Lackay & Lackay hl905 Broadway McGarrah Pinkie (wid Thos J) rl905 Broadway McGarrah Wm M plmbr Millirons Plmbg & Htg Co r210 1st McGaughev W C (Virginia C) buttermkr Swift & Co r666 Napier av MPcGhaarwmacJyo)hnr RMD 2(MCoalrugmt;busCrhderokee McGee A B (Willie) slsmn Coleman- Meadows-Pate Drug Co h757 Ridge av KIV) McGee Adolphus (c; Lizzie) lab h935 Pio Nono av (V) McGee Alma (c) rll7 E Ell McGee Annie (c) lndrs rlOO Harris McGee Bertha (c) cook rl20 (80) Bay McGee Carrie (c) r539 E 2d (EM) McGee Chas (c; Senie) lab h504 O'Hara la McGee Chas (c) lab r935 Pio Nono av (V) McGee E Lee (Ethelyne) printer Macon Teleg Pub Co h862 New McGee Edmond C (Georgia) driver h 102 Cleveland av (V) McaGpteeAE4lbert B (Gail) h261 Georgia av McGee Ellen (c) lndrs h337 Maple McGee Ennie C (Annie E) detective Police hl22 Cole McGee Erith E nurse 862 New r do McGee Felix (e; Gussie) lab h822 Hur- ley la McGee Harold (Amy) farmer r712 2d McGee Helen waiter r746 Walnut McGee Jesse R mgr Mansfield Dray Line rl22 Cole McGee Jos L atndt Am Oil Co r974 Walnut McGee Jos S (Lillie) lawyer h974 Walnut McGee Katie (c) lndrs hl06 Elklon pi (SM) MMccGGeeee LMeoaryE ssttuuddeenntt r9r87642 WNaelwnut McGee Mozelle (c) hl54 Guernsey la McGee Nannie J elk r974 Walnut McGee Pearl r534 Washington av McGee Perrv (Ivey) farmer r712 2d McGee Robt bkpr r862 New McGee Sami (Buford) fctywkr Happ Bros Co h404 Cedar (SM) McGee Wm (Lily) rl97 Boulevard (NH) McGee Wm W (Kath L) artist h224 Belmont av McaGvO(hVee) Claude S student rl23 Pierce McGehee Fannie tchr rl23 Pierce av (V) McGehee Jas T II (Nell S) pres-treas Macon Paper Co hl23 Pierce av (V) McGehee Jas T III (Eliz M) sec Macon Paper Co h864 Mulberry apt 3D Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? IS Answered By the Classified Business Lists In tills Directory 254 "A SAFE PLACE TO TRADE*' STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 McGehee Nell S Mrs v-pres Macon Paper Co hl23 Pierce av (V) McGehee Richd driver Macon Paper Co r!23 Pierce av (V) McGehee Sami J (Mary R) elk Clark MMeGeemouogrihalsWIenscleyrl3(1c3; VLienoelvai)llelaabv h(lV03) Douglas av (V) McGhee Addison F r414 College McGhee Chas (c; Janie) h522 Ross McGhee Connor (Betty) USA hl38 Curry dr (NH) McGhee "Emma (c) lndrs r72l White- head al McGhee Jos (c) lab City McGhee Jos (c; Mary) lab h972 Pio Nono av (V) McGhee Marie (wid Addison F) h414 College McGhee Marv (c) maid r3I2 (322) Mon- roe McGhee Nora (wid John W) r620 Dun- can av MaclGhee Sami (c) lab r379 Boardman's McGill Lillie r210 1st McGill Wm F (Annie) carp rl017 Elm MTcGeninnneiys Laveon(iSdMas) (Annie) slsmn hl50 McGinnis Myrtle fctywkr Happ Bros 'Co rl45 Academy McGinty Homer (Jewel H) slsmn Sterchi Bros Stores Inc h230 Belmont McGinty Martha r230 Belmont av McGinty Milton C (Marie C) slsmn L N Jordan hl35% Park pi MCcGoinrtly35N%inaPawrkaitepri F W Woolworth McGinty Ruby student r230 Belmont av McGinty Sara E elk U S Re-employ- ment Service rl35 % Park pi McGinty Susie H Mrs boarding house 664 Plum h do McGinty Thos A (Susie H) h664 Plum Mc(EGMir)t Robt (c; Ollie) lab h234 Powell MeGoldrick Jos P (Annie S) acct h2 Rose pi MeGowman Walter mach r304 Ruther- ford av CSM) McGrady Chas W (Laura) h202 Stanis- laus cir McGrady John student r202 Stanislaus cir McGrath Patk J grower Idle Hour Nurseries r Forsyth rd McGraw Ashby F steelwkr Taylor Iron Wks & Sup Co r822 1st McGraw Geo (Ruth) millwkr Bibb Mfg Co r606 2d McGraw Geo F (Susie M) blrmkr r822 1st McGraw Katie Mrs millwkr Happ Mfg McGuire Ida (wid Jas W) artist r311 Cherokee av McGuire Sami slsmn rl219 Oglethorpe McGure Minnie (c) lndrs h221 Linen McGuyrt Wm S lino opr Macon Teleg Pub Co r804 2d McHinsley Wm O fctywkr Happ Bros Co rl706 3d McIntosh Emma Cc) cook h437 Peters Alley (EM) McIntosh Emma Mrs smstrs Snyder's Ready-to-Wear h556 Arch McIntosh Louis (c; Susie D) porter MGooondroyeear Service Stores h312 (322) MacvIntyre Carrie Mrs r316 Washington ivLcinvaie Bessie e Mrs fctywkr Happ Bros Co rl811 2d Mclnvale Chas H (Margt) fctywkr Happ Bros Co h!811 2d Mclvey Clifford wtclhmn Leaptrot Dry Clng Co rl08 Hardeman av McKay Albert (Harriet L) slsmn hl32 Hines ter (V) McKay Annie elk r560 Orange McKay Annie L (c) h416 (415) Phillips la (EM) McKay Blythe L society editor Macon Evening News rl32 Hines ter (V) McKay Carrie L Cc) lndrs r416 (415) Phillips la (EM) McKay Chas P (Claire C) slsmn Frank Roberts hl21 Culver (V) McKay Clifford A (Frances) pres The Letter Shop h402 Ingleside McKay Cornelia R (wid Chas S) h719 2d McKay Don lab Ga Power Co McKay Harriet L Mrs society editor Macon Telegraph hl32 Hines ter (V) McKay Henry M jr (Eleanor S) electn CofGaRy h855 Mulberry apt 200 McKay Jas W (Leslie) fctywkr Happ Bros Co h751 Ridge av (V) McKay Jas W jr slsmn Macon Gas Co r751 Ridge av (V) McKay John J (Annie) ins 516 Mulberry R910 h560 Orange McKay John P jr (Josephine) slsmn Bibb Mfg Co hl50 Emily pi McKay Marion L (Grace) slsmn hll7 Brentwood av McKay Ophelia (c) maid h244 Garden (EM) McKay Ozzie B (c) sten Hubbard Co r 371 Monroe McKay Wm (Lula E) rl29 Napier av McKay Wm L (lone) hl07 Applewood (EM) McKee Hhirley supt Am Bakeries Co r 197 Boulevard (NH) Co r456 Center (EM) McGraw Roberta opr SBT&TCo r822 MMcK)ee Stella Mrs r3808 Houston av (S 1st MoKeechin Robt bkpr rll50 (2) Mill- McGraw Walter M (Martha C) bkpr r edgeville rd (EM) 129 Appleton av McGreggor Kathaleen nurse r804 Hem- McKellar Addie M student rl75 Magnolia lock McKellar Idus E (Anne B) prof Wes- McSGprrienggor Danl E (Lula) trainmn h806 McGriff Leon G (E Edith) sec Central leyan College hl75 Magnolia MncKetetlsilea Lilia M (c) cook h4 (157) Ben- Cotton Oil Co h57 Marion pi (WH) McGriff Ola M (c) maid hl429 (324) MpcKieerndarvee John C (Carrie) hi 155 Na- Ardvines al McGriff Thos Cc: Mamie) lab r432 Coles McKenna Andrew student rl04 Capital McKenna Martha sten rl04 Capital av al McKenna Minter rl04 Capital av McGruder Annie M nurse County Board McKenna Wm A (Mary C) hl04 Capital of Health McGuire Carl E (Evelyn) waiter Plan- MMccKKeennnneayWFrmanAk Mjr e(lIksabr!e0l4MC; aMpictaKleanv- tation Lunch r227 Cedar (SM) ney & Adams Service Station) h512 McGuire David L (Betty) supt Natl Life Washington av & Accdt Ins Co hl22 Stonewall pi (V) McGuire Fritz (Para) slsmn r445 Boulevard (NH) McKenney Louise rl033 Vineville av (V) McKenney Margt rl033 Vineville av (V) McKenney Robt L (Mary O) hl033 Vine- ville av (V) 255 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 McKENNEY & ADAMS SERVICE STATION (Frank M McKenney, Chas Le H Adams), Washing- and Lubricating, Complete Service, 600 1st, Tel 6346 (For further information see page 2, Buyers' Guide) McKenny Steph P (Ruth) trav slsmn h Mc6K89enCzioelleCgaessie M (c) student r462 City Hall la McKenzie Emmett G (Helen) pres Cen- tral Cotton Oil Co h430 Nottingham dr (WH) McKenzie Naomi (c) maid r291 2d av (V) McKenzie Wm (c; Rosalie) lab h204 Collins pi Mrc2K1e5rvSeyprAinggnes elk Union Dry Gds Co McKervey Annie dept mgr Burden Smith & Co h2I5 Spring McKESSON-RILEY DIVISION, Wholesale Druggists 418 Broadway, Tels Offainced 23792734, Order Dept 3971-3972-3973 MCKESSON & ROBBINS INC, Wholesale Druggists 418 Broadway, Tel 2723 McKibben Thos N (Lillian D) slsmn Home Furnishing Co hl23 Stonewall McpKl in(Vle)y Hartford H partsmn McCormick Deering Store r224 Georgia av McKinley Ida (c) lndrs h559 Monroe MPcKowineleryCLoouhilsOlOG W(Callynduet) formn Ga McKinley Pauline supvr WPA r617 Orange McKinley Raymond A (Anna B) carp h 110 Branch CCH) McKinley Rufus (c; Tommie) lab h224 Collins pl McKinney Beatrice (wid Perry) r804 Elm McKinney Beni F (Anna L) loco firemn h30-2 Peachtree (EM) McKinney Carrie (c) rlOO Empire av (V) McKinney Cleveland (c) lab rlOO Empire av (V) McKinney Danl (c; Emma) driver h346 Madison McKinney Edw R (Mattie L) h518 Oglethorpe McKinney 'Emma (c) lndrs rlOO Empire av (V) McKinney Eug student r302 Peachtree (EM) McKinney Geo H (Eula M) loco eng h 136 Flamingo dr McKinney Geo W (Winona) maeh H3020 Houston av (SM) McKinney Harvey C (Dorothy) ftr Macon Gas Co hlOl Davis (SM) McKinney Henry C (Mary E) mech Central Sash & Door Co h410 Cleve- land (SM) McKinney Henry H (Hattie L) firemn h 822 Main (EM) McKinney Horace (c) lab CofGaRy McKinney John W (c) rl37 Long (SM) McKinney Jos O (Leila B) gro 533 For- syth h606 do McKinney Leroy K appr CofGaRy r302 Peachtree (EM) Mrc8K22innMevainLuc(EileM)V sten Olin P Beall MMccKKiinnnneeyy MMaarryyr3B02 rP6e06achFtoreresy(tEhM) McKinney Massey (c) lab rll4 (270) Brief McKinney Matilda (c) rlOO Empire av McKinney Otis L (Stella M) slsmn Ga Power Co hl06 DeSota pl McKinney Robt (c; Helen) driver h715 3d av (V) McKinney Ruby r211 Mikado av (SM) Mcr2K0i6nnWeyooRductlihfefrford (c; Julia B) lab McKinney Sami H (Lucy) atndt Broadway Service Sta rl28 Virginia av MMccKKiinnnneevv WWmm CM st(uc;deMntinrn6i0e6) Flaobrshylt3h7 Long (SM) McKinnie Tommie r812 3d McKinnon Eloise office sec Jefferson Standard Life Ins Co rl42 Piedmont McKinnon Norvelle E (Bessie M) mech Adams-Buchanan Motor Co hl42 Piedmont av McKinnon Norvell E jr student rl42 Piedmont av McKinnon Wm asst mgr F W Woolworth Co rl25 Rose Park McKissick Abram Cc) porter rl41 Sycamore (V) McKissick Chas (c) lab rl41 Sycamore (V) MocfKiGssiackInFclorre4n52ce SMprsirngslswn Mangels McKissick Rutherford B slsmn Sears Roebuck & Co r452 Spring McKnight Sue Mrs waiter Busy Bee MLcLuanicnh srele07a0lsoWaMlncuCtlain McLain Bertha (c) maid rl27 Park Hotel al McLain Eliz (c) cook rl02 Empire av (V) McLain John D (c) porter rl27 Park Hotel al McLain Wm D (Belle) cond h525 Hillyer av (CH) McLaughlin Chas K (Mary) phys 567 Walnut hl06 Buford pl McLaughlin Clifford Rev -asst pastor St Joseph's Catholic Church r814 Poplar McLaughlin Edwin E (Julia) lab h315 White (SM) McLaughlin Edwin E jr r315 White (S M) McLaughlin Eleanor r664 College McLaughlin Lucius (c; Johnnie) elev opr hi066 Hazel McLean Carolyn nurse ir225 Buford pl McLean Helen student r774 Mulberry McLean Henry W student r22'5 Buford McPLl ean Hugh S (Lucille R) elk First Natl Bank & Trust Co h225 Buford pl McLean Lucy B Mrs elk Union Dry Gds Co h431 Calhoun McLean Oscar emp CofGaRy McLean Wm O (Lucy B) marker Snow's Lndry & Dry Clng Co h431 Calhoun McLean Winship (Gertrude) mgr Atlantic Refg Co h520 Orange apt 5-6 McLellan Agnes Mrs mgr Nancy Earle rl02 Yates av (EM) McLellan D Murray boardmn Fenner & Beane rl02 Yates av (EM) McLemore Wm (Ruby) lab r254 Washington av McLendon Amelia (wid Andrew) smstra hl020 Oglethorpe McLendon Annie V (wid Jas L) h278 College McLendon Augustus C (Blanche M) h 1539 College McLendon Cortez H (Bobbie E) elk h307 MNcLaepnideronavIdaap(tc)4 maid h531 Grant Chapel al (SM) McLendon J Wm elk Birdsey Flour Mills r7l 1st McLendon Lena student r619 Walnut apt 5 McLendon Robt formn Bibb Mfg Co r 865 Orange McLendon Wm E (Essie C) supt Natl Life & Accdt Ins Co 'hi05 Park pl apt 4 McLendon Willie emp CofGaRy McLeod John W jr sash mkr Willingham Sash & Door Co h322 Cleveland ASM) Macon Federal Savings & Loan Ass'n Loans on City Heal Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 256 JJ fl S .3 M >> p 5 ^3 5 hS 4S35i 25 .2 3 J 3 O 8 45 3tmtoo a .33 3 -oCO bOe 'S C_5P ~TI 23> COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 McLeod Kimbrough atndt Tank Car Service Station r544 Forsyth McLeod Leona (wid John W) r322 Cleveland (SM) McNair Georgia (c) agt North Carolina Mut Life Ins Co h220 Mutual av (V) McNair Jas (c) student r220 Mutual av McLesky Chas (Ruth) slsmn r422 Vineville av (V) McNAIR LUMBER & SUPPLY CO, Wm O McNair Pres, B Ray McNair Sec, McLester Hortense elk Union Dry Gds Co r769 Mulberry McLoud Armanda (c) r237 Jones McLueas Luna (wid Robt E) hl506 Vine- ville av (V) McManus Dorothy D student rl07 Plaza McManus John D student rl07 Plaza McManus Leonard W (Dora D) real est Murphey Taylor & Ellis Inc hl07 Plaza McManus Leonard W jr student rl07 Plaza McMaster W Chandler slsmn D H Adams Motor Co r533 Orange apt 2 McMath Geo r397 Belmont av McMath Jas M Rev (c; Annie) evangelist h414 (415) 3d av (V) McMath Marynell millwkr Southland Knitting Mills r397 Belmont av McMichael Aurelia (c) rl36 Pecan av 262 5th, Tel 5200 (For further information see back cover and page 9 Bayers' Guide) McNair M L r301 Cherry McNair Mary (c) lndrs rl45 Pecan av McNair Nell B (wid Wiley P) hi N Arlington pi McNair Obie (c; Ella M) janitor r804 Fort Hill (EM) McNair Plushie (c) student rl Parker av McNair Ruth (c) maid rl066 Ocmulgee MCcNouainrtySidrlneyN BAarlsisntgtcoonunptyi eng Bibb McNair Wm O (Annie M) pres McNair Lbr & Supply Co h2406 Forsyth rd McNair Willie L (c) tchr r220 Mutual av (V) McNeal Claudie L car repr CofGaRy McNeal O N auto mech American Bakeries Co r Miller Field rd McMichael Ethel Mrs millwkr Bibb Mfg Co rll5 Myrtle (EM) McMichael Eva M (wid Jas M) bkbndr r663 Hemlock McMichael Ralph bus opr Ga Power Co McMichael Rupert L (Ethel) lab rll5 Myrtle (EM) McfiMceirchralell7RuCtahllaewlkayU (SV)Probation OfMcMichael Victor H (Ruth) phys hl22 DeSoto pi McMichael Wm J (Gladys) lab h229 Ayers rd McMickens Benj (c; Octavia) r510 Ham- mond McMillan Chas A jr (Doris) sta opr h242 College McMillan Daisy millwkr Bibb Mfg Co r 363 Clinton (EM) MCMillan E C Paint & Glass Co (Eug C McMillan) 358 3d McMillan Essie r525 Mulberry McMillan Eug C (Lula F; E C McMil- lan Paint & Glass Co) hll9 Rogers av (V) McNear Ira (c; Jerolene) hl85 North av (NH) McNeil Cecil (Winifred) millwkr Bibb Mfg Co rl09 Willingham (EM) McNeil G Elbert (Alice) millwkr Bibb Mfg Co hlO 9Willingham (EM) McNeill Edw USM r614 Ocmulgee McNeill Jas msngr r614 Ocmulgee McNeill Nola M Mrs h614 Ocmulgee McNelis Frances student r654 1st McNelis John P opr Yellow Cab Trans & Baggage Co r654 1st McNelis Margt M sten Carling Tile Co r 654 1st McNelis Patk G (Margt K) policemn h 654 1st McPhearson Sallie (wid Tim) r220 Ayers rd McPherson Andrew J (Mary) hl205 Montpelier av McPherson Arth E appr CofGaRy rl205 Montpelier av MMcP)herson Clarence delmn rl47 Ell (S McPherson Eug L (Susie) grader Natl McMillan Eug C jr student C E McMil- Handle Co hl47 Ell (SM) lan Paint & Glass Co rll9 Rogers av (V) McMillan Geo L (Bertha) city firemn h2022 2d McMillan Kathleen rll33 Walnut McMillan Lowren (Audrey) hlpr Central Sash & Door Co hl26 Ponce de Leon av (SM) McMillan Mary E student r2022 2d McMillan Paul elk Lester A Thomas r McPherson J H slsmn Gulf Oil Corp McPherson Jas L pkr rl2Q5 Montpelier McPherson Katie J Mrs smstrs r804 Elm McPherson Lois slswn S H Kress & Co r Cross Keys McPherson M Lucille rl205 Montpelier McPherson Margt fctywkr rl47 Ell (S M) McPherson Rufus grader Natl Handle Co rl47 Ell (SM) 757 Pine McMillan Ray H (Madge) millwkr Bibb Mfg Co r363 Clinton (EM) MCMillan Walter C (Gladys D) supvr Penn Mut Life Ins Co hllO Euclid av McPherson Viola (c) lndrs h202 Green McRae Ruth office sec h461 College apt 5H McRae Womble student r419 Johnson av (HH) Mc(MSMoo) re Jos (c) lab rll6 (16) Alabama McMullen J Ernest (Mary L) auto mech rl811 2d McRoy Eli (c; Willie) lab rllO Tind'all av (SM) MMecSSweaarisn MHaercietor(c)L h(iC19laErad)gelwoaonosd ah6v98 McMullen Jos (Martha) lab r560 Wool- Winton av folk (EM) MeSwain John L (Pearl L) detective Po- MoMMauylnlianrsd Jo(sEM(c); Annie) lab h702 (701) MoMullis Jas mldr r220 1st MOMurray Edith (wid Jas D )h723 Col- lege McNabb Emma B r7'21 Hemlock McNabb Mary E (wid Lorenzo D) h721 Hemlock McNabb Ruth maid Hotel Grady McNair B Ray sec McNair Lbr & Sup- ply Co r314 College MMccNNaaiirr EBleissshiae B(c)Rehv30(6c;(3L0o7u)is2edKa)v p(aUs)- tor Holsey Temple C M E Church h575 Monroe lice hi25 Rembert av MdSwain Martha E elk rl25 Rembert MeSwain Ruth (c) cook r325 Madison McTyier Rubv (wid Wm L) rl02 Holt av' (V) McWaters Chas L (Dora) eng MD&SRR h793 Courtland av McWaters Chas L ir (Kliz) firemn MD &SRR h275 Hill Crest av (CH) McWaters Eliz student r275 Hill Crest av (OH) McWaters Louise slswn r802 Mulberry McWhorter B H driver r Hotel Fickling McWhorter Edw (c; EUla) brkmn h221 Middle (V) 257 MACON Moving - Packing - Crating Prompt Efficient Service TRANSFER NEW AND USED FURNITURE CO. 408 BROADWAY PHONE 304 McWhorter H O driver r Hotel Pickling McWhorter Henrietta (c) lndrs h512 1st M3c/WV hort)er Wm (May L) lab Taylor Iron Wks & Supply Co r7 3d St la McWilliams A Orell slsmn I N Jordon r 609 Holt av (NH) McWilliams Annie B (wid Simeon) r 105 Buford pi McWilliams Ellen E (wid Wm A)N hl65 McWilliams Henry C (Clara) cond hi 14 MPcWoniclleiamdes MLaenolneyaPv ((MSMar)y) trav slsmn Happ Bros Co hl21 Corbin av (V) McWilliams Robt C h3801 Houston av (SM) McWilliams Robt S (Mae E; Mack Pur- chasing Co) h609 Holt av (NH) Mdodana Christine C instr Ballard Nor- mal Soh rl008 Clinton rd MeAagdceyrsr3B1o4bbFieorsAythMrs sten Davis Ins Meaders 'Edgar B (Sadye G; Bibb Mat- tress Co) r600 Montpelier av Meaders J Otis (Emma L) mldr Taylor Iron Wks & Sup Co hl04 Emory av MEADERS MATTRESS CO, W T Mea- ders Pres F N Johnson Sec-Treas, Mfrs and Renovators of Mattresses and Pillows, 425 Arch, Tel 5136 MeMadoenrtspePliuerrloanvia (wid Grover C) h600 Meaders W Howard (Bobbie A) teller r 314 Forsyth Meaders Wm T (Eunice) pres Meaders Mattress Co hll3 (13) Balkcom av (E M) Meadows Adelaide (wid Wm M) hl03 Woodland av (I) Meadows Albert waiter Benj P Lyles r 3171 1st Meadows Anita (c) tchr r210 Mutual av formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 262 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Mills Robt C C (Leila I) emp CofGaRy Mims Maudestine (c) tchr rl26 (165) hl02 Jeff Davis (SM) Roye (CH) Mills Rayfield (c; Johnnie) lab h263 Mims Minnie L lndrs r915 Pio Nono av North (V) (V) Mills Sally M (c) agt Afro-American Mims Rachel (c) student r324 5th av Life Ins Co r333 3d av (V) (V) Mills Sarah (c) cook r619 Middle (EM) Mills Shalor H (Margt C') credit mgr Mims Randolph (c) lab rl26 (165) Roye (CH) Sterchi Bros Stores Inc r320 College Mims Richd (c) lab r342 Middle (V) Mills Styles N agt Natl Life & Accdt Ins Mims Rosa (c) rl26 (165) Rove (CH) Co r605 Orange apt 2 Mills Theo (e; Ada) lab hllO Neal av MMim)s Ruby (c) maid hl06 Woolfolk (E (V) Mincey David L student rl02 Ryals av r Mills Thos W (Bertha W) lab City Water Ming Ila (c) h205 Industrial Home rd Wks Shop h910 Oglethorpe Ming Leonora (c) r804 Fort Hill (EM) Mills W Hines (Cleo M) mach CofGaRy h309 Ormond ter Mills Wm (c; Emma) lab r317 Patterson Ming Melvina (c) r804 Fort Hill Mingledorff Robt S (Birdie) h211 Balk- com av (EM) (NHts) Mingledorff Willie r211 Balkcom av (E MiCllos r5W16mORgleathgotrpPerogressive Life Ins M) Minnefield Minnie (c) lndrs h228 (174) Mills Willie (c) h619 Middle (EM) Moore la Milnar Lula (c) lndrs hl326 1st Minor Albord V blrmkr r412 American Milner Alma (c) cook r622 (620) 4th av (V) blvd Minor Annie M Mrs (Macon Shoe Co) r It s Milner Henry (c; Annie) h851 Ash Milner Isaiah (c; Mamie L) h718 Haw- thorne Milner Leola (c) hll4 (101) Plummers al 116 Vista cir Minor Avery B (Clara) tmkpr r440 American blvd Minor Carl (Eunice) h311 American Milner Oliver (c; Willie) carp h258 Gar- blvd den (EM) Minor Carl (May) lab h307 American Nto-i ^H Milner Willie (c) restr 455 Clinton (EM) r258 Garden (EM) Milton Mellie (Minnie) car repr CofGa Ry r771 1st Mimbs Laura Mrs millwkr Atlantic Cotton Mills hl2 Atlantic Village blvd Minor Fannie L (wid John T) h753 New M4i1n2orAFmraernikcanL b(lJvodhnnie J) loco eng h Minor John D (Betty E) h768 Hemlock Minor John T slsmn Herbert Smart MMimibllss Mrl2imAi tlmaniltliwckrVilAlatglaentic Cotton Mimbs Wilbur bge agt rl37 Magnolia Mimms Eli (c; Nora) lab h!62 4th av Clothing Co Inc r510 Mulberry Minor Jos B (Winifred H) carrier IIS PO r753 New Minor Marguerite tchr PS r768 Hemlock (V) Minor Thos slsmn r Hotel Fickling Hi Mimms Lucille (c) rl58 4th av (V) Mimms Mayo (c) lab hl31 (12) Park Hotel al Mims Abbie (c) smstrs h28 (528) Clay- ton (V) Mims Abner L (Carmen) slsmn hll5 La- mar (V) Mims Adolphus (c; Emma) brklyr hl26 (165) Roye (CH) Mims Adolphus jr (c) student rl26 (165) Roye (CH) Mims Anna (c) r937 Elbert (SM) Mims Anna (c) maid r324 5th av (V) Mims Beni millwkr Willingham Cotton Mill r330 Winship (WH) Mims Chas (c; Mandy) h937 Elbert (S M) Mims Chas (c; Hattie) lab City h212 (3) N Tatnall Mims Clara (c) r937 Elbert (SM) Mims Danl (c; Mary) janitor h342 Mid- dle (V) Mims Danl jr (c) lab r342 Middle (V) Mims E Velma (Susie) lab r2010 Vine- ville av (V) Mims Eddie (c) USN rl26 (165) Roye (CH) Mims Ella P (c) r324 5th av (V) Mims Elliott (c) chauf r342 Middle (V) Mims Emory (c; Pinkie) lab h79 Forest av (V) Mims Essie (c) student r438 4th av (V) Mims Garfield (c) r937 Elbert (SM) Mims Geo (c; Willie M) h930 Elbert (S M) Mims Gracie (c) tchr r342 Middle (V) Mims Green D (Lottie) h330 Calhoun Mims Jack (c) r520 Flanders (EM) Mims Jas (c) lab MD&SRR h324 5th av (V) Mims John (c; Lucille) lab h939 (909) Elbert (SM) Mims Kathryn r212 2d Mims Lucy (c) r520 Flanders (EM) Mims Mary (c) lndrs h203 Telfair Mims Mary (c) maid r324 5th av (V) Minsey Louise (c) cook r289 1st av (V) Minson Mary (c) maid r8 Reynolds al MBinrtiegrhaAmlva millwkr Bibb Mfg Co r44 Minter Arnold L (Fannie M) hl07 Grand Minter Daisy (c) cook rl236 Broadway MMiinntteerr FInaenznihe21L8 mSiplrlwinkgr rl07 Grand av MMinftgerCJoulhiu44s BWrig(hAalmice) millwkr Bibb Minter Richd G (Caroline) eng r203 Oak Haven av Minton Clarence lab r467 Cotton av Minton Derry H slsmn Snow's Lndry & Dry Clng Co r597 Hillyer av (CH) Minton Jas r55 Monroe (U) Minton Lonnie M (Ethel) electn rl34 Stratton (SM) Minton Mack B (Mollie) h597 Hillyer av (CH) Minton Mack B jr slsmn Swift & Co r 597 Hillyer av (CH) MCinotoInncRur5t9h7 sHteinllyFer TavVi(nCcHe)nt Realty Minton Walter pntr r55 Monroe (U) Minton Warren S installer r597 Hillyer av (CH) Minton Zudie Mrs h55 Monroe (U) Minute Lunch (Theodor Narkas) restr 320 2d Miraglia Edw (Frances) gro 404 Mul- berry hl008 Walnut Miraglia T Anthony barber Watkins Barber Shop rl008 Walnut Mirron Chas (c; Ann E) lab rl310 Broadway Mishoe Sarah r454 Elm Mishoe Wiley h454 Elm Mitchall Marv waiter rlOl North av (N H) MMitc)ham Louis (c) lab r517 Flanders (E Mitcham Raymond (c) r517 Flanders (E M) Mitcham Willie (c) lndrs h517 Flanders (EM) Mitchel Alice (c) cook r!07 Simmons av LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 Mitchell Anderson (c; Flora B) lab h M3it0c7heCllhaArnledsrew(SM(c)) lab rill (154) Ce- dar (U) Mitchell Anna (c) h318 (72) Plummers Mitchell Annie (c) h509 (309) Hall (E M) Mitchell Annie M (c) r9 (302) Hanson Mitchell Annie M (c) lndrs hS08 Ross Mitchell Arth (c; Ada) lab h258 Broad Mitchell Blanche (c) rl27 Park Hotel al Mitchell Buddy (c) r220 Telfair Mitchell Caroline (c) r357 Maple Mitchell Carrie hl03 Womack (EM) Mitchell Chas (c; Mabile) cook h9 (302) Hanson (SM) Mitchell Chas (c) lab Natl Handle Co r 1306 Broadway Mitchell Chas (c; Florence) lab hl08 Holt la (V) Mitchell Chas (c) lab hl2% Plant al Mitchell Chas (c; Christine) lab h205 (226) Turpin (T) Mitchell Charlie M (c) lab r9 (302) Han- son (SM) Mitchell Clara M (c) maid rl07 SimMmitcohnesllavClifford (Mary) lab h708 Broad (EM) Mitchell Clifton (c; Pearl) lab MD&SRR r861 (867) Broadway Mitchell Clyde waiter r229 Tatnall Mitchell Compton student r708 Broad (EM) Mitchell Cora (c) lndrs hllO 2d av (V) Mitchell Della (c) hl28 (155) Cedar (U) Mitchell Donald G Jr (Mildred) reporter Macon Evening News h307 Buford pi Mitchell E C electn Ga Power Co Mitchell Ella (c) drsmkr 211 (434) Thompsons al h do Mitchell Ella M (c) r405 (417) Bay Mitchell Emma (wid John S) hll5 Gor- don (SM) Mitchell Emma K (c) lndrs rl42 2d av (V) Mitchell Emmett L (c) porter Pekor Cook Jewelry Co r667 Hazel Mitchell Ernestine (c) maid r509 (309) Hall (EM) Mitchell Estelle (c) h503 (507) Maynard (EM ) Mitchell Flanders (c) driver rl27 Park Hotel al Mitchell Florrie (c) r970 Hazel Mitchell Florrie r229 Tatnall Mitchell Fornev D (Jessie L) ydmstr h 239 Ell (SM) Mitchell Fornev D jr student r239 Ell (SM) Mitchell Frances (c) maid hl25 (204) Magnolia la Mitchell Frank (c: Carrie) lab r278 2d av (V) Mitchell Frank B (Matibel) phys 21 Ar- lington pi h do Mtiotcnheplil Frank B ir student r2l ArlingMitchell Fred (c; Mary) bellmn Hotel Grady r512 Fort Hill (EM) Mitchell Glenn L (Evelyn A) agt In- dustrial Life & Health Ins Co h615 Pio Nona av (V) Mitchell Hattie (c) hl06 (6) Orchard Mitchell Hattie L (c) tchr PS r524 E 2d '(EM) Mitchell Hattie M (c) emp Snow's Lndry & Dry Clng Co h6 3d St la Mitchell Hayward H (c; Mary) porter h 524 E 2d (EM) Mitchell Henry (c) r215 Powell (EM) Mitchell Henry elk r415A 3d av (V) Mitchell Henry (c; Willie M) chauf h755 Ash Mitchell Henrv H (c; Eddie M) porter Ry Exp Agcy h534 E 2d (EM) Mitchell Henry R (Grace) cond h237 Ell (SM) Mitchell Herman (c) janitor Beda Etta College Mitchell Homer (c: Stella) lab h2 Parker Mitchell Homer L (c) lab rl75 Park Hotel al Mitchell Horace (c; Lois) hl07 O'Neal's al (EM) Mitchell Horrance N (Agnes) hi 10 Cor- bin av (V) Mitchell lima A r708 Broad (EM) Mitchell Isaiah (c; Tessie) lab hllO (10) Wise av (V) Mitchell Jack student r702 Woolfolk (E M) Mitchell Jacob (c) student r581 (576) Siam (EM) Mitchell Jas (c) lab rl08 (120) Richard (U) Mitchell Jas (c) millwkr Bibb Mfg Co r720 Hazel Mitchell Jas (c) pdlr h312 Gantt pi Mitchell Jas (c) wtchmn hl08 Turpin la (T) Mitchell Jennie (c) lndrs h767 (768) Ocmulgee Mitchell Jesse A (Blanche) pres Mit- chell & Williams Inc hl47 Summit av (NH) Mitchell John (c) lab rl08 (120) Richard (U) Mitchell John (Ethel) lab G Bernd C'o h581 (576) Siam (EM) Mitchell John B (Ruth) driver Ga Power Co rl227 2d Mitchell John C (Myra) h2810 Houston av (EM) Mitchell John C (c) lab WPA Whse r 156 (157) May av (U) Mitchell John P (Annie) slsmn Nehi Bottling Co h215 Heard (SM) Mitchell Jos A student r239 Ell (SM) Mitchell Josephine (c) h552 Monroe Mitchell Julia M (c) hlOl Clara (EM) Mitchell Katie (c) cook rll8 (83) Bay Mitchell Lillian (c) student r258 Broad (EM) Mitchell Lillie (c) maid h21 Parker av (V) Mitchell Lily (c) lndrs r24 Parker av (V) Mitchell Lizzie (c) maid h3 Sparks al Mitchell Louis T (Lois M) eng Fire Dept h241 Winship (WH) Mitchell Lucius (c; Julia M) porter Pig'n Whistle Sandwich Shop hi 7 Harris al Mitchell Lucius (c; Rosa) waiter hl31 Middle (V) Mitchell Mae h652% Cherry Mliatchell Margt L (c) lndrs rll6 Bostic1 Mitchell Marion H (Nina E) gro 370 (334) North (V) and 415a 3d av (V) Mhit3c4h6elHl aMrdaeryma(nc) alvndrs r204 Kitchens Mitchell Mary (c) millwkr Bibb Mfg Co r220 Telfair Mitchell Melvin C (c; Lucia V) phys 552 New r do Mitchell Minerva (c) lndrs hl07 (121) Long la Mitchell Moses (c) student r258 Broad (EM) Mitchell Nan bkpr Barnes & Barnes Inc h864 Mulberry apt 4D Mitchell Nannie A Mrs smstrs rl432 2d Mitchell Philip (c; Emmie L) h562 Ward (V) Mitchell Philip jr (c) r562 Ward (V) Mitchell R Frank (c) carp rl42 (301) Nussbaum (SM) M(it3c0h1e)llNRussFbraaunmk ((ScM: )Annie) lab hl42 Mitchell Robt (c: Rebecca) lab CofGa Ry hl52 Elm Mitchell Robt L (Sue L) rep h476 College apt 6 Mitchell Robt P h229 Tatnall Snow's Laundry and Dry Gleaning Go. Licensed "Sanitone" Gleaner Phone 6000 264 AUTHORIZED DEALER PRINTING BINDING R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. ,,Tel. 11 RUBBER STAMPS THE BEST WORK CORRECT PRICES Mitchell Roscoe (c) lab r581 (576) Siam (EM) Mitchell Ruby fctywkr r716 3d Mi(t1c2h0e)llRRicuhfaursd ((Uc;) Mattie) lab hl08 Mitchell Rufus (c; Amanda) porter h 227 Cedar (U) Mitchell Susanna (c) cook rll9 (11) Tinsley la Mitchell Susie (c) hl23 Walker la Mitchell Susie (c) fctywkr h342 HamMmitcohnedll Theo W (Evelyn) meat ctr Oates Market r218 American blvd Mitchell Thos (c; Hassie) lab h278 2d av (V) Mitchell Thos L (Sue J) agt Prudential Ins Co r Forsyth rd Mitchell Vera Mrs pkr r559 2d Mitchell Violet (c) Indrs rl42 2d av (V) Mitchell Walter (c; Lena) lab hi40 Washington (EM) Mitchell Walter L (Gladys S) filtermn City Water Wks h2455 (2457) 2d Moats Leana (c) cook h302 (315) Henrietta (SM) Mobley Alex W (Lillie) h734 Anderson (SM) Mobley Annie (wid Jas A) hl52 High Mobley Josephus (c) porter r343 4th av (V) Mobley Louise elk Coleman-Meadows- Pate Drug Co rl52 High Mobley Mattie (c) cook rl058 Hazel Mobley Melvin L (M Elease) hlpr Sch- wartz & Phaul Inc rll4 Stratton (SM) Mobley Ora r734 Anderson (SM) Mobley Otis (c; Julia) plstr h343 4th av (V) Mobley Rachel (c) maid hl5 Graham's Lot Mobley Thos lab r734 Anderson (SM) Mobley Walter E (Frances) phys 700 Spring R220 h401 College apt 1A Mobley Walter E sec Macon Lodge No 230 BPOE h774 Mulberry Mobley Willie M (c) maid r343 4th av BURKE'S 406 Cherry St., MACON Mitchell Wm (c; Emma) h406 (381) Plummers al Mitchell Wm (c; Eva) lab h236 Collins MPitichell Wm (c; Minnie) lab h667 Hazel Mitchell Wm (c; Annie) lab hll5 Linden Mitchell Wm (c; Carrie) lab rl07 (599) Singleton's la Mitchell Wm (c; Mattie) orderly h909 MEitdcgheewllooWdmavH agt Am Natl Life Ins Co r Columbus rd RD 2 Mitchell Wm R (Laura) tinner CofGa Ry h702 Woolfolk (EM) Mpitichell Wm P student r21 Arlington Mitchell Willie (c) student r524 E 2d (E M) Mock John R car repr C of G Ry Mock Wm T (Margt) dept mgr h261 Georgia av apt B2 Mode Van B pntr r616 Hemlock Modena Dominick (Maude) mach hl54 Broadway Modena Jos L (Molly) emp C of G Ry rl54 Broadway Modena Nicodemus J (Lavonia) emp C of G Rv h305 Fairmont av (B) Mho2d1e1na3dPeatver(S(MLu) die; The Kennesaw) MMod)ena Peter jr student r711 3d av (S Modem Grocery Co (Max Cohen) whol gros 1033 Broadway Modernistic Shoe Repair Shop (c; Louis D and Wm E Watson) 329 Monroe MITCHELL & WILLIAMS INC, Jesse A Mitchell Pres, Roy G Williams V-Pres and Genl Mgr, Macon's Leading Druggists, Store No 1, 376 2d, Tels 3947 and 3948, Store No 4, 656 Cherry, Tels 13461347 Moffett Kendrick S (Rosie; Moffett HT)ransit Line) h227 Nottingham dr (W Moffett Tranit Line (Kendrick S Moffett) trans 350 Cherry Mohone Grant (c; Mary) loco firemn h Mitchum Clayton (Margt) millwkr Bibb 547 (41) Tindall av (SM) Mfg Co h33 Bibb av Mohone Jas (c; Claudia) lab r547 (41) Mitchum Mamie (wid J Edw) r27 Prog- Tindall av (SM) ress Mitchum Marvin (c) delmn Glass Mohoran Elvenia (c) rl02 Pringle (EM) Moland Clyde (c) r515 Flanders (EM) Polk's Pharmacy Moland Minnie (c) Indrs rllO (231) Tur- Mitts Keyes (Martha) trav slsmn h401 pin (T) Bankers College apt 7A Mixon Arth (Mildred) millwkr Bibb Mfg MHol)loy Olah P Mrs hl85 Boulevard (N Co r328 Hydrolia (EM) Molton C Eug (Willie T) slsmn Darling Encyclopedia Mixon Benj J (Kizzie) h256 (56) Maynard (EM) Shop r324 Hanson (SM) Molton Cecil J ship elk Goodyear Serv- Mixon Ellis T (Annie R) linemn hll42 ice Stores rl363 Oglethorpe The Bank Directory of the World Issued Milledgeville rd (EM) Mixon Essie (c) r534 Jackson Mixon Lillie T Mrs elk r2130 Broadway Mixon Milton J r256 (56) Maynard (E M) Mixon Oliver student r315 Coleman av Molton Hiram N (Willie L) elk h324 Hanson (SM) Molton John T (Emmie) lab hlOO Capitol av (Mikado pi) Molton Kathryn Mrs rl92 Oakland av Molton Lucile sewer rlOO Capital av Mar. and Sept. (CH) (Mikado pi) $15.00 per volume R. L Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Mixon Susie (wid Walker) r2130 Broadway Mixon Thelma millwkr Bibb Mfg Co r 256 (56) Maynard (EM) Mixon Walker r256 (56) Maynard (EM) Mixon Wm H (Lillie T) policemn h2130 Broadway Mixson Mattie r924 Walnut Mize Clarence S (Bessie) photog 620% Cherry hl728 3d Mize Lois D Mrs tchr PS h307 (193) Log Cabin blvd Mize Louis (c; Mary) r267 Walnut Mize Walton E (Lois D; Georgia Mkt Service Sta) h307 (193) Log Cabin blvd Mizell Martha A office sec Dr W W Chrisman r213 Bond apt C3 Mizrahi Benj driver r220 1st Moates Sadie M Mrs millwkr Bibb Mfg Co rl32 Roff Home la Molton Martha (c) student r329 Madison Molton Reid elk rlOO Capital av (Mika- do pi) Molton Ronald elk Floriede Snell r324 Hanson (SM) Molton Rose waiter r Thomaston rd RD 2 Molton Roy L (Lillian) driver rlOO Cap- ital av (Mikado pi) Molton Sarah N (wid Chas J) rl363 Oglethorpe Molton Thos F sawyer Middle Ga Lbr Co r RD 2 Molton Thos R elk Lester C Goodwin rlOO Capital av Moltz Lester (Artis) mill wkr Atlantic Cotton Mill h234 Roff Home av (V) Momand F Louise student r433 Johnson av (HH) Momand Faye O (Gladys) r708 Hemlock 265 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Momand Henry C (Bertha M) cond h 708 Hemlock , , ,, Momand Henry G (Louise E) h433 Johnson av (HH) Momand Olvine P (Gladys) fish 456 1st r708 Hemlock Momand R Thos (Naomi) supvr h708 Hemlock Moncrief Chas (c; Kattie) lab hl50 5th Moncrief Eva tchr PS rll4 Rutherford av (SM) . Moncrief Geo B (Roxie A) r204 High- tower Moncrief Janie student rll4 Rutherford av (SM) Moncrief Marion L atndt Stewart Oil Co rll4 Rutherford av (SM) Moncrief Marion W (Margt B) car repr hi 14 Rutherford av (SM) Monfee Andrew J (Pearl) millwkr Willingham Cotton Mill hill (45) Holt av (NHts) Monica Court apts 353% 3d Monk's Garage (Lewis H Colquitt) 618 Broadway Monroe Anna C (c) hl08 Spring Monroe Claudie (c) Indrs r206 (523) Craft (V) Monroe Leola (c) maid r8 Fulton al Monroe Maude (c) cook r206 (523) Craft (V) Monroe Turner (c) gro 203 (788) Prince (SM) h do Monroe Wm E (Annie L) auto mech h 109 Ponce de Leon av (SM) Monsees Jas A Rev (Onie) pastor Elizabeth Primitive Baptist Church h534 Washington av Moody Walter T jr (Dorothy W) bkpr First Natl Bank & Trust Co rl22 Rem- bert av , , Moon Calvin E (Georgia) woodwkr h246 Washington av . ,,,, Moon Carrie Mrs millwkr Bibb Mfg Co h50 Davis (PM) Moon Emory (c) h210 Coles al Moon Franklin T chf eng Kinnett-Odom Co r 6th and Cherry Moon Hannah millwkr Bibb Mfg Co r33 MBooibnb Mavarcus (c; Gwendolyn) lab C of G Ry h575 Siam (EM) Moon Thos (Henrietta) fctywkr h749 Anderson (SM) Mooney Geo (c) lab rll5 May Mooney Jas A (c; Mattie) porter h344 Madison Mooney Jas R jr elk Chas A Odom jr r723 Broadway Mooney Opal student r675 Edgewood av Mooney Thos (c; Ella) prsr Matthew L Fleming rl05 May Moore Abr (c; Susie) lab r408 (503) Prince (SM) Moore Addie (wid Thos) millwkr Bibb Mfg Co r645 Ash Moore Adele Mrs office sec Am Natl Red Cross Macon Chapter h623 Ingleside av (I) . Moore Alan A (Mary M) mach C of G Ry hl02 Rembert av Moore Albert (c; Bessie) lab C of G Ry h404 (507) Prince (SM) Moore Alton C (Julia A) slsmn Nehi Bottling Co r313 Forsyth Moore Alva E (Mary A) blr inspr h825 Monsees Jessie C (wid Dock P) h654 Plum Moore^ Amos L (c) cook rill Berthadale Montague A P Mrs matron Mercer Univ Montgomery Alice (c) hl7 (10) Short (EM) MMonftggoCmoerry869A2lidce Mrs millwkr Bibb Montgomery Cornelia student r735 College Montgomery Ernie L (Mary M) lab r717 Cherry Montgomery Howard B farmer r218 Cherokee av ,,,, ,,,, Montgomery John R reprmn SBT&TCo 1735 College Montgomery Josephine (c) rl7 (10) Short (EM) Montgomery Leroy (c; Georgia M) lab h7 Short (EM) Montgomery Paul A (Tommie S) formn SBT&TCo h735 College Montgomery Thos (c; Annie) lab r214 Woodcliff Montgomery Walker P (Ruth) h218 Cherokee av Montgomery Walker P jr farmer r218 Cherokee av Montgomery Wayne W student r218 Cherokee av Montgomery Wm T (Eva) elk to receiver Fourth Natl Bank hi 12 Ingleside av Moody Berry L bkpr College Hill Phar- macy r215 College Moody Clifford A (Mary E) hl017 Mont- pelier av Moody Edgar student rl015 Walnut Moore^Annie Mrs elk Union Dry Gds Co r613 Arch , Moore Annie A (c) hl22 Spring Moore Annie R tchr r227 Lawton av Moore Arth (Ruby) slsmn Buck Ice & Coal Co rl03 McGee (CP) Moore Arth B gro 1751 Broadway h do Moore Asa E (Frances) elk hi 12 Aca- demy Moore Asa E (Minette) driver h6 Rose Moore Augustus L rl977 3d Moore Beni M (Emma S) inspr County Bd of Health h536 (59) Flamingo dr Moore Betty h462 Oak Moore Burney (c; Pearl) lab h411 Madi- son Moore C Marion (Annie B) slsmn Hat- cher & McCrary r860 2d Moore Calvin G rl05 Kenmore pi Moore Cary B (Alma W) formn Macon Teleg Pub Co h420 Montpelier av Moore Cecil A (Mabel) linemn Ga Power Co h907 (935) Napier av Moore Celia B Mrs asst librarian Wash- ington Memorial Library r88 Arlington pi Momoaren-DCehnats-S(ucl;livManamCieo Lh)616hlpSrprFinregeMoore Chas B (Ruth; Moore & Boone) Mhoollr3e CChlaaystoRn ((ZVo)e R; Tatnall Sq Serv Sta) h304 Hines ter (V) Moore Chas W (Lillian) auto mech h Moody Edith (wid Wm W) hl015 Wal- 310 Pio Nono av (V) nut Moore Chas W (Ola) carp Willingham Moody P C (Emily) mech Dunlap Chev- Cotton Mill hll4 (7) Holt av (NHts) rolet Co Moody John elk Tatnall Square Drug Store r215 College Moody Julian E (Tillie) elk Tatnall Sq Drug Store r407 Carling av Moore Chris (c) rl30 Plummers al Moore Clarence W (c: Fannie) dist mgr NC Mut Life Ins Co hl008 Clinton rd (EM) ' Moore Claude L (Gladys)s auto . mech . h Moody Paul bkpr r860 Mulberry 304 Pio Nono av (V) Moody Tommie T (wid Jesse T) r865 Moore Cleo Mrs rl421 3d Cherry Moore Cleveland (c; Louise) porter Am 18 Moody Walter T (Jennie) firemn MD& SRR h215 College Bakeries Co hll5 New Moore Clyde K lab h!07 Stratton (SM) SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY MIRRORS the SOCIAL Of Your CITY 266 MORE GOODS --ARE-- BOUGHT -AND-- SOLD THROUGH THE Classified Directory than by Any Other Medium on Earth W YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES 1J445 Plymouth Moore (V) D Allen (Doris) hl02y2 Holt av Moore Danl (c) lab r6 Bear's al Moore David elk Walgreen Co rl04 Nel- son (SM) Moore Delia (c) maid h296 1st av (V) Moore E Arnold hlpr Capitol Cycle Co r318 Winship (WH) Moore E Cecil (Rose A) h318 Winship (WH) Moore E Marion (Susie M) carp h54 (9) Roff Home pi Moore E Monroe (Celia B) custodian US PO r88 Arlington pi Moore Edgar (c; Mattie L) lab h339 Bookers al Moore Edw mill wkr Bibb Mfg Co r771 1st Moore Edw P (e; Kate) shoe repr Dixie Shoe Repair Shop h'535 Flanders (E M) Moore Edw M (Adele) bkpr Southland Coffee Co h623 Ingleside av (I) Moore Effie (c) Indrs hl231 Broadway Moore Elfleta (c) tchr Hazel Street Sch rll5 Chestnut Moore Elijah F (Jewel M) slsmn rl363 Oglethorpe Moore Ella (c) rl02 (101) Bowman (EM) Moore Emma (c) h301 (11) Henderson (SM) Moore Emmett (c) lab r212 (231) Gantt City rd (SM) Moore Emmett L millwkr Willingham Cotton Mill rll4 (7) Holt av (NHts) Moore Emmie L millwkr Willingham Cotton Mill rll4 (7) Holt av (NHts) Moore Enoch C (Nancy) gro 47 White (SM) h do Moore Erie C (Evelyn) millwkr Bibb Mfg Co r607 2d Moore Ernest C (Emily) elk P'O h2717 Forsyth rd Moore Ernest L (Irene M) dist mgr Life & Casualty Ins Co of Tennessee h500 Napier av Moore Estella (c) maid rl03 Curd's al Moore Etta Mrs slswn Burden Smith & Co r911 Cherry Moore Eulalia h*305 Linden av Moore Eulys T (Josephine) supvr h2908 Houston av (SM) Moore Eupha W (wid D Emory) tchr G A B Sch of Commerce r884 Hillyer av (CH) Moore Evelyn student rll5 Inverness av Moore Fannie D Mrs private sec Ballard Normal Sch rl008 Clinton rd Moore Felton student rl32 Curry dr Moore Florence (c) h414 E 2d (EM) Moore Frances matron Hephzibah Or- phanage r Forsyth rd Box 222 Moore Geo (c) cook The Polar Bear r407 Ward (V) Moore Geo lab Central Bedding Co r RD 5 Moore Geo (Ethel) labr411 Elm Moore Goebel E (Myrtle) millwkr Atlan- tic Cotton Mills hi Atlantic Village Moore Goldie M (Jos L) hl415 Edgewood Moore Grace (c) cook r205 (368) Rail- road av (V) Moore Guy S (Lucille S) stockmn No- land Co rl48 Parkwood av Moore Hannah (c) Indrs rllO Bostic la Moore Harry L (Zell M) h781 Patterson (NHts) Moore Harvey (c) porter r6 Opera House al Moore Henry hl06 (210) Green (V) Moore Henry (c; Georgia) lab r209 Pat- terson (NHts) Moore Henry C (Mary) millwkr hl09 Brookdale av (B) Moore Herman student rll5 Inverness Moore Homer (c; Isabella) lab h227 Summit Hill Moore Howell E (Louise J) supvr elk W PA r208 Crescent av (OH) Moore Ida (c) maid rl38 (274) Roye (C H) Moore Irvin (Exie) millwkr Bibb Mfg Co hl03I1st Moore Irwin student rl'15 Inverness av Moore Isaac (c) h521 Forsyth Moore Isaac (c; Priscilla) porter r405 (408) Crisp (SM) Moore J Lawrence (Evelyn J) caretkr h 114 Chappell (SM) Moore Jacob r248% Main (EM) Moore Jas B (c; Janie) lab Taylor Iron Wks & Sup Co h314 (447) Alabama av Moore Jas C (Irene) gro 2348 2d h2346 do Moore Jas M slsmn Dunlap-Peeler Hdw Co rl27 Boulevard (NH) Moore Jefferson M (Eugene) millwkr Willingham Cotton Mill h450 Vine (N Hts) Moore Jesse (c; Eliz) h6 (567) Duffey's al Moore John (c; Alice) hl02 (101) Bowman (EM) Moore John (c; Ola) r Coy Burton Moore John (Gladys) lab h317 Melrose (B) Moore John D (Irene L) flagmn h508 Beech av Moore John E (c) r5 (507) Duffey's al Moore John T rll08 Montpelier av Moore John T (Carrie W) comnr Macon Bd of Water Comnrs h77 Arlington pi Moore Johnson & Thomas (Lloyd D Moore, Walter T Johnson and Maurice C Thomas) lawyers 516 Mulberry R301 Moore Jos E civ eng r77 Arlington pi Moore Julia rl09 Brookdale av (B) Moore Kath student rll3 Clayton (V) Moore Kath Mrs (Dinty Moore's Lunch Room) r811 Poplar MoMofrge LCeoonha4rdSCche(IlldaavM)(EmMil)lwkr Bibb Moore Leroy (c) janitor rl04 (4) Wise av (V) Moore Levorse (c; Katie) lab h401 Colquitt Moore Lewis C r56 Holt av (NHts) Moore Lillian rl415 Edgewood av Moore Lillian (c) r212 (21*3) Gantt City rd (SM) Moore Liza (c) r312 Gilmer Moore Lizzie (c) cook r857 3d Moore Lizzie (c) Indrs r217 Summit Hill Moore Lizzie (c) maid h212 (231) Gantt City rd (SM) Moore Lloyd D (Mamie; Moore Johnson & Thomas) hl92 English av (V) Moore Louis (c) lab r4ol Colquitt Moore Louise r320 Pio Nono av (V) Moore Louise (c) maid rl04 (4) Wise av (V) Moore Louise tchr rll3 Clayton (V) Moore Made L student r500 Napier av Moore Maggie r331 (393) Hill Crest av (CH) Moore Malinda (c) r207 Patterson (N Hts) Moore Mandy (c) h220 Mitchell la (V) Moore Margt elk rl415 Edgewood av Moore Marguerite student r425 Vineville av (V) Moore Marguerite T (wid Miller N) r 425 Vineville av (V) Moore Marie rT7 Arlington pi Moore Marion (c) lab r608 Ross MMoooorree MMaarrythasteVn rr370653 L2dinden av Moore Mary Mrs slswn Reliable Outfitters r Smith rd Moore Mary A cash Macon Gas Co r218 Georgia av Moore Mary E tchr PS r227 Lawton av Moore Mary E Mrs smstrs h!104 Nelson (SM) Moore Mary E (wid Columbus E) h860 2d 267 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement - Plaster 457 Third St. Phones 277-278-279 Moore Mary E (wid Jas F) rl05 Stone- wall pi (V) Moore Melba O cash Ritz Theatre r500 Napier av , ,,,,,, _ Moore Minnie (wid John R) h227 Law- Mot(oSonrMea)vMitchell (Mary) pdlr rl,0,,5,, N,,e,lson Moore Molly B (wid Allen R) rl02 Rem- bert av Moore Monroe (c; Leola) lab h223 Sum- mit Hill ,, , Moore Myrtle S (wid Robt C) r206 Clay- ton (V) Moore N Donald r320 Pio Nono av (V) Moore Oliver T (Della) teleg rl07 Lamar (V) MoMo)re Oscar (c; Mary) hSOO Charles (S Moore Oscar (c) h314 Norris (EM) Moore Preston (c) porter S L Orr Co r 104 (4) Wise av (V) Moore Robt '(c; Juanita) porter r303 Ward (V) , ,, Moore Robt A (Nellie B) sheriff County Sheriff h855 Mulberry apt 207 Moore Robt E elk McKesson-Riley Div r 825 Hillyer av (CH) Moore Robt L (Dollye; Commercial Bar- ber Shop) r RD 6 Moore Robt L (Ethel) pdlr hl05 Nelson (SM) Moore Rosella (c) lndrs rl032 Broadway Moore Roy (c; Julia) janitor hl04 (4) Wise av (V) Moore Ruby A r210 1st Moore Ruth A tchr PS r227 Lawton av Moore Sallie (c) h71T Whitehead al Moore Sami C (Ida S) millwkr Atlantic Cotton Mills h320 Pio Nono av (V) Moore Sami E (Lula B) cond h206 Henry (SM) Moore Sara student rl415 Edgewood av Moore Sarah L (wid Hugh M) rl05 Stonewall pi (V) Moore Silas (c; Mattie) concrete fnshr rllO (10) Wise av (V) Moore Simon (Celia K) dry gds 506 Pop- lar hll5 Inverness av Moore Singleton (Mattie H) formn hl08 StJames av Moore Stewart (SM) (c; Mattie) lab ;hl04 (10) Holt la (V) Moore Sue C r305 Linden av Moore Thos (c) lab Bibb Mfg Co h405 1411) Short (EM) Moore Thos (Ella) millwkr Willingham Cotton Mill h56 Holt av (NHts) Moore Thos A (Hattie) mach Taylor Iron Wks & Sup Co hl055 Ash Moore Van H chf elk rl40 Georgia av Moore Virginia (c) cook h205 (368) Rail- road av (V) Moore W F slsmn 1301 Cherry Moore W Oren (Anna N) millwkr Wil- lingham Cotton Mill hl'120 Ash Moore Wm (c; Clara) lab h22) Neal av (V) Moore Wm (Lena) millwkr Bibb Mfg Co hl028 2d Moore Wm (c; Ellen) porter hll38 Broadway Moore Wm H (Eula E) h332 Dannenberg Moore Wm L (c) r966 Ocmulgee Moore Willie M (wid Geo F) h333 Win- ship (WH) Moore & Boone (Ohas B Moore and Henry C Boone) gros 107 Hardeman Moore's Dinty Lunch Room (Mrs Kath- erine Moore) 224 Cotton av Mooreland Clyde (c) porter Hub Fish & Oyster Co r516 Flanders (EM) Mooreland Edw (c; Mary) brkmn r447 Gilmer Moorman Arth L (Essie) linemn Ga Power Co h427 College Moorman Arth L jr student r427 College Moorman Dorothy E r427 College Moorman Edna E student r427 College Moorman Genevieve slsmn r427 College Moorman Nannie E (wid Everett) r427 College Moorman Ollie P slswn Southern Textile Co r427 College Moran Chas A (Theresa) 2d hd clo 1227 [Broadway r385 Orange Moran Ida Mrs elk Union Dry Gds Co r 298 College Moran Ola M (c) cook rill Tindall av Moran Theresa Mrs bkpr Dixie Dairies r 385 Orange Moran Wm C (Kate) , piano tj uner ,,,, Wil- liams Music Co h'317 Ross Moran Wm C (Nelle) slsmn Macon Three Centa Bottling Co rl317 Vine- ville av B i 55****j- XauOXosS ittnoo Morgan Jos (c) bushelmn Schwob Co r 124 2d av (V) Morgan Lewis (c) lab r506 (457) Alabama (SM) Morgan Lolama millwkr Bibb Mfg Co r 114 (45) Hydrolia (EM) Morgan Luke lab Ga Power Co Morgan Lula B (c) h724 Murray al Morgan Madeline r2 Parkers la Morgan Margt Mrs student rl43 Jeffer- son Morgan Marjorie student r247 High Morgan Mary Mrs millwkr Bibb Mfg Co h233 Bond apt 8 Morgan Mary E (wid Jefferson R) h507 Napier av Morgan Maude Mrs millwkr Bibb Mfg Co h32 Bibb av Morgan Olga student rll4 (45) Hydrolia (EM) Morgan Olin N (Florine M) collr Day's h247 High Morgan Olin N jr doormn Capitol Thea- tre r247 High Morgan Oliver P (Lillian) auto repr 3000 Houston av (SM) h do Moalrgan Osie B (c) lndrs h618 Chapman Morgan Pauline rll9 Lee (EM) Morgan Porter (Helen) gro 2105 2d h2107 do Morgan Raly (c) r611 Pebble (SM) Morgan Robt M (Altha) hll4 (45) Hy- drolia (EM) Morgan Rosa P (wid Wm) r311 Napier Morgan Ross E (Lizzie M) h212 3d av (SM) Morgan Runett (c) maid r506 (457) Ala- bama (SM) Morgan Sadie student r32 Bibb av Morgan Sidney (c; Carrie) hll8 E Ell Morgan Solon student rll8 Pierce av (V) Morgan Thos J (c; Kathleen) driver Southland Coffee Co h208 Forest av (V) Morgan Velma (c) prsr rll6 (152) De IBorde (SM) Morgan Wayland B (Minnie) window shades 106 Rogers av (V) h do Morgan Wm K (Marjorie) millwkr Willingham Cotton Mill hll (70) Mill MORGAN & MORGAN (Jas E Morgan), General Insurance 603-605 Grand Bldg 617 Mulberry, Tel 1811 (For further information see left top lines) Morrnan Jas (c) lab Willingham Sash & Door Co Morrell Edmond (c; Virginia) h90 TTagpi Morrill Florence elk h234 American blvd Morrill Mamie r234 American blvd Morris Adeline (c) hl37 Magnolia la Morris Adelle (c) lndrs rl36 Sycamore Morris David jr (c) student r3 Gunn's la (V) Morris Doc (c; Maude) lab r244 Church la (SM) Morris Douglas student r61'3 Arch Morris E Helen Mrs h558 Hemlock Morris Edw (c; Clifford) greaser CofG Ry h400 Broad (EM) Morris Enna W sten Crane Co r475 Orange apt 4 Morris Essie (c) maid r927 Clinton av (EM) Morris-Flinn Co (Clinton Morris) chem- ists 650% 3d Morris Frank (c; Della) lah hll7 Frank- lin Morris Frank (c) lab rlOl Mulberry Morris Geo B student r622 Duncan av Morris Geo W (Esther H) soft drinks 200 Main (EM) h866 Cherry Morris Hattie (c) h390 (380) Melrose (E M) Morris Hattie (c) lndrs h254 Garden (E M) Morris Henry J (Lillian) auto mech h212 Davis (SM) Morris Homer M (Pearl W; Adams Realty Co) ih475 Orange apt 4 Morris Houston (c; Leila B) lab hl'15 (149) Hudson Morris Ida (c) r452 Clinton (EM) Morris Ida (c) cook h514 E 2d (E3M) Morris Ida B (c) cook h238 Middle (V) Morris J Milton slsmn Darling Shop r 47'5 Orange apt 4 Morris Jack A (Mattie W) r399 (411) Montpelier av Morris Jas (c; Leila) h516 '(116) E Acad- emy (EM) Morris Jas (c; Willie M) lab hll6 4th av J) Morris Jas jr (c) student r516 (116) E Academy (EM) Morris Jas L (c; Mary) h31I Norris (E M) Morris John T (c; Isabelle) lab hl02 Davis (NH) Morris John W blksmith CofGRy hl04 Buena Vista av Morris John W lab h467 Elm Morris Jos (c; Christine) lab h241 Church la (SM) Morris Jos A (c) porter r555 Monroe Morris Jos G (Lillie; Morris Pharmacy) h3498 Houston av (SM) Morris Julia (c) lndrs hllO (5) Davis al (EM) Morris Lee (c) lab rl3 Buckner al Morris Lilly B (c) lndrs h927 Clinton rd (EM) Morris Maria (c) r320 Middle (V) Morris Marie (c) cook h827 Montpelier is Answered By file Classified Business In this Directory Morris Aggie (c) hl36 Sycamore (V) Morris Alonzo (c; Mary) sawyer hi01 Thomas (EM) Morris Angie (c) r602 Broad (EM) Morris Arth M (Emma H) candy mkr h 2032 3d Morris Bascom H slsmn Taylor Furni- ture Co r320 Spring Morris Bessie h461 Oak Morris Birdie r437 (1002) Ajax Morris Carolyn P (wid Geo B) elk Bells Pharmacy r622 Duncan av Morris Carrie (c) maid r429 Ward (V) Morris Casey (c) musician r558 Smith row Morris Chas (c; Annie) lab h411 Forest av (V) Morris Christine (c) maid r927 Clinton rd (EM) Morris Claudia M (c) r255 Broad (EM) Morris Clemmie slswn rl223 2d Morris Clinton (Leola C: Morris-Flinn Co) M65 Hendley (NHts) Morris David (c; Mary) lab h3 Gunn's la (V) Morris Marie Mrs tel opr Ga Power Co r 901 Cherry Morris Marvin L (Marguerite) bkpr Millirons Plmbg & Htg Co r320 Spring Morris Mary (c) hl71 Hazel Morris Mary L (c) rl206 Broadway Morris Mattie (c) r5'31 Gilmer Morris Mattie (c) lndrs r408 Mitchell av Morris Mattie E dist traffic mgr elk SBT &TCo r411 Montpelier av Morris Nellie (wid Jas O) smstrs r613 Arch Morris Ora (c) maid rl25 Green Morris Paul I (Virgie) filling sta Forsyth rd h do Morris Pauline (c) student rlOl (421) Thomas (EM) Morris Pharmacy (Jos G Morris) 3498 Houston av (SM) Morris Ralph (The Luggage Shop) r301 Cherry Morris Randolph G (c) tchr Beda Etta College rlOO Grant av (V) Morris Robt (c) lab r254 2d av (V) Morris Robt B (Nancy) trav slsmn h207 College pi 269 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Morris Roberta (c) r514 E 2d (EM) Morris Sami (c) restr 610 (270) Prince r do Morris Susie (c) h255 Broad (EM) Morris Thelma (c) maid h315 (312) Wo- mack (EM) Morris Thos (c) lab r254 2d av (V) Morris W H beer 705 Log Cabin blvd h do Morris Walter (c) porter r390 (380) Mel- rose (EM) Morris Wm (c; Christine) hl09 Harris Morris Wm (c) r514 E 2d (EM) Morris Wm G (Eliz) rl223 2d Morris Willie (c) h657 Elm al Morris Willie (c) maid h7 Opera House al Morrisette Frances S r608 Forsyth1 Morrison Addie R r811 Main (EM) Morrison Anna (wid Jas) rl435 2d Morrison Georgia (wid D Q) rill Stone- wall pi (V) Morrison Jas E (Hazel) mach hl31 Flamingo dr Morrison John G '(Bessie) gro 809 Main (EM) b811 do Morrison Memorial M E Church Rev Martin A Shaw pastor services 11:00 A M and 7:'30 P M Sunday School 10:00 A M 170 Henry (L) Morrison Otis A (Hunterline) slsmn Dunlap-Peeler Hdw Co h213 Clisby pi (V) Morrison Wm T (Sallie 1) lab h303 (301) Cutter's Green (EM) Marrow Earl M (Sadie) millwkr r!61 Gardner (PM) Morrow Eliz S (wid Wilson) hll5 Garden (EM) Morrow Ethel millwkr Bibb Mfg Co rl65- 66 Gardner (PM) Morrow Eug (Eunice) millwkr Bibb Mfg Co hl47 Comer ter (PM) Morrow Fred A (Rosa) millwkr Bibb Mfg Co hl65-66 Gardner (PM) Morrow Gladys millwkr Bibb Mfg Co r 165-66 Gardner (PM) Morrow Lawson millwkr Bibb Mfg Co r 166 Gardner (PM) Morrow Mabelle millwkr Bibb Mfg Co r 165-66 Gardner (PM) Morse Carl (c) lab h212 Collins pi Morse Sarah (wid Wm H) rl22 Rogers av (V) Mortgage Investment Co J Clay Murphy pres Eden Taylor jr v-pres Paul J Dos- ter sec-treas loans 470 Cherry Morton Clyde E student 419 Johnson av (NH) Morton Hah Mrs asst supvr WPA r617 Orange Morton Jos M (Mildred) collr Empire Fum Co Morton Lowe emp CofGaRy r426 John- son av (NH) Morton Mardree L (Ilah) r617 Orange Morton Wm B (Lula V) slsmn Dunlap Chevrolet Co r2642 Houston av (SM) Moseley Albert (c; Essie) lab rl027 Montpelier av Moseley Alberta (c) Indrs h565 Dunlap al Moseley Anna B (c) h'142 2d av (V) Moseley Arth (c; Annie) lab h309 Charles (SM) Moseley Beulah Mrs opr SBT&TCo r8U Poplar apt 17 Moseley C C jr fieldmn Penn Mut Life Ins Co r468 Walnut Moseley Carrie (c) cook r923 Pio Nono av (V) Moseley Chas elk Sugar Bowl r460 Spring Moseley Chas (c) lab rl27 Park Hotel al Moseley Chas W (Lizzie) dep marshal r 801 Pine Moseley David W (c; Anna) lab h907 Pio Nono av (V) Moseley Eliz (c) r929 Pio Nono av (V) Moseley Ella (c) cook r637 4th av (WH) Moseley Ethel Indrs Crescent Lndry Co r Milledgeville rd RD 5 Moseley Gus (c; Alice) dairymn Rivoli Dairy h476 Log Cabin dr Moseley Guy L (Annie L) 2d asst chf Fire Dept h618 Montpelier av Moseley H W city firemn r754 Cherry Moseley Harry M (Willie M) vehiclemn Ry Exp Agcy hl90 Magnolia Moseley Ida B (c) tchr Hudson Indus- trial iSch h901 Pio Nono av (V) Moseley Jas (c) fctywkr h205 (1) 3d av (B) Moseley Jas F slsmn Macon Feed & Seed Store :r2214 Forsyth rd Moseley John (Ilia) city firemn r!70 Vir- ginia av Moseley John (c) lab rl42 2d av (V) Moselev Jos (c) delmn r413 Hawthorne Moseley Louisa (c) r352 Madison Moseley Lyda step Adams Mfg Co rl39 Daisy Park Moselev Mamie (c) cook r929 Pio Nono av (V) Moseley Milton T (c; Ida J) lab h929 Pio Nono av (V) Moseley Myrtle fctywkr hlOl Pryor (S M) Moseley Myrtle millwkr Bibb Mfg Co r 503 Main (EM) Moseley Randolph (c) lab CofGaRy r901 Pio Nono av (V) Moseley Robt baker Collins Baking Co r 460 Spring Moseley Robt (c) lab rl27 Bostic la Moseley Robt (c) lab rl027 Montpelier Moseley Rosalie (c) maid h403 Craft la (V) Moseley Sami A (Beulah) mgr Macon Trading & Inv Co h81l Poplar apt 17 Moseley Sank (c; Lula) truck driver Buck Ice & Coal Co hl240 (1008) Dempsey av (U) Moselev Thos A (Ethel B) h514 Mulberry MOSELEY THOMAS O (Arlington Hotel), r do, Tel 51 Moseley Wm S (c) lab r929 Pio Nono av (V) Moseley Wm T (Clifford) meatetr Rogers Stores h801 Pine Moseley Wm W (Annie) elk Arlington Hotel h460 Spring Moselle Rosie (c) hl29 McKays al Mosely Claude (c) rll Parker av (V) Mosely Grace r503 Carling av Mosely Jack student rl401 Oglethorpe Mosely Martha H Mrs hl33 Rembert av Mosely T Hubert (Loyce R; Heard Bros) h503 Carling av Mosely Von V (Thelma) trucker h207 Davis (SM) Mosely Wilbert (c; Katie) farmer h361 Robinson rd Mosely Winnie (c) Indrs rl03 Shamrock (B) Moses Bertha (c) cook rll5 (150) Cedar (U) Moses Caleb (c) lab h89 Cheatham al Moses Carrie r456 Walnut Moses Clem r456 Walnut Moses Frank L (Julia W) hl56 Hugenin Moses Harry (Anne W) phys 403 Cherry R515 h918 Vineville av (V) Moses Isaac (Pricilla H) porter Steve M Solomon jr Moses Julius (c: Alice) lab hl23 (539) Railroad av (V) Moses Wm M (Lucille A) elk rl56 Hugenin av Mosey Voley (c) lab r256 Garden (EM) Mosing Wm M (Hattie) train mstr hlOO (162) Cherokee av Mosla Henry H (Anna) pntr hl280 Montpelier av Mosley Alphonsia (c) maid r215 Plant row MUG LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 270 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Mosley Arth (Lena) millwkr (Bibb Mfg Co h36 Taylor av (EM) Mosley Geo rl016 Oglethorpe Mosley Jas (c) cook rl8 Graham's lot Mosley Margt (c) r215 Plant row Mosley Margt (c) r'711 (708) 3d av (V) Moslev Matilda (c) maid h215 Plant row Mosley Mildred (c) r201 Campbell av (S M) Mosley Millard C tchr Lanier High Sell for Boys r727 Orange Mosley Thos (c; Mattie) lab h400 Robin- son rd Mosley Wilmer C elk Buckeye Cotton Oil Co r371 1st Mosly Rissie (c) rl94 Gordon (CH) Moss Aaron (c; Annie B) lab hl04 (204) Texas (SM) Moss Allen M (Esther) hl39 Daley (SM) Moss Amanda (c) lndrs h268 (660) Hall (EM) Moss Boykin (c; Gladys) lab r321 Mc- Clain la Moss Carolyn J Mrs slswn Dannenberg Co hi 138 College Moss Chas T (Lillian) cond hl20 Ponce de Leon av (SM) Moss Chas T ir rl20 Ponce de Leon av (SM) Moss Clara (c) lndrs r321 McClain la Moss Eola M (c) h808 Fort Hill (EM) Moss Fannie (c) maid rl24 Green Moss Flora (c) cook r320 (314) Monroe Moss Harold student rl20 Ponce de Leon '(SM) Moss Mazie (c) lndrs h252 Plant row Mo!(Vss) Minnie (c) hl31 (204) Railroad av Moss Ola M (c) lndrs h218 Collins pi Moss Urban A (Carolyn J) student hi 136 College Moss Viola (c) h3'13 (507) Plummers al Mosieller H A (Ina S) slsmn Collins Baking Co r3309 Houston (SM) Mosteller Wm A millwkr Bibb Mfg Co r 607 2d Mote Andrew J (Maude) h352 Columbus Mote Enmon J (Ealer) lab h229 Roff Home av (V) Mote Ernest (Louise) pdlr H39 Ross Mote Grady r962 Oglethorpe Mote Joda B (Frederica O) millwkr Bibb Mfg Co h765 Hawthorne Mote Lester A (Artice) millwkr Atlantic Cotton Mills h33 Atlantic Village Mote Maude smstrs r352 Columbus Mote Ola M r229 Roff Home av (V) Mote Ramona r962 Oglethorpe Mote Rastus delmn Hall's Grocery r352 Columbus Mote Roy L (Margt E) millwkr Bibb Mfg Co h767 Hawthorne Mote Wm P (Lottie) h962 Oglethorpe Motes Arth G (Iris) train caller h404 Church (EM) Motes Wm C (Beulah M) millwkr Bibb Mfg Co h430 Jackson Motion Picture Operators Local No 507 meets 1st Sunday 408 Poplar Motor Contract Co Jas W Lumley mgr finance 409 2d R514-15 MOTOR PARTS CORF, Clarence C Rhodes President, Automotive Equipment 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) Motte Chas I (Francina) mgr Buckeye Cotton Oil Co h'304 Bond Motte Lutitia F (wid Chas I) r512 Walnut Mottern Mae Mrs slswn Sears Roebuck & Co rll27 Walnut Moughon Jennie (c) hll7 (525) Craft (V) Moughon Johon (c) plstr r232 Moughon (V) M!o(Vug) hon M1 amie (c) tchr PS h406 Ward Moughon Wm (c; Rosa L) lab hi Barnhart's Bottom Moulder Marie student Ga Academy for the Blind r Atlanta Moulton Frances elk r211 American blvd Moulton Genelle elk Newberry's r2!l American blvd Moulton Hiram N ftr Macon Gas Co r211 American blvd Moulton Jas W (Mary) brklyr rl710 2d Moulton L Elois ftr Macon Gas Co rl224 Montpelier av Moulton Leonard D (Martha) hl224 Montpelier av Moulton Northrop S (Florice T) formn Macon Transfer Co h211 American blvd Moulton Thos F (Ida) farmer h206 Fulton (SM) Moulton W Frank asst elk McKessonRiley Div r519 Johnson av (HH) Moulton Wm C r558 Elm Moulton Wm H student r211 American blvd Moultrie Edw (c; Maude) r8 Ross St pi Moultrie Mary L (c) h342 Bookers al Mount Calvary Baptist Church (c) 200 Gantt City rd Mount de Sales Academy Sister Mary Rita in charge 639-45 Grange Mount Lebanon Baptist Church (c) 115 Key (U) Mount Moriah Baptist Church (c) Rev Robt J Jefferson pastor services 11 A(EMM)Su1 nday school 9AM 213 Powell Mount Olive Baptist Church (c) Rev John H Evans pastor 957 Oglethorpe Mount Pleasant Baptist Church (c) 13 Graham's lot Mount Temah Primitive Baptist Church (c) 303 North (V) Mounts Lewis H (Beryl T) asst director Ballard Normal School h61 (66) Forest av (V) Moutos Andrew (Silver Moon Cafe) r569 Broadway Mouzon Mary J (c) barber h564 Smith row Moxley Seab J (Willie) wtchmn h300 Capitol av (Mikado pi) Moye Cynthia (wid Benj F) h2084 3d Moye General W (Mary E) carp h563 Hemlock Moye Roy student x56'3 Hemlock Moye Wiley millwkr r2084 3d Moyer Harvey P (Olive) whol lmbr 1133 Vineville av (V) h do Moyer Margt student rll33 Vineville av (V) Moyle R Lafayette (Gertrude) millwkr Bibb Mfg Co h97-98 Green (PM) Moyle R Lafayette jr (Gertrude) mill wkr Bibb Mfg Co r97-98 Green (PM) Moyle Reba millwkr Bibb Mfg Co r97-98 Green (PM) Mozo Henry B (Nelle T) slsmn A G Rhodes & Son hlOl Coleman av (CH) Muckue Edw furn repr r371 1st Muecke Art Craft Studio (Wm F Muecke) furn reprs 616 Poplar Muecke Doll Hospjital (Wm F Muecke) 616 Poplar Muecke Edw uphol Rudolph J Muecke r 371 1st Muecke Eloise r396 Forest av (V) Muecke Harold W rl20 Hill Crest av (C H) .Muecke Henry G (Mary E) pres-sec Muecke & Sons Co Inc hl20 Hill Crest av (CH) Muecke Henry G jr student rl20 Hill Crest av (CH) Muecke R'hinehart E (Ruth B) v-prestreas Muecke & Sons Co Inc hl709 3d Muecke Rudolph J (Sarah) uphol 514 1st rllO Hines ter (V) 271 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Muecke Wm F (Allene; Muecke Art Craft Studio) r>20 1st Muecke Willie M r920 1st MUECKE & SONS CO, Henry G Muecke Pres-Sec, Rhinehart E Muecke VPres-Treas, Store Fixtures, Show Cases, Fine Upholstering- and FurnitRuerperoRdeupcatiiroinnsg, 6A14ntNiqeuwe, FTuerlni6tu36re (aFnodr further information see left side lines and page 10 Buyers' Guide) Mueller Arth (Myrtle) trav slsmn h579 Orange apt 3 Mueller Curt (Marie) supt hi 19 Nottingham dr (NH) Mueller Guy J (Viola) millwkr Bibb Mfg Co h'728 Oglethorpe Muiter R G (Caroline) res eng State Hwy Board Div No 2 r203 Oak Haven MULBERRY MARKET, Geo Barnett Mgr, "Everything Good To Eat", Grocbeerrsr,y,MTeealts41a8n1d(FPoror dfuucreth4e1r8i-n22foMrmual-tion see left side lines and page 13 Buyers' Guide) Mulberry Street Methodist Church Rev SDurnEddaymuSncdhoFol-C1o0okAseMrvic7e0s1 1M1:3u0lbAerrMy Mulberry Wine Shop (Jas M Simmons) 406 Mulberry Muldowney Alma Mrs h419 (427) Forest av (V) Mulherin J Larkin cash. Dixie Dairies r Nottingham dr Mullen Annie R (c) maid h222 Collins MPuillen Ellen -(c) cook h322 (312) Monroe Mullen Geo (c) lab h234 Collins pi Mullen Sidney (c; Lizzie) lab r318 (316) Monroe Mullendore Albert (The Vegetable Box) rl068 Oglethorpe Mullendore Gertrude (wid Jas A) hl068 Oglethorpe Mullenix David H (Pauline; Radio Service Co) h"722 1st Mullenix Maybelle tchr PS r722 1st Mullenix Pauline Mrs artist Metro Studio h722 1st Muller Herman (Marjorie) elk Bibb Mfg Co h320 North av (NH) Mulligan Margt bkpr r533 Orange apt 23 Mullin Lizzie rl007 Hazel Mullin Walter C (Frances) asst supvr WPA rll2 Pierce av (V) Mullins A L supt Ga Power Co Mullins Alice (wid Leonard D) rl05 North av (NH) Mullins Frances elk U S Bist Atty r314 College Mullins H L (Beulah) ship elk McKesson-Riley Div hl06 Nisbet pi Mullins Julius M (Mattie) h322 (364) Center (EM) Mullis A Lamar (Cinderalla) dept mgr Dannenberg Co h720 Mulberry Mullis Bobbie L (Marguerite) sta mgr Peoples Oil Co h323 Randolph (EM) Mullis Carlton E (Anne) asst mgr PeopMle) s Oil Co Sta 2 h314 (354) Center (E Mullis Dallas Mrs waiter DeLuxe Cafe r 220 1st Mullis Elsie (wid Emmett) slswn r702 1st Mullis Felton (Frances) ship elk r711 Main (EM) Mullis H L (Velma) millwkr Bibb Mfg Co h20`7 American blvd Mullis Hollis (Nellie) h731 Hawthorne Mullis Jas B (Cath G) millwkr Bibb Mfg Co h308 Rutherford av (SM) Mullis Jessie Mrs r'871 3d Mullis M Ruth sten Met Life Ins Co r540 Washington av Mullis Minnie L (wid Henson) r38 (102) Randolph pi Mullis Newton M (Rosa L) millwkr h291 Morgan av (WH) Mullis Robt C agt Progressive Life Ins Co r Hightower rd Mullis Robt C (Mary E) fctywkr Happ Bros Co h307 Rutherford av (SM) Mumford John C (Cleo; Six Point Lunch) r758 Plum Mundy Ebenezar (Leora) r65 Arlington pi Mundy Jas T mach CofGRy Mundy Roy C (Marie W) elk L&NRR r 202 Coleman av (CH) Mundy Thos J cond h65 Arlington pi Munn Cleone Mrs elk r702 Holt av (N Hts) Munn David M (Fannie) h50Q Edgewood av (SM) Munn Wm K flagmn r500 Edgewood av -(SM) Munsch Annie (wid Albert) rl24 Fort Hill (EM) Munsch Annie (wid Charlie) h804 Wool- folk (EM) MMuunnsscchh WHemlenC E(MsyturtdiceentE)rl8e0lk VRiyrgEinxipa Agcy hl80 Virginia av Munson C-has (c; Grace) h'525 Grant Chapel al (SM) Munson Maggie (c) gro 205 (105) Charles (SM) r205 (100) Peacock (S M) Munson Walter (c; Maggie) brick mason h205 (100) Peacock (SM) Murchison Homer (Willie B> millwkr h3 Gustin pi (V) Murchison Jesse (c; Mary) lab h218 Green Murchison John W millwkr r3 Gustin pi (V) Murchison Maggie (c) maid h703 Ash Murdock E A (A Irene) cond r301 Cherry Murdock Wilbur J (Eula M) millwkr Bibb Mfg Co rlO'l 3d Murner Amos (Bertie) carp Bibb Mfg Co hi 17 Lee (EM) Murphey Augustus (c; Carrie) hl8 Parker av (V) Murphey Flewellyn P elk Macon Gas Co r548 Orange Murphey Geo H elk Leaptrot Dry Clng Co r825 Orange MURPHEY J CLAY, Pres Murphey, Taylor & Ellis Inc, City Investment Co, Mikado Realty Co, Mortgage Investment Co and Hist Agt N W Mut Life Ins Co, h548 Orange, Tel 2288-W Murphey Mary P r548 Orange Murphey Otis A Co Inc Claude H Doughtie mgr ins adjusters 40-3 Cherry R601 MURPHEY. TAYLOR & ELLIS INC, J Clay Murphey Pres, Eden Taylor Jr, Tom M Jones, Albert R Menard, Theo J Volk V-Prests, Paul J Doster SecTreas, Real Estate, Loans, Rentals, Insurance, Surety Bonds 470 Cherry, Ttieolns 2se6e7-f2r6o8n-2t6c9ov(Feor rafnudrtphaegrein2f8oBrmuya-ers' Guide) Murphey Thaddeus E rental dept Murphey Taylor & Ellis Inc r548 Orange Murphey Willard M" (Mildred S) solr N W Mut Life Ins Co h360 Orange MURPHEY WM, Pres The Citizens & Southern Natl Bank, r Savannah, Ga Murphy Abe (c) r513 (114) Elliott (EM) Murphy Albert (c; Maude) chauf h219 5th av (V) Murphy Alice H (wid Thaddeus) h'317 Forsyth Murphy Annie (c) h319 Jackson Murphy Annie sten A S Hatcher Co r655 Murphy Annie B (c) maid rl04 (171) Elklonpl (SM) Murphy Bridget (wid Pat) h65-5 Arch DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED ' STATES and Canada These are for your convenfence If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 272 EDWIN S. DAVIS, District Agent oo o o o m 09 b w4 14 (0 z Where To Buy? Consult the Classified Business Lists In This Directory JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 Murphy Catherine (c) h324 Boardman's al Murphy Chas (c; Louise) lab h404 (305) Charles (SM) Murphy Chas student r231 Capitol av (Mikado pi) Murphy Claude electn r317 Forsyth Murphy Dervell elk Barfield Feed Mills r456 Walnut Murphy Eloise slswn F W Woolworth Co r231 Capital av (Mikado pi) Murphy Emilu opr SBT&TCo r825 Orange Murphy Estelle Mrs r715 Fine Murphy Geo r825 Orange Murphy Geo (Nell) lab r668 Walnut Murphy Gertrude rl32 Holt Murphy Grant (c; Anna) lab Willing- ham Sash & Door Co r219 5th av (V) Murphy Henry J (Rosa) millwkr Bibb MMurfpghyCoHohw30ardSch(ce;ll Eavvely(nE)M)lab r304 Telfair Murphy Jas (c) janitor hl05 (4) Frank Murphy Jessie (c; Mattie) lab r513 (114) Elliott (EM) Murphy Johanna (c) r219 5th av (V) Murphy Josephine A x'324 Pio Nono av '(V) - Murphy Kelly (c; Carrie B) lab hl404 (404) Ardvines al Murphy Lee (c; Clara) porter h232 4th av (V) Murphy Loretto office sec Edw B Har- rold Co rl32 Holt Murphy Marie r655 Arch Murphy Mary (c) r329 ( 346) Bright la Murphy Mary bkpr Dannenberg Co hl32 Holt Murphy Mary L (c) lndrs h353 (352) Mitchell (EM) Murphy Mazie J student r604 Forsyth Murphy Minnie (c) maid r319 Jackson Murphy Patk J mr W S Dickey Clay Mfg Co rl32 Holt Murphy Robt (c; Willie M) porter Flan- agan's Camp hl21 (159) DeBorde (S M) Murphy Robt H ( Lucile F) dentist 516 Mulberry R920 hl02 Corbin av (V) Murphy S F agt Carolina Life Ins Co r Thomaston Ga Murphy Vera A student r604 Forsyth Murphy Viola (c) cook rll`3 Main (S) Murphy W Brodes (Alma) lab h419 Elm Murphy Wm F (Eliz C) city firemn h604 Forsyth Murphy Wm H student r231 Capital av (Mikado pi) Murr Jack student rll4 Coleman av (C H) Murrah Bascom W (Maude) bkpr h560 Courtland av Murrah Jack H slsmn Ga Power Co r560 Courtland av Murrah Maxwell G r560 Courtland av Murray Albert (c) lab h220 Telfair Murray Albert (c; Ada) porter r421 Ha- zel Murray Clyde millwkr Bibb Mfg Co r748 Oglethorpe Murray Danl (c; Matilda) lab hl21 (211) Dannenberg av Murray E Bobo (Mamie) tchr PS hl23 Oak Haven av Murray Edw (Kittie) driver r608:1st Murray Ethel (c) student r302 North (V) Murray Henry (c; Cath) lab h607 (222) Prince (SM) Murray J Milton (Inez S; Murray Print- ing Co) r RD 2 Mulberry ter Murray Jas A (c) pharm Dr M Clarence Mitchell r503 Forsyth Murray John (c; Agnes) lab r464 Lib- erty (SM) Murray Lewis (c; Alice) fctywkr h464 Liberty (SM) Murray Lucinda (c) rl07 Tindall av (SM) Murray M Virgil (Sudie C) dept mgr Un- ion Dry Gds Co h202 Montpelier av MCurorayrl2M2amCileevRelaMnrds salvswn(VD) annenberg Murray Mattie (c) lndrs h251 5th av (V) Murray Moses G (Mamie) dept mgr Dannenberg Co rl:22 Cleveland av (V) Murray Printing Co (J Milton Murray) M4u7r1ra%y 3Rdoy millwkr Bibb Mfg Co r748 Oglethorpe Murray Terry A student rl23 Oak Haven Murray Thos (c; Corine) pdlr r210 Fret- well al Murray W Mercer (Lureen) slsmn E349 Vista cir Murray Wm (c) lab r251 5th av (V) Murray Wm C (Julia A) millwkr Bibb Mfg Co h748 Oglethorpe Murray Wynel office sec Doctor's Busi- ness Bureau & Collection Service rllO Pearl Murrow Gordon P (Hattie) h248 Jeff Davis ISM) Murrow J S student r323 Jeff Davis (S M) Murrow Randolph C (Jennie) h`323 Jeff Davis (SM) MMuurrrroywBeSrathmai (Jwijdr CmraawchforCd)ofhG9R11y New Murry Jas (Daisy) millwkr h38 Blossfield (B) Murry Minnie (c) r220 (163) Grant av Murry Robt (c) wtchmn r Coy Burton Murry Sallie (c) lndrs h209 Roy la Muse Chas J (Anna B) meat ctr Rogers Stores h435 Forest av (V) Muse Robt (c) chauf h389 Madison Musgrove Ira A driver r620 1st Mutt & Jeff Filling Station (Walter E Sisk) 2004 Vineville av (V) Mutt & Jeff Lunch (Walter E Sisk) 2002 Vineville av (V) Mutual Benefit Life Insurance Co W Glenn Hooks mgr 409 2d R426 Mutual Investment Co (Guardrow Pridgen) loans 406 2d Mutual Life Insurance Co of New York J Warren Timmerman dist mgr 409 2d R202 Myddleton Jos P (Billie; The Film Shop) h222 Magnolia Myer Leona Mrs h513 Plum Myers see also Meyers Myers Bessie M student r217 Reid (SM) Myers Derias (Hallie) h217 Reid (SM) Myers Elton H (Mary) lab rllO Enterprise (SM) Myers Fannie (c) r220 Woodcliff Myers Felix (Luvenia) r601 Main (EM) Myers Gertrude (c) r217 1st av (V) Myers Jas (c; Wilma) lab hl28 (230) Green (V) Myers Jas J r825 Main (EM) Myers Jerry M (c) lndrs rll2 6th av (B) Myers John (c; Susie) lab h!59 May av Myers Kathleen elk Met Life Ins CO r 623 Vineville av Myers Lillie B (c) lndrs h624 Chapman al Myers Lonnie W (Mamie L) meatetr Edw P Smith hl30 (110) Colquitt Myers Mary tchr Lanier High ISch for Boys r623 Vineville av Myers Minnie B (wid W Thos) hl29 Highland av MMyyeerrss MNeodllie(J(ecn)npied)lrpWn7t4r8 hE5d1g9ewPoinoed av Myers Paul r217 Reid (SM) Myers Paul CZelda) formn h825 Main (E M) Myers Ruth (c) cook rl205 1st Myers Susie R (c) elev opr First Natl Bank Bldg rl59 May av (U) Myers Walter lab r217 Reid (SM) 273 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 Myers Wm Y (Linda) formn Willing- ham Sash & Door Co giant hll5 Cole Myrick Carrie L tchr PS r926 College Myrick Hazel smstrs r218 Chappell (S M) Myrick Henry (c; Tda) lah h504!4 (111) Elliott (EM) ^ Myrick Mary Mrs smstrs h218 Chappell Nashville Chattanooga & StLouis Railway Evan H Forbes genl agt 403 Cherry R209 Nasworthy Jas (Bersie) millwkr Bibb Mfg Co h330 Clinton (EM) National Biscuit Co Wm H Saunders mgr whol bakers '555 5th National Cash Register Co Elbert C Nye sales agt 155 Cotton av Myrick Rhodie (c) r210 Middle (V) Myrick Roscoe W (Mamie V) slsmn Bank- ers Health & Life Ins Co rl08 Ross Myrick Sophronia D (c) smstrs Josephine NATIONAL FINANCE CO, Wm J Malone Mgr, 461 Broadway, Tel 3233 . National Handle Co Chas F Lamb supt handle mfrs ft Elm Dawson rl08 Forest av (V) NATIONAL LIFE & ACCIDENT INSUR- Myrick Susan feature writer Macon Tele- ANCE CO OF NASHVILLE, TENN, graph h21'3 Bond apt D1 Samuel L Farrar Mgr, 705-706 Geor- Myrick Willie (wid Henry) millwkr Bibb gia Casualty Bldg 516-522 Mulberry, Mfg Co rl07 Cabaniss av (EM) Tel 4046 MyricksAnna (c) Indrs r113 (232) Kahn's National Optical Stores Co Jos I W Nabors Calvin A (Sadie B) sta opr Ga Power Co h'1164 Elm Nabors Forrest A (Iverene M) sta opr iGa Power Co r322 Cherry av Nabors Iverene M Mrs sten Bankers Health & Life Ins Co h322 Cherry av Nabors Martha E student rll64 Elm Nabors Mary J slswn S H Kress & Co r 1164 Elm Nabors Ruth V slsmn rll64 Elm Nail Edith L millwkr r219 Carling av Nail Maggie E Mrs h219 Carling av Nail Mildred O r219 Carling av Naperian The apts 307 Napier av Napier Building 502% Poplar Napier Chas (c) r259 Walnut Napier Comer (c; Ellen) lab hl54 (152) Middle (V) Napier E Tris pres E Tris Napier Co Napier E Tris Co E Tris Napier pres real est 421 2d Napier Hendley V student r310 (328) Hill Crest av (CH) Napier Henry (c; Carrie) h411 (415) E 1st (EM) Napier J Hamilton lawyer 516 Mulberry R614 r415 'Georgia av Napier John B student r310 (328) Hill NaCprieesrt Mavary(CHA) (c) hll6 Price (V) Napier Myrtice r957 Elm Napier Richd (c) delmn rl54 (152) Mid- dle (V) Napier Viola R sten R C Cropper Co r*310 (328) Hill Crest av (CH) NAPIER VIOLA ROSS (wid Hendley V), City Clerk City of Macon, h310 (328) Whittemore mgr 403 Cherry R312 National Pecan Marketing Association Paul J Brown pres (Albany Ga) Fred NaEusBtrraitnt sDewc-itgrheat ssl1s0m0nMru3l1b8erNryew Neal Geo (c; Emma J) porter r427 North (V) Neal Jesse (c) lab hll2 Kitchens Neal John (c; Annie) h Forsyth rd Neal John (c) lab h67 Forest av (V) NEAL ROY I (Luride), Adv Mgr The Macon Telegraph and Macon Evening News, h319 Vineville av, Tel 1132 Neal Steph (Myrtle) elk h279 College Nealy Bessie (c) Indrs r228 Hurley la Nealy Ella (c) r775 Reynolds al Nealy Jos Cc; Emma) lab hl08 (501) Johnson's al Nealy Wesley (c) hlO Graham's lot NEBLETT HOWARD C, Mgr A G Rhodes & Son, r203 High, Tel 795 Nebraska Paul (c; Amanda) lab h507 Clinton (EM) Neel Annie dept mgr Union Dry Gds Co rl28 North av (NH) Neel Evelyn J student rl3'57 Oglethorpe Neel Jos N (Blanche H) pres Jos N Neel Co h624 College NEEL JOSEPH N CO, Joseph N Neel Pres, Walter F Houser V-Pres, W P Mahone Sec-Treas, Roland H Neel Genl Mgr, Quality Clothing, Men and Women, 456-60 Cherry, Tel 2800 Neel Jos N jr Post No 3 American Legion 221 Forsyth Neel Lucy rl28 North av 4NH) Neel Roland H (Evelyn J) genl mgr Jos Hill Crest av (CH), Tel 5348-W N Neel Co hl357 Oglethorpe Naples Mamie (c) cook h341 Madison Narkas Theo (Fannie T; Minute Lunch) h920 Walnut Narrell Cecil J (Edna M) millwkr Will- Neesmith see also NeSmith Neesmith Myrtle Mrs millwkr h314 Win- ship (WH) Nehi Bottling Co Thos J Jones mgr 768 ibnegrghagmj Cotton Mill h61 (12) Dannen- Broadway Neighbors Avilla millwkr Bibb Mfg CO Nash Chas E (Economy Markets) h509 r770 Oglethorpe College Neighbors Jean tchr r302 Hines ter (V) Nash Daisy '(c) r613 Maynard (EM) Neighbors Jos B (Jeanne J) claim agt Nash Dock (c; Hattie) pntr hl46 2d av CofGRy h302 Hines ter (V) Nash Ethel (c) maid r209 (155) Center Neighbors Jos B jr student r302 Hmes ter (V) (EM) Neil Rena (c) rll6 (10) Fulton al Nash Hattie (c) r342 Bookers al Neill Riley (c; Mary) lab hl32 E Ell Nash Henrietta (c) maid rl8 Elbert la Neisler Chas jr student rllO Corbin av (S'M) (V) Nash John H 4c; Rosa L) lab h'609 Stray- Nellam Ethel (c) r256 Elliott (EM) ers al (SM) Nelms Claude L (Sallie) plmbr hl42 Ell Nash Kath (c) h309 'Strayers al (SM) '(SM) Nash Lee (c; Sallie) pntr rl46 2d av (V) Nelson Adeline (c) cook r409 (452) Wo- Nash Lillie (c) maid rllO (231) Turpin (T) mack (EM) Nelson Agnest (c) r206 3d av (V) Nash Lizzie (c) Indrywkr h861 Ocmul- Nelson Annie (c) r226 (719) Pear (EM) gee Nelson Annie (c) Indrs r571 Siam (EM) Nash Moses (c; Leila) lab hl20 (14) Hud- Nelson Austin (c; Minnie) h312 Gilmer son Nelson Bernice rl020 Oglethorpe Nash Paul (c) r209 0155) Center (EM) Nelson Blanche sten Packer Adv Corp Nash Wade N student r371 1st r Forsyth rd Nash Wm M Cc; Kath) blrmkr CofGRy Nelson Camelia (c) r542 Grant Chapel h2'34 (214) Elliott (EM) al (SM) We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 274 T. L. W 0 0 D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. 64 Nelson Carl reprmn r2:20 1st Nelson Sadie (c) maid r414 (222) Eliza- Nelson Carlton (c; Maggie) lab National Handle Co rl621 Broadway beth (SM) Nelson Wm (c; Bertha) carp h902 (991) Nelson Chas millwkr Atlantic Cotton Cowan (EM) Mills rl Ford la Nelson Wm (c) lab h542 Grant Chapel 'NeIlpsifo'cn; TC?PhQatrTlieV HRT(iFrKances) cook Spil- al (SM) Nelson Wm (c) lab h610 (611) Shoals al Nelson Claude (c) lab r216 (556) Moore (EM) 1a. Nelson Wm (c) lab r57l Siam (EM) Nelson Cleo (c) rl07 (6) Fulton al Nelson Wm jr (c) millwkr Bibb Mfg Co Nelson Cleveland (c; Susie M) lab h7 5th r902 (991) Cowan (EM) av (V) Nelson Wm D (c) porter Order of Ry Nelson Corinne (c) cook rll7 Jones Nelson Danl (c; Pauline) lab h200 NeClsoonnd Wblidlglie r4la0b8 MPoapcloanr Gas Co r539 Church al (SM) (512) Grant Chapel rd Nelson Douglas (c; Beulah) lab h20 (8) Nelson Willie (Agnest) porter Ry Exp Fordville la Agcy r206 3d av (V) Nelson Edna R (wid Hyman) hl25 Rose Nesbit Sami (c) h215 Green pk Nesbitt Gloria (c) student rl35 Lawton Nelson Eliz (c) cook rl02 (2) Orchard av la (V) Nelson Eliz (c) lab h571 Siam (EM) Nesbitt Oscar (c; Nicie) lab rl35 Lawton Nelson Eliz Mrs rl08 Patterson (NHts) la (V) Nelson Ella W maid rl2 Spring Nesbitt Willie M (c) Indrs hl35 Lawton Nelson Emory L (Florence M) lab hl020 la (V) Oglethorpe Nesby Robt (c; Maggie) driver h356 Pat- Nelson Eudora (c) maid rl04 ( 204) Texas terson (NHts) (SM) NeSmith see also Neesmith Nelson Frances (c) maid r221 Jones NeSmith Alton millwkr Willingham Mills Nelson Frances tchr PS rl25 Rose pk r421 Edgewood av (SM) Nelson Grace (c) maid rll8 (270) Single- NeSmith Elmer carp r421 Edgewood av ton's la (SM) Nelson Gussie (c) r571 Siam (EM) NeSmith Evelyn (wid Jesse) h39 Melrose Nelson Henry (c; Fannie) dispr rill 4th (B) av (V) NeSmith Harvey bkpr r720 Mulberry Nelson Henry lab CofGaRy rl04 (204) Texas (SM) NeSmith Robt r421 Edgewood av (SM) NeSmith Wm T (Minnie) millwkr Wil- Nelson Henry (Annie) pntr hl029 Mont- lingham Cotton Mill h.914 Ash pelier av Neubet Janie (c) h452 Clinton (EM) Nelson Henry L (Fannie C) mail porter Nevarro Apartments 533-47 Orange Ry Exp Agcy r,lll 4th av (Pleasant Nevarro Apartments Co Leon S Dure Hill) pres Wm V Davis sec-treas rentals 321 Nelson Horace (Beulah) millwkr Atlantic Mulberry Cotton Mills hi Ford la Neville Ashley (c; Alice) firemn hill NeClsaomnpbIreall (acv; S(SuMsie)) lab h506 (708) Nelson Isaac (c) r902 Broad (EM) (726) Nussbaum (SM) Nebvaiullme Ro(SbMt )L (c) lab rill (726) Nuss- Nelson Jas (c; Bertha) janitor rl4l Pecan av New Bethel Baptist Church (c) 404 Division (T) Nelson Jessie M (c) Indrs rl02 Pringle NEW ENGLAND MUTUAL LIFE IN- (EM) SURANCE CO, Olin P Beall Agent, Nelson John (c; Stella) h259 White al (SM) 613 Georgia Casualty Bldg 516-522 Mulberry, Tel 1950 Nelson John (c; Janie) emp CofGaRy New Hope Baptist Church (c) Rev Jas hi 18 (270) Singleton la H Wimberly pastor 217 3d av (V) Nelson John H (c; Lizzie) lab h221 Jones New Jerusalem Primitive Baptist Church Nelson Lizzie (c) maid r534 Middle (EM) Nelson Lizzie E (c) rl04 (204) Texas (c) 200 Short la (EM) New Life Lunch (Nicholas Duke) 226 (SM) Cotton av Nelson Lois (c) r542 Grant Chapel al (SM) New Service Shoe Shop (Zelik Wolf) 466 Poplar Nelson Lola (c) rl04 (204) Texas (SM) Nelson Lonnie (c) driver rl019 Ogle- New York Cleaners (Jas Lamis) cloclnrs 411 3d thorpe New York Life Insurance Co Cecil F Nelson Loubertha (c) h534 Middle (EM) Nelson Louis (c) lab rl.17 Jones Nelson Louise (c) maid x213 Northwest Boundary Nelson Louise (c) waiter Douglas Hotel Whitaker agt 617 Mulberry R210 New Yorker The (Peter J Pappas) restr 312 2d New Zion Baptist Church 304 Edgewood av (SM) Grill Nelson Loujane (c) Indrs h312 Jefferson Nelson Maggie (c) hl07 (6) Fulton al Nelson Margt (wid Eug J) rllO Magnolia Newbern Emma (wid Jos) rll5 Dixie av (SM) Newbern Lloyd (Ruth; Capitol Cycle Co) h321 North av (NH) Nelson Marie (c) cook r655 Oglethorpe Nelson Marie (c) maid r218 Green Nelson Mary (c) cook h238 Calhoun Newberry Columbus M (Docia E) eng Fire Dept hl62 (132) Oakland av Newberry Columbus M jr student rl62 Nelson Mary (c) fctywkr r604 (4) Gilmer Nelson Mary (c) Indrs hlOl (1) Frank al Nelson Matilda (c) r319 Gilmer Nelson Mila (c) Indrs hl02 Pringle (EM) (132) Oakland av Newberry Essie (wid Wm) h99 (11) Dan- nenberg al Newberry Grace sten Bankers Health & Nelson Nancy M (c) Indrs hl09 (7) Frank al Nelson Nellie N r314 Winship (WH) Nelson Newnan B (Lillie B) carp h521 Arch Nelson Nora (c) r571 Siam (EM) Nelson Peter J (Kath) lawyer 403 Cherry R308 h533 Orange apt 18 Nelson R W (c) lab rl07 (6) Fulton al Nelson Robt (c; Idella) lab h413 Monroe Life Ins Co r618 (610) Duncan av Newberry H Grady (Carrie L) driver h 618 (610) Duncan av Newberry Henry G (Macon H) store mgr Piggly Wiggly Stores r317 Orange Newberry J J Co Jack W Newton mgr dept store 502 Cherry Newberry John (Samantha) millwkr Willingham Cotton Mill hll3 (114) Duncan av 275 PI Phones 146-147 'MORTUARY AMBULANCE SERVICE 8l4Mbmy HOTEL Newberry Lorena tchr PS r Lizella Ga Newberry M Cecil elk U S Agrl Extension NerwbLeirzreyllaMGacaon H Mrs st, en Bankers Health & Life Ins Co r317 Orange Newberry Marrietta rll3 (114) Duncan av Newberry Marvin driver Dixie Dairies Newberry Mary E elk r405 Hillcrest av Newberry Mattie (wid John H) r398 Bur- ton av Newberry Morris . (Minnie L) f,,ctAyw,kr , h Ne2w05berPruyltNonewm(SaMn)E (Bessie E) millwkr Willingham Cotton Mill h81 Randolph la Newberry Paul H (Cath) elk T M Ramey Gro Co hill Madden av Newberry Sallie (wid Edw) h608 2d Newberry Zola slswn Dannenberg Co r 608 2d Newby Burns (Myrtice) firemn hllS Dixie av (SM) Newby Cecil ins agt r221 Georgia av Newby Esther sten Kent & Herin r802 Spring Newby Jas (c; Rachelle) emp CofGaRy h75'6 Oomulgee Newby Jas L (Gertrude S) formn h709 Birch (NHts) Newby Jas W r709 Birch (NHts) Newby Lytle R (Marie) plmbr 124 Log Cabin blvd h do Newby Susie (c) lndrs r7 (118) Paradise Newman Thos (c) porter Jas A Smith r456 City Hall la Newman Wm A (Annie G) phys 700 Spring R410 h575 Orange apt 7 Newmans Clayton J (Azlee) millwkr Bibb Mfg Co r58 (59) Davis (PM) Newsom Clifford C (Ida L) civ eng State Hwy Board Div No 2 hl24 (140) Pierce av (V) Newsom Frieda student r!24 (140) Pierce av (V) Newsom Henry N atndt Clay Wrecking Co h614 Montpelier av Newsom Marion inspr rl24 (140) Pierce av (V) Newsome Edw (c; Orrie) roofer Ga Roofing & Sup Co h720 Hawthorne Newsome Ida r765 Walnut Newsome John P elk rl03 1st Newsome Marie rl03 1st Newsome Sparta J (c; Lillie) cook hll3 Woodcliff Newsome Wm F (Ella B) vault custodian hl03 1st Newson Bradford (Mamie D) slsmn Toole Co h612 Forsyth Newton Alice (wid Willoughby) asst NemwatotrnonArYthWCFA(Sr7a6r3ah 2Rd ) broker 610 Mulberry h754 1st Newton Bertha M Mrs r41 White (SM) Newton Beverly student rl37 Pierce av (V) al NEWTON C E JR (Edith), V-Pres and Newell Beauford M (Mattie V) mldr Trust Officer First National Bank & Taylor Iron Wks & Sup Co h2345 2d Trust Co, h206 Riverdale dr, Tel Newell Beauford M jr msngr CofGaRy 1450-M r2345 2d Newell Jean waiter rl31 Knott (SM) Newell Mattie B office sec Macon Memo- rial Park Inc r2345 2d Newell Maude (wid Ovid D) hl31 Knott (SM) Newkirk Grady r217 Tatnall Newkirk Herman (c) lab rll8 4th av (V) Newkirk Laura (c) cook hll8 4th av (V) Newman Albert M (Amanda) blksmith CofGaRy h632 Anderson (SM) Newman Apartments 853 Cherry Newman Eliz (c) student r919 Edgewood Newman Essie (c) maid rll (18) New St la Newman Estelle B slsmn r853 Cherry apt 2 Newman Evelyn (c) r919 Edgewood av Newman Florida nurse 34 Arlington pi h do Newman Glen (c; Annie L) hl05 Strip- ling al (EM) Newman Horace L (Lucille G) slsmn h 853 Cherry apt 2 Newman John D (Gladys) policemn h 2451 2d Newman Julius r34 Arlington pi Newman Julius (c; Rosa L) lab City h450 City Hall la Newman Katie (c) lndrs rlOO (723) Waynes al (SM) Newman Lucille G Mrs dept mgr Dan- nenberg Co r853 Cherry Newman Lucius (c; Camilla) h830 Edge- wood av Newman Luel B (wid Martin) h224 Col- lege Newman M Bernice cash Dannenberg Co r632 Anderson (SM) Newman Mary (c) hl59 Nussbaum (SM) Newman Newton B r632 Anderson (SM) Newman Nicholas L formn USPO r34 Arlington pi Newman Quintus (c; Claude) h919 Edge- wood av Newman Quintus jr (c; Ida) h459 (472) Broad (EM) Newman Robt L (c) lab r803 Hall (EM) Newton Carrie M (wid Melvin) cash Ry Exp Agcy r26 Progress Newton Cecil student r9 Bibb av Newton Cecil G (Ada) millwkr Bibb Mfg Co h9 Bibb av Newton E Lee bkpr Swift & Co r855 New Newton Frank (c; Emmery) lab rl74 College Newton Gladys (c) lndrs rl76 Park Hotel al Newton Helen Mrs opr SBT&TCo r3304 Houston av (SM) Newton Hollis (c) porter r452 City Hall la Newton Jack W (Ida S) mgr J J New- berry Co rl37 Pierce av (V) Newton Jas (c) r404 Applewood (EM) Newton Jason W (Ida M) hl37 Pierce av (V) Newton John (c; Irene) r404 Applewood (EM) Newton Lillian (c) cook r321 Division (T) Newton Lizzie (wid Chas E) r314 Georgia Newton Lucille millwkr Bibb Mfg Co r9 Bibb av Newton Mollie (c) r402 Peachtree (EM) Newton Murwon (Helen D) hlpr Sterchi NeBwrotosnStNoroelsanIdnc (rc3;30O4 rHrioeusZto) nlaavb (ShlM03) Franklin Newton Percy W (Bertha) inspr CofGa Ry h3304 Houston av (SM) Newton Quinton student r3304 Houston av (SM) Newton Ralph G (Irma) phys 516 Mul- berry R804 h217 Buford pi Newton Ruby (wid David) r717 Cherry Newton Victoria tchr r26 Progress Newton Victoria (wid Arth R) h400 For- syth Neylans Oscar S (Cath) asst treas Bibb Mfg Co h654 Forsyth Nicholas Dona student r824 Orange Nicholas Irene student r824 Orange Nicholas John student r824 Orange Nicholas Lucille waiter r824 Orange Newman Rosa M (c) r803 Hall (EM) Newman Sam (c; Jessie) emp CofGaRy Nicholas Nick shoe repr Jake's Shoe Store r824 Orange h826 Edgewood av Newman Selma P r632 Anderson (SM) Nicholas Peter (Christine) waiter Geo Poulos h824 Orange 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Poik Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 276 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every Citlr in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon*s Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 1S3 Nichols Allen (c) lab hlOl Forest av (V) Nichols Jas (c; Colquit) porter J W Burke Co ri02 Forrest av (V) Nichols John W (Mattie) carp hl23 Thomas Nichols Nancy (c) r rear 126 Cole Nichols Nellie Mrs tel opr Ga Power Co r653 New Nichols Wm E (Frances) lab hi 10 Bell av Nicholson Albert (c; Ida P) lab rll2 E Ell Nicks Ella Mrs h273 Ell (SM) Nicopulos Geo (Palace of Sweets) r304 Cherry Niekels Henry H (Amanda J) eng hl34 Highland av Night Owl (Dewey W Ward) beer 19 (.17) 5th Nisglhsmtinngarl4e60HOarrrayngeA (Mary L) trav Nikula Hath J Mrs sten Phoenix Mutual Life Ins Co h533 Orange apt 3 Nikula Oliver A (Kath J) test boardmn SBT&TCo h533 Orange apt 3 Nims Arth L jr (Edwina) sec Dr Pepper Bottling Co of Macon h208 Vista cir (I) Nims Hayes (c; Uzel) lab h226 (125) Grant av (V) Nims Otis (c; Ruby) lab hl74 Lincoln av (V) Nipper Andrew (Jennie) lab h405 Cedar la (SM) Nipper Chas A (Lucile; Nipper's Pharmacy) h5 Rose pi Nipper Sami C (Ruth) mach Acme Welding & Elec Co r RD 4 Nipper's Pharmacy (Chas A Nipper) 700 Spring Nipple Oscar (Bessie) leatherwkr r860 2d Nipple Robt K (Mamie L) mach rll54 Milledgeville rd (EM) Nipple Sami E (Ruth) auto mech rll54 Milledgeville rd (EM) Nirenstein Fulton J (Kathleen) mail elk Macon Teleg Pub Co hl21 Grady (SM) Nirenstein Geo L (Leah) bkpr T & T Packing Co h778 Walnut Nirenstein Issie slsmn Coplan Junk Co r760 Patterson (NHts) Nirenstein Leon (Mollie) carrier USPO h474 Orange apt 3 Nirenstein Lillian bkpr r760 Patterson (NHts) Nirenstein Sami driver r760 Patterson (NHts) Nirenstein Sarah (wid Meyer) h760 Patterson (NHts) Nisbet Sarah (c) cook h863 Pine Nisbet Tibbie K (wid Junius W) h221 Bond Nisbit Martha elk Union Dry Gds Co r204 Forest Hill av Nisbit McDougald (Alzada) h204 Forest Hill av Nix A Elyert (wid G M) hll4 Rose pk Nix Clara (c) h408 (720) Campbell av (SM) Nix Doris r2526 Broadway Nix Edgar C (Emma F) mach h2526 Broadway Nix Essie (c) cook r289 1st av (V) Nix Kate elk r209 Ingleside av Nix Olive K Mrs slswn J K Chandler r209 Ingleside av (I) Nixon Alex (c; Minnie L) millwkr Bibb Mfg Co h780 Reynolds al Nixon Altoe (c; Vertie) pdlr h311 (302) Turpin (T) Nixon Azalee (wid John A) r285 Orange Nixon Clifford (c; Hattie) lab h415 Chestnut NiHxoanrdDemanaln (ca;vSah.r1a1)6 b2lkdsmavith(Vre)ar 203 Nixon Donald (c) r216 Northern av (EM) Nixon Effie (c) Indrs h216 Northern av (EM) Nixon Fred driver rll5 Washington av Nixon Gena H (wid Horace C) tel opr First Natl Bank & Trust Co h285 Orange Nixon Henrietta (c) Indrs rl30 (181) Williams la Nixon Horace C student r285 Orange Nixon Lester (c) student r216 Northern av (EM) Nixon Lila M r207 (107) Balkcom av (EM) Nixon Lula M (c) maid r203 1st av (U) Nixon Margt (c) Indrs h203 1st av (U) Nixon Mazie emp Snow's Lndry & Dry Clng Co rl05 (5) Alabama Nixon Odessa (c) r234 2d av (V) Nixon Pinkie (c) cook h541 E 2d (EM) Nixon Robt (c; Estelle) lab hl24 (12) Franklin st la Nixon Verda M Indrs Crescent Lndry Co r311 Turpin (T) Nixon Willie (c) r216 Northern av (EM) Noble Claud (Edna) elk r920 Elm Noble Doris r40 (37) Taylor av (EM) Noble Francis millwkr Bibb Mfg Co r40 (37) Taylor av (EM) Noble Geo W millwkr Bibb Mfg Co rl2 Schell av (EM) Noble Howard A (Willie B) millwkr Bibb Mfg Co hl2 Schell av (EM) Noble Ida (c) maid h275 Garden (EM) NoObCleH)Jas L (c) lab rl70 (302) Roye Noble John (c; Bessie) lab h432 Park (U) Noble John D (Bessie) sewer layer T L Wood Plmbg & Htg r Roosevelt Hts NoCbole Jhollh9n WCom(Leurciete)rm(ilPlMwk)r Bibb Mfg Noble Leila (c) maid h240 Middle (V) Noble Lewis (c) lab r432 Park (U) Noble Lucious (c) porter Mitchell & Williams Inc rl26 (1) Spring st la Noble Ray C (c) lab rl70 (302) Roye (CH) Noble Wm (c) lab r240 Middle (V) Norb!2le WScihlleiellBaMv rs(EmMil)lwkr Bibb Mfg Co Nobles Gertrude (wid Wm M) rl08 (104) DeWitt (EM) Nobles J C linemn Ga Power Co Nobles J Terrell (Velma) millwkr Bibb Mfg Co rll57 Elm Nobles Jas slsmn hl521 2d Nobles Jas D (Laura) civ eng hi 12 Log Cabin pi Nobles Laura Mrs cash Economy Shoe Reprs & French Dry Clnrs hi 12 Log Cabin dr Nobles Oscar (Gladys M) millwkr Willingham Cotton Mill hl33 (34) Holt av (NHts) NoCboleshlWO-m12 (MBiabmbiea) vmillwkr Bibb Mfg Nobles Wylene beauty opr Godwin's Beauty Shop r656 New Noblitt David J (Margt) slsmn h223 (222) Log Cabin dr Nolan Alvin E (Calna) h369 1st Nolan Ann student r221 Buford pi Nolan Dorothy A opr SBT&TCo r369 1st Nolan Frank (Ola M) millwkr Bibb Mfg Co h739 Hawthorne Nolan Harvey electn rl'17 2d Nolan Mark A (Leila) h615 (719) Log Cabin blvd Nolan Quincy R (Ruth) plant eng h221' Buford pi Nolan Quincy R jr student r221 Buford NoPlian Robt H (Mary) trav slsmn rl04 Cleveland av (V) Nolan Walter K (Hattie) slsmn h507 Ridge av Noland Co Inc Clifton P Ward mgr plmbg supplies 550 Broadway Nolen Clara supvr WPA r Massie Apts Nolley Janie (c) r821 3d av (V) Noonan Kath Mrs hsekpr Central Hotel r501 Bailey av (CH) 277 ROBERT O. THOMAS 569% Cherry St. REALTOR Telephone 1067 Noonan Minor B (Kath) sta eng Central Hotel h501 Bailey av (CH) NoDrfuorlhkamSocuotmhelrnagRt a4i0l7roaBdroaCdlwifafoyrdR1S5 Norman Clara (wid John T) r310 Rocky Creek rd Norman Elsie Mrs r2165 2d Norman Grady L (Josephine E) millwkr Southland Knitting Mills hl603 College Norman Hazel L rl38 Remhert av Norman Ishmael slsmn rl38 Rembert Norman Jas E (Louise W) elk Southland Knitting Mills hl38 Remhert av Norman Julia (c) maid rl07 (1620) Johnson's al Norman Marion (c) porter Tatnall Square Service Sta r608 Ross Norman Rayford student rl603 College Norman Ruby fctywkr Happ Bros Co rlOl West End av (WH) Norman Thos W (Nelle) slsmn h99 Vine- ville av apt F4 Norred Eliz (wid Olin) r522 Giles (SM) Norred Wallace P (Lalar) linemn h522 NoGrrielells A(SddMie) sten Hall & Bloch r965 Walnut Norris Albert L (Laurine; Geoghegan & Norris) hl05 Osborne pi Norris Amanda (c) h!12 (166) Virgin (V) Norris Annie (c) lndrs r598 (506) Smith (EM) Norris Carl R (Belle) mech rl232 College Norris Chas B (Sallie) formn h905 (1919) Log Cabin blvd Norris Charlie B formn CofGaRy Norris Daisy M (c) maid rll2 (166) Vir- gin (V) Norris David Rev (c; Mable) pastor Turner Tabernacle A M E Church h466 Hawthorne Norris Emma student r905 (1919) Log Cabin blvd NohrridsoEthel nurse 855 Mulberry apt 102 Norris Prank E (Verda) mach CofGaRy h967 Walnut Norris Harold E doormn Rialto Theatre r616 1st Norris Jas N agt Natl Life & Accdt Ins Co r209 1st Norris John (c) lab rll2 '(166) Virgin (V) Norris John C (Lura) linemn Postal TelCable Co h3043 Houston av (SM) Norris John L (Bessie M) sign pntr Crimmins Sign Co h567 1st Norris Lily M sec Mercer Univ r615 Woolfolk Norris Macey (c) maid rl09 Edgewood av Norris Martha Mrs elk Union Dry Gds Co h615 Woolfolk (EM) Norris Martha R rll6 Corbin av (V) Norris Napoleon (c) lab rl'12 (166) Virgin (V) Norris Nell h339 Ross Norris Robt B sports editor Macon Telegraph r8l8 Cherry apt 4 Norris Robt O (Martha) elk Union Dry Gds Co h615 Woolfolk (EM) Nodrernis RSumthithH &(wiCdoParu9l5)2deEpltmmgr BurNorris T Ward collr Johnson Bros r616 1st Norris Wesley H student rll6 Corbin av (V) Norris Willard C student rll'6 Corbin av (V) Norris Wm J drug sundries 809 Broad,,Nowrraiys Wh mdoM (Nevada E) slsmn Met Life Ins Co hll6 Corbin av (V) North Carolina Mutual Life Insurance Co (c) Clarence W Moore dist mgr ,,No51r52t61h HNNieogwrhtlhaRn4da1v7Gr(oNcHer)y (Arth L Stamm) Northern Lela (c) maid hl04 (105) Pringle (EM) Northington Harry P jr (Grace) elk Happ Bros Co h908 Napier av Northington Theo M student r908 Napier Northrop Julia A Mrs librarian Macon Teleg Pub Co r Shirley Hills Northwestern Mutual Life Insurance Co J Clay Murphey dist mgr 470 Cherry Norton Cleveland (Florence) blrmkr Cof GaRy h801 Mikado av Norton J Earl rl541 1st Norton Mary R student r206 Forsyth Norton Rosalind slswn P W Woolworth Co r206 Forsyth Norton Sallie J (wid Rufus) hl541 1st Norton Wm A '(Prances) flagmn h206 Forsyth Norwood Annie K (c) maid h540 E 2d (EM) Norwood Caesar (c; Mattie) pntr r904 (992) Cowan (EM) Norwood Cecil (c) r319 (320) Short (EM) Norwood Ernest (Ossie) r608 2d Norwood Ernest (c; Eva) porter Ry Exp Agcy h224 Chestnut Norwood Ethel (c) h8 Harris al Norwood Geo M (Dora W) agt MD&SRR hl24 Lawton av Norwood Irene (c) r212 Yates al (EM) NNoorrwwoooodd LOosrseiettoMHrsstmudgernLt erlr2n4erLaSwhotopns r608 2d Norwood Thos '(c) lab r211 Orange Norwood Wm (c; Dora) lab h322 (312) Monroe Norwood Zennie F (c) maid h211 Orange Nottage David A lab h613 Log Cabin blvd Nottingham Delores student r212 Ridge av (V) Nottingham Dora S rl03 Pio Nono av (V) NOTTINGHAM GEORGE M HON (Zera P), Judge Recorders Court (Nottingham & Nottingham), h311 Hardeman av, Tel 3833-J Nottingham Gwendolyn student r212 Ridge av (V) NOTTINGHAM HARRY E (Jennie G; Nottingham & Nottingham), h212 Ridge av, Tel 4242-J Nottingham Ida (wid Robt V) rllO Hines ter (V) Nottingham J J slsmn r415 Vineville av (V) Nottingham Jas (c; Florence) lab hl03 (558) Johnson al Nottingham Warren elk hl03 Pio Nono av (V) NOTTINGHAM & NOTTINGHAM (Geo M and Harry E), Lawyers 469-410 Georgia Casualty Bldg, Tel 1147 Nowell Gussie M millwkr Willingham Cotton Mill rll9 (41) Holt av (NHts) Nowell Marjorie fctywkr Happ Bros Co r530 College Nowell Myrtie drsmkr 484 Orange r do Nowell Nonie C (wid L Edgar) h440 New Nu Icy Bottling Co Inc Howard M Johnson pres 510 Broadway Nunn D Shelton (Addie J) dist mgr h 460 Cherry av Nunnally John C teleg opr Courts & Co r220 1st Nurses' Official Register Mattie P Blount registrar 130 High Nussbaum Robt N (Bertha B) 3d v-pres Dannenberg Co h818 Cherry apt 3 Nutting Annie M elk Dunlap-Peeler Hdw Co r585 Hillyer av (CH) NUtinTgT)I,NFGlowFLerOs RFAoLr AClOl O(cGceaosioGnsN1u7t1Cotton av, Tel 1776, Night Tels 3341 and 1662 Nutting Geo G (Crystal S; Nutting Floral Co) hi 19 Crescent av (CH) Nutting Geo G jr elk Nutting Floral Co rll9 Crescent av (CH) Nutting Jennie E tchr PS r585 Hillyer av (CH) Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 278 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Nutting John B (Ruth L) asst mgr Nut- ting Floral Co hl21 Crescent av (CH) Nutting John B jr student rl21 Crescent av (CH) Nutting Leila (wid Chas M) h585 Hillyer av (CH) Nutting Sarah C (wid Wm) auto Indry 210 3d h4S8 Walnut Nu Way Weiner Stand (Geo Andros) 218 Cotton Nye Elbert C (Emma C) sis agt Natl Cash Register Co h478 College apt 1 Nye Odorless Incinerator Co A C Felton jr pres John T Moore v-pres J E Wright sec A J Elder treas 220 3d O K Grinding Co (Conrad N Filsinger) O 356 K yS2 ho2de Shop (Felton D McCrary) reprs 356 2d Oak Art & Gift Shop The (Mrs Claire J Walker) 2514 Forsyth rd Oak Ridge Cemetery Madison Oakes Wm C Rev (Janie) hll28 College Oakman Lacy (c) maid r'223 5th av (V) Odom John A (Daisy) inspr Bibb Mfg Co h601 Log Cabin blvd Odom Jolle J (Ruby; Odim Candy Co) hl59 5th Odom Julia S (c) maid r427 North (V) Odom Julian R (Alberta) cash City Bd of Water Comnrs h549 Hillyer av (CH) Odom Margt W student r513 Napier av Odom Martha Mrs elk Union Dry Gds Co r304 Villa av (B) Odom Martha M r203 New Odom Norman H mach Builders Lumber Co h914 (917) Log Cabin blvd Odom O Crockett mgr Odom Realty & OdIonms COollier51L3 N(Laipliiaer Mav) formn h243 Winship (WH) Odom Ostell mach Bibb Mfg Co r601 Log Cabin blvd OOddoomm POawlmenieA(c(c))lnpddrlsr rh836308FDoesmterp'sseaylav (U) Odom Paul W (Martha) elk r304 Villa av (B) Oates Arth (c; Ethel) lab hl30 (6) Tins- ODOM REALTY & INSURANCE CO ley la (Sherman E Odom), 620 Georgia Cas- Oates Edwin R (Pearl C; Oates Market) ualty Bldg 516-522 Mulberry, Tel 1456 h509 American blvd Oates Market (Edwin R Oates) meats 474 2d O'Berry John W (Anna) h630 Vineville av (V) O'Berry Ona L student r201 Pierce av O'(BVe)rry Ruth r630 Vineville av (V) Odom Robt L (Mattie) cond MD&SRR h203 New ODOM SHERMAN E (Mamie C; Odom Realty & Insurance Co), h513 Napier av, Tel 2603-J Odom Sherman W elk Odom Realty & Ins Co r513 Napier av O'Brien Bertha (wid Martie A) fctywkr Odom Thelma (c) prsr New York Clnrs Happ Bros Co r219 Adams r854 Ocmulgee O'Brien Martie r219 Adams Odom Tweedy D (c; Maude) lab h385 O'Bryant Jack (c; Nettie) lab h252 Broad Anthony (IT) (EM) Odom Variety Works (Clifford L Odom) O'Cain Harry P (Lillian) linemn r765 cabtmkrs 513 Cotton av Pine O'Cain Walter L (Mattie) policemn h219 Tatnall Odom Wm (c) barber 720 Elm rl02 Rock Odom Wm P (Doris) formn r465 Dun- can av Ocmulgee Park end Corbin av (V) Odom Wm W filling sta 903 3d h757 O'Connell K Marie h858 Cherry Montpelier av 1 O'Connor Dollie L Mrs hl308 3d O'Connor John student rl927 2d O'Connor Rae student rl927 2d O'Connor Sami B (Sallie B) cond hl927 2d Odum Alonza U (c; Inez) porter Genones Barber & Beauty Shop h369 North (V) Odum Clarence (c) lab r458 City Hall la Odum Cleveland (c; Fannie) lab rl321 Broadway O'Daniel Pearl (wid Mark H) h563 College apt 6 Odell Arth B (Ruby) florist Idle Hour Nurseries r Forsyth rd Odell Kate Mrs elk h324 Ross Odom Albert (c; Thelma) clnr New York Clnrs h854 Ocmulgee Odom Alberta Mrs elk U S Dist Atty h549 Hillyer av (CH) Odom Anderson E (Mattie) driver hll57 Milledgeville rd (EM) Odum Isaac (Mary L) h758 2d Odum Jas (c; Leila) lab h614 Fort Hill (EM) Odums Mary (c) r408 Monroe Oetter Electric Co (Rudolph Oetter) 851 3d Oetter Rudolph (Optye; Oetter Elec Co) hi 20 Stonewall pi (V) Ogburn Aretta Mrs luncheonette mgr F W Woolworth Co r608 1st Odom Athol E (Sarah) sta mgr American Oil Co h749 Montpelier av OgWbuoronlfoCikhas(EeMlk) Glass Pharmacy r560 Odom Bertram (c) r860 Foster's al Odom Bessie (c) r385 Anthony (U) Odom Boykin B (Minnie) slsmn hl70 North av (NH) Odom Candy Co (Jolley J Odom) confr OdmomfrsCh15a9s A5th(Pearl M) h668 Napier av Odom Chas A jr (Earlene) confr 723 Ogburn Edwin (Aretta) pntr r603 1st Ogburn Harry student r560 Woolfolk (EM) OgWbuoronlfoLlkeon(EBM)(Fannie) blksmith h560 Ogburn Robt E (LaFaye; The Rex Beer Garden) h207 3d av (SM) Ogden Fannie T (wid Monroe) tchr Wes- CO Broadway r668 Napier av Odom Clarence E (Eva M) mach hl32 leyan Conservatory h520 Orange apt 4 Ogden Frances r520 Orange apt 4 2 Piedmont av Odom Claudia D (wid Leeward M) office Ogden Herbert student r520 Orange apt 4 Ogle Chas D (Eunice) guard City Stock- sec iFire Cos Adjustment Bureau rll3 ade h452 Edgewood av (SM) Nottingham dr (NH) Oglesby Graham Rev (Anna) pastor Odom Clifford L (Fannie B; Odom Church of God hi 12 American blvd CO Variety Works) h279 Ell (SM) Odom Edwin J student r513 Napier av Odom Eliz sten r668 Napier av Oglesby Jas N mstr mech Buckeye Cotton Oil Co r320 College Oglesby Jeptha D emp CofGaRy Odom Emory S (Mae) cabtmkr Odom Oglesby Robt mill hd Middle Ga Lbr Co Variety Works) r763 Cherry r308 Hanson Odom Hilda rl20 Roye (CH) Oglestreet Clara (c) maid hll7 Telfair Odom Ira millwkr hl20 Roye (CH) Oglethorpe Private Infirmary Inc A Robt Odom Jas (c; Willie) lab WPA Whse Rozar pres Thos H Hale v-pres Osee F h212 (239) Thompson's al (SM) Keen sec-breas 1309 Oglethorpe 279 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Oglethorpe Private Infirmary (Nurses' Home) Margt Thompson matron 1321 Oglethorpe Ogletree Miriam sten U S Dist Resettlement Admin r617 Orange Ohanlon P Jerome (Billie) driver r615 Walnut apt 4 O'Hara Ellen r771 Hemlock O'Hara John W ship elk r663 Mulberry OO'ldKheallmy LBiellrineice(c)J hr6509CheEadtgheawmoodal av (SM) Oldham Jos E (Alice) optician American Optical Co hl29 Piedmont av Oldham Mildred (wid Leonard) r316 Shamrock Oliphant Annie McA (wid Jas) dep elk City Clerk's Office r618 Forsyth Oliphant Ernestyne (c) nurse maid r316 3d av (V) Oliphant G Frank (Jeanette W) suptGa Academy for the Blind rl501 Vineville Oliphant Jeanette W Mrs tchr Ga Acad- emy for the Blind rl501 Vineville av Oliphant Lee (c; Kathleen) loco firemn h713 Daisy (SM) Oliphant Mamie (c) cook h316 3d av (V) Oliphant Twiggs (Mamie) emp CofGaRy Olive Grove Baptist Church (c) 308 Bright la Olive Verna nurse 262 Columbus r do Oliver Addie (c) h318 Hammond Oliver Annie H (wid Warren H) h.456 Orange Oliver Annie R (c) r607 (606) Crisp (SM) Oliver Berta (c) h302 Texas (SM) Oliver Carl S (Thelma M) lawyer 516 Mulberry loth fl h797 Patterson (N Olmstead Virginia (wid Thos C) rl06 Appleton av Olsby Jas supt r314 College O'Neal B P Jr & Co (Benj P O'Neal jr) investments 516 Mulberry R712 O'Neal Benj P jr (Margt; B P O'Neal Jr & Co) h250 Vista cir (I) O'Neal Eva tchr PS rl57 Summit av (NH) O'Neal Geo H (Florine) crane opr Gen- eral Reduction Co T717 Date av O'Neal Hansley T (Amelia B; Adams Realty Co) r RD 1 O'Neal Jas (c) lab f210 North (V) O'Neal Jas T formn General Reduction Co r RD 6 O'Neal John G (Irene) sta firemn County Court House h355 New O'Neal John H (Laura V) slsmn W L Cone Auto Co h359 New O'Neal Jos C (Mary G) mech Dunlap Chevrolet Co hll7 Nelson (SM) O'Neal Julia slswn Central Ga Baking Co r805 Pine OO''NNeeaall LLuuclya (Hwid(wJidChRaso)btr)l;13b4kpCrolrl7eg06e Napier av O'Neal Mamie (c) maid Dr J W Lovelace h210 North (PH) O'Neal Mamie sten r805 Pine Oneal Mary (c) r232 Norris (EM) O'Neal Max student rll34 College O'Neal Robt (c; Eliz) lab h303 (314) 3d av (U) O'Neal Wm B (Minnie) elk Standard Brick & Tile Co hl57 Summit av (NH) O'Neal Wm J (Margt H) elk hllO Holt av (V) O'Neal Willis (c; Magnolia) lab rl64 ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT, EM. gr. Hts) Oliver Carrie (c) maid h248 2d av (V) Oliver Clarence P (Elba) millwkr hlO Melrose (B) Oliver Cleve (c) r318 Hammond Oliver David (c; Lillie M) lab h304 (605) Prince (SM) Oliver Eva (c) hl22 (14) iFulton al Coles al OO''NNeeiill ABgennejs P(c)(Ar5n3n0a)Chliln3t8onB(oEnMd ) Oneil Wm (c) r530 Clinton (EM) O'Neill Chas (Eliz C) h439 Calhoun O'Neill Chas wood 422 Plum h do O'Neill Eudora (c) maid hl08 (222) Stewart's al YOUR CITY Oliver Frances E tchr PS r417 Boulevard (NH) OnCeoy Ch4h5a9s A(45(5N)ellViei)rgliinnieamanvGa Power Oliver Frances E (wid Ernest) h417 Boulevard (NH) Oliver Francis (c) bellmn r248 2d av (V) Oliver Geo r417 Boulevard (NH) Oliver Geo W (c; Manda) lab hll6 (80) Bay Oliver Jas W (c) rl22 (14) Fulton al Oney Sarah A r459 (455) Virginia av Ong Alma (wid Jack) beauty opr Mary Ann Beauty Shop r853 Cherry Ong Benj F (Edna M) policemn hllO (113) Crisp Ong Edna M Mrs slswn Mangels of Ga Inc hllO (113) Crisp D I R OLIVER JAMES W (Lila M), Asst Trust OCof,fihce2r03FCirosrtbNinaativon(aVl),BTaenlk18&34-TWrust Open Air School (c) 901 (950) Maynard (EM) Opry Stella B (wid Jack J) h4S White E Oliver John H (c) student T1015 Edgewood av Oliver Loreen rl40 Knott (SM) (SM) O'Quinn Alvin W (Sue E) meter rdr City Water Works Shop rl505 3d C Oliver Lula (c) hl015 Edgewood av Oliver Mable (c) rl51 Elm O'Quinn Ethel millwkr Bibb Mfg Co r 1427 2d T Oliver Mark (c; Laura) hl07 Bonaire O'Quinn Helen sten r342 Hardeman av Oliver Mark (c; Annie) porter rll6 (80) Orange Mary Cc) h816 Elbert (SM) Bay Orchard Wm (O lab rl9 Wall st la O Oliver Martha (c) h317 Burnett (EM) Order of Railway Conductors Building Olri2v1e4r MPalattniet M (c; Trio Bargain Store) 408 Poplar Order of Railway Conductors Macon R Oliver Maude matron YWCA r763 2d Division No 123 meets Sunday 2:30 Oliver Nell r763 2d Oliver O Lope (c; Mattie) lab h214 Plant p m 408 Poplar O'Rear A Haygood elk r554 1st Y (SM) Oltiovner RMeibllesccha21(3c) Fmrielltwwkelrl Aatllantic CotOliver Roosevelt (c) r318 Hammond Orick Clyde B (Ada) millwkr Bibb Mfg Co hll5 Comer ter (PM) Orington Jas (c; Minnie) delmn rl202 Woolfoik (EM) MIRRORS the Oliver Sarah (c) rl46 E Ell Orkin Exterminating Co A Rowland Car- Oliver Thad S jr mach CofGaRy roll mgr 403 Cherry R501 OOlliivveerr WWaalrtreern (DHeslsaaw) yfecrtyw30k8r r.21d427r425d6 Orlando Celeste (Lucy) tilestr r274 Winship (WH) Industrial Orange Oliver Will (c) hlOl Bay Orlando Vincent (Mary) bldg contr 274 Winship (WH) h do LIFE OlFmilsltienagd SAtrantoioOn (rL75a0llie2dD) atndt Scott Orme Jane student r232 High apt 3 Orme Richd P (Helen) solr h232 High Of Your. Olmstead E Clifton (Amy; American Printing Co) h213 Villa Esta dr OrarpCt a3rrie (c) student r595 Center (EM) CITY Olmstead Kermit B (Florence) driver Orr Claude (Geneva) sta atndt rl39 Rose John T Smith rl06 Appleton av pk 280 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES Where To Buy? Consult the Classified Business Lists In This Directory ARLINGTON HOTEL FREE I STORAGE BMRoOdeAmDWanAdY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. Orr Clifton B asst funeral director Overton Elvin E (Harriet) prof Mercer Burghard-Connally rll7 Corbin av (V) Orr Emily tchr PS rl54 Summit av (NH) Orr Geneva Mrs slswn Belle Millinery Co Univ h505% Adams Overton Queenie (c) lndrs h245 5th av rl39 Rose pk Orr Jas (c; Sarah) lab h309 Norris (EM) Orr Lelia (wid Clifton B) rll7 Corbin av Owen Allen jr chf car inspr CofGaRy r Ow56e9n CBrRooabdtw(aNyell W) acct Bibb Mfg Co (V) Orr Malcolm jr student rl54 Summit av (NH) h612 Montepelier av OOwweenn LLoawgasnonEH(MelakrgPtOR)r sRtoDre2kpr h837 Orr Malcolm W (Jennie L) supt Central Hillyer av (CH) Cotton Oil Co hl54 Summit av (NH) Owen McDuffy (c; Mamie) lab r407 Orr Obie W (c; Annie) agt Afro-American Life Ins Co h595 Center (EM) Charles (SM) Owen W Roland (Ruth) elk MD&SRR h Orr Oliver lawyer 709 Forsyth h do 718 Broad (EM) ORR S L CO, Sami L Orr Pres, Jewelers, Owen Willard L spl investigator Ga Rookwood Pottery, Hotel Dempsey Bldg, 511 Cherry, Tel 4111 Power Co Owens Eva M (c) maid r675 Dunlap al Orr Sami L (Birdie) pres S L Orr Co h Owens Frances rl27 Hines ter (V) 523 Vineville av (V) Owens Jas D (Evelyn F) elk Terminal Orr Sami L jr (Louise) slsmn S L Orr Ticket Office hl27 Hines ter Co hl27 High Orrington Jas (c) delmn Couch & Wood- Owens John (c; Essie) confr h208 (409) Campbell av (SM) all rll34 Woodfolk (EM) Owens Jos (c; Annie B) lab rl36 (110) Osborne see also Ozburn Bay Osborne Jas F (Lucille) formn h628 An- Owens Julia B (c) r753 Ash derson (SM) Owens Lawson H (Annie) hl249 Mont- Osborne Nonnie (wid Frank) rl40 Ell pelier av (SM) Owens Mamie (c) cook rl231 Broadway Osborne Otto O (Naomi N) beer 466 Mulberry h557 1st Osborne Vannie R Mrs supvr SBT&TCo r Wesleyan dr Osborne Wm C slsmn National Cash Register Co r615 Walnut Owens Mattie (c) lndrs rl231 Broadway Owens Philip (c; Rainey) porter Frank OwReonbserStasllihel5e4lk BCalyark Drug Co rll5 W Grenada ter Owens Walter (c) lab h305 Lake Osbourne Chas (c) rll2 Mitchell (EM) Owens Wesley P (Josephine) mldr Tay- OsMcaur'lbs ePrrlyace (Edw Calhoun) beer 523 lor Iron Wks & Sup Co hi 15 W Granada ter O'Shaughnessy Wm J (Doris) treas Cotton States Fertilizer hl06 Calloway (V) Owens Wm L (c; Mary) lab h404 Lawton av (B) Owings John L (Lucile) sec-treas Dixie Otis Elevator Co (br) C Robertson Chamblee mgr 403 Cherry R602 Ott Dewey R elk r608 Forsyth Ott Ethel L Mrs smstrs Mayson's Women Apparel r608 Forsyth Ott Nellie R slswn r608 Forsyth Ott T Cane (Ethel) slsmn Sterchi Bros Stores Inc r Napier av Ott Thos C (Ethel L) slsmn r608 For- syth Ottman Daisy Mrs librarian r763 2d Ottmann Barrington D student r717 2d Otto Dewey asst mgr Piggly Wiggly Stores Otto Fredk R (Annie M) mgr Otto Leather Goods Co hl25 Winship (W H) Otto Julius H (Maggie M) h661 New Otto Julius H (Grace O) yd elk h31 Progress Otto Leather Goods Co (Durell F Lamb) Ou3s5l5eyPLoupllaarV (wid Sami P) rl02 Pursley (V) Outlaw Allen (c; Ruby) lab h207 (252) Prince (SM) Outler Chuck (c; Mary) lab hl50 E Ell Outley Edw (c) r568 Chappell (SM) Outley Lois (c) h568 Chappell (SM) Outley Sami (c) shoe shiner Hayes Bai ber Shop rl36 (139) 5th av (PH) Ouzts Benj D pntr r200 Beech av Ouzts Benj F (Alice R) turn lathe opr Builders Lmbr Co h200 Beech av Ouzts C C driver r Hotel Fickling Ouzts Chas E (Clara J) driver r200 Beech av Ouzts Irene D Mrs r3800 Houston av (S M) Ouzts M Emmett (Corrine M) driver Yellow Cab Trans & Baggage Co h930 Walnut Ouzts-Mitchell & Whaley Inc Claude L Roll & Cot Co Inc hl02 Boulevard (N H) Owl's Cafe Andrew J Ryals mgr 46914 2d Oxford Benj millwkr Bibb Mfg Co r328 Hanson (SM) Oxford Jas C supvr elk WPA r371 1st Oxley B Thamar (Gladys) policemn h854 Courtland av Oxley G Ellen slswn r404 Napier av Oxley Geo W slsmn r314 Beech av Oxley Harry W r314 Beech av Oxley Mary D (wid Geo W) h314 Beech Oxley Mattie (wid Cosby H) h569 Hawthorne Oxley Paul R (Vera; Supreme Storage Garage) h314 Beech av Oxley Sami D lab r569 Hawthorne Oxley Sophie C student r314 Beech av Ozburn see also Osburne Ozburn Edw gro 805 (1800) Log Cabin blvd r925 (1993) do Ozburn Harwell C (Alice J) claim agt h 925 (1993) Log Cabin blvd Ozburn J Lee (Jewel) car repr CofGRy h706 Mikado av Ozier E B slsmn r Capitol Hotel Pace C V linemn Ga Power Co Pace Florence (wid Will) fety wkr Happ Bros Co hl24 Holt Pace Glenn B (Stella) mach h209 Heard (SM) Pace J Floyd (Myrtle) loco eng r305 Clayton (V) Pace Wm D (Paris) loco carp CofGRy hl21 Heard (SM) Pace Willie (c; Josie) lab h411 Shoals al (EM) PACKARD MACON CO, Chas A Yates Pres-Treas, Durwood W Yates Sec, 717 3d, Tel 4871 (For further information see left top lines and page 3 Buyers' Guide) Whaley pres Wm E Ryals sec-treas 5 Terminal av Packer Advertising Corp John A Jones mgr 452 Plum Overstreet Walter E (Derry) h356 Pierce Padgett Benj F (Sarah H) mill wkr Bibb av (V) Mfg Co h821 Hazel 281 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Padgett Britt mill wkr Bibb Mfg Co r 825 Hazel Padgett Clara V Mrs smstrs r712 2d Padgett Delpia mill wkr Bibb Mfg Co r 825 Hazel Padgett Kenny B (Louise) agt Natl Life & Accdt Ins Co h717 1st Padgett Maggie rl03 (264) Pearce (EM) Padgett Pauline mill wkr Bibb Mfg Co r825 Hazel Padgett Terrell B rl03 (264) Pearce (E M) PaHdagzeetti Zonie (wid J Callaway) h825 Page Jos (c; Rosa) lab h601 Straight (U) Page Lizzie (c) lndrs rl226 1st Page Tressie L (c) h822 Elbert (SM) Paine see also Payne PAINE GUY E (Helen M), General Agent Penn Mutual Life Insurance Co, h329 (377) Hill Crest av, Tel 3894 Paines Frank (c) lab Mansfield Dray Line Pair John E (Woodie) hostler CofGRy h 215 1st Pair Sami G (Bertha) supt Atlantic Ice & Coal Co h251 Belvedere dr Pappas Peter J (Mary F; The New Yorker) r Hotel Dempsey Parcel Delivery Co (Jos C Burns jr) rear 652 Cherry Schatzman's alley Parchell Bessie (c) cook r422 Ward (V) Parham Alonzo J (c; Cora L) shoe repr 299 1st av (V) r297 do Parham John H (Iva G) slsmn h435 Duncan av Parham Jos R (Mary) city firemn r708 Montpelier av Parham Loddie (wid Howard) rl20 Win- ship (WH) Parham Mabel H (wid John L) r2834 Houston av (SM) Parham Parthena (c) hl432 Broadway Parham Ralph E (Dorothy) slsmn Met Life Ins Co r RD 2 Columbia rd Parham Willie R (c) r297 1st av (V) Paris Cleo E (Ena L) gro 201 Linden av h do Paris Effie L student rll3 Richmond (SM) Paris L V gro 544 3d av (V) rll3 Rich- mond (SM) Paris Thos N (Edna L) elk L V Paris h 113 Richmond (SM) Pair Virginia H slswn Burden Smith & Co r215 1st PaMlacuelbBeraryrber Shop (Arth T Spell) 558 Palace of Sweets (Jas Andrews and G Nicopulos) confrs 304 Cherry Palisades Apartments 571 Orange Pallard Jas (c) lab r7 (6) Murray al Palm Barber Shop (Peter C Stocks, Roy B Rhodenhiser) 316 2d Park Chas L (Mamie L) dispr h212 Clisby pi (V) Park Hugh H state news editor Macon Telegraph r301 Cherry Park Lummie (c; Zada) hi 15 Spring Park Orville A (Park & Strozier) r Clin- ton rd RD 2 Park Orville A jr associate lawyer Park & Strozier r918 Vineville av (V) Park Robt L dispr MD&SRR r212 Clisby Palm Bill (Mattie) emp Riverside Cemetery rl55 College Paprik V(Vie)w Apartments 105 Park pi Palmer A W formn rl25 Log Cabin dr PARK & STROZIER (Orville A Park, Palmer Alex (c; Leola) lab Natl Handle Co h635 Division HAassroryciaSte)S, trLoazwieyre; rsO, rv40il1le-40A4 PGaerokrgJiar Palmer Clara (c) lndrs hl027 College dr Casualty Bldg 516-518 Mulberry, Tel Palmer Florine H (wid Jos) h36 Arling- 3667 ton pi Palmer Jas (c; Myrtice) lab rl62 Coles al Parker Adolphus J (c; Beulah) lab r304 Charles (SM) Parker Allen (c) farmer h536 Smith (E Palmer Jesse F r512 Oglethorpe M) Palmer John (c; Lula) lab hl09 Edgewood av Parker Alton mill wkr Bibb Mfg Co r514 Jackson Palmer John E (Ida K) sec-treas South- Parker Amanda (c) maid h211 Wood al eastern Battery Co Inc hll4 Florence Parker Anna (c) hl!6 (366) Craft (V) av (SM) Parker Anna (c) rl26 (165) Roye (EH) Palmer John E jr lab rll4 Florence av (S Parker Annie (c) rl72 (124) Plummers al M) Parker Arth (c) h719 Whitehead al Palmer Louise (wid Wm A) r!14 Florence av (SM) Parker Arth lab Builders Lmhr Co r217 Whitehead la Palmer Luther D (Susie) cond h225 Adams Palmer Margt (wid Stanton) r93 Violet av (SM) Palmer Mary E student rl56 Williams (S M) Parker Aurelia (c) r9 Spring PPaarrkkeerr BAezaitlreicestu(dweindt Crh3a2s2) Nr2e0w6 Mont- pelier av Parker Benj (c) lab CofGRy Parker Bessie (c) r305 Womack (EM) Palmer P David (c) lab rl75 Park Hotel al Parker C F lino opr Macon Teleg Pub Co r Capitol Hotel Palmer Ray (c) lab r717 Whitehead al Palmer Sami B phys 403 Cherry R723- Parker C F mter tester Ga Power Co Parker C W usher Ritz Theatre r722 24 hl41 High Oglethorpe Palmer Thos (Narcissus) r512 Ogle- Parker Carl H (Myrtice) atndt Power Oil thorpe Co r627 Pio Nono av (V) Palmer Wm C (Naomi) ins agt hl56 Williams (SM) Palmetto Barber Shop Herbert Rutherford mgr 463 Broadway Parker Carrie (c) r95 Harris al Parker Carrie (c) maid 212 (3) N Tatnall la Parker Chadwick B (Rosamond) ins Life Palms Amos (c) porter rllO Gantt City Ins Co of Va r202 Church (EM) rd (SM) Parker Chas (c; Carrie) h324 (323) Short Palms Jas (c; Bessie) h702 (262) Charles (EM) (SM) Parker Chas (c: Laura) lab h306 Gordon Palsco Lonnie (c; Emma L) lab r305 Gil- Parker Chas H (Mattie) elk h627 Pio mer Nono av (V) Pan-American Life Insurance Co Ernest Parker Chas L (Maude) slsmn American T Kirkland dist mgr 409 2d R425 Bakeries Co h612 Johnson av (HH) Panders Wm (Minnie) mill wkr Atlantic Parker Christine V student T705 Holt av Cotton Mills r955 Elm (NHts) Paniman Patsy (c) lndrs rlOl Monroe Parker Claudia (c) maid Dr Jas L King Hill (V) r518 Monroe 19 Pape Harry E probation officer Bibb County r River rd Parker David (Maggie H) lab City h523 Jackson SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 282 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES (,'JS Plymouth Parker Dolly (c) lndrs hl02 Adams Parker Dorothy (c) cook 3202 Forsyth rd Parker Edw J (Lizzie W) h514 Jackson Parker Edw T (Verdia) millwkr Bibb Mfg Co r722 Oglethorpe Parker Ella (wid Geo F) bkpr Acme Sign Service rl09 Academy Parker Emmett T roofer Ga Roofing & Sup Co r2606 Broadway Parker Ernest (c; Lucille) h340 (140) Division (T) Parker Ernest P (Lucille) car reprmn Cof GRy r3327 Houston av (SM) Parker Estella (c) lndrs r3 Woodcliff Parker Eug (c; Martha) emp CofGRy h 230 5th av (V) Parker Evelyn r853 Cherry Parker Evelyn sten r811 Main (EM) Parker F Lucille sten rl35 Oakland av Parker Fisher F (Lora) mach h2911 Hous- PatrokneravGeo(SM(c); Ruth) lab r610 Ross Parker Geo H (Clarine) millwkr h321 Ross Parker Geo W millwkr Bibb Mfg Co r722 Oglethorpe Parker Gertrude (c) maid hi 15 Gaillard (V) Parker Gladys (c) lndrs rl219 3d Parker Gusie waiter F W Woolworth Co Parker Harry B (Minnie) millwkr At- PalPrakinetircHCeontrtyon(cM; ilSlsalhli5e0) (5) Roff Home lab hl22 (782) Nussbaum (SM) Parker Henry A (Ouida I) h705 Holt av Pa(rNkeHrtsH) enry G rl020 Oglethorpe Parker Hugh W (c; Leila) janitor h205 Madison Parker Ida (c) maid hl36 E Ell Parker J Bart supt h853 Cherry apt 1 Parr2k4e7r BJ oMulaervioanrddi(sNpHe)lk Macon Gas Co Parker Jas r722 Oglethorpe Parker Jas (c) lab hl09 May av (U) Parker Jas R (Minnie) slsmn h421 Beech Parker Jefferson (c) lab rill Sapp av (IT) Parker Jesse (c: Carrie L) lab Natl Han- dle Co hl68 Hazel Parker Jesse W millwkr Willingham Cot- ton Mill rl29 (36) Holt av (NHts) Parker Jewett (c) r458 Hazel PPaarrkkeerr JJoohhnn B(c)(AllambirhaiE10) WslsamlknerFrleae- man-Dent-Sullivan Co h353 Hines ter Parker John H (c) h611 Center (EM) Parker Jos C millwkr Willingham Cotton Mill rl29 (36) Holt av (N Hts) Parker Julia millwkr Atlantic Cotton Mills r4 Atlantic Village Parker Laurice (wid Henry C) rl20 Stani- slaus cir Parker Laurie L (Pearl) h811 Main (EM) Parker Lee M millwkr Willingham Cotton Mill rl29 (36) Holt av (NHts) Parker Leila (c) maid h605 Hall (EM) Parker Leila G (wid Farley) h754 Plum Parker Leland r318 New Parker Leon B (Mary S) fulling sta 2001 Vineville av (V) h do Parker Leonard F (Mattie) gro 501 E 2d (EM) hll3 Nottingham dr (NH) Parker Lillian waiter Booth's Cafe r555 2d Parker Lillie (c) smstrs h3H0 Gilmer Parker Lola home supvr U S Resettlement Admin r322 Georgia av Parker Mack (Sarah) archt rll9 Vista cir Parker Magnolia (c) r408 (720) Campbell av (SM) Parks Mamie L (c) tchr r217 Grant av KV) Parker Margt millwkr r321 Ross Parker Martha A (wid Wm J) rl300 Montpelier av Parker Mary L slswn Globe Dress Shop r RD 3 Parker Minnie (c) lndrs rl29 (205) Magnolia la Parker Miriam (c) lndrs rl09 Mulberry Pa(rVk)er Modene (c) lndrs rll5 Gaillard Parker Myrtice rl29 (36) Holt av (NHts) Parker N H jr (Phalba) elk h532 Boule- vard (NH) PPaarrkkeerr NNaenlscoyn (Hc) (rLl2u4la2 BB)roealdect(nEMG) a Power Co h246 Williams (SM) Parker Opal fctywkr Happ Bros Co r754 Plum Parker Pauline millwkr Bibb Mfg Co r 722 Oglethorpe Parker Preville (c) r307 (375) Bowman (E M) Pahrlk0e9r RAacyad(eImday A: Acme Sign Service) Parker Resa (c) h307 (375) Bowman (E M) Parker Richd M (Nellie) pntr hl238 Col- lege dr Parker Robt L rec elk A S Hatcher Co r 206 Montpelier av PPaarrkkeerr SRaomsia Ctch(Mr aPriSe) rslLsmiznellha32G2 aNew Parker Susie r612 Johnson av (HH) Parker Tabitha J (wid Eug N) hl32 Strat- ton (ISM) Parker Thos (Agnes J) bkpr h550 Log Cabin blvd Parker Thos B (Louise M) teller First Natl Bank & Trust Co h313 Orange Parker Thos L mgr Cannon Shoe Store r802 Mulberry Parker Thos W (Alice) slsmn Corbin Sup Co hi 13 Cleveland av (V) Parker Ves h329 College Parker Vivian student r329 College Parker W B eng r315 Mulberry Parker Walter (c: Maggie) cook h314 4th av (V) Parker Wilda (c) lndrs h762 (152) White- head al Parker Wm (c: Beatrice) lab h598 (506) Smith (EM) Parker Wm L (Ada L) loco eng h206 Montpelier av Parker Wm M (Evelyn A) h618 Hemlock Parker Wm M (Edna M) asst cash City Bank & Trust Co h247 Boulevard (N H) Parker Wm R (Lora) inspr County Bd of Health hl35 Oakland av Parker Willie A (c) lab r516 (488) Hill Crest av (CH) Parker Woodrow millwkr r811 Main (E PaMrk)er Zebede (c; Molly) lab Taylor Iron Wks & Sup Co h702 Hazel Parkerson Nancy D elk The Polar Bear r233 Bond apt 7 Parkerson Theo M (Frances) h476 College apt 15 Parkman Annie B Mrs h317 Randolph (EM) Parks Beatrice F sten CofGRy Parks Bernard H (Velma G) pharm Mitchell & Williams Inc hl02 Rogers av (V) Parks Callister Mrs millwkr Bibb Mfg Co h32. (33) Brigham Parks Candis millwkr Atlantic Cotton Mills r51 (6) Roff Home pi Pa1rksts Clinton lab Coplan Junk Co rl206' Parks Dock L chauf Safety Cab Co r813 Main (EM) Parks Eddie (c) r459% Clinton (EM) Parks Edith millwkr Bibb Mfg Co r32 (33) Brigham Parks Ella M (c) tchr h217 Grant av (V) Parks Flossie (wid Wm) smstrs rl02 American blvd Parks Frank (c: Lillie) lab h227 (561) PaDrkissroHounbearlt D (Wilda M) fctywkr Bibb Mfg Co hlO Bellevue rd 283 Parks Hugh M elk r371 1st Parks Jas W (c) lab rl09 (500) Single- ton's la Pacrakns Jbolsvd(Annie) millwkr rlOl AmeriParks Justyne (c) elev opr r217 Grant av (V) Parks Lizzie (c) h256 Garden (EM) PPaarrkkss MMailmtoine HL ((cM) atbeehllre)PSmirl2l1w7krGBraibnbt Mfg Co h94 Green (PM) Parks Nelson (c: Eliz) h459% Clinton (E M) Parks Oscar (Irma) millwkr Bibb Mfg Co hllO Green (PM) Patrokns Savarah S Mrs tchr PS r2911 HousParks Wm (c: Christine) driver hl22 (12) Hudson Parks Wm A (Adell C) millwkr Bibb Mfg PaCrlooeh8E4m7 mHeatztel(c) r205 Toombs (SM) Parnell Homer (c: Nora) lab h231 (221) PaErnlleiollttLo(EreMn)a (wid Wm J) hill Dixie av (SM) Farrell Mamie (c) lndrs h rear 377 MonParrell Wm P (c) lab r rear 377 Monroe Parris Wm H (Ruby C) slsmn Sterchi Bros Stores Inc r896 Hillyer av (CH) Parrish Francis paymstr Bibb Mfg Co Co Parr7r1i7shHGeemoloHck(Alfreda R) service mgr Frank Roberts h420 Duncan av Parrish Henrv H (Eliz) carp h56 Cedar (SM) Parrish Henry J r56` Cedar (SM) Parrish Joe H student r56 Cedar (SM) Parrish Julia A (wid Claudius C) h518 Orange Parrish Sallie T bdg 209 1st h do Parrish Sol A (Shirley B) loco eng hl05 StJames av (SM) Parson Edna (c) r333 3d av (V) Parson Mattie M (c) cook h333 3d av (V) Parsons Paul E (Nita) mach CofGRy r 319 Duncan av Partain Dennis H (Willie L) carp hllO Heard (SM) Partain Lois A student rllO Heard (SM) Partain Sara B rllO Heard (SM) Pasco Pearl M (c) maid h607 Strayers al (SM) Passmore Annie r613 Orange apt 2 Passmore Hobson L (DIavis-Passmore Roofing Co) r578 Boulevard (NH) Passmore Mamie L priv sec WPA r613 PaOstrzaonrgeJulaiupst (3Maude (R) contr 104 Ella h do Pastzor Maude R Mrs smstrs Union Dry Gds Co hl04 Ella Pate A A elk Hotel Lanier r525 Mulberry Pate Edw (c: Cleo) drver r269 Madison Pate Edw (c) porter S Jones Co h215 Pond Pa(tVe )Elisha (c) porter hl37 Sycamore (V) Pate Geo T (Maggie E) mach h3Q5 Rutherford av CSM) Pate Jesse H (Louise) sec-treas-mgr Coleman-Meadows-Pate Drug Co Inc Pahte!3J2o0hnViBnev(Milleartahva) (lVin)emn Ga Power Co h303 Hines ter (V) Pate Jos (c; Mattie) lab h336 Middle (V) Pate Louise Mrs r241 Boulevard (NH) Pate Marion (c) lndrs Ga Academy for the Blind rl37 Sycamore (V) Pate Pauline G Mrs slswn Dannenberg Co r Lakeside rd Pate Robt millwkr r871 3d Pate T E r315 Mulberry Patrick Chas H (c) student r211 Mutual av (V) Patrick David (c: Alberta) lab h241 Waterville rd Patrick Elwyn student rl219 Oglethorpe Patrick Emily (c) maid r805 Daisy (SM) Patrick Floyd (c; Emily B) agt h222 Roosevelt av (V) Patrick Henrietta (c) cook h2'18 Mutual av (V) Patrick Jennie (c) lndrs rl09 Neal av (V) Patrick Marie (c) r202 Toombs (SM) Patrick Robt G (c; Charlie) carp h211 Mutual av (V) Patrick Robt G jr (c) lab r211 Mutual av (V) Patrick Ruth (c) student r218 Mutual av (V) Patrick Sami (c: Rosa) lab h444 Tindall av (SM) Patrick Vassar R (Carrie) hl405 Vine- ville av (V) Patrick Viola (c) r506 Fort Hill (EM) Patrick Willie B (c; Florence) hlpr r423 (474) 3d av (V) Patten Lue E (c) rll6 (1229) Tracy's la Patterson Adeline (c) r474 Clinton (E M) Patterson Andrew (c: Callie) lab h230 (213%) Elliott (EM) Patterson Anne (c) smstrs r203 Telfair Patterson Annie Mrs hl23 Ayers rd Patterson Annie Mrs elk h811 Montpelier Paattlerson Annie M (c) hi12 (7) Fulton Patterson Annie M (c) maid r314 (320) Monroe Pa1tt2e4rs(o1n32A) rMchiilel Oav (Clara) swtchmn h Patterson Aurelia (c) h620 3d av (V) Patterson B (c) lab h312 Burnett (EM) Patterson B L policemn r415 Virginia av Patterson Beatrice (c) elev opr Hotel Southland r310 1st av (V) Patterson Bee porter Dunlap-Peeler Hdw Co Patterson C Ivey (Priscilla C) gro 218 American blvd h do Patterson Carl elk Walter N Shinholser r Pio Nono av Paterson Carl B slsmn Central Cotton Oil Co r300 Broadway Pa(tVte)rson Carl B student rl06 English av Patterson Carolyn sec rl47 High Patterson Chas F collr r28Q3 Houston av (SM) Patterson Clyde H (Edna) driver Power Oil Co r811 Montpelier av Patterson Doris (c) student r413 Maynard (EM) Patterson Earl (c; Julia) fctywkr h607 (7) Gilmer Patterson Edw (c; Alberta) h310 Patterson (NHts) Patterson Edw (c: Lula) lab hl031 3d Patterson Eliz (wid Wm) h607 2d Patterson Elmer P (c) barber Clinton Bradey rll7 (15) Wise av (V) Patterson Elsie student rl24 (132) Mill av Patterson Fannie (c) cook rl039 Pio Nono av (VO Patterson Fred (Eliz) capt Police h811 Hemlock Patterson Geo S (c) porter W R Werden & Co rl07 Rose Crest av (SM) Patterson Harold H (Leila) supt Swift & Co hlOl Jeff Davis (SM) Paterson Hilda nurse 860 New r do Patterson Inez (wid Geo E) to.559 Orange apt 6 Patterson Irene Mrs cash Mitchell & Williams Inc r815 Poplar Patterson J Homer (Euna M) roofer h 1016 Ash Patterson Jas (c; Sallie) loco firemn h 121 Telfair Patterson Jesse (c: Marion) gro 622 3d av (V) h204 Forest av (V) Patterson Jesse lab r!12 Ponce de Leon av (SM) Patterson John C (Ressie M) h.417 Win- ship (WH) 1 ft w 2 Linen Service 20% DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIRRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories ofi Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information yon are unable to procure else- where, call on ns R. L. POLK & CO. DETROIT 284 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 Patterson John T (Clara L) millwkr h442 Lawton av Patterson Jos A (Carrie) h225 (51) Maynard (EM) Patterson Laura H student r2632 Broadway Patterson Laura I (wid Wm N) r2632 Broadway Patterson Leila (c) lab h439 (448) Middle (EM) Patterson Leo millwkr Willingham Cotton Mill r202 Duncan av Patterson Levi (c: Ida K) lab CofGRy h303 (301) E 1st (EM) Patterson Louis (Maude) city policemn h 415 Winship (WH) Patterson Louis (c: Rosa) lab CofGRy h314 2d av (N) Patterson Lynwood (c) driver J W McPaCttoeorskonLbMr aCcko (rcl;55EsBterlolaa)d la(bEMC)ofGRy hll6 5th av (U) Patterson Mary (c) lndrs hl23 (116) Wood al Patterson Nezzie M Mrs hl06 English av (V) Patterson Nora (c) hl23 Ash Patterson Opal student Ga Academy for PatthteersBonlinRdicrhdRDA (1MSaurygaLr) VpanllteryhGl0a2 Whitehead (SM) Patterson Roberta (c) maid r214 Clark la Patterson Rosa L (c) maid hl23 (122) Or- chard av Patterson Sara student Ethel B Davis Beauty Shop r86*7 New Patterson Thos (c) r216 (129) N Tatnall la Patterson Tillman (c; Lizzie) h.15 Harris al Patterson W Jos student r2632 Broadway Pa3t0te7rs(o3n28W) eSshtoonrt(c(:EMBe)rta) lndrywkr h Patterson Wm (c; Emma) lab hl40 E Academy (EM) Patterson Wm J mach h2632 Broadway Pattillo Flew E sten rll4 Buckingham Pi (V) Pattillo Lula W (wid Julian K) sandwich mkr 114 Buckingham pi (V) r do Pattillo Wm A (Polly H) postmstr PO h Pa4t1ti4shNalalpSieterpahvE (Emma) ins agt Caro- lina Life Ins Co h419 New Pattishall Vera fctywkr Happ Bros Co r 419 New Patton Ada Mrs r87Q 2d Patton Clara (wid Sami A) millwkr h320 Ross Patton Fannie W (wid John R) h765 Pop- PPaattttoonn GGeeoorgsitaud(ewnitd rSl4a2miHAin)esr6t6e7r E(Vlm) Patton Henry T (Nell M) slsmn h463 Na- pier av Patton Jos routemn rl42 Hines ter (V) Patton June student rl24 Hines ter (V) Patton Marianna student rl42 Hines ter (V) Patton Marv T (wid Sami E) hl42 Hines ter (V) Patton Monnie r765 Poplar Patton T Emory (Ruth) elk G G Harde- man Co h285 Masonic Home rd Patton Wm H (Cora W) trav slsmn h533 Orange apt 9 Patton Woolvin student rl24 Hines ter (V) i Paul Aug H mach CofGRy Paul Benj C (Estelle) linemn Ga Power Co h27 Hill Park av Paul Eunice (c) maid h603 (274) Crisp (SM) Paul Geo C elk Willingham Sash & Door Co r Dry Branch Ga Paul Helen E office sec Smith & Smith r Dry Branch RD 1 Paul Jas (Maude) millwkr Atlantic Cotton Mills h4 Ford la Paul Laura M (c) lndrs hl38 (83) 5th av (V) Paul Lena (c) lndrs r603 (274) Crisp (S M) Paul Leslie (wid Chas E) hostess Hotel Lanier hll60 Elm Paul Lola M (c) lab r223 ( 329) Fargason (V) Paul Lowell G r456 Duncan av Paul Oscar slsmn Adams-Buchanan Mo- tor Co rl27 Stonewall pi Paul R Carl (Mary E) dept mgr Goodrich Silvertown Stores hi 160 Elm Paul Ralph L hlpr Ga Power Co r254 College Paul Robert L (c) lab r603 (274) Crisp (SM) Paul T Bertice (Winifred V) elk h456 Duncan av Paul Wm C learner S H Kress & Co r766 Cherry Paul Willie M (c) maid r305 (304) Crisp (SM) Pa(uEldMo)Beatrice (c) hl03 (42) O'Neal's al Pauldo Clifford (c; Lucy L) lab Central Cash & Door Co h306 Crisp (SM) Paulette Wm J elk RyMS r Edna pi PPaauullkk FHroarnacceesMM (sMtuaddeenlitner78M4) Hfiielllydermagvr Met Life Ins Co h784 Hillyer av (CH) Paulk Vivian A student r784 Hillyer av (CH) Paullin Margt S (wid Wm B) h608 For- syth Paulson Frank driver rl03 Nelson (SM) Payne see also Paine Payne Annie J student r268 Oakland av Payne Calder treas Willingham & Payne Inc r355 Orange Payne Chas D (Louise) mgr Gay Clo Co h533 Orange apt 5B Payne City Auditorium 68 Davis (PM) Payne City Clinic Clara M Hayes in chge 70-71 Davis (PM) Payne City Community House Rose av (P M) bet Davis and Green Payne Corinne rl039 1st Payne Elvenia (c) student r263 North (V) Payne Essie M (c) maid Burden Smith & Co r436 Tindall av (SM) Payne G Garland rl039 1st Payne Geo W hl039 1st Payne H H (Emiline) supvr WPA r301 Cherry Payne Hubert A (Goldie) gold buyer r 817 New Payne J M elk r371 1st Payne Jas (c) r256 Broad (EM) Payne John (c; Lula) slsmn h413 (456) Womack (EM) Payne Lillian V millwkr Bibb Mfg Co r 1039 1st Payne Louise Mrs slsWn Mary Lou Shop h533 Orange apt 5B PPaayynnee MMaarriborneyE s(tMudyerntlte)r3f0c1tyCwhkerrrByibb Mfg Co r312 (363) Log Cabin dr Payne N Virginia r268 Oakland av Payne Narcissus (c) cook rl57 5th Payne Robt L (Flora A) mill wkr Will- ingham Cotton Mill h268 Oakland av Payne Robt L jr slsmn Steve M Solomon jr r268 Oakland av Payne Theo J (c: Clara) lab h256 Broad (iEM) Payne Vemie M r816 3d Payne Wanzie W millwkr Bibb Mfg Co r 1039 1st Payne Wm E (Azilee) chf opr Postal Tel- Cable Co r721 Hemlock Payne Wm S h525 College apt 1 Payne Wm S elk Central Sash & Door Co h355 Orange Payne Wm S jr (Mildred H) pres Willing- ham & Payne Inc h355 Orange Payton Blanche elk rl29 Pearl 285 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Payton Elisha C (Pearl) maeh hl29 Pearl PPaayyttoonn RMuabryy L(c()c)hhlli8 (4(1873)) SBteaiyns al PatzhoArplgeer F (Helen) slsmn hl418 OglePeabody Mary H (wid Elbert P) r402 In- Reside Peacock Allie (wid Jas S) h460 Mulberry Peacock Alma student rl25 Plant (SM) Peacock Benj W (Bessie) agt r716 Main (EM) Peacock Chas H (Edith H) slsmn Dunlap Chevrolet Co h681 College Peacock Clyde J Mrs cash Dunlap-Peeler PeHacdowckCEo Jhullla5n B(AeencnhieaBv) 1x210 Clisby PePaico(cVk) Francis r460 Mulberry Peacock J Abr (Rachel M) barber StePepahceoncks BJ aPrbreesrtoSnhompsnh8g2r0r7H1e6mMloacikn (E PeMac)ock John A foremn Atlantic Cot- ton Mills hl25 Plant (SM) Peacock John W (Ollie Q) rll5 Beech av Peacock Jos B (Tessie) millwkr r45 Bake Peacock Julius E (Clyde J) bkpr hll5 Beech av Peacock Leroy msngr r820 Hemlock Peacock Lorene rl'25 Plant (SM) Peacock Paul (c; Fannie) fctywkr Bibb Mfg Co r610 (203) Smith (EM) Peacock Sarah. r454 New Peacock Wm B r716 Main (EM) Peal Willie (Emily) lab Taylor Iron Wks & Sup Co r3il3 (314) Campbell av Pearce see also Pierce Pearce Carrie L (wid Richd W) hl723 3d Pearce Coleman C student r637 Orange Pearce Dudley (Mary) slsmn r254 New Pearce Eliz (wid John T) r223 Tatnall Pearce Helen slswn rl723 3d Pearce Marshall H (Annie) capt Police h637 Orange Pearce Marshall H jr chf radio opr Police r637 Orange Pearce Mary Mrs waiter New Yorker r254 New Pearce Wm L (Lena) barber hl02 Fair- mont av (B) Pearson see also Pierson Pearson Claudia I Mrs gro 1243 2d hl430 3d Pe(aErsMo)n Frank (c) lab h511 (512) Martha Pearson Frank jr (c) firemn Builders Lbr Co roll (512) Martha Pearson I D Mrs elk Union Dry Gds Co r Central Hotel Pearson Hah (c) r224 Powell (EM) Pearson J Andrew (Inez) supvr r417 New Pearson John W (c) porter Karsten & Denson Co Inc Pearson Lillie waiter Jas T Stewart rllO (201) Elliott (EM) Pearson Lon (c) lab Willingham Sash & Door Co rlOO Anthony rd Pearson Mabel r302 (319) Log Cabin dr Pearson Martin (c) shoe shiner 217 5th h do Pearson Mary E (c) tchr h224 Powell (EM) Pearson Pink (c) pdlr h502 Academy al (EM) Pehalr9sol2n R3dalph E (Mary P) emp CofGRy Pearson Sami H jr (Patti R) enumerator h811 Poplar apt 3 Pearson Sidney B auto meeh rl430 3d PetarraslonSSasimh e&on BDo(oCrlaCudoiahlI4)3m0ec3hd CenPearson Thos (c: Inez) h35 Gas House al Pearson Willie M (c) maid r502 Academy al (EM) Peate Andrew (c: Annie) h240 2d (U) Peavey Lazrus (c: Madie) lab r511 Edi- son (EM) Peavy Albert B (Lora R) hl411 Edgewood av apt 2 Peavy Chas D (Ruth M) slsmn Sterchi Bros Stores Inc rll02 Ridge av (V) Peavy Chas HI (Margt) rlQ8 Holt av (V) Peavy Claude Mrs h227 Grant Chapel al (SM) Peavy Doris r237 Washington av Peavy Frank (Emma L) rl05 (11) Myrtle (EM) PeBavayrbGereoShCop(Arl9icl3e) 2bdarber Tatnall Sq Peavy Horace millwkr Bibb Mfg Co rl7 Bibb av Peavy J Prentice (Christine) slsmn At- kins Bakery rl64 1st Peavy Jackson W (Annie L) driver Yel- low Cab Trans & Baggage Co r742 Walnut Peavy Jas M r237 Washington av Peavy Jas W mach opr Willingham Sash & Door Co h237 Washington av PeJaovbybiJnogs HKou(Asennri2e37R)Wsahsoheinrgetporn Daivxie Peaapvvt L2amar W driver rl411 Edgewoo,,d av Peacy Lora Mrs fctywkr Happ Bros Co r 14il Edgewood av apt 2 PeCavayb MCaollor6rv63F P(lFulmorence) chauf. Safety Peavy Mary (c) maid rl31 Maccasin Slide Peavy Mary F (wid Vol) r237 Washington av Peavy Mary L Mrs r2321 Broadway Peavy Wm student rl05 (11) Myrtle (E PeMck) Ephraim (c; Lizzie) driver h237 (233) E 2d (EM) . PPeecdkdicRoordsa G(eco) rW436(CThirnidstailnle)avfo(rSmMn) h 774 Date av Peddicord Howard W r774 Date av Peddy see also P'ettey and Petty PEDDY JULIAN E (Mary H), Mgr Courts & Co, h475 Orange, Tel 3775-W Peddy Wm P auto mech rl34 Winship (W H)' Peddy Willie S (wid Jas) rl34 Winship (WH) Peebles Harry L (Nelle) slsmn Friedman's Jewelers h655 Forsyth Peek Brazilia (c) rll6 Concord (SM) Peek Geo S (Grace) carp r214 Knott (S M) Peek Jesse (c) rll6 Concord (SM) Peek Ruth Mrs millwkr Bibb Mfg Co r520 (552) Oglethorpe Peeks John W (c) barber 464 (2) Poplar h406 Applewood (EM) Peeler Aaron M (Jane) pres DunlapPeeler Hdw Co h309 Georgia av Peeler Della emp Snow's Lndry & Dry Clng Co r229 (112) Dishroom la Peeler Eliz J (wid Chas G) hl27 Coleman av (CH) Peeler Emory S fctywkr r26 Bellevue rd Peeler F Royal (Odessa) millwkr Bibb Mfg Co rill Yates av (EM) Peeler Hazel fctywkr r26 Bellevue rd Peeler Isadore (c) prsr Ernest C Porter r 229 (112) Dishroom Id Peeler Janie S (wid Wm) rl28 Beverly pi Peeler Theo fctywkr r26 Bellevue rd Peeler Thos B (Jacquelin) v-pres DunlapPeeler Hdw Co r310 Nottingham dr Peeler Wm H (Della) restr 26 Bellevue rd Peeler Woodrow W fctywkr r26 Bellevue rd Peeples Grace Mrs millwkr Bibb Mfg Co rl222 2d Peveiplllees aWv m F (Mary) slsmn r205 VinePeete Vera (c) Indrs rl7 Buckner al Peggie Hale Dress Shop Mrs Willie M Davis mgr clo 560 Cherry Peirce Clifford E (Birta) slsmn h204 Berkley dr Pekor-Cook Jewelry Co (J Tom Cook) 603 Cherry Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? 1$ Answered By the Classified Business Lists In this Directory a 286 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Pell Anna V student r259 Orange Pell Louise sten r259 Orange Pell Sami B (Louise) nharm h259 Orange Pell Sami B jr elk r259 Orange Pennym'an Anna (c) h861 Edgewood av Pennymon Andrew (c; Annie) lab h267 Woodcliff Pennymon Chas (c: Leva M) lab h326 Pellew Jas H (Marion C) driver h301 Clayton (V) Green Pennymon Ernest (c) r210 Woodcliff Pellew John T elk Bibb Mfg Co r639 Forsyth Pellew Sarah sten Murphy Taylor & Ellis Inc h639 Forsyth Pelt Wm T (Eva A) millwkr Willingham Cotton Mill hll Randolph pi Pennymon Herman (c: Pearl) shoe repr r 119 Rockhill la Pennymon Jos W (c; Ella) h210 Woodcliff Pennymon Lizzie (c) r267 Woodcliff Pennymon Turner (c) waiter Frank Ma- Pender Durwood millwkr Willingham Cotton Mill rll8 (9) Holt av (NHts) Pender Jerry W (Maggie) carp h3205 Houston av (SM) this rll6 Rock Hill la Pennymon Wm (c) r210 Woodcliff Pennymon Willie M (c) Indrs r212 Wood- cliff Pender John (c: Ophelia) lab h923 (953) Ocmulgee Pentecostal Holiness Church 858 Hazel Peoples Aaron (c; Louvenia) lab Bibb Pender Lois waiter r3205 Houston av (S Mfg Co hlll9 (112) Woolfolk (EM) M) Pendleton Annie M (c) Indrs h204 Cedar (U) Pendleton Grady (Anita) fctywkr Happ Bros Co r656 New Pendleton Sallie P (wid Chas N) h311 Hlardiman av Pendleton Wm E (Stella) rep Equitable Life Assurance Society r233 Riverdale dr (I) Pendleton Willie baker Collins Baking Co rl21 Highland av* Pendley Janie L sten U S Dist Resettlement Admin r860 Mulberry Pendley Lilly (wid Wm T) r200 Melrose (B) Pendley Waymon D (Mavis) elk h200 Melrose (B) Peninsular Life Insurance Co Chas M Reddick agt 617 Mulberry R502 Penland Jos S student r403 Montpelier av Penland Mary N student r403i Montpelier av Penland Robt M (Mattie) trav slsmn h403 Montpelier av Penland Robt M jr r403 Montpelier av PPeennnn DFaannnl i(ec:DSaMrarsh)(Claubrlhe3y0T9o2pd Bavea(uUty) Shop) r756V2 New Penn Fannie M (c) maid r309 2d av (U) Penn Hulon E (Pauline) bkpr WPA Whse Pehnln02L8uCcilnindtaon(cr)drl(0E2M7 )Montpelier av Penn Margt Mrs librarian C S Reading Room r368 College PENN MUTUAL LIFE INSURANCE CO, Gny E Paine Genl Agt, 306-08 Grand Bldg 617 Mulberry, Tel 887 (For further information see page 20 Buyers' Guide) Penn Mutual Life Insurance Co (farm loan dept) Walter C McMillan farm loan supvr 409 2d R519 Penn Roberta (c) student r309 2d av (U) PennWmJjr (Hester H) sec hi 14 Beverly PePninell Mary student r421 Adams Penney J C Co Alf L Grubbs mgr dept store 362 3d; Pennington Claude L (Evelyn A) h420 Overlook av Pennington Leola (c) h478 Chestnut Pennington Willis (c; Hattie G) glazier Central Sash & Door Co h235 (237) Fargason (V) PENNSYLVANIA LUMBERMEN'S MUTUAL FIRE INSURANCE CO, Earle H Strickland Agt 201 Georgia Casualty Bldg 516-22 Mulberry, Tel 236 (For further information see back cover and page 19 Buyers' Guide) Penny Albert r21 3d Penny Andrew (c: Dollie) lab hlOO (2) Harris Penny Edith student r758 Cherry Penny Martha r758 Cherry Penny Minnie (wid Jas F) fctywkr h758 Cherry Pennyman Albert (c; Mary) lab hl04 (4) Frank al Peoples Geo A (c) porter r215 (393) Craft (V) Peoples Mary (c) maid h402 1st av (V) Peoples Oil Co Bobbie M Mullis sta mgr 301 Walnut Pepper Dr Bottling Co of Macon Arth L Nims jr sec bottles 650 3d Pepper Robt (c) lab r451 Collinsville la Percy Walter (Margt) ball player rl85 Magnolia Perdue Adrian student r774 Mulberry Perdue Alonzo (c; Sula) lab CofGRy h 369 3d av (N) Perdue Arth (c) loco firemn rl302 1st Perdue Chas A (Olive) mill wkr Atlantic Cotton Mills Perdue Chas H r8 Atlantic (Lucile E) Village dentist 150 Cotton av R303 hl06 Buford pi Perdue David P slsmn Mayo's r Sher- wood Hall (Mercer Campus) Perdue Dennis (c) lab CofGRy Perdue Jas W (Mary M) slsmn Fried- man's Jewelers r867 Mulberry Perdue Purdey (c; Addie) lab hl24 Powell OEM) Perdue Wm R (Mary E) ship elk Free- Pemrdaune-DWenint-nSiuelli(vc)ancoCook hhl2i264 NEolrmth av Perkins Albert (c) lab rll9 Edgewood av Perkins Annie (c) hl239 Dempsey av (U) Perkins Chas (c: Pinkie) lab hlQ3 Hicks al Perkins Chas W rl08 Forest av (B) Perkins Columbia (c) h566 Hammond Perkins Cora (c) cook r216 (159) Grant av (V) Perkins Daisy (c) cook rill Hicks al Perkins Emma (c) cook h410 Monroe Perkins Ernest (Lila M) mill wkr Willing- ham Cotton Mill rl06 American blvd Perkins Eunice tchr PS h523 Orange apt 6 Perkins Frances (c) Indrs h408 Mitchell al Perkins Geo (c; Ollie) cook r52 New Perkins Jasper (c; Leola) lab rl08 Sapp av (U) Perkins John J (c) lab r307 Dure (U) PeCrkoitntosnJoMhnillWs h(lA03nniBe)roloakbdWaleillainvgh(aBm) Perkins Lee (c: Nettie) lab h307 Dure (U) Perkins Leola (wid Edw L) hi 14 Forest av (B)' Perkins Lillie B (c) r566 Hammond Perkins Louis (c) lab r423 Damour la Perkins Lucy M student r821 (745) Fort Hill (EM) Perkins Lula (c) Indrs hl09 Neal av (V) Perkins Mabel (c) r566 Hammond Perkins Ollie (c) dishwasher Benj F Lyles r52 New Perkins Raymond D mill wkr Bibb Mfg Co rll4 Forest av (B) Perkins Robt (c; Manda) r7 Harris row Pe(rBki)ns Robt J fctywkr hl08 Forest av Perkins Robt N (Jimmye R) adv solr Ma- con Teleg Pub Co h533 Orange apt 15 Perkins Roberta (c) Indrs hill Hick's al Perkins Ruby L rll4 Forest av (B) 287 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Perkins Rufus (Pearl) mill wkr Bibb Mfg Co h56 (57) Davis (PM) Perkins ISallie (c) cook r48 Franklin Perkins Theda (c) r401 Waterville rd Perkins Thos (Gazelle) supt Natl life &Accdt Ins Co h906 College Perkins Wallace (c; Emma) lab hl625 (1245) Dempsey av (U) Perkins Wm (c; Ada) lab h401 Waterville rd Perkins Wm L (c; Annie) gro 821 (745) Fort Hill (EM) h do Perkins Wm O collr Sou Investment Co rl02 Cleveland av (V) PenrerinnbeSragraChoMr4M46rs WcaafestheirnigatomngraDv anPerritt Jas A (Lucile) h614 Arch Perry Ada M (wid Monroe) r203 3d av (S M) Perry Addie (c) h436 Tindall av (SM) Perry Albert (c) lab hll Harris al Perry Emily (c) student r70 Spring Perry Emmett r203 3d av (SM) Perry Georgia T (wid Chas T) rl08 First av (CP) Perry Gertrude (c) r221 (219A) Elliott (E M)' Perry Grace (c) rl2 (2) Cheatham al Perry Griffith elk Bibb Mfg Co rll7 Rogers av (V) Perry Irene (c) student r70 Spring Perry J Chester plmbr Macon Plmbg & Heating Co r RD 1 Perry Jas (c; Camilla) lab hi 10 (6) Ful- ton al Pnearrlyl Jas C (c; Minnie) carp rill TatPerry Jas C slsmn Boyd Shoe Store r806 Cherry Perry John (c; Mary) lab hi 17 Lynwood av (V) Perry John porter Clark Drug Co r70 Spring Perry John C (c; Esther) gro 70 Spring h do Perry Lee (Viola) elk rl24 Washington av Perry Lois (wid Hill) mill wkr r421 EdgePewrroyodMialvdre(dSMst)udent r307 Ridge av (V) Perry Nell L sec-treas Juliette Milling Co h81Q Mulberry apt 8 Perry Patsy (c) h86 (820) Cowan (EM) Perry Pearl (wid Ollie) h203 3d av (SM) Perry Robin T (Lula M) lab h206 Grand av (B) Perry Sara sten Puritan Candy Co r722 PeMrryulSbeprereyr (c; Ruth) pkr CofGRy hllO (98) Bay Perry Thos M (Nannie T) lawyer hl250 Montpelier av PPeerrrryy WWmarrFen(cf)ctcyhwakurf rr3l207(2R)idCgheeaavth(aVm) al Perry Wm L (c) emp CofGRy r709 (619) Prince (SM) Perryman Frances slswn F W Woolworth Co r2524 2d Pe2rdryman Henry C (Grace) cond h2524 Persall Nelda elk WPA r866 Mulberry Persall Pearl mill wkr Atlantic Cotton Mills r516 Oglethorpe Persley Thos K (c; Maxie B) agt h215 Madison Person Albert G (Eliz) r516 Elm Person Annie Mrs fety wkr Happ Bros Co ,,Perrls2o3n DVaiovliedt Pav(c:(LSMill)ie) barber John W Peeks h228 Roosevelt av (V) Person Eug G (Harriett) dispr h2215 For- syth rd Person John (c) rl35 Mitchell (EM) Person John W (c; Rosemond) lab r517 Calhoun Person Kathaleen (c) r3 Parker av Person Luther Cc) h3 Parker av Person Mollie O (wid Robt L) rll34 College dr Person Nathan (c: Annette) lab h051 Elm st la PPeerrssoonn USlpyossrets (c(c); rF2a55nnBier)oahdill(EMMi)tchell (EM) Person Wm D (c; Ora) lab hl524 1st Persons Alva G slsmn Ga Carolina Oil Co r569 Broadway Persons Alva G jr (Eliz A) asst ship elk Ga Carolina Oil Co r516 Elm Persons Dinah (c) maid h750 Center (E M) Persons H Pink (Ruth B) sec-treas R A McCord Motor Co hl22 Buford pi Persons Willie (c) maid r750 Center (E M) Petat Danl (Willie) mill wkr Bibb Mfg Co h63 Davis (PM) Peterman Ida (wid J Thos) r614 Church (CH) Peterman Nina elk r8ll Poplar apt 9 Peterman Oscar E (Gladys L) slsmn Cop- lan Junk Co h616 Church (CH) Peters Edora (c) cook r423 (474) 3d av (V) Peters Jas M (Wilora G) civil eng rl31 Cole Peters Lizzie (c) lndrs h244 5th av (V) Peters Peter (c) pdlr r331 Barfield al Peters Roy (c) tchr PS r244 5th av (V) Peters Thos (c) lab rl48 2d av (V) Peters Wm (c: Minnie) lab r353 Church al (SM) Peterson Frank (c: Maybelle) lab h214 Middle (V) Peterson Jas L loco eng h2916 Forsyth rd Peterson Jos (c) brk mason r542 3d av (V) Peterson Madeline (c) lndrs hl48 2d av (V) Peterson P E chef New Yorker r565 WalPenteurtson Thelma r810 Mulberry apt 8 Peterson Wm (c) h312 (2) Turpin Petrie Rose (wid Pascal) rll9 1st Petrolss Peter hlpr New Yorker r565 Wal- nut Pettey see also Peddy and Petty Pettev Lillie (wid Seth) h338 Ross Pettey Martha H (wid F Adolph; Mary Ann Beauty Shop) rll3 Nottingham dr KNH)` Pettey Noma L Mrs sten Bankers Health & Life Ins Co h287 Masonic Home rd (NH) Pettey Oscar D (Margt E) pntr h249 Belmont av Pettey Roby (Gussie) r338 Ross Pettey S Augustus (Noma L) mach h287 Masonic Home rd (NH) Pettigrew J Melton jr driver Yellow Cab Trans & Baggage Co r420 Newberry av Pettigrew John F (Mary) h225 (51) Maynard (EM) Petty Arth M (Mae M) store mgr Sterchi Bros Stores Inc h3708 Houston av (S M) Petty Arth M jr (Eliz S) slsmn Sterchi Bros Stores Inc rll50 Milledgeville rd (EM) Petty Beatrice tchr r3708 Houston av (S M) Petty Jas C (Murrie H) slsmn Sterchi Bros Stores Inc r3708 Houston av (S M) Petty Mary F student r3708 Houston av (SM) Petty Ruth student h3708 Houston av (S M) Petzinger Chas F (Mary A) genl formn CofGRy h742 Courtland av Peyton Thos J (Eunice) formn hl745 Broadway Pharmes Amos (c) porter Flanagan's Camp r Antioch rd Macon Federal Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Hankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume n. l. Poik & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 288 COMMUNITY SAVINGS & LOAN GO. 201 COTTON AVE. LOANS TEL. 6130 Pharmes Jesse R (c: Naomi) brkmn hi02 (170) DeBorde (SM) Pharr Tillmon I (Eliz) carp rl432 2d Phelps Alice (c) r418 Elliott (EM) FPhheellppss CAhmaoss(c(;c)Zepidnat)r lra2b57hl4lt3hSahvor(tVla) (EM) Phelps Claude (c) r313 Bowman, (EM) PPhheellppss EGtetoa ((cc)) lhalb08rl2(2012E) lmGreen (V) Phelps Glasco (c; Fannie) janitor h223 Price (V) Phelps Glasco jr (c) r223 Price (V) Phelps Gladys (c) r313 Bowman (EM) Phelps Jerry (c) lab r901 Ocmulgee Phelps Jessie (c) r313 Bowman (EM) Phelps Jos Rev (c: Edna) hl20 Elm Phelps Lill O (c; Emma) lab h418 Elliott (EM) Phelps Louise (c) r375 Flanders (EM) Phelps Louise (c) student r313 Bowman (EM) Phelps Lucille Mrs office sec Investment Syndicate rl30 Appleton av Phelps Mason (Lucille) bkpr rl30 Apple- ton av Phelps Richd (c) r313 Bowman (EM) Phelps Richd (c: Ophelia) lab Bibb Mfg Co h313 Bowman (EM) Phelps Wm (c; Ida) r710 Ash Phelps Wm (c) porter Anderson Clayton & Co hill Curd's al Phneultts Emma C (wid Rufus L) hl070 WalPhi Delta Theta Fraternity Wm Johnson pres 1219 Oglethorpe Philadelphia Hat Cleaning Co (Chas Chirbas) 607 Cherry Phillips A Maynard (Julia) phys 516 Mul- berry R818 hl09 Buford pi Phillips Abbie nurse 272 College r do Phillips Alf J student rl355 Edgewood av Phillips Alva L (Ethel) agt Natl Life & Aocdt Ins Co h206 Tatnall Phillips Annie Mrs rl08 Magnolia Phillips Annie L (c) maid rl23 Roosevelt av (V) Phillips Benj (e) lab r2 Bear's al Phillips Bessie (c) cook h203 Coles al Phillips C M plant supt Gulf Oil Corp r 371 1st Phillips Carrie (c) maid hl53 Moore al Phillips Chaney (c) hlOO (723) Waynes al (SM) Phillips Chas plmbr rl31 Culver (V) Phillips Clarence (c) lab hl24 (214) Frank al Phillips Clarence A (A Geneva) main- tenance supvr State Hwy Board Div No 2 h316% Cherokee av Phillips Daisy (wid Jas A) rill School (SM) Phillips David G mgr Macon Academy Music Co r216 2d Phillips Erin student r,109 Buford pi Phillips Ernest mill wkr Bibb Mfg Co r 758 Oglethorpe Phillips Eug G (c; Mamie) carp h712 Elm Phillips Eunice (c) maid hl642 1st Phillips Eva E (c) tchr PS r419 North (V) Phillips Fannie (c) rl32 (128) Maughon (V) Phillips Flutilla (c) maid r265 Cowan (E M) Phillips Garrett L (Gussie) elk Ga Power Co h318 Orange Phillips Harry (Ethel) elk hl024 2d Phillips Henry (c) porter r419 North (V) Phillips J Quinton (Mary M) janitor PS h285 Winship (WH) Phillips Jas (c) porter r436 4th av (V) Phillips Jos J (Fay) supt Sou Crate & Veneer Co h342 Suwanee av Phillips Joshua (c; Lillie) porter A G Rhodes & Son h209 Lincoln av (V) Phillips Leslie ri31 Culver (V) Phnilallilps Lionel A (Ethel S) agt h206 Tat- Phillips Lizzie (c).oook rll6 (196) Virgin (V) Phillips Maggie (c) cook hl23 Roosevelt (V) Phillips Martha (c) lndrs r925 (959) Ocmulgee Phillips Maybeth A Mrs fety wkr Hap Bros Co h661 Plum PhHilalippps OBrtoiss DCo(Mh6a6y1bePthlumA) fety wkr Phillips Robt lab rl31 Culver (V) Phillips Robt (Ola) mill wkr h56 (11) Roff Home pi Phillips Rosa (c) maid rl03 Braswell la PhlielgliepsdRr oy T appr CofGRy rll32 ColPhillips Sallie (c) maid h419 North (V) Phillips Virginia tchr PS rl31 Culver (V) Phillips Wade (Sarah) mach Happ Bros Co r671 2d Phillips Wm (c) r525 E 1st (EM) Phillips Wm (c) r408 Ward (V) Phillips Wm L Rev (e: Hattie) pastor Vineville Baptist Church h408 Ward (V) Phbilelrigps aWvm M (Mattie) inspr hll3 NewPhilm'an Homer (Thelma) brklyr hl22 Philmon Marvin P (Eliz) custodian Winship Sch h756 Montpelier av PhRilomcokyn TChroesekDr(dBeulah V) farmer h305 Philmon Willie B sten W Elliott Dun- woody ir r756 Montpelier av Philsori Lula (c) cook r205 Forest av (V) PhDinuarzeee(UH)'enry (c: Ledonia) lab h323! Phinazee Ida (c) lab r394 (376) Melrose (EM) Phoenix Chas (c: Carrie B) hl52 Lynwood av (V) Phoenix Mutual Life Insurance Co (mort- gage loan div) Andrew J Lyndon rep Ph4y0s9ic2iadnsR2R07egister Mattie P B,,lount registrar 130 High Pi Kappa Alpha Fraternity Chas Edward pres 103 Lawton av Pi Kappa Phi Fraternity 629 Adams Pickard H Frank OEliz) trans dept h911 Orange Pickens Tempie (c) r408 (467) Alabama Pickens Thos (c: Annie) lab h408 (467) Alabama (SM) Pickering Geo A (Willie P) shop formn Steve M Solomon jr hi 10 Mill av Pickern J Bennett Rev (Rheta) pastor hll36 College Pickett Annie (c) h550 Hazel Pickett Chas A gro 170 New hl49 Laurel av (NH) _ Pickett Clifford (c) lab r401 (300) Eliza- beth (SM) Pickett Eug W jr (Louise) lab h Clinton nr E River rd (EM) Pickett Eug W jr (Louise) mech Macon Iron & Paper Stock Co r RD 5 Clinton rd Pickett Ida elk Ga Power Co rl015 Clinton rd (EM) Pickett Ida W Mrs lhl015 ClinAton rd (E M) Pickett Jerry (c) swtchmn r550 Hazel Pickett Wm H elk Chas A Pickett rl015 Clinton rd (EM) Pierce see also Pearce Pierce Annie Mrs r453 New Pierce Bessie (c) dancer r290 1st av (V) Pierce Courtland T (Mary) wtchmn h302 Fairmont av (B) Pierce Eliz Mrs office sec Macon Dental Depot r380 Orange Pierce Emma (wid Chas F) h620 Pine Pierce Essie emp Snow's Lndry & Dry Clng Co ,, _ ... Pierce Estelle beauty opr Burden Smith & Co r453< New 289 M WOA * CON " ! Moving -PrnoPmnpat cFEffkincifeilnnt Sgervic-e Crating TRANSFER NEW AND USED FURNITURE CO. 408 BROADWAY PHONE 304 Pierce G T student r774 Mulberry PieSrtcJeamGeosrdaovn I(SinMsp) r Ga Power Co hl06 Pierce Helen (c) student r560 Broad (E Pierce Ira Cc * Annie) nlstr hl2'5 (541) PiScerjaAlbert (Melba) ship elk McNair Lbr & Supply Co r854 New Pierce Jas (c) lab r405 (332) Elizabeth Pierce John E hdw 412 Poplar h423 New Pierce Lewis (Lena) barber 102 Melrose (B) h do , Pierce Lucia rl02 Richmond Pierce Manson C (Ins) custodian Mercer Univ h624 Adams , , . Pierce Martin (c) hi 10 Moccasin Slide Pierce Minnie (wid Chester) smstrs r2109 Pinkston Alex G jr student rl242 Edge- wood av . , ... Pinkston Alf (c: Katie) janitor h32o 4th Pinavkst(oVn) Alf ir (c) porter Willis Bros- PiwnkeslltoBnaArbsebrurSyho(cp; rA32n5ni4ethB)aylab(VY) ates & Tabor Co hllS Sycamore (V) Pinkston Beatrice (c) tchr r325 4th av (V) Pinkston Gordon (c: Leila) lab h360 Hazel Pinkston Johnnie M (c) maid r307 Mon- Pinkston Leo (c: Darnell) lab h216 Far- gason (V) , , . ,,,,,, ,,, Pinkston Lucille (c) student r325 4th av (V) Pinkston Martha (c) r502 (453) Alabama PifrcifNathan A (Lillian) lab hl02 Rich- Pinkston Mary (c) cook 231 Stanislaus cir rl09 (197) Richard (U) Pierce Wm (c) porter r237 Jones Piercey Alex (c) barber Brown's Barber Shop hl40 1st av (V) Piercy John H (c) porter r377 Monroe Piercy Sophia E (c) maid h377 Monroe Pinkston Wiltielmina (c) cook h704 Center (EM) Pinson John H (Anna) sta mgr George Service Station r3901 Houston av (SM) Piper Bernard H elk USPO r RD 1 Pierson see also Pearson Piper C Beatrice millwkr Atlantic Cotton Pierson Horace Rev (Maudie) r568 Wal- Mills rl08 (303) Pinkerton al Piper Wm D rl08 (303) Pinkerton al Pierson John S (Willie) sismn h706 Woolfolk, av PPiippkpiinn JAolhzandsais(mc)n sNtuudIecnytBr3o6tt7linMgoCnrooe Pierson Stoke (c: Mattie) lab h719 (705) Pippin Laura Mrs slswn r309 Peachtree Elbert (SM) _ (EM) Pig 'n Whistle Sandwich Shop (Jas B Bryan) restr 605 Georgia av Piggly-Wiggly Macon Co Robt H King- man jr pres Malcolm E Everett v-pres J Holland Brown see-treas (office) 464 2d; Branches: 209 Cotton av Lake cor Fbearirrymo4n7t4avan3d58 1H00a7rde2md a8n18ava4n5d8 M19u1l3- Vineville av (V) Pilcher Alton F student rl02 Grace av (SM) Pilcher Carma tchr PS r RD 3 Pilcher Elsie fctywkr Happ Bros Co r328 Columbus Pilcher Frances (wid Jas) r307 Duncan av Pilcher J Alton (Mary W) filling sta 444 Vine (NH) h307 Duncan av Pilcher Julian R tmkpr rl02 Grace av (S M) Pilcher Reuben V (Sara) hlpr Ga Power Co r2838 Houston av (SM) Pilcher T Roger (Susie E) auto mech hl02 Grace av (SM) ,, Pilcher Vivian I office sec Dr Chas W Boswell r414 Jackson _. , Pilcher's Service Station (J Alton Pilcher) 918 Napier av , , _ Pilgrim Health & Life Ins Co (c) Henry Wynne agt 527% Cotton av Pilot Club of Macon Mrs Betsy Ross sec 200 Baconfield (NH) Pindar Geo A (Mary) lawyer 403 Cherry R705 r Jeffersonville rd Pindar Mary R Mrs lawyer 403 Cherry R705 r Jeffersonville rd Pine Isaac (c: Marie) lab hl09 (171) De Borde (SM) , Pine Wm (c: Susie) mill wkr Bibb Mfg Co r315 (45) E 2d (EM) Pinholster Danl F (Margt) cond h753 1st Pinholster Jas C (Mary) stmftr hll2Q College dr ,, Pinholster Raymond A mgr John F Class Vapopath Inc r753 1st Pinkens Willie (c) r303 Elbert (SM) Pinkerton Jos H (Lilia) tchr r417 (418) Log Cabin dr Pinkerton Mattie (wid Peter H) hl23 Log Cabin dr Pinkerton Peter F (Sally) eng rl23 Log Cabin dr Pinkerton Robt A (Marion C) elk h212 (215) Log Cabin dx Pinkerton Roy H (Marie) elk Lester A Thomas rl23 Log Cabin dr Pippin Lawrence sismn rill 2d Pippin Lillian asst Arth W Chaplin r380 Orange ,, . Pippin Marie Mrs mach opr Dixie Roll & Cot Co Inc hl05 Capitol av (Mikado E 2d (EM) Porter Loraine Mrs slswn Maysons Wom- en Apparel rl47 Rose pk PoMrt)er Love (c) r911 (844) Maynard (E Porter Lucile (c) lndrs h801 (181) Col- auitt POHTaterrt sMMarovrintuaBry (hD50a3isyGReo)rgieamabvalmer Porter Mozella (c) hl2 Harris Porter Pauline (c) maid r911 (844) May- nard (EM) Porter Reba student r503 Georgia av Porter Roxie F Mrs rl206 Ash Porter Roy (c) r911 (844) Maynard (EM) Porter Thelma (c) student r9ll (844) Maynard (EM) Porter Tommie L mgr G R Kinney & Co r221 Georgia av Porrlitl,3eJ TCPaYd,abwM ayrs (vV-)pres Cook's Beer Co Porter W Riley (c) loco firemn h509 (476) Alabama (SM) Prater Widie (c: Annie) waiter h534 Flanders OEM) Porythress Elwin (Dorothy D) store mgr r407 Forsyth Posey Editha M waiter Union News Co r 418 Belmont av Po(sSeMy )Jos (Ethel L) lab hl30 Concord Posey Leonard (c: Leila) hall Hotel Lan- ier r220 Powell (EM) Fosev Oscar C dispr MD&SRR h556 PoBseoyulRevoabrtdE ((NFHra)nces W) vehiclemn Ry Exp Agcy rl09 Clayton (V) Post M Davis (Jewel J) emp CofGRv h .227 American blvd POST OFFICE (See United States Gov- ernment) r327 Calhoun POSTAL TELEGRAPH-CABLE CO, Pope Wm C (c: Annie) hill Wise av (V) Fredk B Gabriel Mgr, 451 Cherry, Tel Poplin Annie L (c) rll6 (366) Craft (V) Popped Beulah M Mrs gro 1650 Broadway 362 Mam St,TEealesgt rMapahc,onB,rTanelch641O6ffice h do Posted Lizzie W (wid Jehu G) r856 Mul- Podpoped Jack E jr gro 828 Main (EM) h berry Postelle Minnie (c) r309 Jefferson Poppell Winnie fctywkr Happ Bros Co Postey J E carp r5l:l Broadway h754 Cherry Popper Harry S (Blanche) lab h231 PoWteoaotelfoWlkm(E(cM; )Ehiora) lab hl2U (110) Stanislaus cir Potter Bertha (c; Bertha) maid Lemer Popper Harry S .ir student r231 Stanis- Shops h806 Edgewood av laus cir Potter Jas I (Eva) fctywkr h224 Forest Is Answered By the Classified POPPER JOSEPH W, Lawyer 604 Georgia Casualty Bldg 516 Mulberry, Tel 1376, h300 Vista cir (Ingleside), Tel 174 Popper Peggy student r231 Stanislaus cir Popper Steve gifts 186 Magnolia r231 Stanislaus cir Porch Leon D (Clara D) phys 516 MulPobreterrryBRu8s1t0erhl(4c0: 3MOagryle)thloarbpeh805 (788) Crisp (SM) Porter Clarence (c) lab h407 Chestnut Porter Claudie (c) rl2 Harris Porter Clinton C (Toy B) pres Cooks Beer Co rll3 Callaway (V) Porter Danl F student rl206 Ash Porter Dicie (c) r225 Calhoun Porter Edith (c) maid r349 Middle (V) pa(tEv|eMr()BR) Green (Eva) pntr hi15 Myrtle pPottttss Carlton student rll8 Glynn av Clarence P auto mech M Carlton Sheffield r RD 3 PottsClyde E bottler Nu Icy Bottdng Co r333 San Juan av Potts Julian (lEffie) mach CofGRy hl'18 Glynn av P O 2 CC3LO5. CD t/> CD A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Preister Wyman J (Bessie C) ins agt h 19a Belmont av Prentiss Otis G (Mary j) frt agt Southern Ry System h401 Carling av Prentiss Wm C r401 Carling av Prescott Mary rl06 StJames av (SM) Prescott Thos E (Annie) emu CofGRy hlOO Harrold (SM) Presley Julia nurse 860 New r do Pressley Harry M (Clara B) inspr hl05 (135) Colquitt Preston Cassie (c) r345 Bookers al 'Preston Chas M (Odille T) h227 Bond Preston Cornelia r203 Fairview av (EM) Preston Della (c) h601 (269) Prince (SM) Preston Fredk (c) pdlr h345 Bookers al Preston Henry C (Nancy W) fctywkr Happ Bros Co hl014 Hazel Preston Jas E (Ruth M) asst supt Cen- tral Cotton Oil Co hl58 Hugenin av Preston Jas E .ir elk Bibb Mfg Co rl58 Hugenin av Preston John G (Eliz) radio eng S E Broadcasting Co h540 Courtland av Preston Leola (c) hl426 (234) Ardvines al Preston Maxine slswn h233 Bond apt 7 Preston Oscar lab h306 Rutherford av (SM) Preston Pearl Mrs r233 Chappell (SM) Preston Queen E (wid Laurence E) r610 Church (CH) Preston Robt (c: Annie) emp CofGaRy h 1060 Hazel Preston Sarah L student r227 Bond Preston Thos 6 (Effie) pipeftr h203 Pair- view av (EM) Preston Tony (c: Dollie) lab h54 Scho- field (V) Preston Walter IE (Maude) appr Taylor Iron Wks & Sup Co h233 Chappell (SM) Preston Wm E r306 Rutherford av (SM) Price Ada Mrs instr Ballard Normal Sch r520 Clinton (EM) Price Alma (wid Edgar) smstrs Union 'Drv Gds Co r2516 2d Price Bessie (c) cook rl9 (427) Sparks al Price Bonnie L (c) r753 Ash Price Daisy (c) epok r201 2d av (U) Price Emma L (c) tchr Hazel Street Sch r520 Clinton (EM) Price Eva (c) lndrs h80:l Curd (SM) Price Geo (c: Minnie) lab hllO (100) Richard (U) Price Gilbert (Cora) millwkr Bibb Mfg Co hl63 Clinton (EM) Price Hattie (c) hl015 Elbert (SM) Price Henry (c) tchr r520 Clinton (EM) Price Hollis (Sonora) millwkr Bibb Mfg Co h221 (1) Flanders (EM) PPrriiccee IIrsmraaelM(crs; sEmhsat)rslar6b2:7h2M12aiNn o(rEthMw)est Boundary Price J Marvin (Willie M) loco eng h724 Pine Price Jas T (Ann E) sub sta opr Ga Power Co h209 Newberg (SM) Price Julia P h276 Campus (WH) PRICE L B MERCANTILE CO, Thos R Stewart Mgr, House Furnishing Goods, Blankets, Bed Spreads and Floor Coverings, Etc, 650 2d Price Laura C Mrs mgr The Eleanor Shop h533 Orange apt 10 Price Library Park Orange cor 1st Price Lola L Mrs r209 Newberg (SM) Price Lottie M (c) tchr PS h520 Clinton Price Louis (c) driver r267 Davis al Price Lula (c) h!23 Holmes av (V) Price Mamie (wid Sol) h301 Center (EM) PRsIeCrvEatMorAy,RIrA45, 1DiCetoiltlieagneWesleyan Con- Price Mary (c) lndrs h228 Lynwood av (V) Price Mary (c) maid h313 (327) 1st av (V) Price Mary L (wid Sylvester B) h225 High Price Millie r221 (1) Flanders (EM) Price Minnie (c) lndrs r306 Ward (V) Price Patk H r654 Hawthorne Price Rosa (c) cook h211 Pond (V) Price S B Free Library Mrs Hattie White .librarian 903 1st Price Sami J T (Mary L) business mgr Mercer Univ h296 College Price Thos (c: Sallie) lab Central Sash & Door Co hl24 Concord (SM) Price W A (c; Ada) tchr r520 Clinton (E M) Prichard Chalmers student Ga Academy for the Blind r RD 1 Box 71 Bremen Ga Prichett John (c) r202 Douglas av (V) Pride Mamie (c) hl8 (420) Stein's al Pridgen Elaine r351 (227) Vista cir Pridgen Guardrow (Helen R; Mutual In- vestment Co) h351 (227) Vista cir Priest Maudie L Mrs rl514 2d Priester Chas E (Mae) vd cond MD&SRR h803 Walnut Priester Pretto L (Eva) slsmn Home Furnishing Co r213 North av (NH) Priester Wyman J (Bessie) supt Natl Life & Accdt Ins Co rl95 Belmont av Primitive Baptist Church (c) 110 2d (U) Primus Gus (c; Nettie) wtchmn r9 5th av (V) Primus Isaac (c; Lilia) lab h'150 Lincoln av (V) Primus Mary (c) lndrs hl09 5th av (B) Prince Ben.i (c; Mattie) hl28 Concord (S M) Prince Chas S rll09 Oglethorpe Prince Eddie M Mrs elk Atlantic Cotton Mills rl05 Heard av (SM) Prince Essie M (c) r822 Elbert (SM) Prince Floyd (Eddie M) rl05 Heard (SM) Prince Jas ticket agt rl37 Magnolia Prince Jas C lab r286 Roff Home av (V) Prince Jas M slsmn Prince Produce Co r 555 2d Prince Marie r286 Roff Home av (V) Prince Sylvanus elk hll09 Oglethorpe Pringle Ernest (Virginia) pntr h203 2d av (SM) Pringle Robt L (Pauline) supt h475 Spring Prister Lillian Mrs r701 Anderson (SM) Pritchard Chas usher Capitol Theatre r 103 Stratton (SM) Pritchard E Hanson (wid Louis N) h5 Dessau pi Pritchard Harriet dept mgr Burden Smith & Co r5 Dessau pi Pritchard John lab rl03 Stratton (iSM) Pritchard Mollie (wid John T) hl03 Strat- ton (SM) Pritchard Regina sec Community Sav & Loan Co rll7 Crescent av (CH) Pritchett A P elk r371 1st Pritchett Bessie (wid Thos W) rl03 Ross Pritchett Claudius P tractor repr 444 Pine r Lamar Pritchett Claudius T (Gladys) mach hl24 Lamar (V) Pritchett Constance student rl58 Jeff Davis (SM) Pritchett Davis junk rl426 2d Pritchett Doris F student rlOO Flamingo dr Pritchett Davis G (Bibb Auto Wrecking Co) rl426 2d Pritchett Eknilv Mrs slswn F W Wool- worth Co r!100 (190) Melrose (B) Pritchett Emory B (Emily) elk rlOO (190) Melrose (B) Pritchett Eug B mach CofGRy r440 Ross Pritchett Henry T (Mary L) inspr hlOO Flamingo dr Pritchett Howard hill Enterprise (SM) Pritchett L Eug (Flov M) mill wkr Bibb Mfg Co hl08 Gant (EM) 295 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 Pritchett Luther P (Louise) carp hl58 Jeff Davis (SM) Pritchett Mary E (wid Frank R) hl426 Pr2idt.chett Rachael (wid John L) h440 Ross Pritchett Roy L ins rl09 Alabama av (V) Pritchett W F driver r510 Mulberry Pritchett Walter H (Blanche) carp hlOO (190) Melrose (B) Pritchett Ward student r440 Ross Pritchett Wm P (Mary E) barber Robt G Stripling r RD 5 Pritchett Wm S (Florence) ms agt hl09 Alabama av (V) Prize Bessie L (c) r202 (423) Plummers al PrimzeerMs aarly L (c) cook r202 (423) PlumProctor Daisy M (c) r98 (201) Toombs (S M) Proctor Edmond r355 Walnut Proctor Geo D (Hesser) mach CofGRy h 411 (460) Burton av Proctor Jas (c) h98 (201) Toombs (SM) Proctor Leola (c) h404 Mitchell al Proctor Lizzie (c) maid h228 Moughon (V) Proctor Robt E (Bessie) loco eng hll9 Flamingo dr Proctor Ruby E sten r319 Hardeman av (V) Progressive Life Insurance Co Wallace A Yeomans supt 617 Mulberry R309 Pruden Nona (c) elk Lucius J May h555 Monroe Prudential Insurance Co of America Stanley K Tanner asst mgr 516 Mulberry R301-06 Pruett Edaar (Lillie) r600 Main (EM) Pruett Elijah L (Mary) h601 Main (EM) Pruett Evelyn lab r327 Hydrolia (EM) Pruett Geo E (Eunice C) mill wkr Bibb Mfg Co h839 Hazel Pruett Henry (Sallie) h327 Hydrolia (E M) Pruett Ira A (Ada) mill wkr Bibb Mfg Co hl09 Yates av (EM) Pruett Jack mill wkr Bibb Mfg Co r327 Hydrolia (EM) Pruett Jos F (Geraldine) slsmn McCormick Deering Store h401 College apt 6E Pruett Norman (Ruby) mill wkr Bibb Mfg Co r327 Hydrolia (EM) Pruitt Evelyn pickers Macon Peanut & Stge Co r327 Hydrolia (EM) Pruitt John student r314 College Pruitt Louis (Josephine) mill wkr Bibb Mfg Co r763 Cherry Pryor Beatrice (c) student rl701 Broadway Pryor John (c) driver hl701 Broadway Pryor Otis (c: Amanda) pdlr h338 Hammond Pryor Ridley H student r719 Anderson (SM) Pryor Ridley R (Jewel) barber Palace Barber Shop h719 Anderson (SM) Pryor Robt (c) cook Dixie Cafe & Commissary Pryor Sydney (c: Addie) h344 Hammond Puckett Beni C bkpr Riverside Lbr Co r Walden Ga Puckett Bessie Mrs slswn Held's Dress Shop mi 14 Ninadell dr Puckett Clyde C linemn Ga Power Co r Skipperton Ga PPuucckkeetttt JHoellocJo (Eenllgenr) Cauatpoitoml eHchoter7l16 Mulberry Puckett Mary opr SBT&TCo r RD 3 Skipperton Ga Puckett Otis (Ruby H; Puckett's Beauty Salon) r RD 2 Puckett's Beauty Salon (Otis Puckett) 125 Cotton av Puckette Angie E casewkr City Dept of Public Welfare r308 Cherokee av Pugh Amanda (c) cook h230 Jones Pulham S J (c) roofer rl07 Rose Crest av (SM) Pullen John (Susie) lab r270 Main (E PuMllein S J porter Ga Roofing & Sup Co Purlll0e7ns REomsemcraes(tc)avmaid rl29 (119) Lyn- wood av (V) Pullens Wm (c) lab hl29 (119) Lynwood av (V) Pulliam Bonnie J tchr r409 Adams Pulliam Bonnie J Mrs tchr PS h409 Adams Pulliam Margt student r409 Adams Pulliam Robt L (Bonnie J) tchr PS h409 PuAlldiaammsRobt L jr student r409 Adams Pulling Gottrey (c) h'lpr Macon Auto ISxch r635 Elm Street la Pulling Norman (c: Mattie) porter The Texas Co h637 Elm st la Pulling Press (c; Annie M) hlpr Macon Auto Exch r635 Efim st la Pulling Vincent student Ga Academy for the Blind r Axson Ga Pullins Willie (c) maid r3 Gunn's la (V) Pullum Denny (c) lab CofGRy Pullum Wm (c: Annie) lab hl019 EdgePuwllouomdnavElisha (c; Annie) porter rll6 Bartlett's la Puritan Candy Co (Clarence E Havnaer) 655 Poplar Purnell Dempsey (c: Willie) lab h503 Flanders (EM) Purnell Dempsey jr (c) student r503 Flanders (EM) Pudrenresll (GEMen)eva (c) student r503 FlanPurnell Jas (c: Lizzie) hl20 (237) Clara (EM) Purnell Lula M (c) tchr r503 Flanders (EM) Purnell Ruth (c) tchr r503 Flanders (E M) Purnell Willie M maid r426 (423) Peach- tree (EM) Purnelle Laura (c) r303 (301) E 1st (E M) Purser Dollie Mrs h95'5 Elm Purser Hudson (Leola) mill wkr Bibb Mfg Co h64 Davis (PM) Purser Robt S (Mamie) gro 651 Elm h 653 do Pursley see also Persley Pursley Frances (wid Ciscero) rl03 Brookdale av (B) Pursley Frank student Ga Academy for the Blind r RD 6 Pursley Sami C (Lila) h627 Adams Purvis Alice nurse r530 College Purvis Ernest (Lucille) mill wkr Bibb Mfg Co h860 Hazel Purvis Rube (Nonie) h837 Main (EM) Putnam Amanda Mrs hl234 College dr Putzel Isadore (Rose) sec-treas Morris Putzel Inc h.521 Georgia av Putzel Milford S (Ida B) sec-treas Cop- lan Junk Co Inc r870 Orange Putzel Morris pres Morris Putzel Inc r521 Georgia av Putzell Morris Inc Morris Putzel pres Isadore Putzel sec-treas elec equipment 519 Cherry Pye Findley H (Maude) agt Pilgrim Health & Life Ins Co r225 Chestnut Pvles Annie fety wkr Happ Bros Co r789 PyMlesonLtpelealniedr darviver McKesson-Riley Div r RD 2 Quaintance Geo (c; Mamie) lab hll4 Hicks al Quarterman Allie Mrs slswn Globe Dress Shop h801 Main (EM) Quarterman Cora L (wid Jas) r801 Main (EM) Quarterman David r801 Main (EM) qr ^ co i-< o 2. n> If 3 at cL . { g g 8 B s r PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 296 AUTHORIZED DEALER R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 Quarterman Evelyn fcty wkr r801 Main (EM) Quarterman Jas N (Allie) barber Bate- man's Barber Shop h801 Main (EM) Quarterman ffm (c; Janie) r7 Ross st Qunal rtiman Vivian Mrs rl22: Academy Quatlebaum Wm P (Mary A) driver r756 Mulberry Quave Victor L (Evelyn) phoxtog ,, Dan- nenberg Co h753 Pine Quick Judson (c; Emma) lab h40S Cow- an (EM) ,, Quick Mabel (c) 54 Montpelier av 299 WILLINGHAM SASH & DOOR CO. Lime -- Roofing -- Cement - Plaster 457 Third St. Phones 277-278-279 Read Russell P (Bessie M) adv solr Ma- con Tel eg Pub Co hi 16 Park pi Read Russell P jr adv solr Macon Teleg Pub Co rll6 Park pi Reagan Ellen (wid Emmett R) office sec Trust Co of Ga r200 Burton av Reagan Frank (Ann) lawyer 107 Culver Re(aVg)anhJedsosie B Mrs pkr Stansell Potato Chip & Sandwich Co r902 Orange Reagan Ralph E (Jessie B) slsmn Wil- lingham Loan & Trust Co r902 Orange Reagan Robt W elk First Natl Bank & Trust Co r200 Burton av Realty Investment Co Leon S Dure pres Wm V Davis sec-treas real est 321 Mulberry Ream Donald K (Helen) h'854 Ridge av (V) Reams Marjorie (c) maid h3 (152) Bright al . Reasonover Jason G servicemn Natl Cash Register Co r569 Broadway Reaves Madie P (c) tchr Green St Sch hl54 Lincoln av Reaves Seine (c) rl54 Lincoln av (V) Red Front The (Clyde F McCook) beer 452 Poplar Redd Butler (c; Smittie) porter King- man & Everett Inc hl05 (128) Bow- man "(EM) Redd Chas (c) r405 Madison Redd Ernest jr (Marjorie) mgr Liberty Natl Life Ins Co h209 Berkley dr Redd Jewel Mrs picker Macon Peanut & Storage Co rll9 Garden (EM) Redd Lula (c) restr 405 Madison h do Redd Percy R (Ollie M) hlpr City Water Wks Shop h320 Randolph (EM) ReWddateRr aWymksonSdhoDp rl(lJ9ewGeal)rdehnlp(rEMC)ity Redd Thelma student r320 Randolph (EM) Redd Wm D (c) barber John W Peeks r405 Madison (V) Redden Jos student r629 Adams Reddick Alton h219 Reid (SM) RReeddddiicckk CAhnansieM (acg) t mPeanidinsrul3l1a3r L1ifset Ins Co r306 Washington av RReeddddiicckk FFrraannkk(c(;c)Elllaa)b hC72o2fGHaaRwythorne Reddick Fred (c; Willie) lab CofGaRy r722 Hawthorne Reddick Gene (c) r432 Coles al Reddick Homer (c; Willie D) lab CofGa Ry h764 Ash Reddick Homer E (c) r764 Ash Reddick Isaiah (c; Irma) lab h!69 Tel- fair Reddick Joshua (c; Eddie L) lab hl06 Lynwood av (V) Reddick Mariah (c) lndrs hl313 1st Reddick Marjorie (c) student r501 For- syth Reddick Paul T (Maude) teleg opr h306 Washington av Reddick Wade (c) waiter r501 Forsyth Reddick Wm J (c) r764 Ash Redding Addie (c) lndrs rl06 (6) Frank al Redding Arth (c) lab h405 (417) Bay Redding Arth F (Pauline) millwkr Bibb Mfg Co h906 New Redding Bell (c; Lizzie) lab Taylor Iron Wks & Supply Co rl233 Broadway Redding Clarence (c) lab rl233 Broad- way Redding Edw (c; Anna) h500 (21) Hall (EM) Redding Edw jr (c) r500 (21) Hall (EM) Redding Edw B (Virginia) asst to mgr Phoenix Mutual Life Ins Co h209 Corbin av (V) Redding Elijah (c; Melissa) janitor AlSihoh Temple hl06 Mutual av (V) Redding Eliza (c) h608 Fort Hill (EM) Redding Florence (c) maid r379 Board- man's al ,, , Redding Frances (c) cook r334 Board- man's al Redding Gladys (c) maid r608 Fort Hill (EM) Redding Henry (c; Ella) lab hl08 (567) Randall al (NH) Redding Jas (c; Jane) pnttr ,, hlOO 5th av Redding Jas T (Jessie) hlOl Buford pi Redding Janie (c) lndrs h208 Collins pi Redding Lannie M (c) lndrs r49 Chest- nut la Redding Laura (c) cook r51 Chestnut la Redding Lena (c) lndrs hl06 (6) Frank Readlding Margt (c) lndrs rl20 Neal av (V) Redding Mary D (c) maid r608 Fort Hill (EM) Redding Mattie (c) cook h51 Chestnut la Redding Mattie M nurse 280 College h do Redding Maude r211 Corbin av (V) Redding Melissa (c) student rl06 Mutual av (V) Redding Mildred sten r763 2d Redding Nannie D (wid Chas A) r280 College Redding Robt (c) h410 Ward (V) Redding Salome r280 College Redding Thos (c; Beatrice) lab h For- syth rd Redding Virginia H student r209 Cor- bin av (V) Redding W C Lumber Co (Wm C RedReddidngin)g 4W07mB(rco)adh2w1ay(12R)1S6 hort (EM) Redding Wm (c) car clnr CofGaRy Redding Wm (c; Lizzie) lab hl233 Broadway Redding Wm C (Georgia L; W C Red- ding Lumber Co) h722 Forsyth Reddy Arzado G (Gladys) city firemn h342 North av Reddy Arzado G train caller h433 Boule- vard (NH) Reddy Eliz (wid Oscar E) millwkr r654 Plum Reddy Leola r433 Boulevard (NH) Reddy Lucy r433 Boulevard (N:H) Reddy Nisbet P slsmn Dixie Dairies r433 Boulevard (NH) Reddy Racey L Mrs fctyyrkr Happ Bros Co h303 Chappell (SM) Reddy T Geo (Mattie) eng MD&SRR hl25 Garden (EM) Redging Bertha (c) lndrs h218 Lee (EM) Redley Chas L (Ann K) phys hl35 North "av (NH) Redmond Annie (wid M G) h840 College Redmond Arth (Ella M) lab Taylor Iron Wks & Supoly Co r.417 Bay Redmond Benj F millwkr Bibb Mfg Co r31 (30) Taylor av (EM) Redmond Ella S elk Union Dry Gds Co r402 American blvd Redmond Jesse H (Rose) maintenance mn hll59 Napier av Redmond John L (Helen G) bkpr WU TelCo r402 American blvd Redmond Jos H (Effie T) h402 Ameri- can blvd Redmond P Karl printer Macon Even- ings News r402 American blvd ReTdumrponind Rlaay(T()c; Viola) lab hill (190) Reece see also Rees and Reese Reece Amanda (c) r255 1st av (V) Reece Benj (c; Sarah) lab h409 (333) Anthony (TO Reece Cornelia Mrs fctywkr Happ Bros Co r620 1st Reece Edw (c; May) lab h211 1st av (U) Reece Lizzie (c) hill Lynwood av (V) Reece Robt (c) lab r409 (333) Anthony (U) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume ft. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 300 Who Sells It? IS Answered By the Classified Lists In this Dhectory FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Reece Willie (c) Indrs hlOO (204) Roberts (U) Reed see also Read and Reid Reed Ada (c) cook rl39 Roosevelt av (V) Reed Addie (c) Indrs h860 Hurley la Reed Annie D (c) maid r609 (241) Hall (EM) Reed Benj (c; Hattie) fctywkr hill 4th av (B) Reed Esther (c) student rl20 (80) Bay Reed H J (c) driver Jacob Hirsch rl231 Broadway Reed Hattie (c) h609 (241) Hall (EM) Reed Hattie (c) Indrs rl20 (80) Bay Reed John (c) auto mech h205 (2) 3d av (B) Reed John B (Sallie) pres Safety Cab Co r27 Progress Reed Lewis (c) lab h208 Fretwell al Reed Lillie (c) maid h227 5th av (V) Reed Martha (c) r518 Clinton (EM) Reed Mollie .(c) Indrs hl34 Brooklyn av (S) Reed Nancy (c) rl04 (133) Bay Reed Ola M (c) r609 (241) Hall (EM) Reed Ruffin (c; Laura) h207 Mutual av (V) Reed Sallie Mrs emp Snow's Lndry & Dry Clng Co r732 Wings al Reed Sarah (c) cook r205 (2) 3d av (B) Reed Sarah (c) Indrs r609 (241) Hall (EM) Reed Thos O (Lillian A) pntr hl25 Emory av CSM) Reed Wm (c) lab r609 (241) Hall (EM) Rees see also Reece and Reese Rees Albert W Rev (Augusta) hill La- mar (V) Rees Prances rill Lamar (V) Rees Lee rill Lamar (V) Reese see also Reece and Rees Reese Rebecca (c) maid hll3 Clara (EM) Reese Roberta (c) lab Idle Hour NursReeersieesSrRFicohrdsymthillrwdkr rl02 Reese (EM > Reese Vacelle (c) cook r364 Robinson rd Reeves Albert (c; Julia) elev opr hl4l 1st av (V) Reeves Augustus (c; Sallie) h605 (406) Crisp (SM) Reeves Callie (c) tchr r258 Broad (EM) Reeves Chester R filling sta 1163 Mil- ledgeville rd (EM) h do Reeves David (c) r804 (440) Hall (EM) Reeves Edgar lab rl56 Palace av Reeves Ela (c) rl436 Broadway Reeves Ellie Mrs rll4o Clinton rd (EM) Reeves Emma (c) Indrs h455 Colquitt Reeves Emory slsmn rill 2d Reeves Eug farmer r432 Log Cabin dr Reeves Floyd (c) student r804 (440) Hall (EM) Reeves Frances (c) h525 Plant al Reeves Frank (c; Lillie' M) lab h21Q (270) Campbell av (SM) Reeves Georgia rll40 Clinton rd (EM) Reeves Grady (c; Gertrude) pntr h220 (163) Grant av (V) Reeves Herman M (Edna) slsmn Dunlap Chevrolet Co h544 Log Cabin blvd Reeves Iola Mrs hlU7 Napier av Reeves J W (Virginia J) vehiclemn Ry Exp Agcy rl30 Summit av Reeves Jas elk Nipper's Pharmacy r2405 Re2edves Jas (c) student r404 Cowan (EM) Reeves Jas C pdlr r871 3d Reeves Jas L Rev (May) hll7 (120) Crisp (SM) ReleinvsespJiohn (c; Emma) lab h228 Col- Reese Aaron (c; Alice) lab h533 Pio Reeves John, B (Dora K) pntr hl50 Nono av (V) i Highland av Reese Carlton (c; Mamie) hlpr CofGa Ry h334 Hammond Reeves John H (c) lab r605 (406) Crisp (SM) Reese Charlie M (c) student rl04 (303) Craft (V) Reeves Jos J (Eva) formn r706 2d Reeves Judge (c) lab rll9 (11) Tinsley Reese Charlotte (c) Indrs h311 (315) la Burnett (EM) Reeves Kath elk rl50 Highland av Reese Clarence (c; Lucy S) janitor First Reeves Laura (wid Jas T) h!56 Palace Natl Bank bldg h608 (595) Cowan Reeves Leonora (c) cook h211 Madison '(EM) Reeves Lillian (c) student r404 Cowan Reese Clarence (c) lab r859 3d (EM) Reese Clarence (c) shoe shiner Macon Reeves Louis (c) lab CofGaRy Hat Clng Co r268 Brief (PH) Reeves Milton .(c) lab CofGaRy r4 White Reese Clarence jr (c) elev opr Bibb Mfg al (SM) Co r608 (595) Cowan (EM) Reese Claude' mach Bibb Mfg Co rl823 Reeves Mollie (c) Indrs h230 Collins pi Reeves Oscar (c) lab r605 (406) Crisp ReBesreoaDdworaay (wid Sowell R) r660 Walnut Reese Eddie rl02 Reese (EM) Reteosne F(Vlo)rence (c) Indrs hl7 (119) ClayReese Florine (c) cook hll9 Clayton (V) Reese Garvin ins agt r221 Georgia av Reese Geraldine (c) student r402 (486) 'Clinton (EM) Reese Hester (wid Wm W) hl05 Forest av (B) Reese Irene Mrs rl24 Hines ter (V) Reese Jas P (Eloise) elk City Stockade r5 Dessau pi Reese Jas R farmer rl02 Reese (EM) Reese John E Rev (c; Myrtle F) pastor Stewart Chapl A M E Church h653 Spring Reese Julia A (wid Wm M) r218 North av (NH) Reese Julian hlpr Ga Power Co Reese Luther (c) lab rllO (231) Turpin (T) Reese Maria (c) r809 Ash Reese Mary smstrs Burden, Smith & Co rl02 Reese (EM) Reese Mary S (wid Wm H) hl02 Reese (EM) Reese Neal (c) lab h227 Chappell la Reese Nora (c) hll2 (268) Brief (V) (SM) Reeves Pearl Mrs rl532 3d Reeves Ralph student r2405 2d Reeves Raymond A (Mabel A) slsmn Buck Ice & Coal Co r426 Ridge av Reeves Robt (c; Marriett) lab h413 Haw- thorne Reeves Robt F driver Dixie Dairies rll7 ' (120) Crisp (SM) Reeves Ruby (c) student r404 Cowan (EM) Reeves Seaborn, (c) r230 Collins pi Reeves V Ruth student rll7 (120) Crisp (SM) Reeves Wm (c; Viola) carp h404 Cowan (EM) Reeves Wm (c) lab r455 Colquitt Reeves Wm H (Mary) lieut Ere Dept h2405 2d Reeves Wm S jr (c) fctywkr Bibb Mfg Co r804 (440) Hall (EM) Reeves Wm S Rev (c; Essie) pastor Salem Baptist Church h804 (440) Hall (EM) Reeves Zeke (c; Essie) porter Robt L Stevens filling sta r224 Antioch rd ReCfuoser4L02eoC(hAulrlcehne)(EmMil)lwkr Bibb Mfg Regero Frank (Hortense; Regero & Regero) h515 Boulevard (NH) 301 >h-. A. T. HOLT CO. e n REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 ReWgearsohiRngotsoen (Ravegearpot &5 Regero) hl09 Regero Wm E electn Arnold Torch r211 3d Regero & Regero (Prank and Rose Re- gero) jwlrs 370 2d Register Bernice L (Mary) slsmn r911 Vineville av (V) Register Edgar W elk S H Kress & Co rl29 Rembert av Register Ellie M bkpr Dr Wyatt B Childs r494 Orange Register Lonny L student r201 Pierce av (V) Register Lucile Mrs hl08 (104) Dewitt (EM) Regiser Otto P (Fannie S) cash Ga Power Co hl29 Rembert av Register Wm P elk r371 1st Rehfeld Prank W (Ida) slsmn Gutten- berger Music Shop hl28 Merritt av Re^ichard Evelyn E bkpr Met Life Ins Co r540 Washington av Reichert Fredk W (Willie S; Macon Elec Co) h811 Cherry Reichert Ophelia A (wid John W) hl04 Hill Crest av (CH) Reid see also Read and Reed Reid Amos G (Ella M) h314 Belmont av Reid Arcelus (c) lab rl26 (26) Glen (EM) Reid Benj (c; Emma L) fctywkr Bibb Mfg Co r559 Smith row Reid Bertha (c) hll4 (1235) Tracey's la Reid Cleone smstrs r710 Anderson (SM) Reid Clyde B (M Prances) vehiclemn Ry Exp Agcy rl37 Park pi Reid Effie Mrs millwkr r240 Ross Reid Essie (c) maid r310 Plant (SM) Reid Eulah B Mrs smstrs Snow's Lndry & Dry Clng Co h664 Walnut Reid Eva M (c) r607 (207) Charles (SM) Reid Prances elk rl37 Park pi Reid Frances (c) lndrs r603 (274) Crisp (SM) Reid Geo (c) student rl05 (361) Edison (EM) Reid H M & Co (Harry D Chapman, H Merton Reid) whol lumber 617 Mulberry R203 Reid H Merton (Lois M; H D Chapman & Co) h331 (393) Hill Crest av (CH) Reid Henry (c) lab rl05 (361) Edison (EM) Reid Henry J (c; lama) chauf rl232% Broadway Reid Ida B (c) h319 (310) Burnett (EM) Reid Isaac (c; Bertha) porter DunlapPeeler Hdw Co h414 (516) Maynard (EM) Reid Jacob C brklyr h317 Reid (SM) Reid Jas (c) student rl05 (361) Edison (EM) Reid John (c) r607 (207) Charles (SM) Reid John (c) lab CofGaRy Reid John (c) lab h310 Plant (SM) Reid JOhn (c; Lottie) lab h402 (313) Plummers al Reid John ,(c) lab h274 (358) White al (SM) Reid_Jdhn H (c) barber Geo W Hatfield jr h964 Pio Nono av (V) Reid Jos (c; Clara S) lab Ga Power Co hl25 (602) Bartletts la Reid Katie prsr Crescent Lndry Co rl23 Bowman Reid Leah (c) cook h410 (557) Henrietta (SM) Reid Lenzy (c) lab CofGaRy Reid Lewis (c; Kate) pntr hl23 Bowman (EM) Reid Lillian M (c) tchr rl04 New Reid Lindsey (c; Ondia) lab rl81 (325) Nussbaum (SM) Reid Lloyd (c; Mary) lab h822 Edgewood Reid Lois M r314 Belmont av Reid Louise (c) maid r310 Plant (SM) Reid Lovie (c) butler h rear 417 Ridge av (V) Reid Lucy (c) maid hl07 E Ell Reid Maggie M (wid John N) smstrs r 710 Anderson (SM) Reid Mann (c; Mary) lab h607 (207) Charles (SM) Reid Marjorie L student r331 (393) Hill Crest av (CH) Reid Mary (c) maid rl23 (215) Danne- berg av Reid Melba sten r818 2d Reid Ollie (c) lndrs hl26 (26) Glen (E M) Reid Omer M (Prances E) pntr h205 (202) Hydrolia (EM) ReHideaRltohbt&WLif(ec;InTsheCroesah)531agMt oPnilrgoreim Reid Robt W jr (c) student r531 Monroe Reid Roy C student r664 Walnut Reid Ruby M (c) maid rl05 (361) Edi- son (EM) Reid Susie (c) lndrs rll3 Neal av (V) Reid Thos (Mary) slsmn h818 2d Reid Thos L (Marie) ship elk Happ Bros Co rl36 Cole Reid Voyger C (c) delmn Coleman's Pharmacy r417 Plant Reid Walter T (c; Mary L) hl04 New Reid Wm (c; Sallie) hlQS (732) Waynes al (SM) Reid Wm (c; Minnie) lab r763 Ash Reid Wm (c) lab r607 (207) Charles (SM) Reid Wm (c) lab r406 Mitchell al Reid Wm L (c) rl07 E Ell Reid Wm L (c) student r414 (516) May- nard (EM) Reid Wm T (Eula B) h664 Walnut Reid Wm T jr auto meeh r664 Walnut Reilly see also Riley Reilly Henrietta G Mrs h855 Mulberry apt 106 Reinhart Nellie sten r727 Walnut Reinhart Sallie (wid Jos) h727 Walnut Rekab Lester L (Sophia) mach hlOlO Richmond av Reliable Cab Co (Robt C Franklin, Wm P Haynes) taxi service 552 2d Reliable Cash Market (Carl Grotenstein) gros 2643 2d RELIABLE OUTFITTERS, Ben Gold- man Mgr, Ladies' and Men's Clothing, Millinery, Hats and Shoes 572 Cherry, Tel 2056 Reglleieford Rebecca (c) cook h807 OcmulRembert Jas (c; Janie) lab hl238 Broadway Rembert Jeffie (c) student r91T Edgewood av Rembert Wm (c; Victoria) h917 Edgewood av MAILING LISTS Complete Accurate for Any Locality Write for Catalog Rembley J student r774 Mulberry Remington Rand Inc Benton J Trawick mgr office supplies 516 Mulberry R104 "Mailing Lists Rendals Teola (c) cook r855 (856) 3d av (V) That Puli" Renew Annie M student Ga Academy for the Blind r RD 2 McRae It's Free Renfroe Arth J (Virginia) slsmn hl08 McDonald av (V) Reknifnrsoe(SCMal)vin elk Wm C Liles r305 Jen- R. L. POLK Renfroe Carolyn J cash Friedman's Jewelers r904 Boulevard (NH) & GO. Renfroe Carrie J h904 Boulevard (NH) Renfroe Conrad bkpr First Natl Bank & Directory Trust Co r904 Boulevard (NH) Renfroe D Leone sten Met Life Ins Co r533 Orange apt 14 Publishers Detroit, Mich. Renfroe Ernest (c) r601 (600) Fort Hill (EM) Renfroe Forest (Leola) fctywkr Bibb 1 Mfg Co h216 (56) Clinton (EM) Renfroe Geo r904 Boulevard (NH) Renfroe Hattie (c) lndrs h2 South Boun- I We make up Special Lists dary < 302 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY RONDS Telephone 1811 Renfroe John W (Van) trav slsmn r533 Orange apt 14 RReennffrrooee LLeuocnieusstNen (hM53a3ryOr(aMncgNe)apctar1p4 CofGaRy h305 Jenkins (SM) Renfroe Sula (c) h453 Hazel Renfrow Fred (c; Clifford) lab hl54 (243) Forsyth la Renitz Benj B (Haddye D) lawyer 216 2d h do Renitz Haddye D Mrs law librarian Bibb County h216 2d Rentz Edgar (c; Leona) h201 Hazel Rentz John H yd cond MD&SRR r574 Boulevard av Respess Anna B tchr FS rl39 Highland RESPESS E ROY, Dentist 606 Georgia Casualty Bldg 516 Mulberry, Tel 4817, rl39 Highland av, Tel 4097-J Respess Mary F (c) maid rl21 Gordon (CH) Respess Wm (c) h510 Hammond Respess Wm (c; Annie L) lab r303 (205) ReWssaeateurvJiollse Srd(Fannie J) lab Ga Roofing & Sup Co r443 Jackson Rett Louis E (Mary) tilestr hl7 Marion pi (WH) Revell Edgar L (Ellie) hl02 (301) Pinkerton al Revell John E rl02 (301) Pinkerton al Revels Lillie M Mrs hl531 Broadway Revere Lula (c) r425 Cedar (U) Rex Beer Garden The' (Robt E Ogbum) 451 Broadway Rex Optical Co (F Clark Davis) r504 Mulberry Reynolds Adele (c) h4 Wall st la Reynolds Andrew (Mattie B) pntr hl022 Hazel Reynolds Annie B (c) cook h204 (278) Astor (EM) Reynolds Annie P sten rl04 (168) Cherokee av Reynolds Chas B (Martha) plmbr r235 Washington av Reynolds Cora B student rl24 Garden (EM) Reynolds Doris tchr PS rl33 Virginia av Reynolds Earl e (Josie M) emp CofGa Ry hl33 Virginia av Reynolds Ester L (Sallie M) floormn Union Dry Gds Co h217 Ormond ter Reynolds Evelvn rl24 Garden (EM) Reynolds Gladys student rl33 Hines ter (V) Reayvno(lSdsMG) ladys Mrs smstrs hl24 Violet Reynolds Gladys M (wid Julian C) mgr Darling Shop hl33 Hines ter (V) Reynolds Harry E slsmn r216 Magnolia Reynolds Isaac (c; Cath) lab h2 Moore al Reynolds Jas (Jewel) h235 Washington av Reynolds Jean (wid Wiley L) h630 Church (CH) Reynolds John (c; Georgella) h74 Spring Reynolds John (Rosa L) millwkr Atlan- tic Cotton Mills r25 Atlantic Village Reynolds Julian C elk MD&iSRR rl33 Hines ter Reynolds Kate rl24 Garden (EM) Reynolds LeRoy F (Eunice M) ins agt hl27 Rembert av Reynolds Lonnie (c; Elmira) hlO Ber- thadale dr (V) Reynolds Lucy W (wid Wilber T) h309 Peachtree (EM) Reynolds Mayola (c) student r422 North (V) Reynolds Mildred A waiter Union News Co r418 Belmont av Reynolds Nellie M mus tchr 216 Magno- lia h do Reynolds Otha B (Una) millwkr Wil- lingham Cotton Mill r221 Duncan av Reynolds Paul I (Eliz S) asst dept mgr McKesson-Riley Div r518 Johnson av (HH) Reynolds Ralph (c) mach r313 2d av (V) Reynolds Robt (c) rl018 Broad (EM) Reynolds Robt car clnr CofGaRy Reynolds Robt D (Gladys) driver h809 Clinton (EM) Reynolds Rosa (c) maid r312 Jefferson Reynolds Ruby millwkr Bibb Mfg Co r 231 Washington av Reynolds Ruby Mrs r257 Heard (SM) Reynolds Schofield (c) porter Ry Exp Agcy r254 Middle (V) Reynolds Susie gro 950 (892) Montpelier av h do Reynolds Virginia (c) r700 (620) Cowan (EM) Reynolds Wm F (c; Rosa) car clnr C ofGaRy h520 E 2d (EM) Reynolds Willie M (c) maid h50 (1) Cheatham al Reynolds York (c) rl52 (154) Middle (V) RhcihnaensanWmMo(tco;r JCanoieh)32l4abBAridgahmt s-lBa uRhodenhiser Alton E (Virginia) rl30 Fort Hill (EM) Rhodenhiser Roy B (Vallie; Palm Bar- ber Shop) and chiropodist 316 2d h 1344 College Rhodenhiser Roy B jr agt Life Ins Co of Va rl344 College RHODES A G & SON, Howard C Neblett Mgr, Complete Line of Furniture, Easy Terms, "The House of Service" 357-63 2d, Tels 337-338 (For further information see left top lines and page 15 Buyers' Guide) RHMOoDtoErSPCarLtsARCEoNrpC, Eh4C57(SCtheellraryMa)v,,PTreesl 3823-W Rhodes Edw (c; Mollie) brklyr hl07 6th av (B) Rhodes_ Ethel lndrs Crescent Lndry Co r722 Daisy (SM) Rhodes Genevieve (wid Jos A) hl29 Cleveland av (V) Rhodes Herbert B fety wkr McAfee Candy Co r517 Georgia Rhodes Herbert B jr fctywkr McAfee Candy Co Rhodes Iverson (c; Mamie) emp Sinclair Refg Co h442 Gilmore Rhodes Johnson J (Alma J) cond h50S Edgewood av (SM) Rhodes Josephine (c) h4 3d st la Rhodes Lyman (Lena J) trav slsmn h208 2d Rhodes Wallace (c) lab r206 (104) Plummers al Rhodes Wm J slsmn rl29 Cleveland av (V) Rhodes Willie D (c) supvr WPA sewing dept r210 3d av (V) Rhome Frank lab r451 Center (EM) Rhome Shad (c) lab r713 (621) Prince (SM) Rhone Geo (c; Annie) lab hl9 (427) Sparks al Rhymes Lamar (c) porter American Bakeries Co Rhymes Mattie (c) lndrs hl06 (250) Railroad av (V) Rialto Theatre H Vernon Johnson mgr motion pictures 173 Cotton av Ribbon Clifford (c) bellmn Hotel Grady h347 (449) Alabama (SM) Ribbron Mack D Rev (c) h347 (449) Alabama (SM) Rice Benj (c) lab r952 Broad (EM) Rice Chandler (Ida) millwkr Bibb Mfg Co hll7 Comer ter (PM) Rice Chas W r Hotel Fielding Ric(EeMC)larence M (c; Ida) lab h954 Broad Rice Claude (c) delmn John R Churchill rl99 Elliott 303 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 RidceanEu(gEM(c); Mattie) lab hl09 (8) JorRice Evie (wid John) hl52 Bailey av (CH) Rice F Eliz r505 Bailey av (CH) RRiiccee GFaenonCie ((Ecl)iz)lndslrssmhn31h12125d Vaivsta(TJc)ir RiAcegcGyeoh4W62 (cB;roBaldanc(hEeM) )porter Ry Exp RibceerrGyerltarude (c) lndrs h30 (15) MulRice Henry (c) lab rl32 Norris (EM) Rice Jas (c) porter Webbs Place rl32 Norris (EM) Rice Jessie prin Winship Sch r214 Hines RRiiccee JJuulniaenr7(1c8) l3adb rl32 Norris (EM) Rice Kannon K (Daisy M) plmbr hl53 Bailey av (CH) Rice Linwood (c) rl32 (229) Norris (EM) Rice M Irene millwkr rll2 Branch (CH) RiBceurMkea1 rCthoa h3G71MSrspripnrgoofreader J W Rice Maybelle (c) lndrs h509 Coleman al Rice Minnie F r533 Orange apt 8 Ric(Ee MM) oses (c) farmer hlOOl Ballard Rice Moses (c; Carrie) porter Webb's Place hl32 Norris (EM) Rice Paul B lab h306 Center (EM) Rice Strouthers A (Sallie) millwkr Bibb Mfg Co h54-55 Davis (PM) Rice Thos (c; Leona) hl06 Elm Rice Wade W (Ruth) plmbr h505 Bailey av (CH) Rice Walter r505 Bailey av (CH) Rice Wm J (Martha G) restr 312% Main (EM) h371 Spring RilcieerWaivnnie K (c) lndrs h920 MontpeRich Bessie student r2833 Houston av (SM) Rich Dennis '(Bessie M) fruits 2835 Houston av (SM) h2833 do Rich Walter L electn Eves Electric Co r RD 3 Richard John (c) hl32 Coleman al Richards Carson (Dorothy S) elk h613 1st Richards Ella (c) r439 Patterson (NHts) Richards Fredk E r453 Ash Richards Geo M (Olive) slsmn hl04 Summit av (NH) Richards Herman (c) lab Small Animal Clinic r353 Chestnut Richards Jas (c) rl23 Sycamore (V) Richards Jas (c; Julia) lab h933 Pio Nono av (V) Richards Lonnie C (Addie N) carp hl539 3d Richards Lonnie C jr appr Macon Teleg Pub Co rl539 3d Richards Manuel (c; Missouri) lab h439 Patterson (N Hts) Richards Mary (wid Warren W) h453 Ash Richards Mildred L sten Macon Teleg Pub Co rl539 3d Richards Thos J pntr Co ofGaRy Richards Vesta S Mrs nurse County Bd of Health rl86 English av (V) Richards Wilmer E (Clayton) mech Adams-Buchanan Motor Co h200 Thomas Richardson Adrie K sten r569 Broadway Richardson Alf R (Eleanor; Richardson Engraving Co) r461 Broadway Richardson Anne C student r315 (359) Cherokee av Richardson Annie (c) h640 Pebble (SM) Richardson B L r315 Mulberry Richardson Bernice r201 College pi Richardson Burt P (Ora A) prof Mercer Univ h375 Orange Richardson Chas (c) lab CofGaRy Richardson Chas (c; Georgia) lab hl41 (121) Nussbaum (SM) Richardson Chas H meatetr Barnett Chanin r201 College pi Richardson Chas H (Anne S) phys 700 Spring R330 h315 (359) Cherokee av Richardson Chas H jr student r315 (359) RiCchhaerrdoskoene Eavdw (c; Ruby) lab Taylor Iron Wks & Sup Co h362 Bay Richardson Elmo A (Eliz; Richardson Produce Co) r202 Ridge av Richardson Emma J Mrs sten Jones Johnston Russell & Sparks h261 Georgia av apt Cl Richardson Engraving Co (Alf R Richardson) 461 Broadway Richardson Florence Mrs collr rill (173) Cherokee av Richardson Frances student rl06 Pierce av (V) Richardson Fredk H (Opal E) bkpr h201 Hill Crest av (CH) Richardson Henry J (Minnie) agt Pilgrim Health & Life Ins Co h511 Clinton (EM) Richardson Howard r201 College pi Richardson Ida (c) lndrs hl23 Woodcliff Richardson Jas (c; Mabel) driver hll7 Hilliard al Richardson Jas (c) lab CofGaRy Richardson Jas (c; Willie) lab h239 ColRilcinhsardpsion Jas D (Martha I) meatetr Barnett Chanin hl240 College dr Richardson Jas M tchr Lanier High Sch for Boys r Rivoli dr Richardson Jas T (Allie R) sergt in chge U S Recruiting Office h853 Cherry apt Ri3chardson John C (Lona L) elk Bibb RiMchfagrdCsoonh3K37ateAdaomffisce sec J Hook Spratling r569 Broadway Richardson Kath tchr PS r201 Hill Crest av (CH) Richardson Kirby A (Emma J) reprmn Ga Power Co h261 Georgia av apt Cl Richardson Lula (c) r7 (128) West Boundary Richardson Lumber Co Wm R Richardson pres Ernest P Stone sec-treas 409 2d R505 Rihc2h0a4rdsPoienrcMe aackv W(V)(Helen) trav slsmn Richardson Mary maid Hotel Southland r402 (463) Alabama Richardson Mary H mus tchr 201 Hill Crest av (CH) r do Richardson Maude (c) h3Q9 Elbert (SM) Richardson Milton supvr WPA r Wesleyan dr Richardson Minnie (c) maid h407 (725) Campbell av (SM) Richardson Otha (c; Hattie) lab rl35 Pecan av Richardson Otis (c; Henrietta) lab hll7 (13) Frank al Richardson Pearl (c) lndrs 7 (128) West Boundary Richardson Pearl (c) maid rl Barnhart's Bottom Richardson Pompey B (Aigna M) elk h 420 Cleveland. (ISM) Richardson Produce Co (Willoughby L and Elmo A Richardson) 617 Poplar Richardson Rhea W (Josephine) phys 516 Mulberry R904 h2516 Forsyth rd Richardson Robt (c) lab h703 Guernsey la Richardson Squire (c; Willie) h806 Maynard (EM) Richardson Stewart S student r315 (359) Cherokee av Richardson Vera (c) lndrs rl23 Woodcliff Richardson Volia (c) student r806 Maynard Richardson Wm (c) porter r233 Telfair DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES - and Canada These are for your convenfenee If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 304 J. GUY JACKSON, General Agent GUARANTEE MUTUAL LIFE CO. Purely Mutual Legal Reserve Old Line Company--Organized 1901 Third Floor First National Bank Bldg. Telephone 1142 Richardson Wm C (Eula) gro 343 (437) Alabama (SM) h do Richardson Wm P elk MD&SRR r367 College Richardson Wm R (Mamie E) pres Richardson Lmbr Co h911 Vineville av (V) Richardson Willoughby L (Gillie; Rich- ardson Produce Co) hl06 Pierce Riehenbecker Thelma elk h855 Mulberry 403 Richey Nora (c) Indrs rlOl (57) Davis la Richmond Hotel (c; Gertrude Smith) 319% Broadway Richter Geo L (Lillian) millwkr Happ Mfg Co hl82 Laurel av (NH) Rickenbaker Jos student r427 Forsyth RRiitccekkmeernsbro8an5k5eBrMilTluihele1blrem8r1ray2 sten 3d Sou Ry Sys- RiTckraernssofnerJaCso (c) Mabel) driver Macon Rickerson Mellie (wid Geo) h267 Wash- ington av Ricketson Jas E tchr Lanier High Sch for Boys 102 Ryals av Ricketson Jos E student rl02 Ryals av Ricks Clarence missionary rl21 Summit av (NHL Ricks Emmett (c) barber Jas A Braswell h367 (344) 3d (U) Ricks Geo (c) r414 Gilmer Ricks Geo E (Beatrice) slsmn h412 Bur- ton av Ricks Geo E jr carp r412 Burton av Ricks Jack (c; Willie M) lab hl058 Ocmulgee Ricks L C (Mary) supt r440 Ross Ricks Leila (c) cook h254 4th av (V) Ricks Lucius inspr Bibb Mfg Co r412 Burton av Ricks Penrose waiter r361 1st Ricks Roy (Mildred) fctywkr Happ Bros Co r870 2d Ricks Roy A student r412 Burton av Ricks Sallie B (c) h413 Maynard (EM) Ricks Vernelle student r412 Burton av Ricks Wm J (c) r413 Maynard (EM) RiDddryle GLdesonCoGr7(5L9ou1isste) ship elk Union Riddle Leon G jr r759 1st Riddle Louise Mrs buyer Union Dry Gds Co r759 1st Riddle Willard r759 1st Riddley Lula M (c) maid h417 (541) Hen- rietta (SM) Rider Emmett (c) mach hlpr CofGaRy Ridgeway Marjorie typist WPA r763 2d Ridley Addie (c) Indrs hl52 (154) Middle (V) Ridley Anderson (c) porter Wm C Liles r5 Short Ridley Anne (c) Indrs h229 (112) Dis- roon al Ridley Annie (c) Indrs hl08 Walls al (NH) Ridley Annie M (wid Leonard) elk Union Dry Gds Co r340 Columbus Ridley Chas L (Annie K) supt Macon Hosp and jjhys 820 Pine hl35 North av Ridley Chas L jr student rl35 North av (NH) Ridley Edith L (c) r422 Peachtree (EM) Ridley Elmore (c) porter rl52 (154) Mid- dle (V) Ridley Hamilton B (Kate) city firemn h Ri6d1l6eyFoHrasmytphton (c) porter rl04 (22) Davis al (EM) Ridley Hattie rl31 (122) Wood al Ridley Kate student rl35 North av (NH) Ridley Lee (c; Eliza) hlOO (69) Walls al (NH) Ridley Mary (c) maid h909 Ash Ridley Mattie (c) Indrs hl07 (12) Stripling al (EM) Ridley Nathan R Rev (c; Pearl) h'511 (527) Maynard (EM) Ridley Nelle student r340 Columbus Ridley Rubin (c) driver h901 (913) Qcmulgee Ridley Tass (c; Maggie) rl04 (22) Davis al (EM) Rieger Mary F (wid Wm E) hl344 College Ries Irma W hl972 Walnut Rigby Robt (Sallie) h219 Ell (SM) Rigby Taylor lab r219 Ell (SM) Riggins Adolphus Z (Lorene) mach rl90 Magnolia Riggins ArCh (Ruby) janitor Georgia Casualty Co r5 Franklin st la Riggins Danl (c; Mary) lab rll7 (525) Craft (V) Riggins Danl jr (c) lab rll7 (525) Craft (V) Riggins Edgar G (Cora M) lab h334 Clin- ton (EM) Riggins Jesse (c; Annie) lab hl213% Broadway Riggins Mary L (c) cook r704 3d av (V) RIGHT WAY FINANCE CO (Harvey B Bloodworth), 3 Hardeman Bldg 105 Cotton av, Tel 6 Rigley Frank (Lucile) fctywkr Bibb Mfg Co rl30 Ell (SM) Rigsby Marjorie (c) maid r406 1st av (V) Riley see also Reilly Riley Anna (c) h704 (695) Hall (EM) Riley Anna (c) Indrs h321 Smith (EM) Riley Anna L (wid Wm W) smstrs h5S0 Hemlock Riley Arth (c; Annie) lab Macon Milling Co h659 Hazel Riley Carl E (Katie J) hlpr City Water Wks Shop r219 Duncan av Riley Chester E (Lizzie) millwkr Bibb Mfg Co hl46 Comer ter (PM) Riley Clarence M (Queenie) millwkr Bibb Mfg Co h30 Brigham Riley Clayton H millwkr Willingham Cotton Mill r315 Dannenberg av Riley Cleve (c) r214 Fretwell al Riley Danl (Lucy M) mach CofGaRy h 128 Holt Riley David H r2207 Forsyth rd Riley Dorothy M Mrs sten City Dept of Public Welfare h261 Georgia av apt D1 Riley Edith C (wid Wm) h93 Arlington Ripleiy Edw (c; Susie) lab h214 Fretwell al Riley Eliz r656 College Riley Elvira (c) smstrs r704 (695) Hall (EM) Riley Emma (c) hl07 (141) Gibson av (SM) Riley Emmett (c) lab h216 Plant (SM) Riley Emory W (Emma L) collr Union Dry Gds Co h258 College Riley Eug (c; Clara) ydmn hl02 5th av (B) Riley Fannie (c) h466% Cotton av Riley Frances student rl28 Holt Riley Frank H (Eunice P) slsmn Swift & Co rl234 S College Riley Frank L r2207 Forsyth rd Riley Fred (c; Mary) lab hl96 Tindall av (SM) Riley Henry H (Ruth M) h2207 Forsyth rd Riley J Augustus r768 Cherry Riley Jas (c; Lizzie) lab h551 Telfair Riley Jas T (Ann L) slsmgr ColemanMeadows-Pate Drug Co h658 Forsyth Riley Janie student rl28 Holt Riley Jeanette S Mrs tchr Ga Academy for the Blind rl501 Vineville av Riley Jos B jr v-pres McKesson-Riley Div r656 College Riley Jos T jr (Carolyn M) slsmn A S Hatcher Co h213 Corbin av (V) Riley Julia C (wid Jos B) h656 College Riley Langston (c; Alma) lab hl017 Edgewood av Riley Lee (c; Alice) pdlr h4 Berthadale dr (V) 305 MOTOR PARTS CORP. Complete Part* Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 6X9 THIRD ST. PHONE 4800 Riley Lee H student rl234 College dr Riley Louise student r756 Mulberry Riley Mamie (wid Chas) millwkr Bibb Mfg Co hill Green (PM) Riley Melissa (wid David) r315 Dannen- berg av Riley Mildred (c) r704 (695) Hall (EM) Riley Mildred (c) lndrs rl08 Wyche (S M) Riley Nonie gro 976 Montpelier av h978 Rivers Geo (c; Virginia) lab hll3 (100) RiTvoernsg Glaussie (wid Henry) h38 (,102) Randolph pi Rivers Henry (c; Susie B) uphol h509 3d av (V) Rivers Homer (c; Gussie) lab hll4 5th Riv(Ver)s Jasper (c; Ella) cook h231 2d av Rivers Kath (c) asst supvr WPA r509 3d av (V) Riley Oliver M (Dorothy M) drftsmn Dennis & Dennis h261 Georgia av apt Rivers LeRoy (c; Janie) janitor h.100 (20) Kahn's al Rivers Lillian B (c) student r509 3d av RUinegy OCsocarhl(7c; ESlhbirelrety)lalab(SMMa)con MillRUey Sami (c) lab r441 Chestnut RiMleyooSreamhil2H36(ECssoileleMge) dmreat ctr Jas C Riley Vincent (Annie; Green Front) h Ri1le0y01 VMirognintpiaelibekr parvr93 Arlington pi Riley Willie M (c) lndrs h320 Madison Riley Wise S (c; Bertha) h226 Jordans al (SM) Riner Ollie Mrs r511 Forsyth Rines Albert J (c) lab CofGaRy Rines Dock (c; Lizzie) maid h306 Wood al Ring Chas (Emma) slsmn hl48 Glynn RiHngewnodoedrsoJans ((ScM; O) phelia) labh202 (703) Ringwood Lee (c; Ella) hll4 Wyche (S M) Ringwood Lucius (c; Millie) h201 (7) Mason (SM) Ringwood Maggie (c) h527 E 2d (EM) Ringwood Martin (c; Idella) lab r201 (7) Mason (SM) RiWngawyonoeds Palink(eSyM)(c) lndrs rl07 (128) Ringwood Robt (c; Ophelia) lab h.712 Charles (SM) Ringwood Sallie (c) h203 (408) Thomp- sons al Riordan Fred H (Frances) inspr CofGa Ry hl06 Alabama av (V) Riordajj Russell M (Levada) mach C of Ga Ry hl20 Tyron blvd Risby Beulah (c) cook rl30 Sycamore (V) Risby Charlie W (c; Fannie L) driver Kinnett-Odom Co hl08 (106) Long la Risby Embry (c; Beulah) pntr hl30 Sycamore (V) Risby Kathleen (c) maid r308 Douglas av (V) (V) Rivers Louise asst prof Wesleyan Col- lege Rivers Margt (c) h579 (575) Siam (EM) Rivers Mark E (Maude; Rivers & Cham- bers) hl62 High Rivers Mattie (c) r231 2d av (V) Rivers Mollie (c) r305 E 2d (EM) Riv(EeMrs)Norman (c) lab r579 (575) Siam Rivers Odessa (c) lndrs Crescent Lndry Co rl05 Bostic la Rivers Owens (c) rl55 Broad (EM) Rivers Rosetta R tchr Wesleyan Con- servatory r451 College Rivers Sami (c) lab r608 Flanders (E M) Rivers Thelma (c) student r231 2d av (V) Rivers Walter H (c; Annie B) h517 Chappell (SM) Rivers & Chambers (Mark E Rivers, Woodfin C Chambers) filling sta 500 Cotton av Riverside Arena (Chas H Morgan) danc- ing 615 Ocmulgee RIVERSIDE CEMETERY, Campbell T King Supt, Madison ne cor Jones, end of College, Tel 1816 Riverside Ice & Coal Co Herbert J Pizer mgr 5th at Bridge Riverside Lumber Co (Jas W Young) ft Poplar Rivoli Dairy (Geo F Greene) New Col- umbus rd _ ,. Rivoli Riding Club (Stepp F Wade) Ri- voli dr Roach Collis W (Helen) carp r748 Montpelier av Roach Eliz (wid Alex) h216 Calhoun Roach Fleming mill wkr Willingham Cotton Mill r216 Calhoun Roach Mary E overseer Crescent Lndry Co r216 Calhoun Ritchey C Moses (c; Edith) hlpr CofGa Ry h403 (300) Cowan (EM) Ritchie Milton L (Alma I) cable splicer SBT&TCo hl20 (55) Highland av (LC Hts) Rittenberry Annie (wid Jas W) h806 2d Rittenberry Annie V (wid Edgar) rl03 Coleman av (CH) Rittenberry Elgin B student rll4 Boule- Roach Melvin mill wkr Willingham Cotton Mill r216 Calhoun Roaks Claude waiter r905 Cherry Robarts see also Roberts Robarts Wm G (Harriet) ins agt h291 Masonic Home rd (NH) Robb Jos S (Clelie) slsmn hl02 The Prado (I) Roberson see also Robertson vard (NH) Rittenberry Harry (Willella B) hll4 Boulevard (NH) Rittenberry Harry H student rll4 Boule- vard (NH) Rittenberry Lizzie h765 Montpelier av Rittenberry Mabel W Mrs office sec Dr D D Walker h261 Georgia av apt C2 Rittenberry Willella B Mrs instr City Play Grounds Supvr hll4 Boulevard (NH) Ritz Theatre Harry J Glenn mgr motion pictures 418 Cherry Rivers Alex (c) taxi driver r511 Edison Riv(EeMrs ) Annie C (c) r511 Edison (EM) Rivers Bishop (c) lab rl05 Bostic la Rivers Clara (c) cook h282 Madison Rivers Clarence" (c) rl55 Broad (EM) Rivers Estella (c) waiter Chas Mack h 117 (147) Hudson Rombearnsonrl5A4lbWertaalk(ecr)'smlaaid Robt S FreeRoberson Alvin S (Rosa L; Roberson Realty Co) h613 Orange apt 1 Roberson Annie P (c) r406 (136) Toombs (SM) Roberson Cleo (c) maid r406 (136) Toombs (SM) Roberson Clifford M slsmn Shell Petro- leum Corp r331 Buford pi Roberson David (c) hll6 Pearce (EM) Roberson Emma (c) cook h205 (224) Fargason (V) Roberson Etholia (c) smstrs r227 Grant av (V) Roberson EJva M Mrs smstrs r607% Mam (EM) Roberson Frank U elk GtA&FTeaCo r 554 1st Robersop Geo M (c) porter r407 Ward (V) We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 306 WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. -j-ej Roberson John W (c) roofer r214 Pond Roberts Drew M (Pearcy) restr 504 Plum Roberson Jos r607% Main (EM) Roberson Bath (c) r214 Pond (V) Roberson Bath M (wid Geo W) h856 Mul- berry Roberson Louis B (Eva) h754 Spring Roberson Mamie (c) r204 (278) Astor (E M) Roberson Mamie (c) lndrs h7 Sparks al Roberson Myrtle sten Bankers Health & r555 Broadway Roberts Edgar O (c; Rosa) shoe shiner RoTbeerrmtsinEadlgBararTber(MSahroyp) rc2a0r6p 3rd31a7vR(eVid) (SM) RoCboertrs76E8ffiMe uMlbrsertreyl opr Union Dry Gds Roberts Eliz E hl34 Williams (SM) Roberts Ella' (c) lndrs hl31 (523) Army Plumbing and Heating Life Ins Co r RD 4 Roberson Norman (c; Eva) lab h279 Willingham la (EM) Roberson Osie (c) lndrs hl40 Opera House al Roberson Realty Co (Alvin S Roberson Thos J Crowley) 361 Cotton av Roberson Robt (c) hlpr CofGaRy Roberson Sami (c; Emma) roofer h214 Pond (V) Roberson Sami jr (c) roofer r214 Pond Roberts Ella (c) lndrs rl638 1st Roberts Ella B (wid Jefferson D) rllO Beverly pi Roberts Erasmus M ins slsmn Interstate Life & Accdt Co r554 1st Roberts Ernest (c; Johnnie M) porter SBaVl,laRrdamt & Varnish Co h866 (65) Roberts Eva (c) h2 Plant al Roberts Evelyn (wid Chas M) h218 (260) Center (EM) The Best Plumbing is Always the Cheapest Roberson Simon (c) lab Macon Neon Sign Co r6 Fulton la Roberson Theo R (Nan) slsmn r209 1st Roberson Viola (c) rl23 Roosevelt (V) Roberson W A (Ida M) ins agt hl24V, RoCboelreson Wm (c; Carrie) janitor City Hall h326 Lexington (EM) Roberts Felix student r715 2d ROBERTS FRANK (Ella M). Chrysler and Plymouth Motor Cars, 711-15 3d Tel 5951, h643 Forsyth, Tel 6085 RoIbOeIKrts(EFMra)nk (Irene) lab h429 WoolRoberts Frank (c) mill wkr Bibb Mfg Co rl31 (523) Army Lot 512 1st TEL. 529 Roberson Wm (c) lab h406 (136) Toombs (SM) Roberson Wm jr (c) r406 (136) Toombs (SM) Roberson Willie (c) student r7 Sparks al Roberson Willie M (c) maid r406 (136) Toombs (SM) R4 (393) Sanders H Clifton lab rl529 3d Sanders H Fuller slsmn American Bak- eries Co hill Capitol av Sanders Harvey (c; Helen) pkr CofGRy hoOl Pebble (SM) SaMnd)ers Hattie (c) r220 Jordans al (S Sanders Hazel L elk r415 Church (EM) Sanders Henry F jr student rill Capitol av Craft (V) Sanders Ruth (c) maid r538 Dunlap al Sanders Sarah L rl801 3d Sanders Theresa (c) cook rl Barnhart's Bottom Sanders Thos (c; Rose) lab hl47 Sul- phur Springs rd Sanders Walter (c) lab CofGRy Sanders Wm (c) lab hl26 (127) Cedar Sanders Homer L (Miriam C) lab City h 1537 Broadway Sanders Isadore F (Eliz; Sanders & Tripp) hi 25 Stratton (SM) Sanders Isolene sten r621 Pine Sanders J C (c; Annie) lab h4 Stewart's la Sanders J Homer (Dona J) slsmn hl529 3d Sanders J K r28 Bibb av Sanders Jack (Julia) r212 New Sanders Jas (c) lab h385 Madison Sanders Jas (c; Annie M) lab h249 Mor- gan av (WH) Sanders Jas (Louise) millwkr Bibb Mfg Co hl221 2d Sanders Jas C (Marie) h211 Washington av Sanders Jas D (Minnie) fctywkr h305 iChappell (SM) Sanders Jane B rl30 Magnolia Sanders John L (Naomi) pdlr h477 Vir- ginia av Salnodr erIsroJnohWnkPs (&MaSttuipe) Csoteerl9w1k5r OTgalye-thorpe Sanders John W rl21 1st Sanders Josie L (c) r318 Hammond Sanders Julia slsmn hl05 Cotton av Sanders Laura (c) r220 Pond (V) Sanders Lawton (Ella M) delmn Kin- nett-Odom Co r515 Smith's la Sanders Leo D (Marie) fctywkr h412 Mikado av Sanders Lila R r226 Applewood (EM) Sanders Lillie M r226 Applewood (EM) Sanders Liza (c) r2!7 Fretwell al Sanders Lizzie (c) rl04% (5) Tracy's la Sanders Lizzie (c) lndrs h217 Fretwell al Sanders Lizzie (wid John) hl222 2d Sanders Louis (c; Gertrude) lab rl23 Ash Sanders Louise inspr Macon Peanut & Stge Co r772 Hemlock Sanders Lucy (c) lndrs h319 Maple Sanders Luther (Eudell) millwkr Hihh Mfg Co h760 Oglethorpe Sanders M Opal slswn r772 Hemlock Sanders Mae slswn F W Woolworth Co r317 American blvd Sanders Mae L (c) h560 Smith row Sanders Marcellus (c; Missouri) lab h315 Cedar (U) Sanders Margt h2719 Houston av (SM) Sanders Marshall J slsmn Dannenberg Co r477 Virginia av Sanders Mary (c) lndrs r217 Fretwell al Sanders Mary W (wid Wm P) h223 (226) Applewood (EM) Sa&ndeDrsooWr mCo(cp) lalanbt Wr31i9llinHgahzaeml Sash Sanders Wm (c; Clara) prsr Snow's Lndry & Dry Clng Co rl33 Jones Sanders Wm H (c) lab r931 Montpelier SAuNalDtyERBSldWg M516H-2,2LMawuylbeerrr3y9,8 TGeal C17a1s1-,, rl414 2d, Tel 2159 Sanders Wm L (Leah) loans 566 Mul- berry Rl h317 American blvd Sa1S 220 sM,,oWnl?tpeMlierMaavrtha H) farmer r Sanders Wm M prod r477 Virginia av Sanders Wm P lab rl529 3d CovidI/JeVrl)s Wm P wtchmn r202 Plumtree Sanders Wm W (Georgia C) carp hl21 1st Sanders Wilson W millwkr Bibb Mfg Co rl529 3d Sanders Wimberly C (Alice) carp MD& SRR hl414 2d Sanders & Tripp (Isadore F Sanders O C Tripp) barbers 1504 Broadway Sandford Ida (c) lndrs hl22 Division st la Sandford Jas (c; Mary) lab rl40 Bay Sandford Wm (c) lab r317 Hammond Sandford Wm (c) lab hill (11) Strip- ling al (EM) Sandifer Alma (c) rllO (10) Alabama (SM) Sands Wm A (Gertrude) elk h855 Wal- nut apt 4 Sands & Co Inc Wm C Knight mgr genl mdse 573 Broadway Sanford Carlie (c; Essie M) h645 Long st la (SM) Sanford Charlie M (c) maid r312 (322) Monroe Sanford Clyde R (c; Wilhelmina) tailor 421% Cotton av h238 Jefferson Sanford Dennie (c) h203 (118) Bowman (EM) Sanford Dickerman student rl26 Rogers av (V) Sanford Dock (c; Minnie) lab h299 Blount Sanford Eddie M (c) maid r299 Blount Sanford Emma (c) lndrs h423 Elbert (SM) Sanford Geo (c) lab Taylor Iron Wks & Sup Co r407 (408) Crisp (SM) Sanford Jas (c; Mary) hl50 (140) Bay Sanford Jas (c) atndt rll9 (161) De Borde (SM) Sanford John H (c) gro 1215 Broadway h do Sanford Jos (c; Dollie M) delmn Kin- nett-Odom Co h387 Flanders (EM) 317 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Sanford Lee (c; Mattie) chauf hl50 Middle (V) Sanford Lee (c) lab r312 (322) Monroe Sanford Lois elk Ouzts-Mitchell & Whal- ey Inc rlOl Clayton (W) Sanford Mamie (c) lndrs hll7 (15) Wise av (V) Sanford Mamie (c) maid rll9 (161) De Borde (SM) Sanford O Cleo (Eliz) slsmn Dannenberg Co rl91 Oakland av Sanford Orie (c; Josie) h320 (84) Bow- man (EM) Sanford Otis (c) porter Johnson Pharm- acy rll9 (161) DeBorde (SM) Sanford Paul (c) r645 Long St la (SM) Sanford Paul H (Ruth) tax assessor Bibb County hi 15 Corbin av (V) Sanford Paul H jr student rll5 Corbin av (V) Sanford Roberta (c) cook r312 (322) Monroe SaWnfooorldfolkRub(EyM)(c) maid rlllS (221) Sanford Sadie (c) r238 Jefferson Sanford Shelton P (Nell) dept mgr R S Thorpe & Sons hl26 Rogers av (V) Sanford Shelton P jr (Dorothy) store mgr Piggly Wiggly Stores hl07 Pierce av Sanford Sterling E (Sara) substa opr Ga Power Co h209 Buford pi Sanford Thos (c; Allene) lab hi 115 (221) Woolfolk (EM) Sapp Clayton (R elk Marvin's Gro r424 Ridge av (V) Sapp Edwin student rll8 Highland av (LCHts) Sapp Ellis R (Allene H) gro 859 Cherry h do Sapp Florence (c) maid h2 Harris al Sapp Geo (Dorothy) millwkr hl20 Comer ter (PM) Sapp Hamilton student rll8 Highland av (LCHts) Sapp Herman r664 Elm Sapp Hiram H (Lillian) slsmn hll8 Highland av (LCHts) Sapp Hoyt lab r664 Elm Sapp Jas elk r240 Ross Sapp Jas M (Hildred D) slsmn Dunlap Chevrolet Co hl08 Branch (CH) Sapp Jas W (Ancie) h820 1st Sapp Jason W (Julia) millwkr Bibb Mfg Co hll Bellevue rd (PM) Sapp John L baker Central Ga Baking Co Sapp John W (Victoria) cook Liberty Candy Co h310 Center (EM) Sapp Jos F gro 112 (229) Turpin (T) h do Sapp Lizzie (wid John W) millwkr h354 SaFpapirLviuelwa MavMr(sEM(L)ueree Beauty Shop) rl65 Spring Sapp Mae (wid Lawson) smstrs r560 Hemlock Sapp Myrtle Mrs millwkr Bibb Mfg Co r775 Hawthorne Sapp W R (Venie) h240 Ross Sapp Wm (Lucy) lab r310 Randolph (E M) Sappington Benj P (Ola S) formn h505 Napier av Sappington Livyan K student r505 Napier Sappinton Alberta (c) restr 550 Hammond r8(09 Elbert (SM) Sappinton Edw (c; Alberta) lab h809 Elbert (SM) Saratoga Restaurant (Edw W Braswell) 26 Wall Sargeant Collier H (Pearl) lab r753 Plum Sargent Geo H (Mabel K) ins Life Ins Co of Va rtl20 (55) Highland av (LC Hts) Sargent Virginia (c) maid h204 (212) Fargason (V) Sargent Wm H (Eliz H) cable splicer S BT&TCo h217 (216) Log Cabin dr Sargent Wm R (Jessie I) lab h453 Woolfolk (EM) Sasner Mary (c) cook hl26 (22) Tinsley la Sasner Oscar (c) lab rl26 (22) Tinsley Salsaon Ralph shoe repr Dixie Jobbing House r204 Napier av Sasser Ann Mrs r513 Plum Sasser Emmett (Betty A) slsmn Taylor Iron Wks & Sup Co h802 American blvd Sasser Everett (Florrie B) cond hl06 Clayton (V) Satterfield Dell B (wid John) h221 College Satterfield Marion H (Betty S) mattress mkr Bibb Mattress Co h912 Orange Satterfield Sarah knitting instr Dannenberg Co r425 Georgia av Satterwhite Amos D (Blanche) agt Ry Exp Agcy Inc hll2 Avon rd Satterwhite Wm P (Mina I) gro 862 Hazel h do Sauls Anna (wid John D) rll20 Elm Sauls Clark H (Myrtle M) blrmkr r70 Hemlock Sauls Dewey E (Fannie M) slsmn Simon Moore hl08 Emory av (SM) Sauls Griffin B (Ruth) fctywkr h505 Capital av (Mikado pi) Sauls Leverne O private sec Sterchi Bros Stores Inc r412 Napier av Sauls Ruth student r421 Adams Sauls Seaborn J (Emma) r30 (90) Mill Sauls W Theron bkpr r412 Napier av Sauls Wm C (Eppie B) slsmn Burden Smith & Co h412 Napier av Sauls Wm R custodian PO rl:l20 Elm Saunders see also Sanders Saunders Annie (wid Thos J) rl61 Magnolia Saunders Aubrey D (Jimmie E) film opr Rialto Theatre h479 Orange apt 6 Saunders Chas C (Willie M) elk T Edw Ard r9 Hill Park av Saunders D Mitchell (Eliz P) claim agt CofGaRy h219 Hines ter (V) Saunders Edw (c; Susie) lab hl20 Tindall av (SM) Saunders Emma (wid Lafayette A) r304 Cherokee av Saunders Frances student r201 Pierce av (V) Saunders Gholson L (Mattie) mach h765 Spring Saunders J Reeves student r94 Lawton Saunders John L (Ethel) cond h304 Cherokee av Saunders Julia student r219 Hines ter (V) Saunders Lee (c; Pearl) cupola tndr Tavlor Iron Wks & Sup Co h230 Plant (SM) Saunders Olin L (Arrie L) hl21 Plant (SM) Saunders Walter D (Lizzie L) h94 Lawton av Saunders Wm H (Vivian) mgr Natl Biscuit Co hl8 Drury av (I) Savage Edw W (c; Mildred) carrier PO ih5Q3 Forsyth Savage Eug (c; Fannie) lab Ga Power Co h300 Bowman (EM) Savage Inez (c) maid r257 4th av (V) Savage John W (c; EStella) lab MD& SRR hl45 Fletcher (EM) Savage Laura sten Bibb Mfg Co r218 Georgia av SSaavvaaggee NLounlaa ((cc)) ars3s0t0 DBroJwmC aHn ol(lEeyM)h 225 2d av (V) Savage Wm B (c; Emma) brklyr h229 4th av (V) Savior Mary A (c) r207 1st av (U) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? IS Answered By the Classified Business Lists In this Directory 318 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Sawyer Alvin L (Marjorie W) elk rl60 Winship (WH) Sawyer Arth (c; Anna) gro 514% Fort Hill (EM) 11514 do Sawyer Beer Co Thos T Childs mgr 7 Terminal av Sawyer Cicero (c; Annie C) car clnr Cof GaRy r514 Fort Hill (EM) Sawyer Coal & Ice Co Thos L Balkcon SaswtayermgCrorfailliBng (sct)a l2n7d7rsWhal2ln3u1t 3d Sawyer Everett H (Eliz R) atndt Tank Car Service Sta r!60 Winship (WH) Sawyer J Carlton jr (Christine) cond h728 Date av Sawyer John mech Hart's Mortuary r318 New Sawyer John H (Hattie) policemn hl60 Winship (WH) Sawyer Rosa L lndrs Crescent Lndry Co rl38 Taylor Sawyer Wiley (Alma) pntr h901 Clinton (EM) Sawyer Wm (c) h910 Hazel Sawyer Wm (c) lafa h706 Center (EM) Saxon Jas T (c; Lillie B) pastor Me- morial Baptist Church hl25 (220) Norris (EM) Saxton Carlisle R instr Ballard Normal Sch r50 Forest av (V) Saye Ernest B (Eliz D) pathologist Macon Hosp hl21 Buford pi Saye Florence A (wid Ira A) hl62 Magnolia Saye Martha E student rl21 Buford pi Scallier Dessie (Helen) h373 Clinton (E M) Scandrett J Russell (Margt) office mgr Edw B Harrold Co h575 Orange apt 1 Scant Mitty (c) cook r204 Grant av (V) Scarbary Otis T (Nora) millwkr Willingham Cotton Mill h8 (79) Mill Scarborough Benj student r400 Flamingo dr Scarborough Buford millwkr Willingham Cotton Mill rl Kinnett (V) Scarborough Chas J (Trixie D) millwkr Willingham Cotton Mill hi Kinnett (V) Scarborough Claude (c; Erma) driver r 428 Madison Scarborough Danl W sta mgr Wofford Oil Co r RD 6 Scarborough Emmett (Clara B) millwkr Willingham Cotton Mill h319 Vine (NHts) Scarborough Ernest millwkr Willingham Cotton Mill rl Kinnett (V) ScBarubrodreonugShmEitrhnes&t LCo(Ehth86e4l) Mdiustlbmerrgyr apt 5A Scarborough Ernest L jr r864 Mulberry apt 5A Scarborough Essie Mrs h2229 2d Scarborough Evelyn Mrs sten Benj J Fowler r428 Ridge av (V) Scarborough Herschel V (Maude) slsmn (h400 Flamingo dr Scarborough Jas A (Dora B) rubber stamps 314 Broadway h222 Tatnall ScWarbasohroinuggthonJasavP (Ernestine) carp h233 Scarborough Jasper W (Lillian E) slsmn Dunlap Chevrolet Co hl37 Flamingo dr Scarborough John r460 Mulberry Scarborough John (Katie) ice puller Kinnett-Odom Co hl27 Park Hotel al Scarborough John pntr r221 Georgia av Scarborough Jos W (Evelyn) ftr Macon Gas Co r428 Ridge av (V) ScCaroborr4o2u8ghRLidiglleianavste(nV)T L Ross Lmbr Scarborough Lillie (wid Chas W) h428 Ridge av (V) Scarborough Margt E hostess r864 Mulberry apt 5A Scarborough Martha M (wid Frank) h 530 Washington av Scarborough Opal student r201 Pierce av (V) Scarborough Paul delmn Melham Abraham r2229 2d Scarborough Richd B r222 Tatnall Scarborough Richd F lawyer 516 Mul- berry R407 r232 Georgia av Scarborough Ruby sten U S Referee in Bankruptcy r428 Ridge av (V) Scarborough Thos (Sallie) blksmith r548 Ocmulgee Scarborough Walter (Lillian M) millwkr Atlantic Cotton Mills r40 Atlantic Village Scarborough Zoe sten WPA r5|30 Washington av Scarvey IRobt (Lula) sewer grader A B Lee Plmbg & Htg Co h408 (559) Henrietta (SM) Schaefer Martha student r704 Main (E M) Schaefer Minnie (wid Chas W) h704 Main (EM) Schaefer Wm H (Edith) bkpr r359 Church (EM) Schafer Raymond F soft drinks 210 Center (EM) r214 (156) do Schafer Sallie T (wid Emanuel) h214 Sc(h1a5f6f)erCDenetlrlaal V(Er2M8)37 Houston av (S M) Schaffer Jos (c) lab r473 Chestnut Schall Mary L (wid Geo) elk Union Dry Gds Co hl47 Rose pk SCHALL PAINT CO INC, Robert B Schall Mgr, James R King Salesman, Dealers-Factory Distributors GraySeal Paints and Varnishes, Roofing Paints 307-309 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) SCHALL ROBERT B, (Vinita C), Mgr Schall Paint Co Inc, r563 College, Tel 4959J Schall Sarah E r219 (120) Cutlers la (E M) Scharff Byron D (Doris) mgr Swift & Co hl02 Vista cir Schatzman Carling (Maybelle) mgr Idle Hour Nurseries h do iScheider Lucile (wid Claude) hl04 Cleveland av (V) Schell Anna B (wid Chas P) h322 Linden av Schell Bobby usher Ritz Theatre r336 North av (NH) Schell Chas E (Minnie L) mach Proctor & Gamble h726 Walnut Schell Chas P (Emmie C) elk Central Hotel r322 Linden av Schell Cleveland student r336 North av (NH) Schell Elmer (Marie) fctywkr Happ Bros Co r865 1st Schell Emma (wid Louis) r730 Walnut Schell Ernest R (Claudia) mach Bibb Mfg Co h336 North av (NH) Schell Evelyn h220 (260) Church (EM) Schell Evelyn student r336 North av (N H) Schell J Sidney student r210 Jones av (EM) Schell Louis C (Annie C) welder Bibb Mfg Co hl30 Winship (WH) Schell Louis C jr student rl30 Winship (WH) Schell Marilu slsmn Macon Memorial Park Inc r306 Washington av Schell Sidney A (Bernice) formn Bibb Mfg Co h210 Jones av (EM) Schell Wm L (Frances) appr Taylor Iron Wks & Sup Co r800 Center (EM) Schell Zach D elk Happ Bros Co r730 Walnut Schelling Emile (Thelma) loco eng rl31 Parkwood av 319 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household said Farm Supplies Sporting Goods Macon BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Federal Schelling Geo ft (Minnie; Schelling Shoe ScShheollpin)ghJ8o5hnOsBho(rIndea)pihl31 Parkwood Scahvelling Lillie Mrs elk Union Dry Gds Co rl02 Kemper av Schelling Shoe Shop (Geo R Schelling) Schwartz Saul (Florence; Boston LeathSCeHr WCAo)RThZ806& NPaHpAieUr LavINC, Louis E Schwartz Pres, Sheet Metal Work and Rinofoofremrsat5i1o4nPseluemb,acTkelco34v0er(aFnodr pfuagrteh3e0r Buyers' Guide) Savings & Loan Sc1h1e7rmCeorthtoonrn aMv ary h920 Elm Schwob Co The John R Ziegler mgr men's clo 403 Cherry Ass'n Schermerhorn Mary collr r316 Washing- Scoggins Clyde T (Josephine) rl07 (47) ton av , , , Holt av (NHts) Schiebe Louis W (Lonnie A) steward h Scoggins Delma (Mildred) driver r215 330 Beech av Chappell (SM) Schlueter Edw (Elsie) auditor hl21 Brentwood av Schlueter Harold F student rl21 Brentwood av Schmidt Arth W (Irene R) supvr Southeastern Demurrage & Storage Bureau Schh3m19idtCBoulurmt Abu(sMinnie) lawyer ns Pine cor 7th h90 Osborne pi Scoggins Fredk W r288 Cedar (SM) Scoggins Loutrelle r2165 2d Scoggins R Thos (Minnie B) car repr C ofGaRy h288 Cedar (SM) Scoggins Wm J (Clara C) carp h2165 2d Scoggins Wm L (Helen F) slsmn Max- well Bros Furn Co r438 Duncan av ScRonyhelr0s24EdCwliAnto(nEllrad) f(iEreMm)n MD&SR Loans on City Schmidt John E (Dixie Cafe & Commissary) r2612 Forsyth rd Schmidt Mildred V (wid John E) h2612 Forsyth rd ScChmomidmt iMssainrynieh9M0 rsObskboprrnDe ixpiie Cafe & Schmidt Rosa asst mgr Dixie Cafe & Commissary r2612 Forsythe rd Schmidt Virginia student r90 Osborne pi Schneck Whittle D slsmn rl27 Magnolia Schneider Josephine W (wid Antone) h 655 Hemlock Schofield Alonzo D (Eliz W) h250 Geor- gia av Schofield Bessie (c) maid r423 (474) 3d av (V) Schofield Carl H (Louise H) slsmn Tay- lor Iron Wks & Sup Co hi06 Hill Crest av (CH) Schofield Eliz P r250 Georgia av Schofield Floyd O pres Schofield Ins Agcy Inc hlOO Vineville av (V) Schofield Gladys r250 Georgia av Schofield Hazel (c) r423 (474) 3d av (V) Schofield Hazel G Mrs rep Equitable Life Assurance Society of The United States h249 Stanislaus cir Schofield Insurance Agency Inc Floyd 0 Schofield pres Mrs Tibbie R Schofield v-pres Jos A Wynn sec-treas 516 Mulberry R210 Schofield John S r647 Pebble (SM) Schofield John S (Mary) hlOl Vineville av (V) Schofield John S jr (Hazel G) rep Home Owners Loan Corp h249 Stanislaus dr Schofield Odesa (c) cook r423 (474) 3d Sconyers Francis pickers Macon Peanut & Stge Co rl26 Garden (EM) Sconyers Montine Mrs millwkr Bibb Mfg Co r767 Hawthorne Sconyers Robt (c) prsr New York Clnrs r247 5th (V) Sconyers Willis S (Ella) carp MD&SRR hl26 Garden (EM) Scordas Paul eng GaPower Co r860 Mulberry Scott Ada (c) b.323 Dempsey av (U) Scott Andrew (c) lab r440 (453) Shoals al (EM) Scott Annie B (c) h539 (512) Grant Cha- pel al (SM) Scott Arth (c) h5 3d St la Scott Arth (c) delmn rl25 Army lot Scott Brady (c; Daisy) lab hl03 Drews qtrs Scott C Eliz tchr PS r (515) 511 E Nap- ier av Scott Carita (c) student rl54 Hill Scott Chas (c) porter h541 3d av (V) Scott Chas H (c) delmn r305 (245) Will- ingham al ScoBtotokCelrasude (c) lab City h rear 104 Scott Claude E (Lubell) carp h760 1st Scott Clinton (c; Ardelia) millwkr Bibb Mfg Co h4 (553) Witkowski's la Scott Delia M (c) cook rll2 (300) Craft (V) Scott Doris (c) cook r614 Ross SCOTT E CLEVELAND, V-Pres and Trust Officer The Citizens & Southern National Bank, r Lorane, Ga, Tel 2719-W Heal Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia av (V) Schofield Tibbie R Mrs v-pres Schofield Ins Agcy Inc rlOO Vineville av (V) Scott Ebbin P (Mary E) barber Palm Barber Shop h410 Beech av The Scott Edwin G trav rep U S Re-employ- Bank Directory Schoonmaker Burton H (Elsie) sta mgr (Powell Oil Co hlOl Laurel av (NH) ment Serv r Lorane Ga Scott Elder (c; Beatrice) pntr r214 Mid- of the World Schoonmaker Honda sten rlOl Laurel av |(NH) Schoville Dora (wid Henry W) r706 Pine Schreck Whitfield D elk Noland Co rl27 dle (V) Scott Eliz (c) h616 Dunlap al Scott Eliz (c) student rlOl (222) Long la Issued Mar. and Sept. Magnolia Scott Eliz L Mrs sten County Tax Re- $15.00 Schrimshire Georgia (wid Jas V) h40 ceiver r511 (316) E Napier av Melrose (B) Schrimstrist Jas (Mae) lab rll7 Garden Scott Ella (c) r232% Plant al Scott Ernest (c; Nellie) porter Ry Exp per volume (EM) Agcy r210 Tindall av (SM) Schuesseiler Nettie Mrs inspr r320 Col- Scott Eug (c) porter rl21 (10) Tinsley la R. L. Polk lege SCHUSTER M RICHD, Dentist 617 Mul- berry R612-13, Tel 847, h Wesleyan dr, Tel 73-R Schwartz Harry M sheet metal wkr ISchwartz & Phaul Inc r818 Cherry apt 1 SCHWARTZ LOUIS E (Esther), Pres Schwartz & Phaul Inc, h818 Cherry, apt L Tel 3992 Schwartz Sadie student r818 Cherry apt 1 Scott Eula (c) r232M> Plant al Scott Eula J hl07 Heard (SM) Scott Fannie (c) cook hl21 (10) Tinsley la Scott Fannie L (wid Frank H) h322 Bond Scott Filling Station (Wm C Scott) 2110 ScVotint eFvillolerenacve ((Vc)) maid Atlantic Cot- ton Mills h327 (315) Corbin av (V) Scott Frances E Mrs elk rl73 Virginia av Scott Frank (c; Eloise) lab hll7 Brook- lyn av (S) & Go. Publishers , 431 Howard St. Detroit 354 4th Ave. New York 320 Hoo COMMUNITY SAVINGS & LOAN CO. 3 201 COTTON AVE. LOANS TEL. 6130 tS < 1 Scott Frank (c; Mary) lab h246 Dempsey av (U) Scott Frank H slsmn r322 Bond Scott Harriet N (c) tchr r261 Broad (E M) Scott Henry (c; Tallie) lab h421 Gilmer Scott Howard (c; Lillie M) porter Ry |Exp Agcy till (12) Barker av (V) Scott Jas (c; Fannie) h841 Center (EM) Scott Jas (c; Mildred) lab hill Forest av (V) Scruggs Granzy (c; Ophelia) lab hll7 (210) Clara (EM) Scruggs Horace V (Ruth) chf electn C ofGaRy hlOO Hill (LCHts) Scruggs Jas student 1-774 Mulberry Scruggs Margt sten Turpin & Lane rill Rogers av (V) ScBrurgogss InWcheheilellr R(Mogaergrst) aevlk(VM)axwell Scruggs Wm E (Maud R) slsmn Bate- man Co hl24 Cleveland av (V) *ooa O bo Z Q < u J .sc a0 o $ u J X Scott Jas E (c; Fauthine) lab hl53 Hill Scott John C (Laura) lab h269 Astor (EM) Scott John F (Irene) rll3 Schell av (E M) Scott John L (c) student rll2 (300) Craft (V) Scott Jos W (c) porter rl54 Hill Scott Lela (c) cook hl34 Sycamore (V) Scott Lemuel (c; Cora) driver r253 North (V) Scott Leola (c) maid rllO Ward (V) Scott Leonard (c; Florence) lab hllO (105) Pinkerton al Scott Louise (c) maid 120 Buford pi Scott Lucinda (c) h305 (246) Willing- ham al Scudder Wm J elk Goodrich Silvertown ScSutroryreBs irr8d6ie0 MMrsulmbearnryicurist Palm Bar- ber Shop h610 Plum Scurry Kittie manicurist Hotel Dempsey Barber Shop r569 Broadway Seaboard Air Line Railway Wm W Mil- ler coml agt 403 Cherry R302 Seabrook Clara (c) lndrs h426 Pio Nono av (V) Seabrook Jerry (c; Chanie) lab CofGaRy Sehalb0r1o2okMJoaisn (c()EMla)b r426 Pio Nono av (V) Seabrooks Annie B (c) maid r439 (448) Middle (EM) Seabrooks Fredk S (c) porter Wofford I Scott Mabel (c) maid r614 Rose Scott Margt (c) student r224 Chestnut Scott Mary J rl07 Heard (SM) i N o 00 Scott Marydel student r201 Pierce av (V) Scott Mazell (c) maid r227 Woodcliff Scott Memorial Cottage Mrs Effie Carey matron 714 New Scott Milton (c) r451 Coles al Scott Minnie G Mrs gro 505 E Napier av Oil Co r350 Flanders ('EM) Seabrooks Marie (c) maid r451 Martha (EM) Seabrooks Moses (c) lab rl41 E Ell Seabrooks Sarah (c) cook r229 Jones Seabrooks Wm L (c; Minnie) delmn Edward P Smith hi39 E Ell Seagraves Dewitt (Thelma) millwkr h39 Lake Seagrove L Winzy (Ola M) millwkr Bibb h608 Holt av (NHts) Mfg Co r270 Main (EM) Scott Mozell (c) lndrs r541 3d av (V) Scott Nathan (c; Lula) millwkr Bibb Seagroves Marion E (Nelle D) prsmn Macon Evening News h223 Adams Mfg Co h730 Hazel Scott Nell tchr rl04 Church (EM) Seagroves Nelle D Mrs office mgr A G Rhodes & Son h223 Adams Scott O E dep agt Internal Revenue Sealey Mattie (c) hl22 Edgewood av ts * j* *J bo >> 3 ^ 8 5 J*Bj 8it Scott Ola (c) h232% Plant al Scott Philip (c) driver Worsham & Sher- rill Scott R Benj (Evelyn P) dairywkr Dixie Dairies hl409 Edgewood av SSccootttt RRoobbtt L(c; (OMlaattBie)) tpraovrtesrlshml5n8 hHS1il5l (511) E Napier av Scott Roland B (F Eliz) student r515 Seals Ida (wid John) r60 (4) Roff Home pl Seals Jas (c; Lula) lab h201 3d av (U) SSeeaallys REuublay W(c)Mrr:3s54altAesrahtions Darling Shop hi 10 3d Sealy Lovie (wid John C) h438 Carling Seamore Estell millwkr Bibb Mfg Co r 236 (5-6) Clinton (EM) 2 Q -C (511) E Napier av Scott Rosa (c) maid hl54 Hill Scott Roy (c; Clara) millwkr Willing- ham Cotton Mill h253 North (V) Seamore Odessa millwkr Bibb Mfg Co r 236 (5-6) Clinton (EM) Searcey Annie (c) h325 Division (T) Searcy Dick (c) lab r325 Division (T) T3 G(0 4CJ -3 jB<-UJ. 2) .2 o g -Q <04 JS >oH "C'3O O (0 S o >33> Scott Solomon (c; Viola) lab h716 (626) Prince (SM) Scott T J (c; Rosa) lab rl025 Edgewood Scott Theresa (c) maid r323 Dempsey av (H) Scott Thos student r:104 Church (EM) Scott Wade E Rev (Essie M) pastor East Macon Methodist Church hl04 Church (EM) Scott Walter order picker McKessonRiley Div rl27 Boulevard (NH) Scott Wm (c; Lelia) cook h261 Broad (EM) Scott Wm (c) delmn Vineville Drug Co rl02 Parker av (V) Scott Wm C (Maggie C; Scott Filling Station) h215 Park (I) Scott Wm E (Georgia) cond MD&SRR hi073 Walnut Scott Wlnnelle student rl073 Walnut Scoven O Raymond (Delores B) slsmn Swift & Co hl821 Broadway Scoven Sami G car repr CofGaRy Searcy Annie (c) lndrs rl08 (96) Bay Searcy Bertha (c) hl08 (96) Bay Searcy Blanche (c) lndrs h211 Holmes av (V) Searcy C J (c) rllO Holt la (V) Searcy Clifford (c) lab rl!9 (11) Tins- ley la Searcy Cora (c) maid r318l Green Searcy Effie (c) waiter r8IS Hazel Searcy Eliz (c) lndrs r547 (41) Tinsdall av (SM) Searcy Ellen (c) lndrs hllO Holt la (V) Searcy Enoch (c) lab rl08 (96) Bay Searcy Eug G elk YMCA r371 1st Searcy Frank (c) r6 Hazel Se(aCrcHv) Hattie (c) dom hl80 (240) Roye Searcy Henry (c; Effie; lunch rm 217 (103) Bay h86 Hazel Searcy Jas (c) lab rl436 Broadway Searcy Jane (c) lndrs r22 Berthadale dr (V) Searcy Jerry (c) r4 Clayton (V) Scoville J B elk Hotel Gordon r do Searcy Lucius (c; Ollie) lab rl22 (227) Scoville Wallace W (Carolyn) slsmn rl29 Railroad av (V) Pio Nono av (V) Scranford Lula r218 (260) Center (EM) Searcy Thos (c; Rosa) lab hl0614 (147%) Holt la (V) Scnrougtgs Edw (Cora L) driver ho53 WalScruggs Edna rlOO Hill (LHts) Scruggs Eva (c) r207 Chestnut Searcy Titus (c; Frankie) lab rl08 (96) Bay Searcy Wm (c) gro 601 (122) Elliott (E M) h do 321 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Searcy Wm (c) lab r 119 (11) Tinsley la Searcy Wm L (c; Eliz) rl04 Hazel \. r.SetcarerirsalHtLeerinfery&NH(eTaoltmhmInies LC)o ahgl,t02InMd,uesr-;J/ Sears Homer L (Louise H) agt Indus- trial Life & Health Ins Co h300 Johnson av (HH) Sears Isaac (c; Rosa) lab h564 Chappell SeSnmnaithAl&theCaoMr2r6s3bGeaeuotrygiaoapvr aBptur3den Sent Henry F (Fannie) ctr S M Watson Mfg Co hi 17 (121) Colquitt Sentell Emma M (wid Wm M) r4 Grand Sentell Wm E r4 Grand av Seracy J Jackson (c; Della) hll8 (356) Edison (EM) Sergeant Collier (Pearl) rl531 2d Serrell Jos C electn M L Davidson Elec Sears'john (c; Daisey) mach r320 Ward (V) SEARS, ROEBUCK & CO, Frank E Walters Mgr, Dept Store 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) Seay Elise student r370 College Seay Judge D Rev (c) pastor Cedar Grove Baptist Church h214 Woodcliff Seay Robt (c; Willie M) restr 133 (405) Tinsley la hl34 (400) do Second Baptist Church 1439 2d Second Street Cafe (Bryant A Meeks) 516 2d Second Street Methodist Episcopal Ch Rev Thos B Stanford and Walter L Co Session Lillie L rl06 Ross Sessions Forrest L (Pauline O) asst whse supt Standard Oil Co h764 HemSelsosciokns Howard K (Ruby E) swtchmn h 814 2d Sessions J R slsmn Snow's Lndry & Dry Clng Co r416 Forsyth Sessions Jos (Frances) mar Wisteria Cafe r3498 Houston av (SM) Sessions Josephine (c) r7 Harris row Sessions Julia (c) lndrs h'5 Gunn's la (V) Sessions Leland K trowelmn rl06 Ross Sessions Sadie Mrs r526 Edgewood av (S M) Sutton pastors services 11 a m and 8 p m Sunday Sch 10 a m 2120 2d Sessions Solemlie (wid Jas T) hl06 Ross Sestrung Harriet (c) r93 (16) Hazel Second Street M E Church S S Annex 2132 2d Seephus Berry (c; Pearl) lab r815 Edge- Settle John H (Pearl) pharm h2007 2d Settle John H jr (Helen; Triangle Pharm- acy) L2420 2d wood av Seger Lucy Mrs r656 Pine Seibert Allen K (Nell) trav slsmn h425 Georgia av Seibert Allen K jr r42& Georgia av Selden John A phys 616 Mulberry R801 hi 102 Rdige av (V) Self Cleve r318 Cleveland (SM) Self Geo G (Bessie B) driver Yellow Cab Trans & Baggage Co r412 Hanson (S M) Self Lawrence S (Pearl S) city firemn h 525 Oglethorpe Self Maude fctywkr Happ Bros Co x318 Cleveland (SM) Self Stonewall J h412 Hanson (SM) Self W Lunis driver United Food Brokers Co Iric r412 Hanson (SM) Sellars Isiah (c) lab rl014 Broad (EM) Sellars Willis Kc) rl03 GOO) Thomas (E M) Settle Wm W (Marie) linemn r2007 2d SeEvletnotnh CDhaaypmAadnvepnatsitsot rC1h1u4rMchonRtepveliMer Seventh Day Adventist Church (c) Rev John B Mallary pastor Sunday school 9:30 a m services 11 a m and 8 p m 7 Spring Seventh Street Baptist Mission (c) 351 7th Sewell Edith A Mrs office sec F W Farmer r71i Montpelier av Sewell Homer (Allie) trav slsmn r335 College Sewell Isom (c) r301 Edgewood av (SM) Sewell Mack N (Eva) dept supt Bibb Mfg Co hl20 Log Cabin blvd Sewell Thos (c) lab hi (146) Paradise al Sexton Boston (c) lab h506 (502) Edison (EM) iSexton Floyd E (Erma) millwkr h3 Ford Sellers Aira S (c; Iona) carrier hl03 la Spring Sexton Jas A (Alma M) millwkr Willing- Sellers Cassander W (c) carrier PO rl03 ham Cotton Mill hl21 (40) Holt av (N Spring Hts) Sellers Claude (Estelle) hl30 Ell (SM) Seymour Amy student r51 Arlington pi Sellers Earl (Eunice) agt r744 Anderson Seymour Clarence (Mary) r244 Washing- (SM) ton av Sellers Edw (c) h37 White (SM) Seymour Corrine elk r51 Arlington pi Sellers Eldridge M (Annie) welder Tay- Seymour Esther elk hSl Arlington pi lor Iron Wks & Sup Co h744 Ander- Seymour Jas E (Lucille) printer Macon son (SM) Teleg Pub Co h510 Orange Sellers Gerald (Eileen) shoe repr hl23 Shadborn Morris (Mary) civ eng State Washington av Hwy Board Div No 2 h.414 Forest av Sellers Jas (c) lab r37 White (SM) (V) Sellers Lucille (c) r37 White (SM) Shadburn John D (Flora N) auto tops Sellers Matthew (c) delmn r304 Green Sellers Ophelia (c) h304 Green Sh4a3d8bOurgnleJthoohrnpeDhjlr36(SHariaghFl)anrld36avHigh- Sellers R'obt (c) r37 White (SM) land av Sellers Ruth (c)_ piaid r37 White (SM) Shade Mittie rl51 2d Selman Helen waiter r262 Ell (SM) Shafer Chas A student r965 Cherry Selman Leon D (Ha) motor cycle repr r Shafer Wm C (Anpa E) loco eng h965 2322 2d Cherry Selman Lucius D (Lila) prod h262 Ell Shafer Wilma Mrs hsekpr Hotel Grady KSM) r301 Cherry SeLlsiefer JIonhsnCMo r(6L2o5isFMor)syatght Conn Mut Shaffer Beni F (Nellie J) hahidrsr College Beauty Salon r723 College Selser Lois M Mrs elk Sterchi Bros Stores Shakespeare Annie (c) r647 (130) 4th av Inc r625 Forsyth (WH) Semken Adeline P (wid John D) rl41 Shakespeare Louise (c) hsekpr Douglas Beverly pi Hotel r363 Broadway Semloh Sarah J Mrs prsr h2610 2d Shakespeare Postel (c) lab CofGRy h647 Senft Henry P (Leafy) h864 Mulberry (130) 4th av (WH) apt 5B Shamis Jas elk r353 Fairview av (EM) Senft Henry P trav slsmn h261 Georgia Shamis Wm E (Inez) barber DuPree Bar- av apt B1 ber Shop h'1407 2d YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Life Of Your CITY 322 D. H. Adams TAYLOR STORAGE SHIPPING Motor TRANSFER COMPANY 458 PLUM ST. PACKING PHONE 388 Go. Shamlin Love (c; Mary) agt Pilgrim Health & Life Ins Co h210 Forest av Shaw Ernest millwkr Bibb Mfg Co r270 Main (EM) Studebaker Willys Hiipmobile Sales 655-657 Third St. PHONE 2997 Shank Elsie (c) restr 320 Ward (V) r do Shanks Jas A (c; Perry D) barber Clay- burn B Lane h308 (443) Alabama (S M) Shannan W M Rev (e) r338 Jackson Shannon Carey W (Edith R) baker Collins Baking Co rl22 2d Shannon Leila (c) lndrs h295 2d av (V) Shannon Timothy (c) lab r441 Peter's al (EM) SHANNON WM F, Mgr Collins Baking Co, h648 Forsyth Sharp Beauty P (c) r'710 Elm Sharp Bessie rl20 Yates av (EM) Sharp Bessie (wid Wm) r654% 2d Sharp Celia tchr PS r507 Hillyer av .(C H) Sharp Chas (c) barber Wm Odom h471 (482) Alabama (SM) Sharp Edw (c) lab rll8 Neal av (V) Sharp Geo B (Walton) millwkr Bibb Mfa Co hl20 Yates av (EM) Sharp Gussie (wid Simon G; Sharp's Shoe Shop) h507 Hillyer av (CH) Sharp Hallie (c) maid r2 Spark's al Sharp Horace (c) lab Taylor Iron Wks & Sup Co h710 Elm Sharp Jas P (Johnnie) slsmn hl06 McDonald av (V) Sharp Lillie Mrs mgr Held's Dress Shop Shra7r5p9 LPuorpalyarMrs smstrs r353 Walnut Sharp Mancey (c) hlpr CofGRy Sharp Mattie (c) waiter Broadway Lunch Jhl21 New Sharp Oline r865 Mulberry Sharp W Harold (Lillie) r759 Poplar Shaw Eula (c) r470 Broad (EM) Shaw John (Ethel) formn r*3040 Hous- ton rd (SM) Shaw-Lewis A supt Willingham Sash & Door Co r3040 Houston rd (SM) Shaw Louise casewkr City Dept of Public Welfare r852 1st Shaw Lydia student r302 (310) Hill Crest av (CH) Shaw M Edw (Lucile) bldg contr 346 Hardeman av h do Shaw Marion I (Mae D) r4l5 New apt 2 Shaw Martin A Rev (Annie) pastor Mor- rison Memorial M E Ch hl28 Pearl Shaw Maud (c) lab h470 Broad (EM) Shaw Olive Mrs dept mgr Darling Shop r301 Cherry Shaw Ralph B (Emma T) wire dhf SBT & T Co rl014 Vineville av (V) Shaw Susie (c) lndrs rl229 3d Shaw Sylvester (c) r470 Broad (EM) Shaw V Jack (Cleorie) millwkr Bibb Mfg Co h311 Main (EM) ShPauwbliVc irWgienlifaarEe rc3a0s8ewCkhrerCokiteye Davept of Shaw Warren (c) delmn r472 Broad (E Shealy Ellen Mrs r767 Pine Shaevaly(CLHu)la A (wid Wm P) r548 Hillger Shealy Mary E (wid John W) rl452 Col- lege Shealy Philip C (Lillie M) slsmn w D GH)riffith, & Son h218 Coleman av (C Shealy Philip C jr student r218 Coleman av (CH) Sheats Edwin M emp Walgreen Co r8U YOUR ^Forsyth116 (Mary R) ydmstr h314 Sharp's Shoe Shop (Mrs Gussie Sharp) reprs 618 Cherry Walnut Sheats Thos S collr Union Fum Co r616 1st CITY Sharpe Ed (c; Dora) h'712 (577) Maynara (EM) Sharpe Grady B (Kathryn) slsmn h525 Flamingo dr Shed Clarence (Nannie) millwkr hl36 Roff Home la Shed Wm C rl36 Roff Home la Shedd Hattie A (wid P Lee; rl502 3d Sharpe Harrison (Edna) millwkr Bibb Shedf-ick Irvin L (c; Fannie) hl25 (114) D Mfg Co h759 Hawthorne Wood al Sharpe Harrison 'S .(Ola) fctywkr h25 Shedrick Jerry (c; Annie A) janitor SBT I Lake City (EM) Sharpe Henry J (c) mach h403 (344) & T Co h312 Patterson (N Hts) Shedrick Nathaniel (c; Agnes) cook h3 Maynard (EM) Ross St pi R Sharpe Homer S barber Robt G Stripling Shedrick Stella (c) r301 Edgewood av (S Sharpe Jack L (Ruth) welder Taylor M) E C T O R Y MIRRORS the Iron & Sup Co r459 Carling av Sharpe Lennie (c) r440 Dunlap (EM) Sharpe Lila (wid Milburn C) h2501 For- syth rd Sharpe Melvin (cl lab r440 Dunlap (EM) Sharpe Ossie (Sallie) millwkr Bibb Mfg Co h213 (212) Hydrolia (EM) Sharpe Sallie (c) h440 Dunlap (EM) Sharpe Sallie Mrs millwkr Bibb Mfg Co r213 (212) Hydrolia (EM) Sharpe Sami (c) r440 Dunlap (EM) Sharpe Sarah (c) maid r407 Monroe SShhaarrppee WWimllis(c()c) lalabb rr444400 DDuunnllaapp ((EEMM)) Sharpies Ralph slsmn J W Burke Co r 500 Edgewood av (SM) Sateen Violet (c) cook hl58 Sycamore SShb-aatttteleesn GWrmace(cs)tubdaernbterr3G90e1rtHruoduestSomn iatvh Sheehan E Clinton (Louise K) millwkr Willingham Cotton Mill r217 (24) Holt av (N Hts) Sheehan John C (Ruth) dept supt Bibb Mfg Co hl09 Culver (V) Sheehan L Clyde (Leila) supply officer Ga Natl Guard h731 Courtland Sheehan Robt E (Fannie) chemist Bibb Mfg Co h396 Forest av (V) Sheet Metal Workers Union 1502% Broadway Sheffield, Carlton M (Marie) auto repr Post Office al h906 Walnut Sheffield Carrie r759 Pine Sheffield Lottie r759 Pine Sheffield Mattie (c) lndrs h204 Douglas av (V) (Sheffield Nancy (wid Mark C) h759 Pine Sheffield Peyton (c) porter rllO Middle CIVIC Life Of Your CITY (SM) Shuttles Jack C (Dealva) swtchmn h3901 Houston av (SM) Shuttles Rubie student r3901 Houston av (SM) Shavers Jos N porter Snyder's Ready-to- Wear r473 Chestnut Shaw Alice (wid Oscar T) h404 Pio Nono RV (V) Shaw Eliz, jr opr SBT&TCo rl28 Pearl Sh(aEwM^E) noch (c; Carrie) h909 Clinton rd Sheffield Tealie D spotter Snow's Lndxy & Dry Clng Co r759 Pine iSheftall Chas H (c)_ barber Willis Brasil Barber Shop r418 Pio Nono av Sheftall Jackson (c; Martha W; Willis Braswell Barber Shop) h702 (700) 3d av (V) Sheftall Minnie (c) barber h418 Pio Nono av (V) ShoeffPtaullblWic iWlliselBfare(cr)41c8asPeiwo kNroCnoityavD(eVp)t 323 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 Shefton Anna (c) rl07 Chestnut Shefton Cath (c) tchr PS hl07 Chestnut Shehee Enorka (wid Jos H) hi 16 Stone- wall pi (V) Shehee Evelyn L sten Am Optical Co rll6 Stonewall pi (V) Sheldon Harry L (Esther L) opr Fenner & Beane r Bloomfield rd Shell Clifford H (Emma E) h412 Winship (TO Shell Clifford P (Lillian R) crane opr CofGRy h249 WinShip (WH) ShWelilnSChliipffo(rWd HP) jr appr CofGRy r249 Shell Josephine r902 Boulevard (NH) Shell Petroleum Corp Stewart O Cun- ningham agt office 1368 Broadway fill sta 106 Vineville av (V) Shelley Annie M (c) hlpr r411 Industrial Home rd Shelley B Y lbr inspr Willingham Sash & Door Co r Richmond Shhe'5ll7e0y Chas Siam (c; Rose) (EM) wtchmn CofGRy Shelley Eliza (wid Geo) r23l Reid (SM) Shelley Emma (c) r411 Industrial Home rd Shelley Geo S lab h231 Reid (SM) Shelley Johnnie (c) r411 Industrial Home Shredlley Magdaline fctywkr r413 Chap- pell (SM) Shelley Mary L elk Ga Market House r RD 4 Shelley Monroe (c; Minnie L) farmer h 110 10th av (B) Shelley Ola (c) r411 Industrial Home rd Shelley Solomon (to; Annie) plmbr h411 Industrial Home rd Shelley Solomon jr (c) r411 Industrial Home rd Shellhouse Leon student f1355 Edgewood av Shellings John (c; Lelia) lab rill Drews qtrs SShheellllynuCt lJaudAe sBlsm(nMar5rg6t0) Pmluilmlwkx Bibb Mfg Co hl33 Fort Hill (EM) Shelly Jas (c; Mary E) farmer h314 Ce- dar (U) Shelly Lucinda (c) r321 Cedar (tO Shelly Nellie (c) Indrs hl204 3d Shelly Sampson (c; Willie M) lab CofG Ry h503 Moore av Shelton Clarice millwkr Bibb Mfg Co r 906 New Shelton Elbert M Rev (Beulah) pastor Church of The Nazarene h251 Jeff Davis (SM) Shelton Harry J (Mildred A) millwkr Willingham Mill h764 Plum Shelton Jewel waiter r345 Flanders (E M) Shelton John (c; Minnie) lab MD&SRR hl006 Broad (EM) Shelton Jos W (Willie M) loco firemn hi24 (102) Charles (SM) Shelton Needham (Lillie) lab hlOl Yates av (EM) Shelton Oliver (Luvinia) h345 Flanders (EM) Shelton Otto (Agnes L) pntr h302 Belmont av Shelton Paul (Eliz) millwkr Bibb Mfg Co mi 1st Shelton Snow (c) r418 (282) Phillips la (EM) Shelton Thos (Susie M) plmbr r404 Fort Hill (EM) Shelton Wm (c) porter Arth J Kelley rl42 Bay Shelverton Hovis M Mrs casewkr City Dept of Public Welfare h852 1st ShKepnaortdt C(ShMas) D (Mattie M) cond hl29 Shepard Ethel M rl29 Knott (SM) Shepard Georgia r767 Poplar Shepard Grace G millwkr Bibb Mfg Co r 219 (220) Maynard (EM) ShneipnagrdNeGwrsafrt2o1n9 d(i2s2t0)mMgraMynaacrodn (EEMve)SShheeppaarrdd RJeosbstieBMmasctuhdCenoftGrRl2y8 Rembert Shepard Roger O (Myrtle) mach CofGRy hi03 Richmond Shepard Talmage student Ga Academy SHfoErPtAhReDBlVinOdLrLBEYoxC21(3EHunaimceilEto)n, CGhaief City Fire Dept, Tel 1880, hl28 Rembert av, Tel 2478-J Shepard Volley N (Leona V) city firemn h271 Oakland av Shepard Wm A (Mary V) bus opr Ga Power Co h219 (220) Maynard (EM) Shepard Wm D student r219 (220) Maynard (EM) ShejChard Harriet student rl05 Madden Shephard Jas G (Ola M) wtchmn Taylor Iron Wks & Sup Co hl05 Madden av Shephard Thos D rll5 Monroe (U) Shepherd E B (Gladys) plmbr h635 Elm Shepherd Inez millwkr Bibb Mfg Co r5 Bibb av Shepherd lone student ri'10 Laurel av (NH) Shepherd Jeannie W elk Conn Mut Life Ins Co rllO Laurel av (NH) Shepherd Jewel millwkr Bibb Mfg Co r5 Bibb av Shepherd John R sta mgr Power Oil Co r811 Poplar Shepherd Leon fctywkr Happ Bros Co r 255 Jeff Davis (SM) Shepherd Louis A (Mary) slsmn h711 Napier av Shepherd Louis A jr slsmn -r711 Napier av Shepherd Madye R (wid Wilmer) hllO Laurel av (NH) Shepherd Maggie (wid Albert) millwkr Bibb Mfg Co h741 Hawthorne Shepherd Mollie (wid Benj F) r665 Elm Shepherd Ray private sec rllO Laurel av (NH) Shepherd Roland driver PO r811 Poplar apt 14 Shepherd Rosalie r255 Jeff Davis (SM) Shepherd Rowland atndt r369 1st S h7e6p4paOrgdleAthlmorapepaymstr Bibb Mfg Co r Sheppard Chas M (Hilda) inspr rl03 Newberg (SM) Sheppard Christine Mrs millwkr Bibb Mfg Co r407 Walnut Sheppard Geo W millwkr Bibb Mfg Co r764 Oglethorpe Sheppard J Edw (c; Eliz) carp h305 Broad (EM) Sheppard Marion (Edweiner) elk r871 Sh2edppard Oscar (c; Lula) h411 (454) Womack (EM) Sheppard Robt (Christine) r407 Walnut Sheppard Willie M millwkr Bibb Mfg Co r764 Oglethorpe Sheppard Zoe R Mrs r375 Orange SHERIDAN ALBERT E (Edna), Mgr Georgia Roofing & Supply Co, h230 Tatnall, Tel 1527-W Sheridan Alma E tchr PS rl29 Park pi Sheridan Chris F (Lillie K) h318 For- syth Sheridan Christopher R student rl29 Park pi Sheridan Edw A (Alma K) trav slsmn h 129 Park pi Sheridan John V (Theresa) mgr X V Clothes Shop hl20 High Sheridan Jos A (Anastasia) major TJ S Organized Reserve h409 College Sheridan Julia rl23 Park pi Sheridan Leo D (Kathryn L) dept mgr Builders Lbr Co h544 Ridge av (V) Sheridan Mary student rl29 Park pi Sheridan Phillip J student rl29 Park pi S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 324 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & CO. Members N. Y. THIRD AT PINE CMC TRUCKS PHONE 5100 Stock Exchange N.ExYc.hCanogtteon Chicago Board of Trade AssNoc. iaYte. MCeumrbbers Exchange Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 40S Ga. Casualty Bldg. Phone 1681 Sheridan Robt E rl23 Park pi SHERIFF S E OFFICE (mSeaechBiCbbo--fGCRoyunty of), Tels 448 and 449 Sherling Angelia K tchr PS r302 (303) ShHerilgihntgowBeerssie M Mrs r302 ( 303) High- tower Sherling Emmett L h302 (303) Hightowr Sherling Jas E (Elmer K) contr h311 Hightower Sherling Madge R sec-treas Kenmore Burns Inc r302 (303) Hightower Sherman Aaron (c) lab hll4 (16) Or- chard av Sherman Alice (c) lndrs h869 Ocmulgee S1M)man Andrew (c) 1-611 Maynard (E Sherman Annie (c) maid rll5 (401) Or- chard av Sherman Benj (c; Lizzie) pntr h rear 147 High Sherman Emmett (c; Marie) lab hl20 (13) Turpin la (T) Sherman Ernest Cc; Mary) lab rl34 Maughon (V) Sherman Ethel M (c) student rll4 (16) Orchard av Sherman Fannie (c) r610 (611) Shoals al (EM) Sherman Felton (c) rll4 (16) Orchard av Sherman Hattie Mrsj'821 2d Sherman Henry (c) student rll5 (401) Orchard av Sherman Jas (c) lab rll5 (401) Orchard Sherman Leola (c) r365 (412) Alabama (SM) Sherman Lizzie (c) cook r rear 147 High Shi Susie (wid Erbin) bkpr hi 173 Ash Slhi Trammell F student r30S Cherry av ShNirboltStmggchlaamra K dx (wid (NH) Wm L jr) h!09 Shields Hyacinth tchr Central City Coll Shier David S student r774 Walnut S1yShrieIrsaid778re WaalynuGt ) shoe repr Samuel Ray G Mrs r778 Walnut slswn Dannenberg Co Shier Sami (Semah) shoe repr 365 Broad- way h774 Walnut Shiflett Mary E Mrs millwkr Bibb Mfg Co r28 Brigham Shiloh Baptist Church (c) 421 Annie- wood (EM) Shine Benj (c; Emma) h293 Harris lale(EM)1'ity hl45 Cole Shinholser Mamie (wid Wm M) gro 237 WinshiD (WH) rl36 do Shinholser Martha (wid Thos) r450 Washington av Shinholser Nettie M slswn rl30 Gordon (SM) 1$ Answered By the Classified Lists In this Stlleger&irm H (Jessie) cond ^209 ColShSehrreirlriilEl)(Gho6r0d7onFo(ArsliyctehE; Worsham & Sherwood A Traywick pres Sherwood Lbr Co h2410 Forsyth rd Sherwood Cason (Mamie B) carp hl08 Heard (SM) Sh(eorMwo)od Elfe F student r695 Anderson Sherwood Emmett L (Alice) eng hi 104 Napier av Sherwood Esther tehr PS r2410 Forsyth trd Sherwood Geo E elk r695 Anderson (SM) Sherwood Gugel E (Annie M) h695 An- derson (SM) Shinholser W Jesse (Della) eng hl30 Gordon (SM) Shinholser Walter N gro 2822 FOrsyth rd h2505 do Shlimnghohls9t5e8r D(9a5i7s)yB(rco)adma(iEdMH) otel FickSlHunahzeollster Jas (c; Lilly) pdlr h770 Shinholster Jesse (c) porter Am-erson's Sandwich Shop X308 Campbell av (SM) Shinhoister Matilda (c) h7 3d St la sh'"bhbosM;fgclCoverl5"09dM(co;nrMoearie) millwkr Shipman Alex H (Annie J) slsmn h264 Columbus Shipman Horace T student ri673 3d Shipman Martha L student rl673 3d ShHeI?dd(SM7y ^ L6Ster Grady r108 Sherwood Jack elk rl08 Heard (SM) Sherwood John H (Eula H) jwlr 650 Cherry r Wesleyan dr Sherwood Lou Q (wid Geo W) hi 12 Academy Sherwood Lumber Co A Traywick Sher- wood pres 800 San Juan av Sherwood T Albert student rl08 Heard (SM) Sherwood Thos B (Carrie M) loco eng hl543 College Sherwood Thos B jr (Annabelle) asst mgr Met Life Ins Co h311 Duncan av Sherwood Wm W (Rose) eng h200 Boulevard (NH) Shetine Wm (c) lab h256 Orange St la Shi E Barge student rl40 Beech av Shi Jas D (Josephine M) carp hl40 Beech Shi Jas D jr elk rl40 Beech av Shi S Robt (Lucile T) h306 Cherry av Shi S Robt jr (Henrietta S) surveyor r 646 Forsyth Shipman Oliver S (Annie S) tube bender Dixie Neon Shop hl673 3d SsihyHiPpapPtcPBheeerrncjyCRoGh(3(W1D2iollrBioeetheceSha) Sav)busylsemr nAA S S ShHipaptcShuesrieCoChsSt3e6nHMilDly&erSaRvR(Cr4H05) Car- ling av Shipps Harrold S tmkpr r216 Magnolia Shipps Mary w tchr PS r405 Adams Shirah Albert V (Rosa L) millwkr Will- ingham Cotton Mill hl667 3d Snnah Alice (wid Wm A) hl09 Cedar (S ShM,n)ah Henry N (Thelma O) mech Steve M Solomon Jr hlio Dixie -av (SM) Shmey Annie r slswn Dannenberg Co r464 Orange Shirley Danl (c; Leila) lab hi 13 Drews qtrs Slnrley Hill Club r432 Nottingham dr (N H) Shirley Jasper L (Annie R) ins agt r464 Orange 325 The World*s Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Shirley Louie A home purch mgr Equit- able Life Assurance Society of the Uni- ted States r617 Mulberry Shiver Lillian smstrs rl335 2d Shiver Wm H (Estelle) city contact rep U S Re-employment Serv h'297 Orange Shivers Anna B (c) cook hl20% Lawton la (V) Shivers Claud (c) lab r321 Berry Shivers Edna M (c) maid r408 Monroe Shivers Louise (c) h85o (856) 3d av (V) Shivers Lula (c) lndrs h408 Monroe Shivers Walter O (Mary T) porter Macon's Pharmacy rll8 1st av (U) Shoat Jas (c) lab h9 (3559) iDuffey's al Shoat Thos (c) lab h772 Reynold's al Shoates Charlie M (c) lndrs hl02 Smith (EM) Shoates Ellen (c) maid r435 North (V) Shoates Lillie (c) maid r435 North (V) Shoates Mattie maid Union Dry Gds Co Shoats Nottia (c) r701 (362) Charles (S M) Shoats Ray (c) porter Marilyn Slipper Shop r511 Calhoun Shoemaker Leonard J (c) loco firemn h 233 Gilmer Shoemaker Lonnie W hlpr Swift & Co r 114 Rose pk ShBorroesadEwdawy bartndr Green Front roll Shores S Ann (wid Frank M) h2338 2d Shores Willard M (Lula) cash Spiller's Restr x* RD 4 Shorter Butler E (c) h674 Douglas av (V) Shorter Edw S artist hl30 Georgia av Shorter Geo (c) lab rl Berthadale dr (V) Shorter Jos W (c; Theodosia) porter Richardson Produce Co h51 Parker av (V) Shorty's Tavern (Warring R Masters) 2915 Houston av (SM) Shouse Alberta rl06 Park pi Shouse Alex F emp CofGRy r205 Peach- tree (EM) Shouse Arrie M Mrs rl02 2d Shouse B B firemn MD&SBR r618 Hem- lock Shouse Edgar S (Ethel) loco eng 1)2324 Forsyth rd Shouse Harry rl06 Park pi Shouse Jas P (Lucille B) cond hl06 Park Shpoluse Julius S atndt r2324 Forsyth rd Shouse Mary H student rl06 Park pl Shouse Melvin A (Edna B) atndt rl06 ShPoaurske pl Spear jr (Nellie A) millwkr Bibb Mfg Co h460 New Shrem Abr (Emma) gro 432 Flanders h 428 do Shrem Abr '(Florence) slsmn hi 130 College dr Shrem Gabriel S (Madeira Linen Shop) r!130 College dr Shrem Jack (Fannie) gro 209 Alabama (SM) h702 Daisy (SM) Shrem Rachel r432 Flanders (EM) Shrem Sarah r702 Daisy (SM) Shrem Sarah r432 Flanders (EM) Shrem Solomon slsmn Madeira Linen Shop rll30 College dr Shriers Ophelia (c) cook r332 Dempsey av (U) Shropshire Jas L (c) h604 Fort Hill (E M) Sharvopshire John slsmn r240 Washington Shropshire John T (Eula) plmbr 517 Cotton av h609 Log Cabin blvd Shroyer Clifford B R'ev (Mary) pastor h 1171 Ash Shuford Helen, jr opr SBT&TCo r321 Montpelier av Shuford Naomi Mrs elk r321 Montpelier Shuften-Olivia (c) tchr h236 1st av (V) Shuler Frances instr SBT&TCo r32 Mar. ion pl (WH) Shuler Walter E (Frances W) slsmn r32 Marion pl (WH) Shuley Martha (c) maid hll5 Opera House al Shultz Dock M (Mary L) wtohmn hl020 ASh Shupe Elmer L prsmn Coggin & Mann r255 Oakland av Shupe L Roy (Hallie P) formn Maxwell Bros Inc h255 Oakland av Shupe Sarah M r255 Oakland av Shumey Jas (c) cook r338 Dempsey av (U) Shurney Vine (c) porter r338 Dempsey av (U) Shy Eula B '(c) lab h505 (504) Hall (E M) Shy Lamar student rlOO Cabaniss av (E M) Shy Steve elk r732 Montpelier av Siegel Alvin E phys 516 Mulberry R609-11 r363 3d Siesel Apartments 563 College Sigma Alpha Espsilon Fraternity Wm Knox pres 936 College Sikes Amos M (Mamie) dispr hllO (100) Avon rd Sikes Bernice sten rllO (100) Avon rd Sikes Edna student rllO (100) Avon rd Sikes Elma D sten U S Dist Resettlement Admin r860 Mulberry Sikes Hattie office sec h401 College apt 6-1 Sikes Jas C (Lenora) prsmn J W Burke Co hl528 2d Sikes Jos S (Evie) plmbr appr Millirons Plmbg & Htg Co hl920 2d Sikes Julian M customer's mn Fenner & Beane rllO '(100) Avon rd Sikes Marguerite smstrs rl526 2d Sikes Mattie (wid Jas G) rl526 2d Sikes Robt elk rl526 2d Silas Edw (c; Tommie) rl04 (8) Clara (EM) Silas Hennie (wid John P) rl31 High Silas Julia tchr PS rl31 High Silas Sarah (c) h409 (452) Womack (E M) Silk Stocking Hospital (Geo R Schelling) 117 Cotton av Sills Harry (Agatha) USN h301 Brent wood av Silver Dollar The (Jas M Simmons) beer 316 Broadway Silver Moon Cafe (Andrew Moutos) 311 Broadway Silvers Mark (Fay) pres-treas Burns Boot Shoppe Inc h302 Corbin av (V) Silvius Chas T (Duchia R) miller h603 Log Cabin blvd Silvius Duchia R Mrs tohr PS h603 Log Cabin blvd Simmone Emma (wid Jos) rl977 3d Simmons Addis F (Ethel) brk lyr h560 Edgewood av (SM) Simmons Annie C (c) student rl022 Oc- mulgee Simmons Arth (c) lab hT20 Daisy (SM) Simmons Arth J (c) r430 (431) Peters al (EM) Simmons Aubrey T r852 Elm Simmons Azalea (c) maid h208 Woodcliff Simmons Bessie M (c) r649 Elm St la Simmons Beulah (c) cook rl!5 May av (U) Simmons Brantley K (Frances B) asst Chf WUTelCo r Bloomfield rd Simmons Chas (c) lab rl31 Ritchey (E M) Simmons Collier (c; Lucile) hl03 Cutro al Simmons Cornelia hse maid Ga Acad- emy for the Blind r227 (334) Fargason (V) Simmons David (c; NoraB) lab h212 Turpin (T) DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on ue R. L. POLK & CO. DETROIT 326 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Simmons Dorothy H tchr PS rllO Clisby pl (V) Simmons Edith (c) rl90 Lincoln av (V) Simmons Edw (c; Eula) lab h361 (460) Alabama (SM) Simmons Mamie (c) h649 Elm St la Simmons Mamie (c) Indrs hl064 (1066) SimOmcmounlsg^eMe arie Mrs sten Jackson-Wynn o W1OC0Di H J W Simmons Edw C '(Rosa) brklyr r660 Elm Simmons Ella E (c) rl043 Pio Nono av (V) Simmons Elnara (c) maid Hotel Lanier r 147 Hill Simmons Eistelle (c) h858 Poster's al Simmons Eva M (c) maid rllO Gantt City rd (SM) Simmons Floyd (c; Eva) lab hllO Gantt City rd (SM) Simmons Fluellen (c) book hl21 (21) Wise av (V) Simmons Fred W (Josie K) h817 New Simmons Geo (Laura) hlpr Buck Ice & Coal Co r Unionville Simmons Geo (c) lab rll5 May av (U) Simmons Geo (c; Laura) lab hl07 2d av (U) Simmons Glena sten Progressive Life Ins Co r210 Grenada ter Simmons Grocery Co (Harry and Moses I Simmons) 973 Hazel Simmons Marion (Louise) brklyr rl530 2d Simmons Mary (c) r813 Center (EM) Simmons Mary (c) 1*349% Hawthorne Simmons Mary (c) Indrs rl03 (3) Frank Oil Simmons Mary L Mrs millwkr Bibb Mfe Co h852 Elm Simmons Minnie (c) Indrs rl057 Pio Nono av (V) Simmons Moses I (Aline F) gro 973 Hazel h514 Beech av Simmons Nora (c) Indrs r227 (334) Far- gason (V) Simmons Nora B (c) emp Snow's Lndry & Dry Clng Co r212 Turpin (T) Simmons Norman (c; Greenie) lab hSll Calhoun Simmons Ola M (c) rl29 (151) DeBorde (SM) Simmons Olive D (wid Wm S) h457 Spring <2 o oS 2 c22o pjU I2--I BMWJ U fli a | og -J 2i U4 2 X Oh u n us Snhth^Ruth nurse County Bd of Health rl86 English av (V) Smith Ruth student r701 Winton av Smith Ruth Mrs h716 3d Smith Sadie (c) lndrs r325 Middle (V) Smith Sallie (wid Jacob N) r207 Wash- ington av Sm(SitMh)Sammie L (c) r400 (301) Charles Smith Sami (c) ifctywkr ,r547 (447) Smith (EM) Smith Sami lab Taylor Iron Wks & Sup Co r366 (365) Hawthorne Smith Sami (Othera) millwkr Bibb Mfg Co r9 Bibb av ton av Smith Walker (c) lab City Smith Walter D elk Taylor Iron Wks & Sup Co r371 1st Smith Walter E (Mary) millwkr Wil- lingham Cotton Mill hl09 (46) Holt av (NHts) Smith Walter E (Henrietta L) slsmn Natl Biscuit Co hl701 Vineville av (V) Smith Walter S slsmn Maxwell Bros Furn Co rl6 Marion pl (WH) Smith Warren (c) r410 (512) Maynard (EM) Smith Wesley (c; Leola) lab Standard Oil CO h410 (317) Charles (SM) R. L. POLK & CO. DETROIT t 336 EDWIN S. DAVIS, District Agent JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 Smith Wesley L (Mary L) h220 Bacon Smith Wm (c; Maggie) rl018 Broad (E M) Smith Wm (c) r216 Elliott (EM) Smith Wm (c; Nellie) rl22 (14) Fulton al Smith Wm (c) h516 Womack (EM) Smith Wm (c; Laura) firemn h966 Oc- mulgee Snaelad Mary L (c) lndrs h5 (152) Bright Snead Sami J (Eunice R) auto mech Colbert Mfg Co h211 Newberg (SM) Snead Walter (c; Ethel) lab hl56 5th Sneed Louis (c) lab rl014 Ocmulgee Sneed Mary J (c) rl404 (404) Ardvines al Smith Wm (c) lab City Snell Clara M (c) r504 O'Hara la Smith Wm (c) lab r390 (102) Lexington Snell Cora B (c) maid rl25 (15) Frank- (EM) lin St la Smith Wm (c: Nellie) lab hl04 Peacock (SM) Smith Wm (c; Annie M) lab r310 2d av Snell Elorious (c) rlOO (101) Thomas (EM) Snell Floriede gro 3203 Houston av (S Smith Wm (e: Charity) lab hl04 (6) Toombs (SM) Smith Wm (c) lab rl20 Wise av (V) M) r3303 do Snell Jas (c) porter rlOO (101) Thomas (EM) Smith Wm (c; Estella) porter South- Snell Judge G (c; Mary) millwkr Bibb eastern Exp Co h388 Boardman's al Mfg Co hlOO (101) Thomas (EM) Smith Wm (c; Rosetta) porter h236 (161) Disroon al Smith Wm (c) porter r411 Madison Smwiatyh hW37m5 M(c:idAdlveer(yV) )restr 361 Broad- Snell Julian E (Mattie) blrmkr h3303 Houston av (SM) Snell Sallie (wid Maxie) r3303 Houston av (SM) Smith Wm student r219 (218) Log Cab- Snellgrove G Emmett (Cath K) city edi- in dr tor Macon Telegraph r33 Arlington pi Smith Wm jr (c) lab rl04 Peacock (SM) Smith Wm A (Clyde) inspr hl34 Ponce de Leon av (SM) Smith Wm B (c; Lucy) tailor 416% 2d h do SSTMmlitthh Wm D Wm G rl'701 Vineville av (V) (Sallie V) gro Clinton (E M) nr River rd h do Smith Wm G (Claud) mach opr h207 Forsyth Snellgrove Walter L (Nettie E) elk h343 Carhng av Spelling J Palmer CS pract 516 Mulberry R909 r do Snider Frank (c) r904 Hazel Snider Jas H (Eva) supt h864 Mulberry apt IF Snipes Ada Mrs rl31 Rembert av Snipes Elenora Mrs rll9 3d Snipes Garage (Reuben W Snipes) auto S M)h Wm J (Willie B) r101 Heard (S Smith Wm J (c) delmn rl54 Guernsey idi Smith Wm L (c; Rosa) restr 970 Ocmul- gee r rear 161 Franklin Smith Wm O (Mattie B) barber 3106 Houston av (SM) hlOl Heard (SM) Smith Wm R (Ida T) proofreader Ma- reprs 617 Broadway Snipes Louis A elk j Backer Fum Co r 2321 Broadway Snipes Mary (c) lndrs hl!3 (159) Elizabeth (SM) Snaigpee)s hRle8u8beLnauWrel (aEvloi(sNe;H)Snipes GarSnipes Rosa (c) lndrs rlOl Hicks al con Teleg Pub Co h217 Adams Smith Willie B (c) rl409 Broadway Sn5^theSh1.l3^5y?(3oe2n5=)lc^C,lFalrokra(EM)barber 219 Smith Willie M (c) rll06 Elbert (SM) Russell A (Edna) reprmn h308 SMITH & SMITH (John R L, Joseph LeConte and Furman Smith), Lawyers Cherry av Snooks John r411 Jackson Suite 522 Bibb Bldg 403 Cherry, Tel 375 Smith & Watson (Chas M Smith Melvin fSmow7 Adeline (c) Alf student h5 Buckner al rl03 (264) Pearce (E J Sires) printers 517 Poplar Smith's Battery & Electric Co (Jerry T Snow B Cubbedge (Frances C; Martin Smith) 654 Mulberry Smithey Annie B (wid Steph L) rl2 SmRiatnhdeyolpLheopiW (Mary D) millwkr hl2 Randolph pi Martin & Snow) hll6 Callaway (V) Snow Berris B (Lucille) supt Bibb Mfg Co h630 Oglethorpe Sn(o2w64)CPuretaisrcemi(lElwMk)r Bibb Mfg Co rl03 Smithey Sami L millwkr rl2 Randolph SmPoi thers Edw (c) r456 Bay Smothers Johnie (c) lndrs r227 Neal av Snow Ernest (Winnie) h250 Hydrolia (EM) Snow G Norman (Essie D) millwkr Bibb Mfg Co rl429 3d (V) Smothers Jos (c) formn Willingham Sash & Door Co Plant r213 Ocmulgee Smothers Laura (c) lndrs r227 Neal av (V) Smothers Nancv (c) lndrs r227 Neal av (V) Smothers Ned (c) h456 Bay Snow Georgia C (wid Wm) h538 WashSnionwgtoHnaramv on A millwkr rl429 3d Snow Jas E sec-treas Snow's Lndry & Dry Clng Co r Savannah Ga Snow Jas E steelwkr Taylor Iron Wks & Sup Co r2023 Broadway Snow John O millwkr Bibb Mfg Co h553 Smothers Robt (c) r456 Bay Smothers Thos (c; Jessie) porter Mc- Kesson-Riley Div h227 Neil av (V) Smothers Wm (c) r456 Bay Oglethorpe Snow Oliver E (Thelma) driver r553 Oglethorpe Snow Oswald rl03 (264) Pearce (EM) Smugles Jos (c) lab r213 Ocmulgee Smyly Andrew J rll5 Garden (EM) Snow Roy G (Monteen) basket opr hl25 Knott (SM) Smyly Frank D r667 2d Snow Sallie L Mrs hl429 3d Smyly Jas T (Sarah B) electn h310 Cut- Snow Wm (c) hlO (7) Short st la' ter's Green (EM) Snow Wm A (Martha S) pres Snow's Smyly Jas T jr electn r310 Cutter's Laundry & Dry Cleaning Co hlQ8 Os- Green (EM) borne pi Snead Dewey (c) lab rl56 5th Snow Wm L hl03 (264) Pearce (EM) Snead Harry R (Hattie L) butcher h312 Snow Wm L student x;l03 (264) Pearce Ormond ter (EM) 337 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses ami Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 SNOW'S LAUNDRY & DRY CLEANING VCO-P, rWesm, JAamSensowEPSrenso-wMgSre,cB-TBreRasa, tl7i7f0f Poplar cor New, Tel 6000; Milledgeville Office Tel 440, Bamesville, Tel 233 (For further information see right side lines and page 22 Buyers' Guide) Snowden Andrew W (c; Lucille) loco firemn hl06 DeBorde (SM) Snowden Ernest (c) rl06 DeBorde (SM) Snyder see also Schneider Snyder Lee W (Mary) cond h205 Villa Esta Sntyod-Wer eLaor)uish5N15(JNulaiap:ieSr nayvder's ReadySnCyodmerpWresms &I (WLohusieseC) oelhkl3S5ouBthoeualesvtearrnd Snyder's Ready-to-Wear (Louis N Snyder) clo 622 Cherry Snyers Cora L Mrs h Clinton nr River rd OEM) Social Workers Club meets 1st Monday of each month 453% Cherry Society Hall _(c) 614 (432) Flanders (E Sockwell Chas H (Annie M) slsmn Tay- lor Iron Wks & Sup Co h749 Black- burn (NH) So'lcum Sol (c) lab rlll6 Montpelier av Solem Edw mgr Fairyland Dairy r507 Georgia av Solley Boyce (Odessa) USN hl307 Ridge av (V) Soloman Chas (c: Willie) lab h607 (106) Elliott (EM) Soloman Lee (c: Lugne) hlpr CofGRy h 321 % 3d av (V) Soloman Co Mattie (c) lab Central City Bag Soloman Robt (c: Estella) rl21 Tatnall SSoolloommoonn AAddMiear(ica) h(3c)40tc(3h6r5)r722d1 a3vd (Uav) Solomon Addie L (c) maid r314 Jeffer- son Solomon Arth (c: Sophie) lab r242 Water- SovloilmleonrdBertha M (c) rl03 (207) Henry (SM) Solomon Bessie B (wid Wm G) interior decorator Union Dry Gds Co r218 For- syth Solomon Chas (c) chauf rl40 Jones Solomon Chas (c: Winnie) lab CofGRy h 715 Daisy (SM) Solomon Chas ir (c; Daisy) lab r715 Solomon Lewis (c: Leatha) lab r732 (642) Prince (SM) Solomon Lillian R (wid Wm) h218 Forsyth Solomon Linton M (Hazel) h218 Forsyth Solomon Linton M jr student r218 ForSoslyotmhon Lora B elk First Natl Bank & SoTlormusotn LCoouirs30(9c; GMeaoyr)gilaabahvl064 (1066) Ocmulgee Solomon Louis (c) porter Tip Top Serv- ice Station r714 (624) Prince (SM) Solomon Louise cash Chapman's Phar- macy rll7 Park pi Solomon Lucille (c) student r309 Jeffer- son SSoolloommoonn MLualiatla(ncd) Rh24o0ffiMceit3c5h3ell3d(Er3M0)9 SoGloemoorgniaMaavmie L (c) hl03 (207) Henry (SM) Solomon Mary (c) maid r861 Edgewood av SSoolloommoonn NMaathttaienie(lc)(c;r31B0eu1lasht )avmil(lVw)kr SoBloibmbonMPfghiClipo h(ci:16Re(b1e1c6c) aP) opwoerltler(ErlM52) Hill Solomon R Clinton (Ella) h471 Orange Solomon Raymond student r218 Forsyth Solomon Rebecca maid Hotel Macon rl52 Hill Solomon Robt (c) lab r!27 (17) Franklin Sosltomlaon Robt D (Harriett N) dentist 403 Cherry R3Q9 r220 1st Solomon Roberta (c) r702 (320) Colquitt Solomon Rosie D (c) student r309 Jef- ferson Solomon Sophie student r471 Orange Solomon Spink (c; Manie) h522 North- ern av (EM) SOLOMON STEVE M JR (Mary E), Dis- tributor for Dodge Brothers Motor Cars and Dodge Brothers Trucks, Plymouth Cars, 462 Broadway, Tels 49564957, hl24 Oak Haven av, Tel 4595 (For further information see right side lines and page 4 Buyers' Guide) Solomon Steve M III (Eliz F) slsmn Steve M Solomon jr hl22 Oak. Haven av Solomon Theo (c; Juila) pdlr h765 Glen (EM) Solomon Tommie hlpr Texas Co r RD 4 Solomon Villa M (c) h8 Murray al SoDloamisoyn C(ShMlo)e (c) lndrs r211 Lynwood av (V) Solomon Cicero Z Rev (c; Exa) h721 3d Solomon Webster (c: Trudie M) plmbr hlpr rl23 (202) Magnolia la Solomon Wm (c; Irene) h608 Norris (E M) av (V) Solomon Clinton R lab r471 Orange Solomon Edw (c; Irene) janitor hllOl Pio Nono av (V) Solomon Eliz (c) rl40 Jones Solomon Eliz D (wid Robt E) fum rms 220 1st h do SolomonJEnglish student rl24 Oak Haven av Solomon Eva (c) lndrs rl44 Pecan av Solomon Fredk (Lillian S) asst mgr Caro- lina Life Ins Co rT55 Blackburn (NH) SOlomon Green (c) lab CofGRy Solomon Hazel student r218 Forsyth Solomon Wm G III student rl24 Oak Haven av Solomon Wm H Rev (c: Lula) h311 (312) Campbell av (SM) Solomon Wm L (Susie) elk USPO hl04 Academy Solomon Wm L (c) lab r701 (362) Charles (SM) Solomon Wm W (Louise M) h8U Poplar apt 19 Solomon Zebbie D (c) porter r215 5th av (V) Sons and Daughters of Jerusalem (c) 1020 Coleman's la Solomon Jas (c: Cora) lab h710 Daisy (S Sons & Daughters of Jerusalem Hall (c) M) 1022 Coleman's la Solomon Jas (c: Lannie R) lab Central Sorrell Geo B (Alma M) hl08 (109) Pine- Sash & Door Co h300 (142) Plummer's al Solomon Jefferson (c; Mattie M) lab Central Bedding Co h365 Flanders (EM) Solomon John (c: Fannie) lab h215 5th view av Sorrell J Thos (Daisy) mill wkr Bibb Mfg Co rl32 Roff Home la Sorrell Peter mill wkr rl05 Riley av Sorrells Elmer W sheet metal wkr rl03 av (V) Solomon Jos (c: Janet) lab h473 (462%) SoPrrinelelvsieEwugaCv driver Yellow Cab Trans Alabama (SM) & Baggage Co rl03 Pineview av Solomon Leola (c) h8 (908) Clayton (V) Sorrells Geo W (Josie) carp hl03 Pine- Soldtnon Levi (c: Mittie) lab h rear 819 yiew av Ocmulgee Sorrells Gladys I fl03 Pineview av We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 3S4 4th Ave. New York 338 T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety L. 310-12 First National Bank Bldg. Tel. 64 W 0 0 D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 Sorrells J Wesley (Annie) mill wkr r404 Pio Nono av (V) Sorrells Josie Mrs fctv wkr hi03 Pineview av Sorrells Judge C tehr Lanier High Sch for Boys r Bloomfield rd Sorrells Wm J (Annie R) hl04 (105) Pineview av Sorrells Wm S tchr Lanier High Sch for BtoonysrHdolt av (NH) cor Lawton r Hous- Sorrow Beni L (Bessie) pntr h20Q Georgia ter SoDrruonwcaLnucaiuvs C (Helen A) mill wkr r202 Souder Gladys r213 Stanislaus cir Souder Redding C (Maude H) office mgr Jones Johnston Russell & Sparks h213 Stanislaus cir Souder Redding C jr student r213 Stanislaus cir SoGuetho MEacEoznelBl)arb26e6r1Sh2odp (Jas P Stokes, South Side Social Club (c) 423 Cotton av Southeastern Battery Co Inc Leo J Blum pres John E Palmer sec-treas mfrs 757 Broadway SoCuatrhgeiallsteprrnesBGroeaodcPastRinagnkCionInjcr Evd-pwreKs Wilton E Cobb sec-treas 211 Cotton av SoWutmheaLsteRrnobCeortms pmregssr &PoWplaarrehcoourse8Ctho Southeastern Demurrage & Storage Bureau A W Schmidt supvr Plum sw cor 5th SOwUelTlHMEAASuTsEtiRnNAEgtX, PTReErmSSinaClOS, taHtiaornt-, Southern Life Insurance Co of Georgia (Hatcher & McCrary Inc Agts) 508 Mulberry Southern M B asst mgr United Purchasing Co r Miller Field rd SOUTHERN MORTGAGE CO, Jesse B Hart Pres, Jesse B Hart Jr Sec-Treas, 354 1st, Tel 3315 Southern News Co Frank R Talbird mgr news dlrs whol bsmt 403 Cherry Southern Oil Stores Inc (br) Hubert W Wilcoxon br mgr filling sta 200 Broadway SOUTHERN PAINT & VARNISH CO, H Wm Polley Pres, Paints, Oils and Kalsomine Mfrs 561 Mulberry, Tel 2276 (For further information see page 24 Buyers' Guide) Southern Railway System Richd L Butt (div frt and pass agt) Plum sw cor 5th Southern Railway System (div supt) Willoughby H Cheney div supt 108 Terminal Station Southern Railway System (frt depot) Otis G Prentiss frt agt Plum sw cor 5th Southern Railway System (police dept) Plum sw cor 5th Southern Railway System Alonzo N Batchelor chf elk shops Pine sw cor 7th Southern Railway System (shops) 891 Waterville rd Southern Railway System (store house) 891 Waterville rd Southern Shoe Shop (Abr Wolf) 410 Pop- Tel 1326 Southern Sports Co (Henry Kaplan) Southeastern Greyhound Lines Wallace sporting gds 514 Broadway L Whiting dist mgr 320 Broadway Southern Stages Inc Wm A Dix agt 320 Southeastern Optical Co Calvin W Rob- Broadway garage 804 do ertson mgr whol 358 2d Southern Textile Co Alex B Cameron mgr DIRECTORY SoTuhtohseaGsteKrnellUy nednegrw(reintegrisneAersisnogcidateipotn) 403 Cherry R313 women's fumgs 410 Cherry Somutghrla5n6d5 BBarrobaedrwSahyop Jas T Crawford LIBRARIES We Have on File in Our Souther Chas elk Ard Cash Grocery r620 Pine Souther Dorothy r393 Orange Souther Eliz Mrs r393 Orange Souther Geo L (Fannie) cond h873 Hill- yer av CCH) Southland Barber Supply Co (Jas C Lackie) 56 Poplar Southland Coffee Co Inc Dennis F Brown pres R G Drown (New Orleans) vpres Conrad Theiss sec-treas 503 5th Southland Coffee Shop Harry Callv mgr DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere calf on us R. L. POLK & CO. DETROIT Souther Geo L ir r873 Hillyer av (CH) Souther Henry L (Myrtle) driver h2;13 (207) Villa, Crest Souther Jos J (Marie) metal wkr Bart- lett Sheet Metal Wks rll9 Ell (SM) Souther Myrtle Mrs slswn Snyder's Ready-to-Wear h213 (207) Villa Crest Sorutdhoer Robt L auto repr 811 Broadway Souther Willis N (Mary F) driver r616 1st Southerland Donald student r371 1st SOUTHERN BELL TELEPHONE & TELEGRAPH CO, 213 Cotton av, C L Kirven Dist Mgr, Tel 9090, Branch 501505 2d Southern Cotton Oil Co The Aubrey A Almand mgr Waterville rd Southern Crate & Veneer Co J Clyde Tarver ft Poplar Southern Dry Goods Co (Jos Haskins) 470 Poplar SOUTHERN FLOORING CO (W F Muecke), Floor Contractors, Hardwood, Asphalt, Cork and Rubber Tile, Venetian Blinds 616 Poplar, Tel 5695 (For further information see left side lines and page 13 Buyers' Guide) SOUTHERN FLOORING & INSULATING CO, See Georgia Roofing & Supply Co, 306 Oglethorpe, Tel 3121 (For further information see right side lines and page 29 Buyers' Guide) Southern Investment Co (G Thos Dunlavey) loans 407 Broadway R10 restr 567 Broadway SOUTHLAND HOTEL (Otis M Tarver), Headquarters AAA 569-571 Broadway, Tel 3047 (For further information see right side lines and page 17 Buyers' Guide) Southland Knitting Mills (Leon S Dure pres Wesle.v L Hanson v-pres M Merritt Thurman sec-treas 216 Holt av (V) Southland W H (Sadie) dist mgr h553 Boulevard (NH) Southside Church of Christ 2620 Broadway Southwell Marvin L (Alma B) chf elk MD&SRR hl440 College Southwestern Railroad Co Gordon I Hardeman sec-treas 516 Mulberry R 808-09 Sowell Clifford (Hazel) msngr USPO r463 Soring Sowell Eug O (Louise) elk Oscar R Sowell r93 Clayton (V) Sowell Jeanette student r93 Clayton (V) Sowell Leon V (Katie) elk USPO h530 Log Cabin blvd Sowell Mary A student r93 Clayton (V) Sowell Oscar R (Eva O) gro 701 Broad (E M) and 95 Clayton (V) h93 Clayton (V) Spain Janie (c) maid r332 Gilmer Spangler Geo C (Gertrude B) trav slsmn hl30 Coleman av (CH) Spangler Jas C (Martha) eng rl04 Culver (V) Spangler Susan dk Natl Life & Accdt Ins Co rl30 Coleman av 339 PITTS' MORTUARY Phones 146r-11/4177 AMBULANCE SERVICE 814 Mulberry HOTEL SPARKS AUGUSTUS O B (Mattie L; Jones, Johnston, Russell & Sparks), Lawyer 10th Floor Georgia Casualty Bldg, Tels 96-97-98, h Shirley Hills, Tel 1009 ,, , Sparks Charity (c) hl51 E Academy (E M) Sparks Daisy H (wid Ovid G) h238 Hardi- man av (V) _ __ Sparks Dorothy (wid Wm) r250 Wash- Spencer Della (c) maid rl313 1st Spencer Ella (c) Indrs r910 Montpelier av Spencer Etta (c) maid h412 Gilmer Spencer Ida L (c) Indrs h212% Fretwell Spencer John D (Maidee) columnist Macon Telegraph r Shirley Hills Spencer Jos asst mgr r802 Mulberry Spencer Lula (c) maid h378 (384) Mon- tog Spencer Mary (c) maid hl07 (7) Orchard SparksFrank (c: Alline) lab r342 Gilmer Sparks Garten mgr r468 College SSppaarrkkss JIadsa (c(;c)Ahddl5ie M(8)) lMocaol'loswy sitcahlmn h426 Liberty (SM) Sparks Johnnie (wid Robt L) h450 Wash- ington av , , Sparks Julia (c) r228 Moughon (V) Sparks Julia A (c) tchr Ingram B S Sen rl95 Lincoln av Sparks Lillian F (c) student r426 Liberty (SM) Sparks Margt typist WPA . Sparks Motor Co (Willis B Sparks jr) au- tos 613 3d Sparks Specialty Co Jas L Simpson mgr vending machines 525 Mulberry Sparks Wm (c) lab r227 Morgan av (W SpHa)rks WmS (c: Mamie) porter McKes- son-Riley Div hl95 Lincoln av (V) Sparks Willis B (Mary L) h468 College Sparks Willis B jr (Lucile; Sparks Motor Co) h309 Masonic Home rd (NH) SSppeaarrkoewPaJulFMendgrftGsma nPoWweEr llCioott Dun- wody jr r203 High Spear David student r962 Oglethorpe Spear Euria XMazie) mill wkr Willing- ham Cotton Mills h206 Duncan av Spear Jewel nurse 616 Arch r do Spear Josie (wid Geo H) lab r962 Ogle- thorpe Spear Marcus C (Inez) mill wkr Bibb Mfg Co rl22 Yates av (EM) Spear Susie (c) r851 Foster's al Spearman Ansel J mill wkr Willingham Cotton Mills r215 (25) Holt av (N Hts) Spearman John W ir (c; Lizzie) elk H253 Sp2edarsavH (GVr)over (Ollie M) mech Dunlap Chevrolet Co h.115 Capitol av Speer Alma (c) student r245 2d av (V) Speer Estelle mill wkr Atlantic Cotton Mills h31 Atlantic Village Speer Hallie fety wkr Happ Bros Co h212 Calhoun Speer Martha (c) maid r245 2d av (V) Speer Marvel Mrs slswn The Eleanor Shop h221 (220) Log Cabin dr Speer Mattie (c) h245 2d av (V) Speer Otis V (Marvel) bkpr h221 (220) Log Cabin dr Speer Ray W (Jessie B) mill wkr Bibb Mfg Co h60 (4) Roff Home pi Speer Roy (c) r245 2d av (V) Speight Brooks W (Rosalee) mgr hSIO College ant 4 Speight Walter P slsmn Macon Paper Co r Unadilla Ga Speir Annie B rll5 Lawton av Speir Eleanor student rl27 Highland av Speir Louis E (Louise B) asst eng Fire Dept hl27 Highland av Spell Arth T (Palace Barber Shop) r510 Mulberry Spence Claude elk Rogers Stores r436 Ross Spence Ernest R (Dessie) car repr CofG Ry h436 Ross Spence Geder A (Mary F) shoe repr ,1235 Broadway r420 Calhoun Spence John C (Marie) carp h913 2d Spence R Morelle driver Yellow Cab Trans & Baggage Co r913 2d Spence Virginia opr SBT&TCo r436 Ross Spencer Clifford (c; Beulah) lab h6 Elm Spencer Wm (c) butler 1242 Edgewood av Spencer Willie (c) maid r217 (216) Elm SpwenelcleralWillie L (c) maid r212% ,, , Fret- Sperr Chas O loco eng rl04 First av (C SpPe>r'ry Leola (c) Indrs h3 Bay al Spicer Oscar ir student r936 College Spier Annie Mrs rl28 (52) Hydrolia (E SpMie>rs Chas K (Nell B) head reprmn SBT &TCo h208 Brentwood av Spies Augustus florist Idle Hour Nurser- Spiieess rRiFtzor(sEymthmrad) driver h513 Arch Spikes Geo delmn Kinnett-Odom Co r460 SSppiikkeess LLiullcyy ((cc)) r5r41690EHAazcealdemy (EM) Spikes Thos (Magnolia) lab r350 Clinton (EM) Spikes Wm F (Bessie E) mach h506 Edge- wood av (SM) Spikes Wm I (Eliza E) pipeftr h506 Edge- wood av (SM) Spiller Foy M (wid John H) elk h461 New Spiller Jas A (Lucy) hl36 Edna pi Spiller Jas (E (Rilla) carp h542 Log Cabin blvd Spiller O B r Hotel Gordon SSppiilllleerr WWmm AH (S(Epliilzlea)rs hRl5e2st5r) 3dr RD 4 Spiller's Restaurant (Wm A Spiller) 470 Mulberry Spillers Clyde E (wid Lloyd) h952 Ogle- thorpe Spillers Dewey L student r326 6th av (S M) Spillers E Ruth sten r501 Carling av Spillers Eliz jr supvr SBT&TCo rl71 Magnolia _ Spillers Herbert R (Eliz) emp Hill Dry Cleaning Co rl71 Magnolia Spillers Eustace (Clara) drill prsmn CofG Ry r722 Walnut Spillers Liza (wid Augustus) r229 Cedar (SM) Spillers Lorenzo H (Annie L) trav slsmn r501 Carling av Spillers Robt L student r722 Walnut Spillers Walter C (Mattie) sash mkr Wil- lingham Sash & Door Co plant r2831 Houston av Spinks Anne R sten John J McCreary r 1411 Edgewood av apt 1 Spinks Chas driver r768 Cherry Spinks Chas (Lizzie) lab r355 Walnut Spinks Erman I A asst cash Natl Bis- cuit Co rl411 Edgewood av apt 1 Spinks Hurley H elk College Hill Phar- macy r768 Cherry Spinks Lonnie R (Annie) mach hl411 Edgewood av apt 1 Spinks Wm carp r Hotel Gordon Spires Alex driver rl235 2d Spitz Chas A (Edith) office mgr Good- year Service Stores h912 Napier av Spivey Alice (c) Indrs hll3 (350) Spring la Spivev Arlie Mrs h554 Elm Spivey Artis (c) lab rll3 (350) Spring la Spivey Claude (c: Hattie) porter X V Clothes Shop h215 Middle (V) Spivey Enoch H (Ophelia) hl015 2d Spivey Fannie (c) smstrs Harry A Spivey r207 3d av (V) 125 ROOMS Mulberry at Broadway Tel. 4600 Peik's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 340 ^ A 5 LIBRARIES We HiJve on Fite In Our DIRECTORY LIBRARY Copies of the Direetortes of practically Every City In the UNITED STATES and Canada These are for year convenience If you want Information you are unable to procure elsewhere oall on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 1S3 Spivey Felix M (Adell) mech AdamsBuchanan Motor Co r Lizella Ga SpMivuevlbHeraryrryh2A07(c:3dFaanvnie(VM) ) tailor 519 Spivey Henry (c: Arrie) lab hl40 (141) Middle (V) Spivey Ike (c) r515 (798) Waterville rd Spivey Isaac (c; Ella) lab h309 (422) Elizabeth (SM) Spivev John (c; Mary) lab h515 (798) Waterville rd Spivey John A rl015 2d Spivey Lillian H (c) tehr r207 3d av (V) Spivey Lucille r554 Elm Spivey Mary (c) hi65 Hazel Spivey Milton (c: Janie) lab h509 Mon- roe SSppiivveevy MOluivrderock(c;mMsnagtrtierl0L1)5 w2datchmn CofGRy h77 Wilder (SM) Spivey Ollie L (c) lndrs r209 (207) Ocmuigee Spivey Seamore (c) r515 (798) Waterville rd Spivev Virginia mill wkr Bibb Mfg Co r 1221 2d Spivey Wilev (c) lab r435 Chestnut Spivey Wm (c: Virginia) brklyr h260 1st Spaivvey' (VW) m (c: Willie M) lab h603 (207) Colquitt Spivev Wm C (c) r515 (798) Waterville rd SSppoivoenveWr JmEJar(lc)(Mr5a1y5) (s7l9s8m) nWhal0te6rvRilolgeerrds av (V) Sportsman's Place (Abr Wolf) beer 420 Poplar Spradley Cecil (c; Eva) hlpr CofGRv h 501 Fulton (EM) Spradley Wm L r616 1st Spratling J Hook (Pauline W) optom- etrist 652 Cherry hl21 Hines ter (V) Spratling Jas H II (Sara) optician J Hook Spratling h261 Georgia av apt D3 Spraulding Josephine (c) lndrs h523 Hazel Sprayberry Johnnie A emp CofGRy Spring Bill Baptist Church (c) 500 1st av (II) Spring Street Apartments 163 Spring Springs Bovce (c) lab hl8 Murray al Spruce Camille student r2 Gustin pi (V) Spruce John W (Eunice E) mach h2 Gus- tin pi (V) Spruce Robt D waiter Busy Bee Lunch r610 Forsyth Spruce Thelma B Mrs opr WUTelCo h4 Gustin pi (V) Spruce Thurman P (Gladys) elk Johnson Pharmacy rl41 Pierce av Spruce Weslev C (Thelma B) elk Lucky Strike Bowling Alleys h4 Gustin pi (V) Spry Eug (c: Cora) lab h741 Edgewood av Spry John (c; Bertha L) lab r818 Elbert (SM) Spry Sami (c) r741 Edgewood av Spurling Crimel A (Nora) pntr r502 Fort Hill (EM) Spurling J Andrew (Ida H) auto mech r909 Cherry , ,, Spurling Jas (Carrie) r502 Port Hill (E M) Spurlock Beni H dentist 403 Cherry R507 r511 Walnut Staamer Agnes (wid Richd) hl060 Wal- nut Stadium Eug (c: Lendy) lab h238 Jordans al (SM) Stadum Louise (c) rllO (452) Johnsons al Stadum Otis (c: Beatrice) driver r222 Jordans al (SM) Staedtler E Frances Mrs elk Met Life Ins StaCfoforr2d06BeHniigh(c: Addle) meat ctr h307 Monroe Stafford C Kate (c) maid r541 (441) Tin- dall av (SM) Stafford Clyde (c) rl44 (196) Washing- ton (EM) Stafford Earl (c) lab r541 (441) Tindall av (SM) Stafford Edw rl520 2d Stafford Floyd (c; Elnora) hl97 Divi- sion st la Stafford Jeannette student Ethel B Davis Beauty Shop r2344 2d Stianfgfotordn J(eInEnMi)e E (c) hl44 (196) Wash- Stafford Jos Cc: May) lab h317 Norris (EM) Stafford Olivia (c) lndrs h541 (441) Tin- dall av (SM) Stafford Peggy (c) student rl44 (196) Washington (EM) Stafford Ruby (c) rl44 (196) Washing- ton (EM) Stafford Sarah Mrs r2344 2d Stafford Wilev B loco eng hl520 2d Stahle Jas I student rl39 Flamingo dr StaFhlalemiJnogsoRdhr lpr Cliff Walker Co rl39 Stahle Martha. C smstrs Happ Bros Co r 139 Flamingo dr Stahle Rav A (Minnie C) bicycle mech Cliff Walker Co hl39 Flamingo dr Stair Jack (Savannah) slsmn h26l Georgia av apt D2 Stakely Jas O drftsmn W Elliott Dun- wody jr r278 College Staley Carrie (c) r413 Walnut Staley Edw student rlOO Putnam Staley Jas (c) h413 Walnut StCaloefyfeeJasCoHhl(0E4dnAa)yesrslsmrdn Southland Staley Juanita student rlOO Putnam Staley Oliver D (Octavia) hlOO Putnam Staley Pearce (c: Paralee) lab hlOO (406) Randall al (NH) Stalker Ida P student r866 Mulberry Stallings Albert (c) del mn hl25 Army Lot Stallings Ethel maid Hotel Lamar r453 Bay Stallings Henry P (Sallie D) paperhngr h908 Elm Stallings Henry P (Marie A) slsmn Steve M Solomon jr r206 Winship (WH) Stallings John M (Onivia) student rl26 College Stallings Lucile slswn S H Kress & Co r 908 Elm Stallings Willie L interior decorator High- land Shops rl02 Rembert av Stallworth Amon J barber Genones Bar- ber & Beautv Shop r RD 4 Stallworth A H inspr Ga Power Co Stallworth Asberry W (Ida R) store mgr Roger Stores hl21 Academy Stallworth Asberry W jr slsmn r!21 Aca- demy _ ,,, . Stallworth Bradwell G Rev (c: Roberta) Sthalll2w06orth(40C2)aeWsaroo(lcfo: lkGu(sEsMie)) lab h244 (246) Mitchdll (EM) Stallworth Elmer C student r3503 Hous- ton av (SM) Stallworth Felton (c: Odessa) lab h210 StCalllawrkorth(EJMu)lian W collr L B Price Mer- cantile Co r RD off New Dublin rd Stallworth Mack (c: Rosa L) lab h402 Cowan (EM) . Stallworth Mary (c) lndrs r204 (212) Clark (EIM) Stallworth Mattie (c) lab hl21 Ritchey (EM) ^ ,, Stallworth O C bus opr Ga Power Co Stallworth Paul (Nettie: Terminal Serv- ice Station) h678 Courtland av Stallworth Robt B opr Yellow Cab Trans & Baggage Co rl21 Academy Stallworth Robt L (Neva) gro 3503 Hous- ton av (SM) h do 341 ROBERT O. THOMAS 56914 Cherry St. REALTOR Telephone 1067 Stallworth Thos (c: Willie) porter h204 (212) Clark (EM) Stallworth Wm student rl21 Academy Stalnaker Marie H bkpr r805 Woolfolk (EM) Stalworth Bennie (Mattie S) porter Idle Hour Nurseries rl23 Ritchey (EM) Stalworth Mack (c; Leila) hlpr CofGRy h6,13 (239) Hall (EM) Stamatis Louis (R Doris) asst mgr DeStLamuxme CAarfteh hLl02(No(1r4th2) HCigohlqlaunitdt Gro- cery) r Milledgeville rd Stamps Dolores (wid Porter D) elk Clark Memorial Ins h452 College apt 3 SSttaanmcpesl JDaosroHthy(c;r45J2uliCaolBle)gecaarppt h3854 (852) 3d av (V) Stanch Arch (c: Lessie) lab h410 (402) Mitchell al Stancil Arch ir (c) r410 (402) Mitchell al Stancile Doyle T (Lena P) slsmn Toole Furn Co h205 Newberg av Standard Brick & Tile Co Wm E Dun- wody pres Wm J Massee v-pres Sami T Coleman sec-treas 460 Broadway Standard Market (Ralph Bobo) gros 159 Franklin Standard Oil Co John M Gibson mgr whol oils 307 (119) Bay filling stations 2V6i3n8evBilrleoad(Vw)ay 601 2d 80 Spring 102 StaBnrodaadrdwaPyaper Co S Jos Isof mgr 518 Standard Paper & Paper Stock Co S Jos Isaf pres Robt A Willis sec 1911 Broadway Standard Parts Co Clarence G Collins mgr auto parts 702 3d STANDARD SAVINGS & LOAN CO, Geo C Almon Sec-Treas and Mgr, 352 2d, Tel 2437 Standard Stores Inc Arth Haskins pres Mrs Esther Cohen sec-treas dept store 360 3d Standard Wholesale Co Arth Haskins pres Mrs Esther Cohen sec-treas whol dry gds 360 3d Standifer Edw (c) driver Willingham Sash & Door Co plant r226 (22'5) Lee (EM) Standley Sarah (c) h533 Flanders (EM) Standridge Chas C (Margt) shoe repr 630 Washington av h do Stanfield Fredk (Barbara) mill wkr Atlantic Cotton Mills h5 Atlantic Village Stanfield Roy (Mary) fety wkr r224 Forest av (B) Stanford Augustus L (Essie I) cond h231 Beech av Stanford Auren E slsmn r371 1st Stanford Chas (c; Ophelia) lab h227 Hurley la Stanford Dora (c) maid rl04 (105) Pringle (EM) Stanford Doris N opr SBT&TCo r231 Beech av StaBnef^ocrhd aDvorothy R opr SBT&TCo r231 Stanford Jas L (c; Ruth) driver hl36 Woodcliff StManafpolred John (c: Alberta) driver r319 Stanford Leola C (c) r435 Cedar (U) Stanford Letitia (c) maid r435 Cedar (U) Stanford Lloyd (c: Clara) mason hl05 (107) Pringle (EM) Stanford Lloyd jr (c) student rl05 (107) Pringle (EM) Sta(Unf)ord Louis (c; Mav B) labh435 Cedar Stanford Maggie (c) lndrs h404 (104) Lexington (EM) Stanford Mary tchr PS r203 Jeff Davis (SM) Stanford Mozelle (c) rl08 Harris la Stanford Roe (c) lab r860 Hurley la Stanford Sol (c: Eddie M) h503 (127) Norris (EM) .,,. . Stanford Thos B Rev (Estella) pastor Second Street Methodist E Church h 203 Jeff Davis (SM) Stanford Wm H (c; Malissa) h226 (225) Lee (iEM) Stanley A Clement (Anne) loco eng h2601 2d Stanley Bert (c) lab rl9 Wall st la Stanley Carolyn r708 Montpelier av Stanley Carrie E (c) lndrs h347 4th av (V) Stanley Chas (c: Mary) lab hl02 Turpin la (T) , , ._ Stanley David W (Thelma) mech Ga Power Co h708 Montpelier av Stanley Frank (c) lab rl4 Opera House al Stanley Geneva (c) cook rl57 Elm Stanley Hayes (c: Daisy) hl2,l Douglas (SM) Stanley Hayes L (c) del mn rl21 Douglas (SM) Stanley Jas (c) rll5 Opera Hotel al Stanley John E lab r407 Walnut Stanley John H (Mary R) furn rms 407 Walnut h do Stanley L K (c; Minnie) orderly rl57 Elm Stanley Louise Mrs hl23 Magnolia Stanley Louise H Mrs slswn Dannenberg Co r460 Spring Stanlev Maggie rl222 2d Stanley Marvin (c) lab rlO (78) DeBorde (SM) . no SSttaannlleeyy NMaoamryi (rc5)33maOidrarnlg4eOappetra 2H3ouse al Stanley Ora C (c) rl21 Douglas (SM) Stanley Oscar C r5Ql Carling av Stanlev Rosa (c) maid r75 New Stanley Sarah Mrs elk r460 Spring Stanlev Thos (c: Rosalee) h624 Ham- mond ,, Stanley Thos (c) bus boy Jas A Smith r 11 Opera House al StAandlaemv s-WBumchaKnan(MLeootnoorrCa o Fh)l04sRlsomgn- ers av (V) Stansel'l Potato Chip & Sandwich Co Robt'H Frieman pres J Thos Dent sectreas 516 1st Stansell Wm H (Jessie B) mgr Stansell Potato Chip & Sandwich Co r722 1st Stanton Aiken M (Stanton Sound Serv- ice) r320 Hill Crest av (CH) Stanton Clarence H (Wynelle S) driver h 204 Tatnall , _ Stanton Dellie M (wid Geo G) h306 (320) Hill Crest av (CH) Stanton Florence U (wid Clarence H) h 102 Branch (CH) Stanton Francis M student r306 (320) Hill Crest av (CH) Stanton Lizzie (c) lndrs rl015 Edgewood av Stanton Sound Service (Aiken M Stan- ton) radio reprs 203 Cotton av Stanton Wm (c; Frances) bellmn Hotel StaGprealdtoynrJ2a25s AOr(aEnuglea L) pntr 201 Sim- mons h do Stapler Irene (wid Maury M) h203 High Staples Ernest A electn Maxwell Bros Inc r221 Georgia av Staples Grady (Edith) mech Maxwell Bros Inc r313 Forsyth Staples H G bus opr Ga Power Co Staples Jerry (c) lab hl2 Cheatham al Stapleton Ezelle (c) r314 2d av (V) Stapleton Harvey P (Cora E) bus opr Ga Power Co h4i7 Montpelier av Stapleton J Alf student r343 Carling av Stapleton John T (Stella) track formn StCapolfeGtoBnyVr3io21la8 f(e3t2v00w)kHr oHuasptopnBarvos(CSMo )r 104 3d Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 342 Wifv, A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Stargele Eunice B Mrs office sec Morgan Steerman Wm L (Kath K) cook Pig 'n l& Morgan Ins Agcy r21'3 Bond apt B1 Whistle Sandwich Shop r3020 Houston Stark Beni (c) baker Sunlite Elec Bake av (SM) Shop Stefano Christen elk Florida Fish & Starke Dennie rl02 Troup Oyster Co r318% Main (EM) Starke Denny (c; Georgia) driver hl25 E Stefano Frank student r3il8% Main (EM) Ell Stefano Geo (Adeline; Florida Fish & Starke Dorothy private sec Maitland R Oyster Co) r318% Main (EM) Solomon 1'102 Troupe Stefano Jos student r318% Main (EM) Starke John T (Dollie) dispr hl02 Troup Stefano Luke (Rose) slsmn h318% Main Starke Sarah rl02 Troup (EM) Starkes Chas (c; Nora) pdlr h436 Telfair Stefano Rose elk Sam's Mkt r316 Main Starkes Comer (c) porter r436 Telfair (EM) Starkes Edw (c) hlpr Terminal Service Steger Edna student rl405 Oglethorpe Station r436 Telfair Steger Frank B (M Lucille) barber Palm Starkes Henry (c; Zillie M) lab r436 Tel- Barber Shop) hl405 Oglethorpe fair Steger Frank B jr student rl405 Ogle- iStarkes Ruby (c) maid r436 Telfair thorpe Starks Eug (c) fcty wkr Carstaphen r Steger Mary (wid Frank) rl405 Ogle- Buckman al thorpe Starks Lizzie (c) h420 Hazel Steinmeyer Erwin student rl03 Emory av Starley Chas (Johnnie C) auto mech r (SW) 907 Cherry Sterlings Gertrude sten r220 1st Starling Alberta (c) smstrs WPA r602 3d Stelljes Geo ir (Lucy R) aud Snow's av apt 1 (V) Lndry & Dry Clng Co h401 College apt Starling Mattie (c) h602 3d av apt 1 (V) 3C Starnes Ivey G emp CofGRv Stelljes Margt (wid Geo) rl04 Florida av Starr Hattie (c) maid h210 Middle (V) (V) Starr Henry elk r875 Mulberry Stembridge B Frank (Onie) slsmn r659 Starr Herman (Prances) gold buyer h812 1st Cherry Stembridge Dewey (Cleone) carp rll9% Starr John H (Bettina; Brown-Starr Richmond Electric Co) h825 Mulberry Stembridge Jack (Thelma) slsmn h700 Starr John H student r812 Cherry Woolfolk OEM) STATE OF GEORGIA (See Georgia-- State of) Staten Ernest (c; Lillian) porter h311 Green Statham Audie roofer Ga Roofing & Sup Co r724 Davis Statham Carlton (c) r601 (208) Colquitt Statham Kath (c) maid r601 (208) Col- quitt Steadman Andrew J (Ida) carp hllO Ca- baniss av (EM) Steadman Chas T lab rllO Cabaniss av (EM) Steadman Martha Mrs mach opr Dixie Roll Cot Co Inc r305 Center (EM) Steadman Wm (Martha) lab r305 Center (EM) Stearman Sami M hlpr MD&SRR r427 Wolfoik (EM) Stembridge Lena (wid Oscar) r753 1st Stembridge Lillian A r659 lt Stembridge Lloyd (Helma) ship elk Ma- con Paper Co r Lizella Ga Stembridge M Louise slswn Winton E Bloodworth r659 1st Stembridge Olin L (Lucille) ship elk h324 Forsyth Stembridge Sudve bknr Freeman Dent Sullivan Co r753 1st Stenson Bowden (c: Eula) lab rl017 Edge- wood av Stephan Laura E (wid Wm G) hl25 Yates av (EM) Stephan Robt (Doris) mill wkr Bibb Mfg Co rl25 Yates av (EM) Stephans Judge P (c: Mary) lab h2091/2 016) Bay Stephans Lovie (Corinne) printer h352 Woolfolk Stecher-Traung Lithograph Corp Wiley Stephens see also Stevens M Jordan jr rep 403 Cherry R304 Steed Albert G appr CofGRy r400 (399) Stephens Addie (c) Indrs r8l3 Daisy (S M) Bailey av (CH) Stephens Anna M (c) r309 (602) Colquitt Steed Cornelia rll5 Cleveland av (V) Stephens Annie (c) h909 Pio Nono av (V) Steed Fleeta (c) r235 Gilmer Stephens Arth (c: Georgia) restr 344 Mid- Steed Florence sten Ga Carolina Oil Co dle (V) h5 Gaillard (V) r412 Vineville av Stephens Barber Shop (Robt A Stephens) eo Steed Frances E cash Postal Tel-Cable Co h412 Vineville av (V) Steed Jas elk RyMS r Cross Keys Ga Steed Jas (Virginia) elk hll55 (2) Mill- edgeville rd (EM) Steed Jos N cond Ga Ry h810 Hemlock Steel Louise sten Ouzts-Mitchell Whaley Inc r412 Vineville av (V) Steed Marv E r400 (399) Bailey av (CH) Steed Philip S trav slsmn hI15 Cleveland av (V) '206 Cotton av Stephens Bessie M (c) rlOO (172) DeBorde (SM) Stephens Burrell (c: Minnie) h206 Tin- dall av 0SM) Stephens David (c; Ida) hlpr A G Rhodes & Son h730 (742) 3d av (V) Stephens Dorothy sten Coplan Junk Co r307 Adams Stephens Duncan (c) hlpr CofGRy Stephens Earl (c; Eura) lab h712 Daisy (SM) I* a Steed Wm H (Cassie) blksmith CofGRy h 105 Clav av (NH) Stephens Ellena (c) rl40 (223) Roye (C H) Steed Wm T (Lester L) blksmith CofGRy Stephens Emma (c) Indrs h460 City Hall h400 (399) Bailey av (CH) la Steel Maxine (c) student rll03 Dempsey Stephens Geo (c; Rozelle) h584 White- av (U) hall Steele Cleveland (c) lab rill Walker la Stephens Geo C (Wylene) mill wkr Will- Steele Frances supvr WPA h213 Bond apt ingham Cotton Mill h24 (87) Mill D4 Stephens Geo H (c) lab h508 Clinton (E Steele Mattie J (c) maid r295 2d av (V) M) Steels Hattie (c) Indrs h&42 4th av (W Stephens Harold W student r517 Beech H) av Steerman Albert D (Myrtle E) mach h Stephens Hattie (c) presser Tatnall 2011 3d Square Dry Clng Co r229 Mitchell 343 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Stephens Henry tc: Willie M) lab h235 (443) Alabama (SM) Stephens Herbert A (Nell) cond h307 Adams Stephens Hugh L (Annie) loco eng h200 Crescent av (CH) Stephens I W r301 Cherry Stephens Isaac (c; Annie) lab CofGRy h407 Colquitt Stephens Isabella (c) Indrs hill Walker la Stephens Jas (c) h307 Blount Stephens Jas H (Evie) r50 (.5) Roff Home StePpi hens Jas L (c; Hattie) lab h608 Mitchell (EM) Stephens Jesse M r840 Courtland av Stephens John (c) r307 Blount Stephens Jos carp r504 Hemlock Stephens Jos W (Margt M) policemn h 517 Beech av Stephens Jos W jr elk Bibb Mfg Co r517 Beech av Stephens Lee M (Marv A) sta eng h2520 Broadway Stephens Lena M (wid Chas) smstrs r555 Hemlock Stephens Leon (c; Cora) lab hl02 Gustin av Stephens Lucy roO (5) Roff Home pi Stephens Malcolm (c: Lucille) lab rll6 (196) Virgin (V) Stephens Marion (c: Lillian) lab h413 (543) Henrietta (SM) Stephens Marvin L student r517 Beech av Stephens Marv E checker Snow's Lndry St&ephDernys CMlnagryCEo rM50r5s Brla6il8eySpavrin(gCH) Stephens Minnie (wid Luther) gro 1217 Broadway h do Stephens Pearl School Log Cabin blvd cor Livingston av Stephens Prentice (Pansy) mill wkr Bibb Mfg Co hll9 Yates av (EM) Stephens R T elk r5 (6) Lake City (EM) Stephens Raford fety wkr Bibb Mfg Co r 5 (6) Lake City (EM) Stephens Robt (Annie) porter Firestone Auto Sup & Serv Stores r448 Craft (V) Stephens Robt A (Emily D: Stephens Barber Shop) h453 Walnut Stephens Robt A (c: Bessie) loco firemn h 100 (172) DeBorde (SM) Stephens Robt A ir (c) lab rlOO (172) DeBorde (SM) Stephens Rufus (c; Fannie) lab hl27 (126) Orchard av Stephens Sallie (wid Walter) r910 Log Cabin blvd Stephens Sami M (Arizona) car inspr C ofGRy h305 Ormond ter Stephens Sarah (c) Indrs Crescent Lndry Co rl051 Pio Nono av (V) Stephens Susie (c) cook hl08 (106) Long la Stephens Tillie (c) r407 Colquitt Stephens Wm (c; Mattie) h3 (6) Short OEM) Stephens Wm (c; Lovie) lab h351 (454) Alabama (SM) Stephens Wm A (Jean) elk The Kenne- saw h513% Cotton av SteWpohoelnfsolWk m(ELM)(Gladys C) printer h604 Stephenson see also Stevenson Stephenson Edw J (Winnie) hl32 Knott (SM) Stephenson J Wm student r525 Courtland av SteUpnhieonnsoDnryJaGsdLs C(Aonhn5i2e5CC) oduerptltaonwdnaevr Stephenson Jas L ir (Jacqueline C) elk Union Dry Gds Co h430 Washington av Sterphdeonson Roberta instr Wesleyan Coll Stephenson Voni (c) Indrs hl26 CD Spring la Stepp F Wade (Mary: Rivoli Riding Club) h Rivoli dr Steppe Rebecca r821 Hemlock Steppe Rebecca H Mrs nurse h821 Hem- lock Steppe Robbie student r821 Hemlock SteCpoper8W21mHAem, rloouctkemn Crescent Lndry STERCHI BROS STORES INC, G Wright Brown Mgr, "It Costs Less At Sterchi's To Furnish Your Home" sw cor Cherry and Broadway, Tel 3100 and 565-575 Poplar, Tel 5957 (For further information see left top lines and page 16 Buyers' Guide) Sterling Cornelia (c) maid hl08 Woodcliff Sterling Gertrude elk State Hwy Board Div No 2 r220 1st Sterpjan John M (Annie M) carp MD& SRR h341 Clinton (EM) Stern Morris L (Fannie P) lawyer 99 Vineville av apt A3 Stern Richd h99 Vineville av apt A3 'Stetson Eug W .ir (Grace) asst cash Citizens & Southern Natl Bank h309 (98) Ingleside av Stevens see also Stephens Stevens Abbie Mrs r204 American blvd Stevens Albert (c; Viola) lab h466 City Hall la Stevens Annie M rear 261 Walnut Stevens Bascom S (Louise) formn h209 Rocky Creek rd Stevens Bertram mill wkr Bibb Mfg Co r250 Peachtree (EM) Stevens Bob student r629 Adams Stevens Carl r254 Hydrolia (EM) Stevens Carlton E (Louise) genl agt Connecticut Mutual Life Ins Co h221 Forsyth Stevens Carrie Mrs r418 Plum iSStteevveennss CChhaass (rcl6: 5W2ildlie) lab City h224 Madison Stevens Chas M (Annie) h250 Peachtree (EM) Stevens Claxton r250 Peachtree (EM) Stevens Cora. rl26 Richmond Stevens Daughtry M (c) maid rear 261 Walnut Stevens Edgar (Mary E) custodian Hotel Grady r301 Cherry Stevens Edw T (Clifford) bldg contr h 263 Georgia av ant 2 Stevens Eliz (wid Luther) hl65 2d Stevens Elmer r250 Peachtree (EM) Stevens Ernest L (c) r602 (2) Gilmer Stevens Ethel (c) Indrs r328 Monroe Stevens Ethel M (c) cook Henry Williams Stevens Eva (c) hl04 (216) Short (EM) Stevens Freeman (c: Alline) lab hl22 (136) Elklon pi (SM) Stevens lone elk Williams Jwlry Co r759 1st Stevens J B (c) lab r223 Division (T) Stevens J P Engraving Co 457 Cherry Stevens Jackson E (Mabel) mill wkr Bibb Mfg Co r5`56 Ocmulgee Stevens Jas (c) lab r rear 261 Walnut Stevens Jas B (Minnie F) chiropodist 403 Cherry R307 h261 Georgia apt C4 Steavllenrsl2J2e6sseB(rco)addel mn Couch & WoodStevens Jessie student r204 American blvd Stevens John r612 Main (EM) Stevens John (c) lab hl5 (4) Moore al Stevens John (c: Lula) slsmn h307 (265) Broad (EM) Stevens John L (c) rear 261 Walnut Stevens L Kay (Minnie L) mgr Dunlap Chevrolet Co h811 Napier av Stevens Lena (c) Indrs r207 Roy la Stevens Lewis M hlpr h'102 Kemper av Stevens Lillian D (wid Louis O) h367 Col- lege Stevens Lillie (c) cook r458 (457) Log Cabin dr o ripn ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT. EM. gr. "YOUR CITY D I R E C T O R Y MIRRORS the Industrial LIFE Of Your CITY 344 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Where To Buy? Oonsult the Classified Business Lists In This Directory ARLINGTON HOTEL FREE STORAGE BMRoOdeArDn WaAndY, RNeaEsAoRnabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. Stevens Lizzie (c) lndrs r542 3d av (V) Stevens Maddison J (Ethel) electn r554 1st Stevens Manuel (c; Fanny) lab r75 Bay Stevens Manuel E (Sudie) welder h207 Fulton (SM) Stevens Mary (c) h97 Bay Stevens Marv (c) hll04 (1010) Broad (E M) Stevens Mary (c) lndrs h99 Society Stevens Mattie h759 1st Stevens Mattie L service rep SBT&TCo r 140 Highland av Stevens Mattie L (wid Whitt) mill wkr Bibb Mfg Co h254 Hydrolia (EM) Stevens Minnie Mrs nurse 261 Georgia av apt C4 r do Stevens Napoleon (c; Delice) !hl212 (327) Woolfolk (EM) Stevens Orion (Minnie) slsmn hl07 Har- rold (SM) Stevens Oscar K (Rachel) photog Metro Studio r220 New Stevens Parthenia (c) rl24 N Tatnall la Stevens Robt B (Minnie) mill wkr Bibb Mfg Co r250 Peachtree (EM) Stevens Robt K (Eliz) loco eng r709 Wal- nut SteWveanlnsuRt ohb3t1L2 (NBaeprtihear Ba)v filling sta 601 Stevens Roger L (Mamie) fcty wkr rll4 Chappell (SM) Stevens Roscoe (c; Sally) lab h516 (488) Hill Crest av (CH) Stevens Ruby (c) r507 (508) Harris Stevens Russell L (Mattie) r201 (32) Holt av (N Hts) Stevens Russell L ir (Louise) mill wkr Willingham Cotton Mill h201 (32) Holt Steavven(sNTHhtso)s E (Dorothy E) driver h507 Virginia av Stevens Viola (c) maid 99 Society Stevens W Hardy (Fannie H) hl40 High- land av Stevens Walter (c) lab rl325 Broadway Stevens Walter (c) lab rll3 Hicks al Stevens Walter C (Flynne) ordinary Bibb County h304 Buford bl Stevens Wm (c: EUla) lab rl24 N Tat- nall la Stevens Wm A (Ella J) farmer h401 Rocky Creek rd Stevens Wm A hlpr Acme Welding & Elec Co r RD 6 Stevens Wm O (Ethel) drugs 1040 2d h860 Orange Stevens Wm P (Mildred) r205 Vineville av SteCvaebnisn Wdrills (c; Ella) r458 (457) Log Stevens Wilson W (c; Frances) brkmn h 221 Telfair Stevenson see also Stephenson Stevenson Frances (c) lndrs h209 (248) Thompsons al Stevenson Isabel (c) r855 Ocmulgee Stevenson Luther (c: Charlie Mae) lab h347 Hammond Stevenson Robt L (Nadine) window dresser Walgreen Co r260 Astor (EM) Stevenson Theo (Sarah) mill wkr Bibb Mfg Co hl02 Highland av (NH) Stevenson Thos E (Mary) slsmn Schwob Co r215 1st Stevenson Turen B (Middie M) carrier USPO hl04 Cabaniss av (EM) Stevenson Wm (c; Lula) lab h513 (514) Martha (EM) Steward Hattie Mrs r410 Cleveland (SM) Steward Jas T (Hattie M) r410 Cleveland (SM) Stewart see also Stuart Stewart A Eliz student rl25 Buford pi Stewart Addison (c) student rl44 (198) Washington (EM) Stewart Andrew D (c) lab h321 Patter- son ((NHts) Stewart Anita student rill School (SM) Stewart Annie L (c) r411 (311) Watex- ville rd Stewart Annie L (wid John) rl723 3d Stewart Arlie (Rhoda) slsmn h724 Napier av Stewart B Elmo student r215 Ninadell dr Stewart Ben.i C (Ethel) sec-treas Stewart Oil Co hi 18 Rogers av (V) Stewart Betty F student r712 Hillyer av (CH) Stewart C Elrod driver Yellow Cab Trans & Baggage Co rl063 Elm Stewart C Emma (wid Jefferson H) marker Crescent Lndry Co h803 Pine Stewart Cath Mrs rl57 Magnolia Stewart Chapel A M E Church (c) Rev John E Reese pastor services 11:45 a m and 8:00 o m Sunday sch 10:00 a m 565 Catton av Stewart Chas A (Ella) sec Stewart-Goette Electric Co h849 Winton av Stewart Cornelius (c) maid hl07 (128) Waynes al (SM) Stewart David (c; Mary) porter Helds Dress Shop r6 Spring la Stewart Dicie (c) lndrs hl04 (17) New Street al Stewart Edw D (c) h250 Powell (EM) StetrwalarStaEshdw&ZDo(co:rECgoehrt4h1a1) (g31la1z)ieWr Cateenr-StevwillaertrdEliz (c) maid rl04 (17) New St al Stewart Eliz (c) student r263 5th av (V) Stewart Eliz B home economist Ga Power Co nll9 Corbin av (V) Stewart Ella (c) rl68 Astor (EM) Stewart Emma (wid Elbert F) rl07 Carlisle av Stewart Emma L (c) r633 Gort Hill (E M) Stewart Emmett E (Lillie A) citv firemn h2l5 Ninadell dr Stewart Essie M (c) maid r769 (766) Ocmulgee Stewart Fannie (c) lndrs r34 Macon av (EM) Stewart Fred D (Mae A) slsmn Macon SteGwasartCGo lehn32n2JCeolklemGaanPaovwe(rCCHo) rll9 Corbin ay (V) Stewart-Goette Electric Co Fred W Goette pres__Chas A Stewart sec electl contrs 558 2d Stewart Gussie (c) r411 (311) Waterville rd Stewart Gussie M (c) maid r263 5th av (V) Stewart Harry C (Gladys B) pres Stewart Oil Co h712 Hillyer av (CH) Stewart Harry C ir mill wkr Bibb Mfg Co r7.12 Hillyer av (CH) Stewart Henry S (Mattie E) driver h210 Duncan av Stewart Horace (c: Pearlie M) porter h 268 2d av (V) Stewart J D Edw (Marian A) drftsmn h 101 (104) Pineview av Stewart J Vester (Rosa L) pdlicemn h 2721 Houston av (SM) Stewart Jas slsmn Goldgar Furn Co Stewart Jas (c: Mary) lab hll6 (6) Spring la Stewart Jas lndry wkr r915 Walnut apt 6 Stewart Jas M (Bessie) carp rlOO Troup Stewart Jas T (Hattie E) restr 266 Main (EM) r410 Cleveland (SM) Stewart Jas T (Maude) steel wkr Taylor Iron Wks & Sup Co hl'18 Cedar (SM) Stewart Jesse O (Lillie) investigator h 125 Buford pi Stewart John (c) rl017 Oglethorpe Stewart John slsmn r369 1st Stewart John R (Lucile) driver r915 Walnut apt 6 345 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Stewart Jordan (Della M) fcty wkr rl04 Mill av Stewart L Richd (Sarah E) solr h915 Walnut apt 6 , Stillwell Earl F (Estelle) contr h355 Edna pi Stillwell Wm A (Carolyn) pres-mgr Stillwell Constn Co r308 Ingleside av Stewart Leo H (Estelle) sta mgr Hightower Service Station hl28 Ponce de Leon av (SM) Stewart Lizzie (c) h436 Lawton av Stewart Lottie lab rill Garden (EM) Stewart Louise (c) maid r34 Macon av (EM) Stewart Louise J (wid Glenn T) hll9 Cor- bin av (V) ,, Stewart Lucinda (c) r256 Garden (EM) Stewart Mandv (c) lndrs hll5 Glen (E M) Stewart Margt (c) maidr411 (311) Water- ville rd Stewart Marguerite L sten Noland Co r 722 Mulberry Stewart Mary B (c; Broadway Lunch) h 266 4th av (V) Stewart Massey (c) r250 Powell (EM) Stewart Maude (c) cook h418 Monroe SteewrsaratvM(iVll)ie (wid Benj C) rllS Rog- Stewhrt Minnie W (wid Jas T) r!19 Corbin av (V) Stewart Mose cook Hotel Lanier r302 GrXGGIl Stewart Nancy A prof Mercer Univ r320 Orange Stewart Nathan (c) waiter r266 4th av (V) Stewart Nellie millwkr Bibb Mfg Co rl31 Roff Home la Stewart Oil Co Harry C Stewart pres Benj C Stewart sec-treas fill sta 501- 509 Mulberry 2d nw cor Oglethorpe plant 105 Ocmulgee Stewart Pierce (c; Viney) lab h854 Wil- low Stewart Print (c) plstr h263 5th av (V) Stewart Richd C (c) barber 117 Doug- las av (V) hl47 Lincoln av (V) Stewart Richd L student rll9 Corbin av (V) Stewart Robt A (Minnie) elk hl09 Madden av Stewart Rosa L (c) cook hl39 Pecan av Stewart Rosie (c) cook hllO (106) Long la Stewart Rudolph lab Ga Power Co Stewart Shaw dairywkr Dixie Dairies Stewart Theo R (Fannie) driver h213 Carling av Stinnett Wm S (Bettie L) cond h460 Orange Stinson Alf (Alma) lab hl05 (261) Clin- ton (EM) . , . Stinson Benj (c; Rosa M) lab rl Violet av (SM) Stinson Chas (Margt) tinner rl020 Walnut Stinson Clarence (c; Ida M) lab h209 Roosevelt av (V) Stinson Edw (c; Rosetta) lab Ga Power Co K145 Hill Stinson Essie M (c) rl45 Hill Stinson L Sol (Willie) hl03 Clinton (E M) Stinson Louise lab rl04 Emerald (EM) Stinson Lula (c) h653 Elm al Stinson Mattie (c) lndrs rl2Q (552) Magnolia la . Stinson Rebecca J (wid Mathew W) r 107 Brookdale av (B) Stinson Robt B lab hl07 Brookdale av (B) Stinson Robt H mech Dunlap Chevrolet Co r240 Jones av (EM) Stinson Roland D (c) lab rl45 Hill Stinson Rosie L (c) maid rl45 Hill Stinson Thos L (c) porter rll8 (137) Kahn's al Stinson Thos L (c) porter Choppel's Service Sta r626 Monroe Stinson Wm (c) r209 Roosevelt av (V) Stinson Wm (c; Mattie) lab h626 Monroe Stinsonville A M E Church (c) 116 & Co r853 Cherry Stinsonville Baptist Church (c) 107 Grant av (S) Stites Clara Mrs rl206 Ridge av (V) Stitt C Wm Rev (Carolina) pastor East Macon Baptist Church K210 (250) Church (EM) Stitt Maynard student r210 (250) Church (EM) Stitt Paul student r210 (250) Church (EM) Stivarius Fred W (Louise S) bkpr Bur- den Smith & Co h406 (408) Forest av (V) Stocks Emma (c) rl018 Broad (EM) Stocks Peter C (Annie B; Palm Barber Shop) hl71 Magnolia Stewart Thos J (Octavia B) sec-treas Stocum Wm (c; Ollie M) lab hl20 E Ell Burden Smith & Co Inc h920 Vineville av Stokes Bertha (c) hl05 (726) Waynes al (SM) ,, StPewricaert MTheorcsanRtile(ZeClomar36W9) 1mstgr L B Stewart Walker W (Willie L) collr Kill School (SM) Stewart Wm (c; Katie) baker hl52 Spring Stewart Wm (c; Sallie M) lab h905 (107) StDewemarptseWymavE ((UW) illie F) asst genl frt agt CofGaRy hl43 Hines ter Sto&kesCoC rJ8u53lianCh(eMrrayry B) slsmn Swift Stokes Carlos E (Edna) mach hl05 Put- nam . ,, Stokes Carrie (c) r416 (533) Henrietta (SM) Stokes Cecil delmn John A Chapman r 305 Newberg (SM) Stokes Chester (c) lab r416 (533) Henri- etta (SM) Stewart Wm S (c; Mattie) lab h633 Fort Hill (EM) Stewart Wm T (Ibbie) hl063 Elm Stewart Winburn E student rl43 Hines ter (V) Stewart Zelma W Mrs dom L B Price Stokes Chester F (Lollie A) emp CofGa Ry h306 Newberg (SM) Stokes Clarence E (Nell) baker American Bakeries Co hl08 Willingham (EM) StHokeemslCocoknnie (wid Robt R) smstrs r516 Mercantile Co r369 1st Stokes Ennis G (Lila) driver h310 Cedar SSttiildehsamJosThEos (CAlmloac)o estnogrer47m1grOrPaingggely (SM) Stokes Felton (c) lab r416 (533) Henri- Wiggly Stores hl23 Holt etta (SM) Still Hazel M Mrs beauty opr Burden Smith & Co r2D Terrace Apts Still Ila B Mrs fctywkr Happ Bros Co rl517i Broadway Stillman Milton (Dollie) lab h427 Wool folk (EM) Stillwell Construction Co Wm A Stillwell Stokes Florence (c) h416 (533) Henrietta (SM) Stokes Geo (Hellen J) baker Collins Baking Co r720 Plum Stokes Gus (c) lab r235 Jefferson Stokes Helen (c) student r202 Woodcliff Stokes Horace (Helen) millwkr Bibb Mfg pres-mgr genl contrs 1216 Broadway Co r554 1st SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 34S YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES 1PlyiDOUtH Stokes Irene H Mrs cash Dannenberg Co r202 Davis (SM) Stokes Jas (c) delmn r341 Maple Stokes Jas (c; Mattie) driver h309 Mon- roe Storokees Jas (c: Martha) lab h543 MonStokes Jas P (Gertrude; South Macon Barber Shop) rl03 Nelson (SM) Stokes Jean (c) lndrs h34l Maple Stokes John Henry (c; Lucy) truck d(EriMve)r Nutting Floral Co r611 Maynard Stokes Juanita tchr PS r208 Albemarle StoPki es Leonard S (Annie V) h43 (252) White (SM) Stokes Lizzie (c) hllO Reid (SM) Stokes Lydia elk rl24 Holt Stokes Malcolm student rl219 Oglethorpe Stokes Mary L Mrs r820 Hemlock Stokes Melita r621 Pine Stokes Naomi (c) maid r341 Maple StoGkoersdoOntis(SRM) (Ida M) policemn hl31 Stokes Peter (c) chauf r341 Maple Stokes Susie (c) h34 (25) Reid (SM) Stokes Thos (c; Mabel) porter r309 Mon- roe Stokes Thos W (Mary) real est 156 Cot- ton av h208 Albemarle pi Stokes Wm (c) lab r416 (533) Henrietta (SM) Stokes Zora (wid Grover C) h509 Mi- kado av Stone Andrew (c; Viola) lab h511 Edison (EM) Stone B Raymond (Lucy) city firemn h 301 Cleveland (SM) Stone Bobbie elk Hotel Dempsey Cigar Stand r215 New Stone Chas B auto meeh r203 1st Stone Claude (c; Bessie) lab h34l 2d av (V) Stone Dicie (c) rl50 New Stone Dicie (c) lndrs r230 Orange Stone Ernest P (Mary B) sec-treas Richardson Lbr Co hl07 Kenmore pi Stone Ethel B Mrs r871 3d Stone Frank (c; Susie) lab h205 Yates al (EM) Stone J Lindsey (Mary) mach h709 Courtland av Stone Jas (c; Essie) carp r521 (501) E Academy (EM) Stone Jas G (Dena N) elk Chas A Pickett h215 New Stone John (c) lab rl025 3d Stone John (c) porter Kingman & Ever- ett Inc h7Q3 Hammond (SM) Stone John C (Annie L) driver h303 Cleveland (SM) Stoavne (JIoSMhn) C (Lucy) pntr r3307 Houston Stone John P (Mary G) cash American Bakeries Co hl408 Edgewood av Stone Leola (c) lndrs h5l5 Forsyth StoMnfeg LCeoonra4r0d9 (AElnmnie L) millwkr Bibb Stone Leroy (Mamie) baker h308 Ell (S M) Stocanne Mavary F (wid Robt H) r217 DunStone Olliver (c) auto mech r316 Wal- nut Stone Ralph E (Claudia M) pntr r217t Duncan av Stone Robt L (Fannie) r564 Boulevard (NH) Stone Sami (c; Lurenza) lab h984 (1003) Montpelier av Stones Dola (c) maid r436 Monroe Storage Battery Co The (Clarence G Plunket) 570 2d Storey Geo (Cora) sewer layer T L Wood Plmfog & Htg r Roosevelt Hts Storey Howard (c) lab h927 Pio Nono av (V) Storey Storey Jas M Louise (E(cl)iz)mra2i4d55r9(224757P)io2dNono av (V) Storey Wm (c) lab r924 Pio Nono av (V) StoNroenvoWamv J(r,V)(c; Marv F) lab r924 Pio Stork Amelia L (wid Fredk W) h817 Walnut Storrs Edith R h307 Adams Story Alf K (Lizzie E) asst dist mgr U S Re-employment Serv hill Piedmont Story Buren student Ga Academy for the Blind r RD 3 Sylvester Ga Story Chas (c; Mamie) driver h800 (115) Colquitt Story Cora (c) r410 Ash Story Effie millwkr Atlantic Cotton Mills rl57 White (SM) Story Elias D (Faye R) slsmn r369 1st Story Elise Mrs opr SBT&TCo 128 Ell Story Ernest H (Era) elk rl22 Grady (S Mj Story Hazel L student rill Piedmont av Story John J (Rhoda) mgr The L J Cullen Co r Ashburn Ga SSttoorryy LSyodl ia(cE) er4lk35riElllbPeriet dmOSoMn)t av Story Timothy (Elise) fctywkr rl28 Ell (SM) Stough Geneva (c) lndrs hl316 Broadway Stough Herbert (c) r516 Hammond Stough Zera (c) lndrs rl316 Broadway Stout Wilbur W (Pauline R) tchr h930 College apt 1 Stovall Catharine E dental asst Robt H Mabry r724 San Juan av Stovall Enlis (c; Leah) loco firemn h354 Hazel Stovall Geo R (Mary) elk Karsten & Denson Co Inc h724 San Juan av Stovall Jas R r724 San Ju'an av Stovall Katie (c) cook hl8 Graham's lot Stovall Katie (c) lndrs h227 (303) 5th Stowers Eddie J (Helen) stereo Macon Teleg Pub Co h854 Pine Strackman Chas T plmhr A B Lee Plmbg & Htg Co rllO Cabaniss av (EM) Strayer Annie sten r2327 2d Strayer Edith chf opr elk SBT&TCo r 2327 2d Strayer Ethel C (wid Horace G) h2327 2d Strayer Horace student r2327 2d Street Carrie (c) lab Ga Power Co h 1068 Ocmulgee Street Edw (c; Annie) lab h313 Forest av (V) Street Fannie (c) h216 Fretwell al Street Janie (c) cook r421 (472) 3d av (V) Street Jos S Rev (c; Lottie B) pastor h 105 Empire av (V) Street Lottie B m'aid Hotel Grady rl05 Empire av (V) Street Mary (c) lndrs h317 Patterson (N H) Street Olie M (c) r421 (472) 3d av (V) Street Oliver (c; Minnie O) lab r812 Elbert (SM) Street Sami (c) lab h Forsyth rd Streeter Jos (c; Mary) rll8 Turpin la (T) Streeter Wm A loco eng r Hotel Fickling Streets Leola (c) cook h82 (133) Forest av (V) Streyer Mattie (wid Walter N) rSOO Napier av Stribling Clara K Mrs hl09 Nottingham dr Stribling Hubbard (Ruby) elk rl24 Washington av Stribling Mary (c) lab r322 Hammond Stribling Peter (c: Elnora) r322 Ham- mond Stribling S G (Rose) eng hi 13 Summit av (NH) Strickland Amos (c) lab r318 Walnut 347 WILLINGHAM SASH & DOOR CO. _ _ _ mm - A ni - u Lime -- Roofing -- Cement -- Plaster 457 Third St. Phones 277-278-279 Strickland Arth G (Grace S) bkpr SterStdrihciklBarnods BSrtaoxretosnInBc (D1xo2l3l3i6e)Floabrsyh6th07r%d Main ('EM) STRICKLAND E H & CO (Earle H Strickland), Insurance With a Savings, 301 Georgia Casualty Bldg 516-22 Mulberry, Tel 236 (For further information sGeeuidbea)ck cover and page 19 ^Buyers STRICKLAND EARLE H (Mary D;EH Strickland & Co), h563 College apt 5, Stroberg Chas E (Stroberg Body & Fender Wks) rl34 Summit av (NH) Stroberg Chas W (Ruth; Stroberg Body & Fender Wks) 1x134 Summit av (N StrHo)berg Emory G rl34 Summit av (N H) Stroberg Fred elec eng r752 Spring Stroberg Fred R L (Estie) supt 1x752 Stroberg Kate (wid C F) smstrs 1x759 Walnut Stroberg Maurine tchr r752 Spring Strickland Essie Mrs fctywkr Happ Bros Co r818 Hemlock Strickland Ida (c) cook rll5 New SSttrriicckkllaanndd LuMcyart(hca) rls4t0en1stSaidvne(yV) W Hatcher rl20 Highland av Strickland Rolf (Katie) millwkr Atlantic Cotton Mills 3x36 Atlantic Village Strickland Sol P (Mary) collr Right Way Finance Co hl20 Highland av StrmicektalalwndkrWha8l1t8er HPem(Eloscskie M) sheet Stringer Thos A (M'arjorie) meat ctr StArinrdgfCeallsehr GJraocckeryh4h3l828RWosasshington av Stringfellow Genevieve Mrs slswn Lemer Stroberg Oscar slsmgr Snow's Lndry ) Hendrix aMl attie) porter hlOl TaBgeueechHoawvard J (Inez B) formn h464 Tasoe Howard J jr student r464 Beech Talbird Esther Mrs tchr PS rl06 Selma ard (U) Swift Wm O (Grace; Middle Ga Tourist ?(3TM91,i7f!)s)-H5oouftsJtdorninkasv 3<(>S5 MM)ulberry h4005 Swift & Co Byron D Scarff mgr whol TaC^oirrd53|,rAanrklmRgto(nPapttiie) mgr Sou New Tahl5b3irdAMrlianmgtioenM (wid Albert) tchr PS mngilfltsWSaMterfPolrudmrdcotton gin and oil Swift's Ice Cream Raymond L Innis mgr TRytr554lst' (Gretchen) wldr CofGa Taliaferro Harry R (Kath C) chf eng wnol 575 5tfti Swr8il5l2ingCEovuertllyanndphayvs 521 Mulberry R715 TTa,l?larnv,t ^Cal,taeurdJewkTs b3(1M8 aCrghte)roksetea avmgr Standard Oil Co h210 Ridge av (V) Swinford Eberle (Lula B) asst supt Riverside Cemetery h311 Boulevard (N H) Swinford Eliz B student r311 Boulevard TaVllteonetviRneuabayvrnl4i(0av1)(VWiindevW illm e 0) av h1401 (V) Tallent Vernie rl401 Vineville av (V) T by65pf6(V)H (Mattie S) clk h200 Clis- 351 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Macon Federal Talley Jas N (Eliz) hl014 Vineville av (V) Talley John (c; Mary) lab h605 (1281) Elbert (SM) Talley John W elk Bibb Mfg Co r20O Clisby pi (V) Talley Leola (c) lndrs h211 Fretwell al Talley Martha C r200 Clisby pi (V) Talley Perry (c) lao r605 (1281) Elbert (SM) Talley Phil E (Grace) slsmn Ga Power Co h301 Buford pi Tallon Charlie M (c) maid rl30 (6) TinsTallelyonlaErnestine (c) maid rl30 (6) Tins- ley la Talton Erma A Mrs elk U S Re-employ- ment Serv r774 Mulberry Talton Geo (c; Hannah) lab h56 Craigs la (SM) TTaallttoonn LMulaary(c) m(ca) id lrn3dltr5s Chha4r2l0es ((S3M27)) Straight (XJ) Talton Minnie (c) r403 Charles (SM) Talton Robt L (Marjorie) slsmn r572 Hillyer av (CP) Tamplin Jos P lab r277 Ell (SM) Tamplin Maggie (wid Jackson) h277 Ell (SM) Tamplin Ruth A r277 Ell (SM) Tamplin Wilbur E (Nannie S) electn Stewart-Goette Electric Co r289 Winship (WH) Tank Car Service Station (Malcolm E Everett) lilling sta 852 Broadway and 431 Main (EM) Tankersley Danl O (Georgia) carp h218 Cedar (SM) Tankersley Sarah E (wid Chas J) r218 Cedar (SM) Tanner Alex (c; Beatrice) driver r327 Corbin av (V) Tanner Anna (c) lndrs h210 Roosevelt av (IV) TaMnnlger CDoavhid!51H C(Momagegriet)ermi(lPlwMk)r Bibb TalansnearvPr(aVn)k (c; Ruth) lab h30,,6 D,,oug- Tanner Geo H (Vera H) linemn Ga Pow- er Co r903 Cherry ,, TaMnn) er Harold H lab h299 Chappell (S Tanner Hillman B (Gladys; Union Shoe Shop) r512 Log Cabin blvd Tanner Ira T (Ethel E) emp CofGRy h 197 Edna pi ,,,, , , Tanner Isaac (c; Louisa) h5 Malloy s al Tanner J W (Hurdah) h332 American blvd Tanner Jos R sec-treas Nehi Bottling Co r405' Adams Tanner LaPae textilewkr r332 American blvd Tanner Mary L (c) lndrs hll9 Grant av (S) Tanner Raymond I r418 Winship (WH) Tanner Rena textilewkr r332 American blvd Tanner Ruby tohr PS r2720 Forsyth rd Tanner Ruth socialwkr Bibb Mfg Co h740 Oglethorpe TaPnrnuedrenSttiaanl lIenys KCo(oRfubAymNh)7'1a0ssNt ampigerr Taanlner Spivey (c) lab r9 (132) Malloy s Tanner Wyander H (Mary) track formn h514 Log Cabin blvd Tanton Edw D (Sarah) pntr rl924 2d Tanton Reuben L (Lillie B) carp hl924 2d Tappan Jas E (Virginia H) slsmn Steve TaMppaSnoloVmirogninjiar Hhl0M3 rLs asuurreglicaavl n(NurHse) CofGaRy hl03 Laurel av (NH) Tarpley Clinton driver r3502 Houston av (SM) Tarpley Elsie slswn Southern Textile Co rl26 Ponce de Leon av (SM) Tarpley Jas W (Pearl) furn fnshr h3502 Houston av (SM) Tarpley John P (Mary) driver h211 Hines ter (V) Tarpley Maggie (wid Singleton W) rl26 Ponce de Leon av (SM) Tarpley Melvin E (Mae) formn rl03 Troup TaCrvreesrceDnat nal vA (C(IRHe)gis) loco eng hll7 Tarver Edw (c) hlpr r965 Hazel Tarver Port (c; Hattie) porter Firestone Auto Sup & Serv Stores h965 Hazel Tarver Gus A (Sadie C) installer SBT &TCo h451 Duncan av Tarver Hugh R student rl242 Edgewood Tarver J Clyde (Anne M) mgr Sou Crate & Veneer Co h511 Beech av Tarver Lettie (wid Spencer) h203 Col- lege pi Tarver Mozelle (c) cook 248 Stanislaus cir TARVER OTIS M (de Luth; Southland Hotel), r do, Tel 3047 Tarver Robt (c) lab r965 Hazel Tarver Spencer G (Hazel) driver G Bemd Co r913 New Tarver Wm (c; Mary) lab CofGaRy h 104 Elm Tarver Willie M (c) student rl04 Elm Taska Herman (c; Olivia) slsmn r21'5 Plant row Tasker Benj (c; Inez) lab hl47 (151) Sy- camore (V) Tasker Furman (c) waiter Edw R Cole r215 Plant la Tasker Jesse (c) lab rll35 Broadway Tasker Lena (c) hl06 Empire av (V) Tasker Lillie (c) cook rl49 Sycamore (V) Tasker Wm T (c; Annie) lab rl06 Em- pire av (V) Tatnall Apartments 930 College Tatnall Square ns Ash Tatnall Square Baptist Church Rev Lew- is H Wright pastor services 11 a m and 7:30 p m Sunday sch 9:45 a m Ash bet College and Adams Tatnall Square Barber Shop (Richmond Bennett) 607 Linden av Tatnall Square Drug Store Wm B Martin mgr 601 Linden av Tatnall Square Dry Cleaning Co (Geo R Harvey) 605 Linden av Tatnall Square Presbyterian Church Rev C Lqgan Landxun pastor service 11:30 a m and 7:30 p m Sunday Sch 7:30 p m 752 College Tatnall Square Service Station (Chas R Moore, H Marion Waters) filling sta 99 Montpelier av Taylor Albert (c) delmn r366 (365) Hawthorne Taylor Alice Mrs matron Methodist Orphan's Home r201 Pierce av (V) Taylor Allene (c) rlOO Lynmore av Taylor Almeda (wid Wm J) h2Q3 Grand av Taylor Andrew J (Maude) 11727 Orange Taylor Andrew J (c: Ethel) porter Chandler Service Sta r336 Jackson Taylor Annie B (c) lndrs r448 Douglas av (V) Taylor Annie B (wid Robt J) sec Harts Mortuary h257 High Taylor Annie M (c) r454 Hawthorne Taylor Arlie (c) h9 (132) Malloy's al Taylor Arth (Marjorie M) lab h2437 Broadway Taylor Arth B (Lucy) millwkr h218 Ross Taylor Aurelia (c) lndrs hl21 Army Lot Taylor Bessie nurse 514 Orange h do Taylor Bishop (c; Addie) pntr hl04 (303) Craft (V) Taylor C W (Maude) atndt College St Service Sta r RD 1 Taylor Carrie (c) h201 (116) Bowman , ,(EM) Taylor Carrie (c) cook hi Sparks al Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 352 g a ~ * Jb2o *>*> OLaj 4uO- 5 s 2 5 T33 M-"3-c -3. ( t; n 2 Tb -O3o .2 J J3 ^ H -3Ss> COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 Taylor Chas (c; Hattie) lab h307 Edgewood av (SM) Taylor Chas porter Collins Baking Co r 1402 College dr Taylor Chas (e) restr 301 Edgewood av > (BM) r do Taylor Cherry (c) Indrs hll9 Hicks al Taylor Clarence (c) lab Mansfield Dray Line r Pleasant Hill Taylor Clarke millwkr Bibb Mfg Co r234 (8) Clinton (EM) Taylor Claude rlOO 2d Taylor Claudia r720 Broad (EM) Taylor Clement (Gaynell) elk r607 2d Taylor 'Clemmie (c) student r210 Coles al Taylor Clinton (c; Annie) lab City hl314 1st Taylor Comfort (c) maid rl29 Adams Taylor Cornelius (c) lab r211 Grant av Taylor Georgia (c) maid hllS (19) Wise av (V) Taylor Geraldine (c) fctywkr r966 Ocmulgee Taylor Gertrude (c) Indrs h613 (13) Gilmer TaCyolorh3G59ertErulmde (c) millwkr Bibb Mfg Taylor Grenville (c) lab John T Smith B702 Daisey Taylor H Harry (Virginia) slsmn hl41 Lamont av Taylor Hammie (wid Owen W) rl03 Ridge av (V) Taylor Harold (c; Emma) waiter h26 Buckner al Taayvlor Harold F student rl31 Oakland Taylor Hattie (c) r452 Bay Taylor Hattie (c) hll03 Woolfolk (EM) Taylor Creigh W (Maude) atndt The Power Oil Co r RD 1 Taylor D Hughes (Prances) hll3 Culver Taylor Henry F Rev (c; Lula) pastor Umonville Baptist Oh h409 (536) Henrietta (SM) Taylor Henry L Rev (Winnie L) hi 133 Taylor Daisy (c) cook r541 3d av (V) Taylor David (c) delmn Lyons Cash Mkt Taylor E S (Taylor Transfer Co) h425 Vineville av (V) Taylor ES jr buyer Coleman-Meadows- Pate Drug Co r Wesleyan dr TAMYuLrpOhReyE, DTEaNyloJrR&(REulltihs MIn),c,V-SPerecs- Treas Mikado Realty Co, Mortgage Investment Co, h521 College, Tel 333 Taylor Edith millwkr Bibb Mfg Co r602 Main (EM) Taylor Edw (c; Jessie) lab h307 (308) Campbell av (SM) Taylor Edw (c; Janie) lab h227 Morgan av (WH) Taylor Edw (c; Louise) lab h218 Woodcliff Taylor Edw (c) porter r448 Douglas av \(V) Taylor Edw P lawyer 150 Cotton av R 403 h855 Mulberry apt 101 Ta(yVlo) r Elbert (c) lab r205 Holmes av Taylor Eliz rl09 Cedar (SM) Taylor Eliz (c) Indrs rl05 Bostic la Taylor Ella M (c) rl24 (21) Tinsley la Taylor Eloise (wid Chas E) rl416 Oglethorpe College dr Taylor Henry W (Lucille A) hl7 Ran- dolph pi Taylor Homer (c) lab r rear 22 (243) New St la Taylor Houston N (Willie H) formn h819 New Taylor Hugh N (Pearl P) slsmn h454 New Taylor Ida (c) rl52 Madison TAYLOR IRON WORKS & SUPPLY uCmO, aCndA WMcPAlFislteemr iPnrgesV, -JPrWestsF,ulFghEAdams Sec-Treas, 1014 Broadway, Tel 102 (For further information see page 24 Buyers' Guide) Taylor J M (c; Mary) lab hlOl Pringle (EM) Taylor Jas (Lena) r287 Roff Home av \(V) Taylor Jas (c) delmn John C Meadows h604 Ross Taylor Jas (c; Clemmie) driver r414 Bay Taylor Jas (c; Alice L) lab hl04 Gantt City rd (SM) Taylor Jas (c) lab rllO (301) Hawkins av Taylor Jas (c; Frances) lab h213 Holmes av (V) Taylor Emanuel (c) lab hl24 (21) Tins- Taylor Jas (c; Caroline) lab h410 (501) ley la Prince (SM) Taylor Emma (c) Indrs h'5-7 (407) New TaSytlroeretEmlaory (c) r400 Ward (V) Taylor Jas F appr Macon Teleg Pub Co rl03 Womack (EM) Taylor Jas H (Clara R) meoh Steve M Taylor Ernest (c; Mary) lab City r58 Solomon Jr r817 New Spring Taylor Jemison W (Alma) h2402 For- Taylor Esther L (c) rl67 Hilliard al syth rd Taylor Eug (c; Annie) lab hl25 (15) Taylor Jemison W jr elk r2402 Forsyth, TaFyrlaonr kElvina SSt(wliad Wm A) h.712 Vineville av (V) Taylor Evelyn (c) r313 Walnut Taylor Evoyn h720 Broad (EM) Taylor Fannie (c) cook hl7 Buckner al Taylor Fannie (wid L M) h864 Mulberry Taylor Francis (Hath J) porter Yellow Cab Trans & Baggage Co r360 Ash Taylor Prank (c; Lilia) lab CofGaRy h 765 Ash Taylor Frank (c; Fannie) sawyer Natl Handle Co hi 13 (529) Campbell av Taylor Frank jr sec-treas Taylor Furn- iture Co r709 College TAYLOR FURNITURE CO, Mrs Pearl Taylor Pres, Frank Taylor jr SecTreas, 161 Cotton av, Tel 2051 Taylor Geo mach r766 Cherry Taylor Geo (c) shoe repr Geder A Spence r825 Montpelier Ta4y2l9orEGe2odW(E(Mc;)Mary) lab CofGaRy h Taylor Geo (c) Indrs r211 Roosevelt av (V) rd Taylor Jesse J (Martha) carp hill (114) Crisp (SM) TaiynlgoraJvohn (c; Bertha) lab hl42 CarlTaylor John (c; Daisy) lab Natl Handle CO h720 (630) Prince (SM) Taylor John (Cleo) millwkr Bibb Mfg Co hl71 Gardner (PM) Tahyalmor CJoohttnon(cM; ilCl lha5ra0)7 pPoiorteNronWoilllaingTaylor John (c; Katie) shoe repr rl315 1st Taylor John J slsmn Taylor Fum Co rT09 College TTaayylloorr JJoohhnnniWe MJ ((cI)dam)aihd RrlivSopliardkrs al Taylor Jos (c) janitor hl25 Northern av (EM) Taylor Jos (c; Fannie) porter Sears Roebuck & Co hl55 Hill Taylor Josephine (c) cook r613 (13) Gil- mer Taylor Joshua (c; Lillie B) lab Willing- ham Sash & Door Co h436 Hammond 353 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Taylor Julia (c) maid rl07 (1620) John- sons al _ Taylor Roberta (c) maid r513 Forsyth Taylor Rosa (c) h263 Gantt City rd (S Taylor Julian student r709 College Taylor Julian S (Minnie I) hl43 Cole Taylor June student r207 Beech av Taylor Justine (c) lndrs r221 5th av (V) Taylor Kine (c; Annie M) delmn h809 Port Hill (EM) Taylor L Margt rl31 Oakland av Taylor Lanier elk Sou Gro Stores Inc r 2402 Forsyth rd Taylor Lila (wid Dewey) fctywkr Happ Tavlor Rosa prin Whittle Sch r227 Bond Taylor Rosa L (c) r3 (152) Bright al Taylor Rose (c) cook r935 Montpelier av Taylor Ruben (c) lab r210 Coles al TadyelorgraRrtuebnyrd42ir5ecVtoinreVviilnleevialvle (AVv)e KinTaylor Rufus H (Leona M) auto mech Georgia Auto Co hl31 Oakland av Taylor Rufus L Rev (c; Lillie L) h32a Bros Co rl427 3d ,, ,,, Taylor Lillie N (c) tchr PH Sch r325 3d Taayvlor Lois (c) lndrs rl330 1st Taylor Lorena Mrs rlOl StJames av (S M) Taylor Louise (c) r513 E 2d (EM)i Taylor Lucille (c) rll6 (167) Plummers al Taylor Luther r252 Broadway Taylor M R Mrs elk WPA r224 Georgia Taylor Magnolia (c) cook h448 Douglas Taayvlor(VM) allie (c; Cora L) tchr r226 (125) Grant av (V) Taylor Mamie (c) maid h211 (127) Vir- gin la (V) . Taylor Marcus T (Arrilla) h602 Main (E M) Taylor Margt student rl05 Pierce av (V) TaJyolnoersMJaorhgntstBonMRrsussienlflor&maStipoanrkselkr 195 Pierce av (V) Taylor Martha (c) cook r232 Collins pi Taylor Martha (c) cook hl30 (181) Wil- liams la . Taylor Martha tchr PS r Rivoli dr Taylor Marvin (Barbara) elk r904 New Taylor Mary (c) cook r362 Robinson rd Taylor Matthew (c) lab rll7 (13) Frank al Taylor Mattie E (wid Job E) h318 Napier Taylor Mattie L (c) r769 Ash Taylor Maude Mrs cash Natl Life & Accdt Ins Co r727 Orange Taylor Mildred beauty opr r!04 Cleveland av (V) Taylor Mildred mill wkr r269 Maple Taylor Mildred V mill wkr Willingham Cotton Mill rl7 Randolph pi Taylor Minnie (c) cook rl04 (115) Cedar (U) Taylor Minnie (c) cook h227 Linden av Taylor^Ruth tchr Winship Sch r318 Napier av Taylor Ruth (c) tchr PS r400 Ward (V) Taylor Ruth Mrs ins agt Murphy Taylor & Ellis Inc Taylor Sallie r751 College TaMyloonr tpSealmieri Lav (Mattie E) carp hl050 Taylor Sarah slswn r425 Vineville av (V) Taylor Serena B Mrs student Ethel B Davis Beauty Shot) rlOl StJames av Taylor Sidney L (Agnes) loco eng h767 Pine Taylor Sunshine student r819 New Taylor Susie (c) h400 Ward (V) Taylor Susie (wid Jas B) rl08 Kemper av Taylor Theo (c; Corinne) tire changer Sears Roebuck & Co h524 Hawthorne Taylor Thos (c) barber Palmetto Barber Shop r602 3d (V) Taylor Thos (c) pdlr r366 (365) Haw- thorne . , Taylor Thos jr (c) porter Firestone Auto Sup & Serv Stores r460 Broad (EM) TAYLOR TRANSFER CO (E S Taylor), aSnedrviLcoengOuDristManoctteo,HaMuolivnign,g,458StPolruamge, Tel 388 (For further information see left top lines and page 32 Buyers' Guide) Taylor Tullie M h200 Cutters la Taylor Vallie (c) maid rl24 (12) Frank- lin St la . _,, Taylor Veston mill wkr Bibb Mfg Co r 2437 Broadway Taylor Viola (c) hill Penn av (V) Taylor Watt (c; Irene) lab r602 Ross Taylor Wm (c) r438 O'Hara la Taylor Wm (c) delmn rl67 4th av (V) Tanyulotr Wm (c; Annie) lab h468 Chest- Taylor Wm A (Lillie M) bkpr h207 Beech Taylor Minnie (c) cook r406 (505) Prince Taylor Wm A blrmkr CofGRy . (SM) Taylor Wm E slsmn E C McMillan Paint Taylor Minnie J tchr PS rl43 Cole Taylor Minnie L r257 High Taylor Moina C cash Conn Mut Life Ins Co r2402 Forsyth rd Taylor Nancy E (wid J W) h274 Colum- bus Taylor Neva nurse r356 New apt 4 Taylor Odessa (c) rill Elm TaMylfogr COomehrllL L(aZkuemaC)itywtc(EhMm)n Bibo Taylor Otis (c) lab r359 Elm Taylor Pearl (c) maid rl06 (305) Craft Taylor Pearl J (wid Frank) pres Taylor Furniture Co h709 College Taylor Polly (c) h810 Fort Hill (EM) Taylor Quincy (c; Viola) ydmn h475 Log Cabin dr . , TTaayylloorr RRaancdhaelll L(c;(cE) mmmaaid) lral2b9r6A02daRmosss Taylor Richd (c; Flora) lab Natl Handle Co h438 O'Hara la Taylor Robt (c) blksmith 108 Middle (V) rll7 (13) Franks al (V) . Taylor Robt (c; Fannie) mill wkr Bibb Mfg Co h311 Womack (EM) Taylor Robt G atndt Terminal Service Station Taylor Robt J (Katy) investments Ih2<)5 Vineville av Taylor Roberta (c) cook h rear 151 2d & Glass Co rl43 Cole Taylor Wm H (Virginia) delmn Natl Biscuit Co rl41 Lamont av (L C Hts) Taylor Wm M (c; Ida M) lab rl65 (317) Nussbaum (SM) Taylor Willie (c) lab Idle Hour Nurseries r Forsyth rd Taylor Willis A (Ethel) lab r825 Orange TaByloowr mZaenatr(iEcMe )(c) studen_t r201 (,116) Teabeau Claude Mrs hl53 Boulevard (N H) TeBagrouaedWwamy (c; Alma) loco firemn hl315 Teague Wm W (Ruth) fety wkr h24 Bellevue rd Teal Dempie B (wid Henry R) h743 Ridge av (V) Teal Francis E bkpr r743 Ridge av (V) Teal John W (c; Tommie) lab Taylor Iron Wks & Sup Co rl02 (146) Eliza- beth (TF) ,, ,, Teal Wm (c; Emily) lab h400 (567) Hen- rietta (SM) Teasley Joel H rl03 Hartley av (CP) Teasley Oscar A (Mary) timekpr h215 Edna pi , ,, Teate Ralph J (Cora I) supt R L Polk & TeCboeaur4J8o3hnOAran(gAerd Cash Grocery) rl53 Boulevard (NH) 8. F. MERRITT COAL GO. 1414 FIRST Cor. Ash YOUR CITY D I R C T O R Y MIRRORS the CIVIC Life Of Your CITY D. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Co. Studebaker Willys Hopmobile Sales Service 655-657 Third St. PHONE Teel L T (Musette) mill wkr Atlantic Cotton Mills hl7 Atlantic Village TeNlfoaniro Paevter(V()c; Edna) lab h912 Pio Teamvple(VA) ugustus (c; Lula) lab r325 3d TesmonpleraBbebtih 8I7s0raeCl hReervryIsaac E MarcuTemple Herschel (c) lab r401 (708) Hen- derson (SM) Temple Jefferson (c; Eugenia) lab h400 (511) Prince (SM) Temple Jesse (c; Helen) lab r401 (402) Crisp (SM) Temple Junius A (Mary) civ eng State Hwy Board Div No 2 hl02 Cleveland av (V) Temple Thamer E (Mable G) cond hl50 TeCmoplele Walter P pntr r617 Pine Temple Walter P jr cond h617 Pine Tenme Carl (c; May) carp h320 (318) Patterson (N Hts) Tennille Estelle tchr PS h576 College Tennille Paullin r576 College Temrmanin)alTBeramrbienralShSotpati(oSnwep O BrockTerminal Information Bureau Terminal Station Terminal Service Station (Paul Stallworth) filling sta 342 Cherry Terminal Station 5th cor Cherry Terminal Station Baggage Room A D Satterwhite bge mstr Terminal Station Thames Geo W (Helen R) store mgr Rogers Stores r507 Duncan av Thames Irvin W (Christine T) agt Carolina Life Ins Co r91 Lawton av Thames Joel E (Rosa L) sta mgr Ingleside Oil Co h510 Ridge av (V) Thames Jos L (Cecile) elk rll2 Ingleside Thames Lehman (Cecelia) elk GtA&P TeaCo rll2 Ingleside av Thames Lelia Mrs elk Coleman-Mead- ows-Pate Drug Co hl67 Magnolia Thames Lonnie (Mabel) bldg contr 1416 Oglethorpe h do Thames Louise J Mrs sec-treas James & Kingman Lmbr Co rl340 Vineville av (V) Thames Ruby B Mrs slswn Boyd Shoe Store rll4 Madden av Thaavme(sWTHh)os J (Mary L) h313 Morgan Thames Walter P (Eliz H) bldg contr 401 Duncan av h do ThvaimlleesaWv a(lVte)r S (Louise J) r340 VineThames Wilbur M (Ruby B) elk hll4 Madden av Thames Wm w student r401 Duncan av Tharp Chamie B (Mary E) asst div audiThtoarrp GCahaPsowBerr4C6o4 hO4r6a4ngOe range Tharpe see also Thorpe Tharpe Augustus (c; Johnnie M) h257 Cowan (EM) Tharpe Benj C (Edna) elk PO h244 Edna pi 2997 Terminal Ticket Office R Neal Bateman Tharpe Bessie hl02 (3) Balkcom av (E ticket agt Terminal Station M) Terrace Apartments 864 Mulberry Terrell Auto Electric Co (Jack H Terrell) contrs 520 Broadway Tharpe Chas (c) lab h272 Madison Tharpe Chas jr (c) emp CofGaRy r272 Madison YOUR CITY D Terrell Jack H (Kath; Terrell Auto Electric Co) hl38 Summit av (NH) Terrill A Jack (c; Hattie B) brkmn h806 (700) Crisp (SM) Terrill Arth L (Mallie) slsmn hl75 North av (NH) Terrill Vida elk Court of Ordinary rl75 North av (NH) Terry Alice (c) cook rl33 5th av (V) Terry Allie (wid Howard) millwkr Bibb Mfg Co h905 New Tharpe Claire rll6 Vista cir Tharpe Delia (c) r213 Green Tharpe Dora (wid Randolph) rlOl Mill Tharpe Dorothy r407 Walnut Tharpe Edgar J (Perris) elk PO hi04 (105) Balkcom av (EM) Tharpe Edgar J jr student rl04 (105) Balkcom av (EM) Tharpe Edith rll6 Vista cir Tharpe Eura L (c) rll8 ( 220) Green (V) Tharpe Evelyn E opr SBT&TCo rlOU I R je c T o R Y Terry Arth (c) lab Chambers Lmbr Co Inc hl36 Pecan av Terry Eva L fety wkr rl04 (107) Crisp (SM) Terry Prank (c) janitor SBT&TCo rl252 2d Terry Ida Mrs r820 1st Terry John elk r905 New Terry Lillie (c) rl36 Pecan av Terry Mack I (Carrie p) filtermn City Water Wks h450 Virginia av Terry Margt slswn P W Woolworth Co r905 New Terry Marion P (Jessie L) slsmn H Mar- shall Fum Co hl04 (107) Crisp (SM) Terry Mary student r905 New Terry Mary E student r450 Virginia av Terry Ollie Mrs nurse h516 Ocmulgee Terry Paul (c) lab h800 (801) Charles (S M) Montepelier av Tharpe Felix student r308 Mikado av (S M) Tharpe Geo H (Lulu M; Strong Shoe Co) h201 Vista cir Tharpe Gus (c) pntr r582 Monroe Tharpe Gussie (c) rll35 Broadway Tharpe H Lynwood (Kath) carp r436 Carling av Tharpe Horace (c; Mamie) lab h50S (605) Henrietta (SM) Tharpe Hugh student r308 Mikado av (S M) Tharpe Jas (Bernice) r326 Linden av Tharpe Jas (c; Mattie) janitor h668 Douglas av (V) Tharpe Kathryn Mrs slswn W T Grant Co r436 Carling av Tharpe Lee H (Mae) electn h308 Mikado av (SM) TERRY SAM L, Sec-Treas Pitts Mortu- Tharpe Lillian V Mrs r433 Carling av MIRRORS the CIVIC Life Of Your CITY ary, r814 Mulberry, Tel 146 Terry Thos (c; Mary) lab h.1252 2d Terry Wm J (c) r602 (2) Gilmer TEXAS CO THE, Jack Cutler Agt, 770 Division, Tel 200 Texas Co The filling sta 500 Forsyth Thackston Jas A (Myrtle B) driver Wof- ford Oil Co plant h872 Hillyer av (CH) Thames Carolyn sten Bibb Mfg Co r401 Duncan av Th(a1m58e)s ECarirslpT ((SEMsm) alee M) slsmn hl21 Thames Earl T jr student rl21 (158) Crisp Thames Fronie Mrs r510 Ridge av (V) Tharpe Ludie (Clara) porter DunlapPeeler Hdw Co rl22 Moughon (V) Tharpe Marie (c) lndrs h24 Parker av (V) Tharpe Martha (c) h206 Woodcliff Tharpe Mary A jr opr SBT&TCo rl06 Montpelier av Tharpe Pearl (c) lndrs r Tharpe (B) Tharpe Raymond L (Roslyn) pntr Adams-Buchanan Motor Co r RD 5 Tharpe Robt (c; Fannie) porter r272 Madison Tharpe Robt A (Emma) real est Mur- phey Taylor & Ellis Inc hll6 Vista cir Tharpe Robt K (Jacob I; The Polar Bear) r.101 Coleman av 355 S MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 0 455-57 SECOND ST. TEL. 4401 u Tharpe Thos S jr (Prances) slsmn Tay- lor Iron Wks & Sup Co h564 Boule- vard (NH) Tharpe Wm (Clara) r407 Walnut Tharpe Wm H (Daisy) carp hl06 Mont- pelier av Tharpe Wm T (c; Josephine) hl5 Parker av (V) Tharpe Willie (c; Mary) porter r220 3d av (V) Thatch Roht R slsmn Natl Biscuit Co r 695 Cherry Theiss Conrad A (Edith W) sec-treas Southland Coffee Co hl05 Ponce de Leon av (SM) Theiss Marion G rl05 Ponce de Leon av (SM) Thigpen Bernard E (Ellen) slsmn Fried- man's Jewelers r256 Washington av Thigpen Budge C (Marie) elk h716 Mul- berry Thigpen Doris student rl06 Jeff Davis (SM) Thigpen Emmett B (Mary B) car repr CofGRy h424 American blvd Thigpen Guy A (Willie V) elk Power Oil Co hi06 Jeff Davis (SM) Thigpen Lillian K student r424 American blvd . Thigpen Wm mill wkr Willingham Cot- ton Mill rll8 (9) Holt av (NHts) Thigpen Wm G (Alice) elk Vineville Drug Co h712 Pine Thistlewood Geo H r558 Arch Thistlewood Geo S (Rosalie) auto mech City Storage Garage h558 Arch Thomas Bertha L (c) r416 Maynard (E M) Thomas Bessie (c) cook rl28 (241) Rail- road av (V) , ,, , Thomas Bessie (c) cook rl05 Braswell la Thomas Birdie (c) maid rll (18) New Strict lSi Thomas Bonnie L (Christine D) slsmn X V Clothes Shop h857Ms Cherry Thomas Buster (c) delmn Ingleside Pharmacy r5 Bookers al Thomas C G (c) r519 Ross Thomas Carl (c: Lillie M) millwfcr Will- ingham Cotton Mill rl02 Bartlett Thomas Carrie (c) cook hl28 Jones Thomas Carrie (c) maid h651 Hazel Thomas Cath (c) r327 Ballard (EM) Thomas Cecil rl802 2d Thomas Chas (c) rl (7) Spring Thomas M) Cha1 s (c; Prances) h509 E 1st (E Thomas Chas (c; Mary) driver Toole Furn Co hll7 (123) Cedar (U) Thomas Chas (c; Lula) lab hl41 Auburn Thomas ^has (c; Ada) lab hl68 (300) Roye (CH) Thomas Chas (c) porter r5 Rose la Thomas Chas F (c) lab rl68 (300) Roye (CH) Thomas Christine Mrs cash r867 Cherry Thomas Claudia (c) lndrs hl02 Bartlett Thomas Cletia L smstrs rll9 Daley Thomas Clifford (c) driver rl302 1st Thomas Clinton C (Athalie) car inspr h 159 Jeff Davis (SM) T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Thom Mattie r225 North av (NH) Thomas A J (c; Eva) lab r8 Reynolds al Thomas Adam (c; Louise) driver Jacob Hirsch h817 3d Thomas Agnes (c) rl36 dlOl Bay Thomas Alex (c; Jessie) lab hl20 (402) Thomas Danl (c) hl3 Gas House av Thomas Danl (Helen) elk r325 Ross Thomas David (c) lab r221 Division St la Thomas Della (c) r320 Hammond Thomas Dollie M casewkr City Dept of Public Welfare r505 Forsyth Tel. 3047 Middle la (EM) .. , Thomas Allie (c) lndrs r612 Washington av Thomas Alonzo (c; Beulah) lab r230 Calhoun Thomas Alonzo (c) porter r432 Monroe Thomas Andrew (c; Jeneva) lab hl20 Cowan (EM) Thomas Andrew .(c) mill wkr Bibb Mfg Co h3 Lenox la ,, ,,,, , Thomas Anna (c) hl57 (218) Duval (E M) Thomas Anna (c) lndrs hll2 Reid (SM) TThhoommaass AAnnnneie (c(c))r2c2o8okLyr4n6w8ooCdheasvtn(uVt) Thomas Annie (c) maid x607 Telfair Thomas Annie P (c) maid rll7 Wyche (SM) ThAolmabasamAann(iSeMM) (c) cook r231 (441) Thomas Archie L (c) cook hl233 3d Thomas Arge C rll9 Daley (SM) Thomas Arline (c) cook hll3 Hicks al Thomas Arth (c) grease wiper CofGRy h2 Harris al , , Thomas Arth L (c; Willie M) lab Mill- irons Plmbg & Htg Co h247 Dempsey av (U) Thomas Augustus (c; Celie) lab h400 (8) Crisp (SM) . _. Thomas Barney M (Willie) car pntr Cof G Ry h521 Main (EM) Thomas Bartow (c; Mattie) lab h9 Ber thadale dr (V) Thomas Beatrice (c) dom h315 Ernest (EH) ,, Thomas Beauty B (c) dom r315 Ernest (CH) Thloamas Benj (c; Dora B) hll6 Bartletts Thomas Benj (c; Rosa) lab hl81 (325) Nussbaum (SM) , Thomas Berry L (Josephine) mach h410 Winshop (WH) Thomas Bertha (c) student r276 2d av (V) Thomas Donald (c; Estella) lab rl62 Lincoln av (V) Thomas Doris (c) student rl22 New Thomas Dorothy tchr r545 Courtland av Thomas Early (c; Virginia) lab h333 (556) 2d av (U) Thomas Edgar (c; Eldora) agt Pilgrim Health & Life Ins Co hl62 Lincoln av (V) Thomas Edgar (c) delymn Chas A Pick- ett r7 Spring . ,_ Thdoamryas Edw (c; Julia) r2 (5) West Boun- Thomas Edw (c: Mary) lab CofGRy h 452 Bay Thomas Edw (c) lab rl76 College Thomas Edw (c) lab rl94 Tindall av (S M) Thomas Edw (c; Corine) mill wkr Bibb Mfg Co h359 Flanders (EM) Thomas Edw (c) sta atndt h616 Chap- man al Thomas Eliz emp WPA r617 Orange Thomas Ella M rl04 Montpelier av Thomas Ella M (c) cook rlOl 4th av (B) Thomas Ellen (c) h5 Rose la Thomas Ellen (c) rl (7) Spring Thomas Elmo (c) r317 Dure (U) Thomas Elnora (c) dom r315 Ernest (C H) Thomas Emily (c) cook rl61 College Thomas Emma (c) h7 (150) Bright al Thomas Emma (c) h224 Chappell la Thomas Emma (c) lndrs h302 (202) 2d av (U) Thomas Emma (c) maid rl306 Broadway Thomas Emma (c) maid hl6 Parker av (V) Thomas Emma (c) maid r5 Rose la Thomas Ernest (c) lab r612 Rose Thomas Essie (c) maid h352 Madison Thomas Essie (c) maid r306 (603) Prince (SM) Thomas Essie M (c) student r519 Ross Thomas Estella Mrs dishwasher Dannenberg Co rl62 Lincoln av Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & CO. Publishers 431 Howard St. Detroit 354 4th Ave. New York 356 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. MStoemckberEsxcNh.anYge. N. Y. Cotton Exchange ChicagoTraBdoeard at AssNoc. iaYte. MCeumrbbers Exchange Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds THIRD AT PINE GMC TRUCKS PHONE 5100 Thomas Estelle tchr PS r RD 3 TThhoommaass EEtthheell M(c)(cI)ndmrsaidhl3rl30(71)stSpring Thomas Ethel M (c) maid r5 Rose la Thuoemr as(SIMra) (c; Geneva) porter h80 WilIrene (c) r314 (228) Bowman (E Thomas Eug J (c; Ida) mill wkr Bibb Mfg Co hll2 ( 209) Thomas (EM) Thomas Eva (c) maid r223 5th av (V) Thomas Thw(.S^ot-Molad)s Evelena Eavzek(iVel) G (c) student rl20 Lyyn(Vallie) hl05 Dixie av Thomas Fannie (c) hl306 Broadway Thomas Fannie (c) Indrs h476 Lake Thomas Fannie (c) maid h261 Woodcliff TThToiommaass Jj DW(acl)telrab(ch;44A9 dCdoiele)s laalb h2lo Lincoln av (V) Thomas Jack routemn rll2 Pierce av (V) Thomas Jack R (Hazel) slsmn Dannen- berg Co rl42 Beech av Thomas Jas (c) h305 Gilmer Thomas Jas (c) lab rll38 Broadway Thomas Jas (Annie) lab h457 Elm Thomas Fannie H (wid Jas A) hll7 Cul- ver (V) Thomas Fannie M (c) r5 Murray al Thomas Fanny (e) Indrs h420 Bay Thomas Cabin Felton dr (c; Marshie L) r472 Lo6g Thomas Filmore (c) delmn Pitts Phar- inacy r Ayres rd Thomas Fletcher (c) r449 Coles al Slide8 Fl0ssie (c) maid h134 Moccasin (EM)S JaS (C' Daisy) lab h232 Norris ITioma-s Jas (c) lab r612 Ross inomas Jas (c; Fannie) lab rl031 3d Thomas Jas (c; Lou) porter J Hook T1S6l0pTM6raaCt^h,l New Street Thomas Prank (Edna P) auto mech Georgia Auto Co r9 Marion pi (309) WFraatnerkvil(lce; Grdeorgia) lab h409 ThioanmaasavFrank A student r545 Court- TThBTohmraamfsSaCsFo)uran1M0e0r50aslPHNiooemNweon^o(cfa:CvtyWW (Vka)rltH erapPP Thonias Geo (c; Odessa) driver h919 Ha- sytl?8 JaS E carrier PO h50o For- Thomas Jas W (Azelie M) wtchmn Atlantic Cotton Mill hl54 Carling av Thomas Janie (c) hl435 Broadway lliomas Jay Y (c) Indrs hl435 Broadway avSS(V)C; attle) lab hl2 Lyn- T1blvdaS JeSSe F student r502 American ^eTrlifcoluSbus ^ Dixie DairHanson(C:(SM)Venia) ^ h7 T^awthornel (C' Etbe14 loco Sremn r412 T^i2ofSBartlett' LaUra M) Wpr CofGRy Th(SM)S GC (c; Eva) lab h108 Concord Thomas Geo (c) lab h220 Gilmer Thomas Geo (c; Janie M) millwkr Bibb Mfg Co hi 16 E Ell Thomas Geo L (c; Annie R) fctywkr I3ibb Mfg Co rl08 Simmons av Thomas Geo N (Irene; T & T Packing Co) h545 (108) Courtland av Thomas Geo N mill wkr r404 Pio Nono av (V) Thomas Geo W pntr r404 Pio Nono av ^Si.h.Bo?imo .sasFJuToJr(nh?hnnC/o(c(h;cl)L2i0zPzo(i2er)6te4pr) oSrr7tien5rg3lMeAtaosxnhwleall (J?b^ H student rl68 (300) TNewsS rJ53h0nc^leagPePr MaCn 1176111118 Thomas John R (Effie) city firemn hl23 Piedmont av 'noTm*",vWc!St?)a> emp CorGBy Th(SM)S Jones L (c) r707 (207) Charles Thomas Georgia (c) r501 E 1st (EM) Thomas Geraldine (c) indrs h701 Church al (SM) Thomas Gertrude (c) fctywkr Bibb Mfg Co r458 Hawthorne Thaovma(Vs )Gilbert (c; Julia) pntr h276 2d Thomas Joe (Winnie) county eng Bibb County hll9 The Prado Thaoemrsas(EJoMs)(c; Pauline) lab h519 FlanThomas Jos (c) lab r604 Ross Thomas Jos (c; Hattie) lab hl08 Sim- mons av IS ilnswered By the Classified Lists In this Thomas Cottrell (c) lab r449 Coles al Thomas Hattie (c) hl31 (221) Elliott (E M) Thomas Hazel (c) Indrs r207 (319) Haw- kins av Thomas Hazel B Mrs slswn Dannenberg ThCoomarls4H2 eBnreyec(hc) alvab r904 Hazel Thomas Henry (c; Annie) lab r914 Pio Nono av (V) Thomas Henry (c; Julia) lab h7 Rose la Thomas Henry (c; Julia) lab Willing- ham Sash & Door Co plant hi (7) Spring Thzoeml as Herbert (c; Lillie) lab hi 15 HaThomas Herman (c) r222 Elliott (EM) Thomas Hester '(c) Indrs hll2 (300) Craft (V) Thomas Horace (c) rl42 (262) Forsyth la Thomas Howard (c; Dorothy) h!03 (220) Blount Thomas Hugh G (Ida) business mgr The Clinic h219 Vista cir _ton Mill r3l5K45niClbavrkh,i'nWg ilalvingham CotThomas Jos E (Mary A) h658 New Thomas Jos E jr student r658 New Thomas Jos H teller First Natl Bank & TTrust Co rll2 Pierce av (V) 13" PiercSeLavk(V)U Gr Str6S InC r ^BartTettf8?111116 (C> StUd6nt r116 Tll(CH)S Josepbus lab r168 (300) Roye TTbwe2"staifsBEouufnada?(rcye;mE)vVie()c:lab M) h529 h208 North- ThoSas LaTia^c)rmfoncmSgefM) cT h755a RWygeJ affv) ^ Crane TilockaS Laura (wid Wm D) r768 HemTh(5 Laverne rli7 (15) Balkcom av Thomas Lee (c) r437 Peters al (EM) 357 The World's Largest Store Shop at Sears i ?0 SEARS, ROEBUCK AND CO. and THIRD ST. MACON, GA. Save O CO Thomas Lee (c; Ozie L) lab h909 El- bert (SM) Thomas Lee (c; Mittie) restr 411 Crisp (SM) h707 (207) Charles (SM) Thomas Leola (c) r212 Church al (SM) Thomas Leola (c) r409 (410) Crisp (SM) Thomas Leroy (c) lab h825 Daisy (SM) Thomas Lester A (Clifford H) drugs 1001 Broadway hl03 Florida av Thomas Lester A jr pharm Lester A Thomas rl03 Florida av Thomas Lettie (c) rl03 (10) Bright al Thomas Lillian (c) lndrs r406 E 2d (E M) Thomas Lillie M (c) lndrs rl02 Bartlett Thomas Lizzie (c) lndrs hill (110) 1st av (U) Thomas Lizzie (c) lndrs h212 Fretwell al Thomas Lizzie (c) lndrs h212 (6) Vir- gin la (V) _ , Thomas Lonnie (Della) lab r367 (347) Hydrolia (EM) ThCoomttaosn LMorilelnrlL54 mCiallrliwngkravWillingham Thomas Louise (c) cook h203 (2) 3d av (B) Thomas Louise (c) maid r7 (150) Bright Thaolmas Louise E tchr PS r502 American blvd Thomas Lucille student r545 Courtland Thomas Lucretia (c) hl302 1st Thomas Lucy (c) maid h207 (319) Haw- kins av Thomas Lucy (wid Clyde A) rl64 Lamont av Thomas Luin (c; Bertha) lab r215 Collins pi Thomas Mildred (c) student rll6 Bart- lett's la , _... Thomas Milton (c; Corme) millwkr Bibb Mfg Co h424 Flanders (EM) Thomas Minnie G (wid Jos H) hll'2 Pierce av (V) Thomas Morris (c) lab rl3 Buckner al Thomas Moses (c; Ida) lab h230 (130) Cowan (EM) .. Thomas Nellie (c) r420 Hawthorne Thomas Nellie (c) cook r435 Chestnut Thomas Nellie (c) maid rll5 (151) Jones Street la ... Thomas Nelson (c) r218 Division (T) Thomas Nelson (c) lab rl39 Hazel Thomas Norman (c) delmn Colemans Pharmacy r230 Plant Thomas Norman (c; Ludie) lab hl42 E Ell Thomas Oscar (c; Savanna) cook h452 City Hall la . Thomas Oscar (c; Mary E) driver h403 (303) Waterville rd Thomas Oscar (c; Ida) lab h rear 1127 Napier av , ,,,,,, Thomas Oscar (c; Alice) lab h323 Gil- mer Thomas Otha (c; Susie) driver hll (300) Hanson (SM) Thomas Ovin G (Ruby M) caretkr h345 Columbus Thomas Paul (c; Maggie) lab h222 El- liott (EM) . Thomas Paul (c; Julia) lab r629 4th av (WH) Thomas Paul T (Evelyn T) cixty ,, firemn b 121 Winship (WH) Thomas Pauline elk rl64 Lamont av Thomas Pearl (c) cook h220 3d av (V) A O z r C3 > r * E pj 3 g o 0y0i Thomas Lula (c) r7 (150) Bright al Thomas Pearl (c) student r201 Bartlett Thomas Lula (c) cook r753 3d Thomas Perry (c) lab rl20 Broadway Thomas Lula F (wid Robt O) h502 Thomas Peter (c) lab r305 Elbert (SM) American blvd Thomas Phoebe (c) lndrs hl49 Lincoln Thomas Lula W (c) h560 Broad (EM) av (V) Thomas Luther M (Pearl D) bkpr City Thomas Porter L (c) rl20 Lynwood av DIRECTORY Dept of Public Welfare hl64 Lamont (V) Thro9mMasarMionFrpani k(W(EHd)na B) auto mech Thomas Rebecca (c) cook r905 Pio Nono av (V) LIBRARIES Thomas Mabel fcty wkr Happ Bros Co Thomas Robt (c; Viola) lab h602 Center rl59 Jeff Davis Thomas Mabel (c) (SM) lab h603 (120) Ellioitt (EM) (EM) Thomas Robt C (c) porter r432 Monroe Thomas Robt H (Lillian) spl agt hl35 We Have on File in Our Thomas Mamie (c) dom r315 Ernest (C H) Thomas Mamie fcty wkr r415 Oak Thomas Mamie L (c) r462 Hazel Thomas Mansel A rl59 Jeff Davis (SM) Thomas Margt E (wid Wm D) rll9 Daley (SM) ,, Thomas Margt E (wid Wm D) hll9 Da- ley (SM) Thomas Mary (c) h403 (819) Cedar (TJ) Thomas Mary (c) h218 Division (T) Thomas Mary (c) h3 (312) Hanson (SM) Thomas Mary (c) r319 (18) Plumtree (E M) Thomas Mary (c) rll6 (1229) Tracy's la Thomas Mary (c) gro 229 Patterson (N Hts) r do Thomas Mary (c) lab hl36 (110) Bay Thomas Mary (c) lndrs hl08 (770) Nuss- baum (SM) Thomas Mary F (c) r411 (410) 3d av (V) Thomas Mary L (c) h314 Industrial Home rd Thomas Mary L (c) maid Ethel R Davis Beauty Shop rll (300) Hanson (SM) Thomas Matthew (c; Eula) lab Happ Bros Co h213 (350) Turpin (T) Thomas Mattie S sten Willingham Loan & Trust Co r502 American blvd Thomas Maude (c) hl34 Roosevelt av (V) Thomas Maurice C (Myrtle; Moore Johnson & Thomas) hi 14 Corbin av (V) Thomas Max (c; Mary) ydmn h401 Smith (EM) Thomas Mildred rll2 Pierce av (V) Pierce av (V) THOMAS ROBERT O (Margt D), Real- tor, Real Estate Sales and Rentals 569% Cherry, Tel 1067, h502 American Blvd, Tel 645 (For further information see right top lines and page 29 Buyers' Guide) Thomas Robt T (c; Bertha) firemn h234 2d av (V) Thomas Robt T jr (c; Mattie) carrier PO h524 Monroe Thomas Rosa (c) maid r420 (327) Straight (U) Thomas Rosa M (c) maid r317 Dure (U) Thomas Roscoe (c) student r201 Bartlett Thomas Ruby tchr PS r RD 3 Thomas Rufus (c; Lucinda) lab hlOl 3d av (U) Thomas Rusay M (e) hl31 E Ell Thomas Ruth (c) maid r209 Plant (SM) Thomas Sami fcty wkr Happ Bros Co r 159 Jeff Davis (SM) ThRoamilarsoaSdamavi ((cV; )Ruth) lab h.ll.8 (14) Thomas Sami (c; Carrie B) lab h305 (310) Campbell av (SM) Thomas Sami R (c; Lizzie) pdlr r89 For- est av (V) ,, Thgoeme as Sanford (c) brklyr h915 Ocmul- Thomas Sara sten r658 New Thomas Sarah (c) h753 Ash Thomas Sarah (c) maid r276 2d av (V) Thomas Scott (c; Louise) lab hl50 1st av (V) Thomas Seab (c) porter Wm C Aber- crombie jr r553 3d DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want Information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 358 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Thomas Sidney (c) lab r315 Ernest (C H) Thomas Sidney (c; Rosa) lab h317 Dure Thombley Robt L (Martha J) sec-treas HCoerrbbienrt aSvma(Vrt) Clothing Co Inc h319 IP It' Thomas Silas (Annie) lab Taylor Iron Wks & Sup Co r Unionville Thomas Susie (c) cook hi02 Cutro al Thomas Susie (c) elev opr Hotel Lanier h931 (963) Ocmulgee Thomas Sylvester (c; Jessie) lab hl22 PHI New Thomas Tallulah (c) h314 Forest av (V) Thomas Tempie (c) cook hl51 Moore al Thomas Ulysses (c) r707 (207) Charles (SM) Thomas Vallie (c) Indrs hl03 (10) Bright al Thomas Viola (c) Indrs r2l2 Church al (SM) Thomas Walter (c) mach r220 3d av (V) Thomas Walter (c) glazier Willingham Sash & Door Co plant r210 Lincoln av Thomas Walter N (Maggie) hll7 (15) Balkcom av (EM) Thomas Walter P (c; Thomas Funeral Thompkins Bertha (c) rl26 Edgewood av Thompkins Johnnie M (c) tchr Hazel Street Sch r853 Ash Thompson Agnes slswn Johnnie John- son Beauty Supply Co r7 Rose pi Thompson Albert (c) lab r51 Monroe (U) ThCohmeprrsyon Albert F (Mary G) bkpr r903 Thompson Almeda student rl56 New Th5o0m5 pJsaocnksAonnder F (Jessie M) guard h Thompson Andrew (Nora) mill wkr r53 (8) Roff Home pi Thompson Andrew P (Josie L) h615 Walnut apt 1 Thompson Austine r851 Hemlock Thompson Benj A car repr CofGRy r Hotel Gordon Thompson Bernice r.116 Dixie av (SM) Thompson Bessie r620 1st Thompson Bessie (c) maid rll3 Middle la (EM) cn Home) h229 Patterson (NHts) Thomas Wm (c; Susie) hl46 (459) Army Th(oEmMp)sohn22B6ud(7r1o9w) P(ce)arbl a(rEbMer)246 Main Lot Thompson C B mill wkr Bibb Mfg Co r Thomas Wm (c; Julia) h326 (322) Bur- 338 Calhoun 2b ewag5 W 06 I og H or nett (EM) Thomas Wm (c; Odessa) r320 Hammond Thomas Wm (c) hl05 Spring ThCoomaIsncWrm3.1(7c)Ddurriever(UC)hambers Lmbr Thomas Wm (c; Pearl) driver hl23 Edgewood av Thomas Wm (c; Argo) driver h502 O'Hara la Thomas Wm (c) lab r801 (701) Crisp (S M) Thomas Wm (c; Eula) lab h453 Gilmer Thomas Wm (c; Aurelia) lab Mansfield Dray Line r228 Jones Thomas Wm (c) lab rll8 (137) Kahn's al Thomas Wm (c; Bessie) lab hlOl (119) New Street al Thompson Carlisle baker Central Ga Baking Co Thompson Carlton W (Eva L) ship elk Empire Fum Co r774 Pio Nono av (V) Thompson Carrie (wid Joah) mill wkr Bibb Mfg Co r338 Calhoun Thompson Cath student r7 Rose pi Thompson Chas E (Jessie D) slsmn Dunlap Chevrolet Co h316 Linden av apt (A) Thompson Clark A (Louise M) bkpr Packard Macon Co h703 Birch (NHts) Thompson Cleo M beauty opr Marinello Beauty Shop r801 Pio Nono av (V) Thompson Clinton E slsmn Dunlap Chevrolet Co r316 Linden av apt A Thompson Collie (c) h225% 5th Thompson Danl M store mgr Rogers Thomas Wm (c; Eula) lab hllO (10) Stores r533 Orange apt 2Z 3h O 2 KmQ. to to Tracy's la Thomas Wm (c; Gertrude) lab h2119 Wyches al Thomas Wm (c; Fannie) lab hll5 (151) Jones Street la ThGomaraasgeWhm213(c;JonMeasry) porter Fried's Thomas Wm B (c) rl40 Bay Thomas Wm B (c) lab rl50 (140) Bay Thomas Wm G (c) lab r7 (150) Bright al Thomas Wm G route mn rl35 Pierce av (V) Thomas Wm H (c) phys 266A Main (E M) r314 Forest av (V) Thomas Wm J mill wkr Willingham Cotton Mill rl54 Carling av Thomas Willie (c) maid 2410 Forsyth rd Thomas Willie P (c) tchr PS r321 Doug- las av Thomas Woodrow pntr Macon Neon Sign Co r611 2d Thomas Zachariah (c; Lizzie) lab hl227 3d Thomason Annie M Mrs hl43 Sulphur Springs rd Thomason Clyde (Louise) driver rl64 1st Thomason Jas U (Hattie P) h261 Maple Thomason Jettie M (Mamie) carp hl02 (105) Applewood (EM) Thomason John H student rl02 (105) Applewood (EM) Thomason Lillian inspr Macon Peanut & Stge Co r RD 4 Thomason Lillian slswn rl43 Sulphur Springs rd Thomason Louise mill wkr Bibb Mfg Co rl02 (105) Applewood (EM) Thomason Virginia M opr SBT&TCo r 261 Maple TThhoommppssoonn DDoolclkie (FMsyurpt)t pMnitdrdlrel0G26eo2rdgia Hospital r710 Spring Thompson Donnie (c; Lera) lab CofGRy h327 Ballard (EM) Thompson Edna A student r851 Hemlock Thompson Eldora nurse 216 Adams r do Thompson Eleanor Mrs floorwn F W Woolworth Co rl44 Holt Thompson Ella (c) cook rl034% Broad- way Thompson Elnora (c) r311 Henderson row (SM) Thompson Emmett elk Lyons Cash Mar- ket r338 Calhoun Thompson Eunice Mrs rl79 North av (N H) Thompson Fred F student r801 Pio Nono av (V) Thompson Fred N guard City Stockade Thompson Fredk W (Vivian) city firemn h846 College Thompson Fredk W jr student r846 Col- lege Thompson Gabriel r505 Jackson Thompson Gene A (Myrtle C) mgr Wis- teria Cafe h476 College apt 9 Thompson Geo W (Charlsie) mill wkr Bibb Mfg Co h651 Ash Thompson Georgia (wid Robt) r663 Plum ThgormeepnsoCnoGre2o6r3giaGeWorgMiarsasvlswn WalThompson Harry (Ethel M) driver Leap- trot Dry Clng Co h957 Elm Thompson Hazel beauty opr Pucketts Beauty Salon r620 1st Thompson Herman L r316 Linden av apt (A) Thompson Jas A (Lutrelle) flagmn hl074 359 LOTHER WILLIAMS' SON Frederiok W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON. GA. PH0NE 1586 Thompson Jas N (Ruby) elk Leaptrot s ThMomktpsro2n55JoMhnon(tcp)elliaebr ralOvO Telfair Thompson Jos A (Mallory S) cond h851 Hemlock ,, Thompson Juliette (wid Geo) r7 Rose pi Thompson Leila (wid Geo W) hlOO Villa Thaovmp(Bso)n Leroy B (Eda Belle) sec-treas Dessau Realty & Ins Co h320 Buford Thornton Gus (c; Susie M) rlG8 (7) Jordan (EM) Thornton Jesse T (c; Mary) hl018 Broad Th(oErMnt)on Jos G (c; Mamie E) loco firemn 724 Ash Thornton Lillie Mrs (Hi-Lo Grocery) r RD 6 Thornton Lizzie (c) h509 (519) Maynard (EM) Thornton Lucille (wid Jas) r530 Wash- Thompson Leroy B jr student r320 Bu- ford pi , Thompson Lillian (e) cook r51 Monroe (U) Thompson Mahalia (c) lndrs hl07 (120) Kahn's al Thompson Margt matron Oglethorpe Private Infirmary (Nurses' Home) r 1321 Oglethorpe Thompson Mary mill wkr Bibb Mfg Co r 651 Ash TThhoommppssoonn MMaartytiesm(sct)rs mh4a1i6d Crla0lh8ou(n770) Nussbaum (SM) ThCoommpesronteMr a(tPtiMe )Mrs mill wkr rl23 Thompson Minnie (wid Martin J) h616 Arch Thompson Maude O fety wkr Happ Bros Co r202 Newberg (SM) Thompson Myrtle C Mrs asst treas Macon Teleg Pub Co r416 College apt 9 Thompson Norman R (Mary S) elk Sands & Co r613 1st Thompson O Richd (Hazel) phys 700 Spring R201 h206 Belvadier dr Thompson Odessa (c) r404 Robinson rd Thompson Ophelia (c) lndrs r232 Jones Thompson Owen P (Rosa P) credit mgr R S Thorpe & Sons r305 Fort Hill (E M) ington av Thornton Lurline (c) r433 Chestnut Thornton Mamie (c) cook rl05 Cedar Th(oUr)nton Mary J (c) hl020 Broad (E M) Thornton Robt L (Bessie N) hl985 3d Thornton Smalley (c) soft drinks 527 Hazel h do Thornton Stanford elk Hi-Lo Grocery r RD 6 Thornton Thos R (Helen) trav slsmn h 575 Orange apt 8 Thornton Wm D (Verna D) USN h864 Mulberry apt 2d Thorpe see also Tharp Thorpe Allene (c) rl060 (1065) Coleman's la Thorpe Annie (c) r227 Hurley la Thwoarpne (BEeMat)rice (c) prsr r510 (650) CoTHORPE CECIL A, Pres R S Thorpe & Sons, r300 Georgia av, Tel 3287 Thorpe Chas student rl315 Vineville av (V) Thorpe Chas (c) fety wkr rl03 4th av (B) Thorpe Chas B (c; Emma) porter Amer- ican Oil Co rll4 New Thorpe Cicero (Odessa) car repr CofGRy hlOll Montpelier av Thorpe Claude (c) porter Brown's Bar- Thompson Paul (Dolly M) mill wkr Wil- ber Shop r510 (650) Cowan (EM) lingham Cotton Mill r3 Gustin pi (V) Thorpe Daisy W (wid Virgil) tchr PS h Thompson Pearl (wid Thos W) r801 Pio 206 Delaware av (V) Nono av (V) Thorpe David student r206 Delaware av Thompson Pete lab Taylor Iron Wks & Sup Co r305 Elbert Thompson Ray (Eleanor) appr Macon Teleg Pub Co rl44 Holt Thompson Richd C (Daisy) h217 (216) Hydrolia (EM) Thompson Richd G (Louise) dispr hl32 High Thompson Thelma Mrs rl42 Stratton (S M) Thompson Viola (c) hl008 Broad (EM) Thompson Wilbur L (Grace) loco eng h 307 Forsyth Thompson Willa L r316 Linden av apt (A) Thompson Wm (c; Sarah) fety wkr h213 4th av (B) (V) Thorpe Ervin formn rlOl Mill av Thorpe Frank (c; Ellen) hl060 (1065) Coleman's la Thorpe Frank jr (c) student rl060 (1065) Coleman's la Thorpe Geo H (Frances) trav slsmn h 1315 Vineville av (V) Thorpe Jas (c; Mattie) lab h510 (650) Cowan (EM) Thorpe Josephine (c) r230 5th av (V) Thorpe Lillie (c) lndrs rl20 Franklin Thorpe Loudie (c; Clara B) chauf rl22 Mou^han (V) Thorpe Louise (c) cook rl23 Edgewood ThAormpeeriLcaonuisbelvHd (wid Monroe C) hll3 Thorpe Marion student r206 Delaware av Thompson Wm A (Maude E) elk PO h (V) 156 New Thompson Wm A (Mildred I) disxt , plant Thorpe Mary (c) cook hl26 (492) Virgin (V) chf SBT&TCo hl42 Beverly pi Thorpe Melissa (c) lndrs hl435a Broad- Thompson Wm A jr ri56 New way Thompson Wm H slsmn Adams-Bu- Thorpe Nell student r206 Delaware av chanan Motor Co r851 Hemlock (V) Thompson Wm K (Edna) brklyr h223 Thorpe Nellie P (c) clnr Snow's Lndry & (263) Willingham (EM) Dry Clng Co r909 Ash Thompson Wm W (Clara A) carp Taylor Thorpe Olin student r206 Delaware av Iron Wks & Sup Co h620 1st (V) Thompson Zack (c; Hattie) wtchmn h Thorpe Ophelia (c) lndrs rl23 (202) 311 Henderson's row (SM) Magnolia la Thomson Eunice asst alumnae sec Wes- leyan Coll Thomson Lee porter rl20 Linwood av Thomson Vernon L (Emma IF) sub sta opr Ga Power Co h653 Forsyth-- Thomer Estelle M tchr PS r204 Buford Thpolmer Gertrude sten Hall & Bloch r 204 Buford pl . Thornton Ethel (c) h315 (720) Short (E M) THORPE R S & SONS, Cecil A Thorpe Pres, W H Thorpe Sec-Treas, Clothing, Men's Furnishings and Shoes, Ladies' Sanitary Hair Cutting 2d fl 515-517 Cherry, Tels 159-314 and 761 (For further information see page 11 Buyers' Guide) Thorpe Rillane (c) lndrs r414 Mitchell al Thorpe Robt E (c; Marie) lab h2i Par- ker av (V) 3^ L3coi Oi5-t o 2. (t fh t En>h era 2- O 3 oO g(-Jc co r n e SrCOf' Phil- lips la (EM) Tillman Ophelia maid rl07 2d av (U) Tilton Cora Mrs hsekpr Hotel Southland r569 Broadway Timberlake Joel H (Mary S) h710 For- Tismymtherman Evelyn student r657 College Timmerman J Warren (Marie) dist mgr Mutual Life Ins Co of NY h657 College Timmons Louise student r360 Fairview av (EM) Timothy John (c) gro 337 Madison r335 do Tindall Ollie E rl08 West End av (WH) Tindall Richd H carrier US PO r Cross Keys Ga Tindall W Shelby (Marie) slsmn h269 Maple Tindall Zollie L (Lois) mgr h320 Giles (SM) Tinker Eliz (wid Wm H Tinker) r3506 Houston av (SM) Tinker Francis E (Hattie M) slsmn Met Life Ins Co hll9 Ninadel dr Tinker Herbert G (Alice) h3506 Houston av (SM) Tinker Wm H elk RyMS r732 Napier av Tinley Clara Mrs slswn rl63 2d Tinley Foy L (Clara F) decorator Dan- nenberg Co rl63 2d Tinley Ollie B case wkr City Dept of Public Welfare rl96 Laurel av (NH) TiSnlperyinsogn Lloyd F (Inez) sta atndt r403 Tinsley Anna (c) h350 Harris la Tinsley Clarence (c) student r205 Gantt City rd (SM) Tinsley Foy Mrs slswn Lemer Shops r 163 2d Tinsley Fred (c) driver B F Merritt Coal Co rl333 1st Tinsley Harold (c) r205 Gantt City rd (S M) Tinsley Hattie M Mrs mill wkr Bibb Mfg Co hl06 (265) Pearce (EM) Tinsley Ida M (c) maid rl405 (405) Ard- Tivnisnleeys Jaals S (c; Margt) rl20 Green (V) Tinsley John (c; Alice) lab h205 Gantt City rd Tinsley John D (c; Lucy) h411 (554) Henrietta (SM) Tinsley Kimball (c: Ella) driver B F Mer- ritt Coal Co hl333 1st Tinsley Leo (c) lab r411 (554) Henrietta (SM) Tinsley Lodesta (c) r553 Hammond Tinsley Lula (c) cook r Coy Burton Tinsley Martin T (Tinsley's Grocery & Market) r616 Arch Tinsley Mary M (c) h418 Applewood (E M) Tinsley Mattie (c) h512 Maynard (EM) Tinsley Sami (c) r350 Harris la Tinsley Sami (c) lab B F Merritt Coal Co r307 (304) Tindall av (SM) Tinsley Theodosia tchr Winship Sch r534 College Tinsley Wm (c; Ruby) driver B F Memtt Coal Co hl329 1st Tinsley Wm H (Bonnie) mill wkr Bibb Mfg Co h328 Hydrolia (EM) Tinsley's Grocery & Market (Martin T Tinsley) 1601 Broadway Tinson Corine (c) lndrs ri.41 (135) Hazel Tip Top Service Station Aldine H Bowden mgr filling sta 1600 2d Tipton Edw W (Lillian) lawyer 105 Cot- ton av R13 h896 Winton av Tipton W L h316 Shamrock Tissereau Daisy r310 (312) Giles (SM) Tissereau Louis h310 (312) Giles (SM) Todd Annie (c) r318 Hammond Todd Ernest (c) r819 Ash ToEdddgeJwoLoadwraevnce(SM(G) ussie M) lab r417 Todd Jas W (Mary) auditor h515 Beech Todd Kath nurse 262 Columbus r do Todd Lee S (Kath) mech Dunlap Chevro- let Co r555 1st Todd Mary B Mrs r914 Ash Todd Morgan (Marie L) lab rll53 Ash Todd Rufus L (Annie) linemn Ga Power Co r619 Pine Todd Sami (Carrie) porter Burney Bros Co Todd Sylvester (c) lndrs h227 Woodcliff Todd Wm C r417 Edgewood av Toland Eug W (Lizzie) mill wkr Bibb Mfg Co hl004 Hazel Toland Geo auto mech r330 Shamrock Toland Oscar (Dora) auto mech h330 Shamrock Tolbert Chas (c; Mary) lab CofGaRy h To5l0b3eyrtz E 1st (EM) Chas jr (c) r503 % E 1st (EM) Tolbert. Fletcher (c: Georgia) lab h402 Mitchell al Tolbert Wm (c: Ida M) lab h205 Alabama (SM) Toles Wm H r467 Cotton av Toliver Nancy (c) h905 Ash] Toliver Ola A (c) tchr PS r905 Ash Tolliver Adel (c) r217 Pond (V) Tolliver Benj vc; Ruby) lab h426 Ham- mond Tolliver Caldonia (c) rlOl Blount Tolliver Chas (Jessie) driver Freeman- Dent-Sullivan Co r356 Patterson (N Hts) Tolliver Chas (c) soft drinks 237 Edge- wood av h do Tolliver Edw (c) porter Ingleside Oil Co r Holton Ga Tolliver Ernest (c: Ida) janitor h98 (106) Hazel Tolliver Eug (c; Bessie) driver Freeman- Dent-Sullivan Co h97 (18) Hazel Tolliver Frances (c) hl04 (126) Bright al Tolliver Homer (c) lab r432 Coles al Tolliver Jas R (c: Lizzie K) lab hlOl Blount SIGNATURE ONLY SAME DAY Macon Trading &. Investment Co. 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Of Your CITY 362 YATES MOTOR CO. o u o Cl] z U! < $> 2 ,,U 2 fa DQ<5^ S'* ffl 1 Z to o u MORE GOODS -arebought --AND-- SOLO THROUGH THE Classified Business Directory than by Any Other Medium on Earth 707 THIRD ST. Tolliver Wm J (c: Viola) lab hl30 Pecan Tolson Albert (c) plstr h332 Boardman's al Tolver Monga J (c; Mary) lab h208 (210) ToFmalregyaWsoinllie(V()c: Pinky) lab hlO Thomas (EM) Tomlin Ernest A (Rena M) emp CofGa Ry h452 College apt 2 Tomlin Ernestine student r452 College apt 2 Tomlin Geo A (Myrtle) linemn Ga Power Co r652 Pine Tomlinson Donald R student r410 (416) Montpelier av Tomlinson Edna student r421 Adams Tomlinson Ella M mill wkr Bibb Mfg Co rl04 Green (PM) Tomlinson Ella (wid John T) mill wkr Bibb Mfg Co hl04 Green (PM) Tomlinson Frances M bkpr r410 (416) Montpelier av Tomlinson Jesse (c) lab r543 Monroe Tomlinson Tennis (c) lab r543 Monroe Tomlinson Wade F (Vera) lab h868 Elm To(m41l6in)soMnoWntpmeliTer (aBvlanche) mgr h410 Tompkins Henry O (Annie P) carp h401 Bailey av (CH) Tompkins Ida (c) maid h802 Hazel Tompkins John (c) stone ctr r802 Hazel To(mCpHk)ins Melvin O carp r401 Bailey av Tompkins Robt L plmbr r401 Bailey av (CH) Toney Irvin J (Yuie) mill wkr h41 T.afro Toole Ambrose W (Julia) elk Lester Grady h2504 2d Toole C Julian (Pearl H) slsmn h440 Beech av Toole Chas J jr (Martha) slsmn hl02 Ayers blvd Toole Chas L (Eva J) dentist 403 Cherry R720 hl05 (201) Elizabeth pi (V) Toole Florence r252Q 2d Toole Florence (c) maid hll5 Armond av Toole Frank L (Mary) formn D H Adams ToMoloetForurCniotuhre52C2o LInocg TChaobsiEn Tbolvodle pres 367-60 2d TOOLE G GLEN (Mary W), Sec Macon Chamber of Commerce, h478 College, Apt 4, Tel 555-R Toole Glenn T jr (Emily) elk h327 Buford Pi Toole J Wiley (Dolly B) slsmn Toole Furn Co r Lizella Ga Toole Jas J (Florence) cond h2520 2d TodoolerfJu&liaSnoCn jrr (ALyoeurisse)blevldk J S WalToole Kath (wid Oliver A) hl07 Oliver av (LCHts) Toole L Eug mgr Toole Furn Co r422 IVineville av (V) Toole Lila tchr Winship Sch rl07 Oliver av (LCHts) Toole Louis E (Annie) farmer h606 (603) Burton av Toro8l1e4LNuleawP Mrs fctywkr Happ Bros Co Toole Myrtis cash Finance Service of Macon rl44 Hines ter (V) Toole Otis fctywkr Happ Bros Co r814 New Toole Reba Mrs h917 New apt 1 Toole Robt J (Eliz) formn h2520 2d Toole Robt M (Lula P) fctywkr Happ Bros Co h814 New Toole Ruth tchr Winship Sch rl07 Oliver av (LCHts) Toole Thos E pres Toole Furn Co Inc h 422 Vineville av (V) Toole Virgil J slsmn r440 Beech av Toome Eliz (c) maid rl67 (319) Nussbaum (SM) Toomer Alf (c) student r204 Woodcliff Toomer Aretha (c) r rear 280 Main (E M) PHONES ! 11444458 Toomer Chas (c; Lizzie) driver h242 2d av Toomer Gertrude (c) lndrs hi Cheatham al Toomer Mary (c) hl67 (319) Nussbaum (SM) Torbett Virginia K (wid Jacob K) rl08 First av (CP) Torch Aaron (Sarah) mkt supplies 454 1st hl99 English av (V) Torch Harry slsmn rl99 English av (V) Torch Isadore (Rosalie) sten h810 Mul- berry apt 4 Tory Love (c: Annie) lab h248 (246) Church la (SM) Towery Wm M blksmith MD&SRR r611 2d Towler Arth G (Jewell T) trav slsmn h 421 Forsyth TobwinleraSvila(sVC) (Blanche) slsmn hi18 CorTownes Alice (c) lndrs hll2 (11) Frank al Towns Laurena elk r254 New Townsend Belle (c) cook r rear 307 Or- ange Townsend Carter E (Inez E) tchr Lanier High Sch for Boys h234 High Townsend Dennis P r356 Church (EM) To(wEnMs)end Geo C (Risa L) h356 Church Townsend Virginia asst librarian Weslyan 'Coll Townsley Wm E wtchmn Marwell Bros Inc Tracy Alma Mrs fctywkr rl9 Bellevue Trradcy Mattie Mrs alteration Burden Smith & Co r Triple Hills Trading Post (Richd B Hicks) 2d hd furn 458-66 1st Tramell Hattie (wid Albert) r51 (6) Roff Home pi Trash Anne elk r305 Forsyth Traumbau Roy (Lou) slsmn r379 Orange TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson & Son Agents, 702-703 Bibb Bldg 403 Cherry, Tel 214 (For further information see bottom stencil and page 18 Buyers' Guide) Traver Seneca C (Bernice) mgr Cheeman's Ice Cream Shop r202 Coleman Travers Margt (wid Lawrence) r655 Arch Travers Thos (Grace) restr 865 Broadway h809 Pine Trayick Robt (c: Mary) lab r910 Elbert (SM) Travis Adolphus (c: Cora M) lab h604 (328) Charles (SM) Travis Lillian (c) maid r506 (507) Crisp (SM) Trawick Benton J (Lottie) br mgr Remington Rand Inc hll5 Hill Crest rd Trawick C H (Sallie) r432 Ross Trawick Candy Co (Wm A Trawick) candy mfrs 268 Main (EM) Trawick Claude (Lulu L) pres-treas Cdrlaude Trawick Coal Co Inc r Wesleyan TRAWICK CLAUDE COAL CO INC, Claude Trawick Pres-Treas, Red Crescent and Silver Star Coal 201 Edgewood av, Tel 59 Trawick Edw F meat ctr John C Trawick hl310 2d Trawick Emory J student r432, Ross Trawick Frankie L (c) tchr PS r210 (207) Grant Trawick Geo V bkpr Jackson-Wynn Co r RD 2 Trawick Guy A candy mkr Trawick iCandy Co r206 Fort Hill (EM) Trawick Jas W r206 Fort Hill (EM) Trawick Jessie B Mrs candy mkr Trawick Candy Co r206 Fort Hill (EM) Trawick John C (Annie B) meats 1007 2d h432 Ross 363 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement -- Plaster 457 Third St. Phones 277-278-279 Trawick Lonnie (e) solr r210 (207) Grant Trawick Peggy lab r755 Clinton (EM) Trawick Thos r432 Ross Trawick Wm A (Jessie B: Trawick Candy TrCawo)ickh2W06mPAortjrH(iLllen(aE)Me)lk Bibb Mfg Co r206 Fort Hill (EM) Trawick Wm L jr shoe repr 610 Haw- thorne r432 Ross Traynor Morris (c) lab r207 (73) Craft (V) Treadwell Eva Mrs smstrs hllO Buena Vista av , , Treglown Nolan (Pauline L) swteh mn h 2600 Broadway , . Tremble Calvin T (c: Minme) driver Hubbard Co hl33: 5th av (V) Tremble Clemmie J (c: Leila) baker h230 Jefferson Tremble Cleosia (c) clo clnr 133 5th av (V) r do Tremble Lillie M (c) maid h221 Lynwood av (V) Tremont Temple Baptist Church (c) Rev Berry B McClendon (c) pastor Services 11 a m 8 p m Sunday School 10 a m 534 Cotton av Trenary Wm P ir (Esther) sis mgr Carl- ing Tile Co h401 College apt 5E Trevick Wm R (Ellen) barber 2120 Por- syth rd h2125 do Triangle Pharmacy (John H Settle jr) 2806 Houston av (SM) Tribble Berner (Jewel E) driver h659 Hemlock Tribble Chas J (Estelle) lino opr Macon Teleg Pub Co hl02 Villa Crest Tribble Eugenia M (wid Chas E) r322 Forsyth TrriceRiRvoegliinGalad agt Sinclair Refining Co Trice Zack T jr (Edwina P) office mgr Sinclair Refg Co r541 Georgia av Trimble Betty r Rivoli dr Trimble Clem (Leila) baker Collins Bak- ing Co r230 Jefferson Trimble Edw (c; Alice W) porter Hart's Mortuary h414 Ward (V) Trimble Elijah (c; Missouri) lab hlOl (534) Kahn's al TRIMBLE LEE S (Effie H), Exec V- Pres-Mgr Macon Chamber of Com- merce, h Rivoli rd, RD 2, Tel 3879 Trinity C M E (c) 446 Tindall av (SM) Trio Bargain Store (c; Mattie M Oliver) 2d hd clo 650 Poplar Tripp Effie Mrs elk Happ Bros Co r200 Stratton (SM) Tripp Martha (c) maid r708 Clinton (E M) TTrriipppp MOsacrayr MCrs (Eslfsfwien Mr9;05SCanhdeerrrys & Tripp) h200 Stratton Trippe Joshua (c; Susie) lab h441 Pat- terson (NHts) Trirp44p1e PSautstieers(ocn) tc(NhHr tGs)reen Street Sch Tronce Prance student rl37 North av (N H) Tronce Fredk W (Ida: Metro Studio) h 137 North av (NH) Troop Lanier electn r815 Orange Trotter Bula T mldr r361 1st Trotter Jas T barber Hayes Barber Shop r361 1st Troutman Annie P (c) maid rl04 (115) Cedar (U) Troutman Jos (c: Mary) lab CofGRy h 509 Gilmer Troutman Louis (c) lab r320 Cedar (U) Troutman Mary (c) h523 Coleman al Troutman Sarah (c) lndrs hl04 (115) Ce- dar (II) Troutman T J Mrs smstrs Snow's Lndry Dry Clng Co r469 Spring Troutman Thos J emp CofGRy Troutman Zeffie (c) r806 Fort Hill (E M) Truesdale B Rhett (Sarah C) elk Munici- pal Court h660 Napier av Truesdel Julius E student r660 Napier av Truesdel Lemuel D doormn Capitol The- atre r660 Napier av Truesdell Pearl M drsmkr 1330 3d h do Truett Jos (c: Mattie) lab CofGRy hl77 Lincoln av (V) , Truitt John C (Rosa) mill wkr Bibb Mfg Co r97-98 Green (PM) Truman Dorothy G (wid Arth) sten h434 Truman lEmilv student r434 Ross Trust Co of Georgia W Lamar Harrell TsrcehsudmygrMianrvtheastmVen(twsid41M7 a2tdhias) r910 Walnut Tubbs Wm (Josie) carp r607 2d Tucker Allen sawyer r421 (422) Log Ca- bin dr , ,, Tulacpke-Pr eAellleern HPd(wLouCiose)h7t0ra7vVslisnmevnillDeuanv- (V) Tucker Annie L cream tester Swift & Co rl39 Williams (SM) Tucker Aretha (c) maid hi 13 Linden av Tucker Bascom student r371 1st Tucker Beni hlpr Wm W Veal r3021 Hout- ton av (SM) Tucker Bruce S (Gertrude) h304 Bailey Tuacvke(rCCH)Eug hsewarmer M,acon G,,as C,,o r2Ql Hendley (NHts) Tucker C O Mrs smstrs r922 Walnut Tucker Carl sawyer r421 (422) Log Cabin dr Tucker Carrol sawyer r421 (422) Log Cabin dr Tucker Chas (c) porter John W Peeks r 232 Plant al Tucker Chas B (c) barber John Bailey r 105 Linden av Tucker Chas W car repr CofGRy Tucker Claude E (Ophelia T) toll test bdmn SBT&TCo h201 Henley (NHts) Tucker Claude E ir r201 Hendley (NHts) Tucker Claudie Mrs mill wkr h233 Ross Tucker Clayton O emp Vineville Furniture Co r304 Bailey av (CH) Tucker Cowart I mach CofGRy rl530 2d Tucker Crowley (Katie) servicemn Cen- tral Tire Co hl50 Williams (SM) Tucker Doris student r866 Mulberry Tucker Dorothy L r201 Hendley (NHts) Tucker Edw (c: Vinie) carp hlOl 8th av (B) Tucker Edw (c: Vinney) lab h9th av (B) Tucker Edw (c) pdlr h484 Industrial Home rd Tucker Ernest (Sarah) driver h2;136 2d Tucker Essie (wid John T) r2011 Vine- ville av (V) Tucker Felder (Minnie C) floor fnshr h Tu3c3k7erCFallhooreunnce (wid J Wm) mill wkr Bibb Mfg Co h910 New Tucker Geo E slsmn r509 Arch Tucker Geo W pdlr r515 Hemlock Turner Geraldine (c) maid PS r961 Pio Nono av (V) Tucker Gertrude hl53iO 2d Tucker Gordon (c: Bessie) mech r609 Hazel Tucker Gordon (c) sta atndt r411 Arch Tucker Gradon H (Blanche E) emp Vine- ville Furniture Co hll9 Stonewall pi (V) Tucker Harold rl064 Elm Tucker Harry C (Grace L) city firemn h 217 Carling av Tucker Henry (c; Delia) lab hl30 Green Tucker Howard R (Grace) firemn MD& SRR h rear 232 Roff Home av (V) Tucker al Ida M (c) cook r212V2 Fretwell Tucker J P Mrs tel opr WUTelCo r Grady Hotel Polk'S Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 364 FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Tucker Jas H (Ella S) elk Ry Exp Agcy Il536 Boulevard (NH) Tucker Jas I (Annie T) elk Porter Morgan hl39 Williams Tucker John F (Julia) elk Hotel Grady r301 Cherry Tucker John H (c; Florrie J) cook Mercer Turk John (c: Mattie) firemn hl20 Concord (SM) Turk Louis (c) lab rl20 Concord (SM) Turk Maria (c) Indrs hl43 Forsyth la Turlington Walter C (Carolyn H) sheriff County Municipal Ct h390 Suwanee av Turlington Wm T (M Jewel) hl05 Pio Univ rl07 Rosecrest av (SM) Tucker John O (Beatrice) mill wkr Will- Nono av (V) Turnage Frank (Jeannette) pntr h517xh ingham Cotton Mill r230 Duncan av Mulberry Tucker John W r415 New apt 3 Turnage Henry (Mary J) r99 (11) Dann- Tucker John W (Nettie) carp h421 (422) enberg al Log Cabin dr Turner Alice L Mrs r Hotel Fickling Tucker Jos T (Cordelia) elk Union Dry Turner Allison F (Myrtle N) slsmn A G Gds Co h922 Walnut Rhodes & Son hlQ3 Hill Crest rd Tucker Lillian rl39 Williams (SM) Tucker Lizzie (c) cook h211 Green Turner Ann student r300 Hardiman av Turner Ann E office sec Dr John R Tucker Lizzie (wid Jas C) hl019 Hazel Holmes r579 Orange apt 5 Tucker Lucile elk Weslyan Pharmacy 7196 Turner Annie (c) cook rl09 Empire av (120) Chescent av (CH) (V) Tucker Lucile Mrs h852 Walnut Turner Annie M alteration Burden Smith Tucker Lula (c) maid h466 Bay & Co r30O4 Houston av (SM) Tucker Martha Mrs r750 Pine Turner Arbelia (c) h435 Chestnut Tucker Mary smstrs r2136 2d Turner Augustus R pntr r3004 Houston Tucker Mary Mrs office Sears Roebuck av (SM) & Co r RD 4 Turner Bertha (c) cook r335 Ernest (CH) Tucker Maurice (Lunar) plmbr rl52 Bai- Turner Byron H (Neva) cond h240 Boule- ley av (CH) vard (NH) Tucker Monroe student rl39 Williams (S Turner C Thos (c: Eunice) lab h779 Rey- M) nolds al Tucker N L (c) lab .Central Sash & Door Turner Carrie E (wid Spencer B) h579 Co r201 (410) Thompson la Orange apt 5 Tucker Paul C elk Rogers Stores r343 Turner Chas rll6 (111) Dewitt (EM) Carling av Turner Chas (c; Clara) driver Willing- Tucker Prentiss (Mary N) hl064 Elm ham Sash & Door Co h403 1st av (V) Tucker Prentiss (Gertrude) r910 New Turner Chas F (Ruby M) shoe repr h520 Tucker Rachel (c) Indrs rl06 3d av (U) Ash Tucker Ralph (c) embalmer Hubbard Co Turner Clarence (Flossie) rd mstr M D r269 Madison & S RR rl25 Rose pk Tucker Richd W carp rlO'19 Hazel Turner Dorothy office sec Doctors Busi- Tucker Roy A (Ruth B) test boardmn S ness Bureau & Collection Service rill TuBckeTr R&utTh BCoophrl0S8BTL&ogTCCoabriln08drLog Rogers av (VO Turner Dotie (c) rl09 Empire av (V) Cabin dr Turner Edith (c) cook h211 Grant av Tucker Sarah L student r201 Hendley (N (V) Hts) Turner Edmond (c) r214 Fretwell al Tucker Wm I (T & T Packing Co) r910 Turner Edw mill wkr Willingham Cotton New Mill rll8 (9) Holt av (NHts) Tucker Winnie (wid Elmer S) rl29 Pierce Turner Edw H (Eva) collr Doctors' Busi- av (V) ness Collection Service hill Rogers av Tucker Zelma M cash F W Woolworth (V) Co r201 Hendley (NHts) Turner Ella (c) Indrs h310 2d av (V) Tudor Fred W (Bertha) trav slsmn h563 Turner Elnora (c) Indrs r704 Guernsey Who College 4 la Tudor Jos H atndt Macon Auto Exch r Turner Emma (c) r6 (313) Hanson (SM) Sells it? 563 College apt 4 Tuff Aaron (c) student rl30 Pecan av Tuff Chas (c) porter Chandler Service | TuSftfa Hr7e0n6ryCl(icn)torn354(ECMh)urch al (SM) Tuff Isaac (c; Fannie) h327 Burnett (E Turner Eoline (wid John L) h226 Belmont Turner Eug driver City r520 Ash Turner Eva (c) h80O Maynard (EM) Turner F White elk Henderson-Turner Co r1000-02 Napier av Turner Frances (c) maid hl211 1st Tuff Jackson (c; Amanda) lab h706 Clinton (EM) Tuff Jas (c; Doris) lab h512 E Academy Turner Geo (c; Lucy) lab h,106 (150) TuErlnizearbGetehrtr(uSdMe )Mrs mill wkr Bibb Mfg Co rll6 (111) Dewitt (EM) Is Answered By the Classified Business Lists In this (EM) Tuff Roland (c: Theresa) bottler hl05 Woodcliff Tuff Ulysses (c) r706 Clinton (EM) Tuff Wm (c: Narcisse) janitor Georgia Casualty bldg r854 Ocmulgee Tuff Wm (c) porter Glawson Service Sta h415 1st (EM) Tuft Mattie (c) r507 Clinton (EM) Tuft Nellie (c) rl07 Walls al (NH) Tuft Wm (c; Julia) lab h242 Church la (SM) Tuggle Annie (c) r400 Cowan (EM) Tuggle Chas (c; Mattie) lab h400 Cowan (EM) Tuggle Lenton (c) lab r400 Cowan (EM) Tuggle Lois (c) r40O Cowan (EM) Tuggle Royce (c) r854 Ash Tuggle Valla M (c) r854 Ash Turner Hannah (c) maid r703 Ash Turner Harry E (Ida M; Ivey-Turner Ice Cream Co) h222 Belmont av Turner Helen (c) cook rll6 Hicks al Turner Henry (c; Jossie) carp h560 Ward (V) Turner Hope S (Hattie E) mgr Chicken Grill hl414 3d Turner Horace (c: Aberta) lab h218 Fret- well al Turner J Hudson student r214 (254) Church (EM) Turner Jack (Gertrude) hll6 (111) De- witt (EM) Turner Jas (c; Annie) lab h410 Peachtree (EM) Turner Jas (Willie J) stock elk Coleman- Meadows-Pate Drug Co h865 Mulberry Turner Jas C (Katie) driver h203 1st Directory Turk Dexter (c: Ethel) cook h457 Hazel Turk Geo (c) porter Adair Service Sta r614 Ross Turk Hazel (c) r457 Hazel Turk Henry (c) porter r315 Middle (V) Turner Jas O (Berta) gro 465 (455) Clinton (EM) r214 (254) Church (EM) Turner Janie sten r579 Orange apt 5 Turner Jas (c) taxi driver r219 Elliott (EM) 365 A. T. HOLT CO. bV*1 REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 TTuurrnneerr JJoehsnsie(c;(cF) anconoiek Lr4) 3c5loCphressrtnrlu3t1 Pecan av Turner John (c: Ada B) lab h.139 (159) Nuissbaum (SM) Turner John E (Annie) mill wkr Bibb Mfg Co hl72 Gardner (PM) Turner John H H (c; Neomi) h219 Elliott (EM) TTuurrnneerr JJoohhnn HW ((cE; llLau)cyn)urlsaebryrml5n0 h5Uth08 Main (EM) Turner Johnie M (c) r219 Elliott (EM) Turner Jos (c) rll64 Ocmulgee Turner Jos (c; Mary) delmn Kinnett- Odom Co h312 Calhoun Turner Jos (c; Georgia) gro 944 Montpelier av r334 Ajax Turner Jos (c: Ruth) lab r4Q4 (507) Prince (SM) Turner Jos B batterymn Freid's Garage r3004 Houston av Turner Jos S elk rl03 Hill Crest rd Turner Julian H (Reba L) sec-treas Kingman & Everett Inc h847 Patterson (NHts) Turner Julius (Carrie) tailor Union Dry Gds Co h218 North (V) Turner Lawrence (c: Annie) hlOO (137) TuBrnayer Lois P (c) hat checker r219 Elliott OEM) Turner Lola M (c) maid rl211 1st Tu2rdner Louis B (Frances) meat ctr rl663 Turner Louise (wid Chas E) r774 Mulberry Turner Lucile (wid Jas S) alteration Burden Smith & Co h206 Log Cabin dr Turner Luke (c: Bessie) h315 Hammond Turner Magnolia (c) student r312 Calhoun Turner Mamie (c) r813 (724) Dempsey av (U) Turner Mamie (wid Augustus) h3004 Houston av (SM) Turner Manuel (c: Otha) h6 (313) Hanson (ISM) Turner Marie (c) r214 Fretwell al Turner Mary (c) h260 (236) Elliott (E M) Turner Mary (c) 1102 3d av (U) Turner Mary (c) lndrs rlOl 3d av (U) TTuurrnneerr MMaattttiiee ((cw)idr7C10A()12h83)'19HaVllin(eEvMill)e av (V) Turner Mattie B (c) maid rlOOS (1006) Main (KM) TuCronerrl2M0auRdoeyeL M(CrHs )mill wkr Bibb Mfg Turner Milton A (c; Clara) carp r383 Middle (V) Turner Minnie (c) maid r726 (636) Prince (SM) Tusrynther Mittie A (wid Joel W) r619 ForTurner Mumer (Ollie cabtmkr rllOS Main (EM) Turner Myrtice (c) maid r383 Middle (V) Turner Myrtle Mrs slswn Simon Moore r Turner Ralph E msngr US PO r239 Edna Tuprlner Rav (India) mech Dunlap Chev- rolet Co r Clinton Ga Turner Rebecca r569 Broadway Turner Rebecca (c) r303 (205) Waterville rd Turner Robt (c) lab r435 Chestnut Turner Robt P elk First Natl Bank & Trust Co Turner Roosevelt (c) lab rl008 (1006) Main (EM) TTuurrnneerr RRoovsaH(c()Wri2lm14a FRr)etuwpehllolaUl nion Furn Co r287 Washington Turner Roy L (Annie) mill wkr Bibb Mfg Co hl043 1st TuTrnuernrer RCuos)selhll000(H-0a2zelN; apiHerenadversonTurner Ruth V Mrs slswn Burden Smith & Co rl20 3d Turner Sallie (c) lndrs hl008 (1006) Main (EM) Turner Sami (c; Ruby) porter Dunlap- Peeler Hdw Co hl05 Bonaire Turner Sami H slsmn Buck Ice & Coal Co r239 Edna pl Turner Sarah E slswn Betty Maid Shop r 226 Belmont av Turner Sidney elk Goldman Pawn Shop rl03 Hillcrest rd Turner Stonewall (c) porter r383 Middle (V) Turner T Clyde (Ora L) furn wkr hl411 3d Turner T Edwin (Irma G) ship elk FreeTumrnaenr-DTenEtd-SwuinllijvranelkCoSnholwl5's PLanrkdwryoo&d Dry Cleaning Co rll5 Parkwood av Turner T Rad (Helen V) pres City Bank & Trust Co h300 Hardeman av Turner Tabernacle A M E (c) Rev David Np omrriSsun(cd)aypaSscthor1S0earvmice3sd 1se1:c3o0raHmaw8thorne Turner Thos (c) h773 Reynolds al Turner Thos (c; Edna) lab h508 Flanders (EM) Turner Thos E (Nelle J) collr Hatcher & McCrary Inc hi 12 Park pl Turner Thos iE (Hattie) lab h239 Edna Tuprlner Tully C jr (Ora L) slsmn Fred W Williams rl411 3d Turner W Jos (Ruby) gro 110 Chappell (SM) hl46 Concord (SM) Turner Wallace (c: Mattie) lab h509 Fulton (EM) TuBrnroeardwWaya>lt-er M (Brass Rail) r569 Turnier Warren S (Ora H) pntr h867 Cherry Turner Wm (c: Hattie M) hl09 Empire Tuarvne(rV)W> m rllOS Main (EM) Turner Wm (c; Mattie) carp h203 Lynwood av OVD Turner Wm (c) elk Chas Gebara Turner Wm (c: Mabel) film opr Douglass Theatre h68 Spring Turner Wm (c; Eva) lab h211 (157) Center (EM) to MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free 103 Hillcrest rd Turner Wm (c) lab rl008 (1006) Main (E Turner Nell student rill Rogers av (V) TuLrinfeer InNsellCieo srt2e3n9 BEadnnkaerpsl Health & Turner Ola (c) cook r349 Hawthorne M) Turner Wm (c; Geraldine) lab r961 Pio Nono av (V) Turner Wm (c; Lillie M) lab rlOl 3d av R. L POLK & GO. Turner Oscar C (Ida) elk Miller Bros r816 New Turner Otis auto mech Robt L Souther r606 2d Turner Perry (c; Nellie) lab h203 Campbell av (SM) (U) Turner Wm (c; Willie M) lab hl02 3d (U) Turner Wm M (c; Ella) porter h907 Clin- ton rd Turner Willie (c) student r509 Fulton (E M)l DirectoryPublishers Detroit, Mich. Turner Philip (c) lab Bibb Mfg Co h307 Norris (EM) Turner Philip (c; Lula) mill wkr Bibb Turners Temple Rev Acie C Edwards (c) pastor Services Sunday School 10 a m ] 2 p m 8 p m 84 Hazel We make up Mfg Co hll8 (119) Powell (EM) Turners Temple C M E Church (c) 84 Turner Ralph (c; Julia) lab rt09 Drews qtrs Turpin Anne P tchr PS r376 Orange Special Lists -- 366 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Turpin Wm C h376 Orange Turpin Wm C .ir ((Edith C; Turpin & Lane) h415 Hines ter (V) TUMRcPKIiNbbi&n LALNanEe)(,WmAtCtorTnuerypsi-nat-JLr,awV 515-18 Ga Casualty Bldg 516 Mulberry, Tels 3036-3037 Tuten Jas G slsmn h70 Arlington pi Tuten John J (Mollie K) formn Carstaphen h728 Walnut Tuten Lenora student r728 Walnut Tuten Louise student r728 Walnut Tuten Minnie (wid Jas G) r70 Arlington Tuptit Freida Mrs elk Bibb Mfg Co r630 Forsyth Tweedy Eunice Mrs r619 Walnut apt 6 Twilley Jas elk r201 New Twilley Maude nurse 250 College apt 3 h do Twilley Orlando B (Pearl) auto mech h 201 New Tyler A Cullen (Claudia; Tyler Bros Garage) hl023 Clinton rd (EM) TTyylleerr BBirloliseGbaeraaugtye s(hAopCu66ll3enWaanldnuFtehltodno J) 215 3d Tyler Curtis H (Billie) sta mgr Standard Oil Co r663 Walnut Tyler Felton J (Grace; Tyler Bros Garage) r2604 2d Tyler Hollis M (Mabel) slsmn Standard Oil Co r393 Orange Tyler Judge E (Mamie P) sta eng hl31 Virginia Tyler Julius W (Marguerite) student r221 Georgia av Tyler Mabel H beauty opr Mrs Cula Coyle r393 Orange Tyler Martin F (Leila M) restr 726 HawTytlheorrnMeichhl do(Inez) driver r706 2d! Tyler Richd (c; Mary) lab h440 O'Hara la Tyler Richd L (Tommie L M) slsmn A S Hatcher Co r637 Vineville av (V) Tyler Roberta (c) cook h619 Division Tyler Sally W (wid Wm R) r712 Hillyer av (CH) Tyler V Curtis (Mary) auto mech h233 Bond apt 3 Tyler Welbom E elk Tyler Bros Garage rl023i Clinton rd Tyner Ben.i F (Beulah) mach CofGRy r 704 Main (EM) Tyner Chester G (Nevada) auto repr Ih 620 1st Tyner Eliza E rlOO Highland av (EM) Tyner Richd J (Eva) trimmer hl77 North av (NH) Tyner Richd J jr lab rlOO Highland av (NH!) Tyner Thos B (Ruby) policemn h212 New Tyner Wm E (Addie) hlOO Highland av (NH) Tyner Willie O rlOO Highland av (NH) Tyrus Andrew H (c; Eugenia) h242 (243) Mitchell (EM) Tyson Codie mill wkr Bibb Mfg Co rl28 Comer ter (PM) Tyson Edw mill wkr Bibb Mfg Co rl029 1st Tyson Eloise smstrs r559 Main (EM) Tyson Eva elk Hotel Dempsey Cigar Stand r559 Main (EM) Tyson Faydette student r319 Walnut Tyson Jas M emp PO r319 Walnut Tyson Jeffie mill wkr Bibb Mfg Co rl029 1st Tyson Julius (c) lab h313 Jefferson Tyson LeRoy (Effie) driver h559 Main (EM) Tyson Lloyd L (Clara) mill wkr Bibb Mfg Co hl28 Comer ter (PM) Tyson Margt smstrs r559 Main (EM) Tyson Randolph (Annie) mill wkr Bibb Mfg Co rl029 1st Tyson Robt (Maxie) r314 Cutter's Green (EM) Tyson Ruby (c) cook hl20 (4) Spring la Tyson Sallie E (wid Wm) h319 Walnut Tyson Sarah (c) rl51 E Academy (EM) Tyson Waller M (Lizzie: First & Last Chance) h Forsyth rd Tyson Walter T (Daisy) slsmn r379 Or- ange TTyyssoonn WWmm eElk(Nr7e6l9lie)Muellbeecrtnry Stewart- Goette Electric Co h27 Progress Ullman Floretta (wid Emanuel) hl306 Vineville av (V) Ullman Julius elk rl306 Vineville av (V) Ulmer Geo A (Elna) welder h820 2d Underhill A B mgr Underwood Elliott Fisher Co rll7 Lawton Underhill Dillon (Lydia) electn h308 UnRdiedrgheillavJ (Vsl)smn Underwood Elliott Fisher Co rll7 Lawton av Underwood Dorothy rl531 2d Underwood Eliz (wid Hezekiah F) hl531 2d Unhdilelrwmogodr E55ll7ioMtt uFlibsehrerryCo A B UnderUnderwood Frankie waiter Douglas B Fincher rl531 2d UUnnddeerrwwoooodd JMohanggmieill(cw)krtcrlh0r5 PRSileyr2a4v8 Proud Underwood Maggie (wid Howard) h554 Roff Home av (V) Underwood Rosalie (c) cook r569 Monroe Underwood Scott (c; Maggie) paperhngr h248 Broad (EM) Un1d01erwColeomd oSnidsnleay (c; Rosie M) driver r Underwood Thos L (Della) elk h807 Main (EM) Underwood Victor (Eva) cash rl51 2d Underwood Wm O slsmn Bateman Co r 371 1st Union Baptist Church (c) 306 E 2d (EM) Union Brothers & Sisters of Zion Hall Rev Jas Cummings (c) pastor 106% Concord (SM) Union Bus Terminal Wm A Dix terminal mgr 320 Broadway Union Carbide Sales Co (storage) 201 Poplar Union Dry Goods Co The John T Killen pres D Sidney Wagnon sec-treas dept UnsitoonreFu4r1n7ituCrheeCrrOySimon L Becher prestreas Lewis S Lavine v-pres-sec 510 Poplar Union Jos (Jewel) driver r817 New Union News Co Chas M Galloway mgr news dlrs Terminal Station Union Pheado A Mrs slswn Michael Burg r908 Cherry Union Shoe Shop (Hillman B Tanner) shoe repr 456 Cotton av Union Tailoring Co (Chas P Worley Wm L Daniel) 510% Broadway Union Thos (Pheado) elk Michl Burg h 808 Cherry UnhiodnoToney (Mary) gro 771 Broadway Unionville Baptist Church (c) Rev Henry F Taylor pastor 932 Pio Nono av (V) Unionville Cemetery (c) 928 Pio Nono (V) Unionville Hall (c) 934 Pio Nono av (V) Unionville School (c) Straight sw cor 2d (U) United Auto Co (Norman R Howard) auto reprs 860 Broadway United Brotherhood of Carpenters &> Joiners No 144 meets Friday 730 p m 408 Poplar United Brothers Lodge No 5 I O O F J C Gray sec meets Tues 8 pm 515 2d Unmitgerd 5C0i1gaCr hSetorrryes Inc Oliver R Bliss jr United Food Brokers Co Inc Lucille Shine mgr 5th nw cor Pine United Garment Workers of America No 157 meets each Friday 4pm 408 Poplar 367 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 UNITED PURCHASING CO (Harvey B Bloodworth), Purchasers of Salary and Wages, Courteous and Confidential Dealings 361 5th, Tel 3567, Night Tel 1515 United Spanish War Veterans meets 2d Friday of each month 454% 1st UNITED STATES GOVERNMENT FEDERAL BUILDING, Mulberry ne cor 3d Agricultural Extension David F Bruce AgBriibcbulCtuorualntEyxAtegnesniot n3dFrfal nFceedseMralLbolwdge home demonstration agt 3d fl Federal bldg Archaeological Laboratory Central City pk Army Recruiting Office Jas T Richardson in chg 4th fl Federal bldg Bank Examiner Howard V Williams 690 Arch Coemraml isbslidogner Wm E Martin 2d fl FedDistrict Attorney T Hoyt Davis 3d fl Federal bldg District Court Hon Buscom S Deaver judge 2d fl Federal bldg DISTRICT COURT CLERK, Geo F White, Federal Bldg, Tels 274 and 188 Farm Credit Administration Chas G Hayes field supvr 4th fl Federal bldg Home Owners Loan Corp Carl D Rogers John S Schofield jr reps 3d fl Federal bldg Internal Revenue Agt Jas B Meyer Federal bldg INTERNAL REVENUE SERVICE, Chas H Dunn Deputy Collector, Federal Bldg, Tel 5397 Marine Corps Recruiting Station Major John M Tildsley in chg Cherry nw cor 1st MARSHAL, Edward B Doyle, Federal Bldg, Tel 6411 National Re-employment Office G Roy NaBveythRuenceruditiisntgmSgtratCiohne,rrLyienuwt Sctoarnl1esyt A Jones in chg 3d fl Federal bldg Organized Reserves (U IS Army) Maj Jos A Sheridan in chg 3d fl Federal bldg POmSaTsteOr,FFMICuElb,erWrymnAe cPoartti3ldlo PostPost Office Inspector, Harry H Hudson 2d fl Federal bldg PreorbaaltibolndgOfficer, Chas E Roberts, FerRailway Mail Service Albert N Camp- bell elk in chg Terminal Station Referee in Bankruptcy, Jos LeConte Smith 2d fl Federal bldg ReA-SndeettrlseomnefnatrmAdsmupinvirst4rathtiofnl FGeedoeraAl bldg ReO-Sffeicttel)emEedngtaArdCminYisoturantgiondi(sDt ifsatrrimct supvr 3d fl Federal bldg Weather Bureau, Geo A Clark meteor- ologist, Federal bldg Works Progress Admn (offices) 356-58 Cherry WoCreknstePrr)ogGreesosrgAiadmBiniHstorlabtriooonk (Hsuopmver 601 (483) Charles (SM) Works Progress Administration (Home Making Center; c) Jessie Brown supvr 3318 Gilmer Works Progress Administration (Sewing Dept) Willie Rhodes supvr 235% Middle WionrgksRPoroomgr)es6s01Ad3md inistration (SewWorks Progress Administration (whse) 900 3d Works Progress Administration (Home Making Center) Mrs Mary Brown supvr 228 Grant Chapel al Unity Life Assurance Co meets Tuesday after 1st Monday 8:30 p m 408 Poplar Upchurch Andrew L (Rosebud) carp h217 Rocky Creek rd Upchurch Harry carp rl248 2d Upchurch Lee (Rosebud B) woodwkr Central Sash & Door Co r RD 3 Upchurch Phillip R (Bessie) slsmn Ga Power Co h22 Drury av (I) Upshaw Jas r613 Main (EM) Upshaw Lonnie (Lillace) mill wkr Bibb Mfg Co r612 Main (EM) Upton Barney H mach CofGRy r220 New Urquhart Grace B Mrs dental asst Dr E Henry Valentine rl27 Magnolia Urquhart J Lewis (Grace S) slsmn Bur- den Smith & Co hl27 Magnolia Urquhart Julian F (Sanella) lawyer 105 Cotton av R13 rll4 Log Cabin dr Urquhart Sanella Mrs slswn Burden Smith & Co rl,l4 Log cabin dr Ursery Benj (c) h306 (732) Bowman (E M) Ursery Julius (c; Maggie L) yd mn h596 Fort Hill (EM) Ursery Lorene (c) r596 Fort Hill (EM) Usery Ned (Ellie J) baker Collins Baking Co rlOl 1st Usher Emmett C (Eliz T) elk CofGRy h 216 Clisby pi (V) Usher Frank (c) lab r254 Middle (V) USINA COMPTON H (Helen S), Cash The Citizens & Southern National Bank hl04 Florida av, Tel 6314-R Ussary C .D mech Central Sash & Door Co r314 Winship (WH) Ussery Alphonso (Belle) h629 Church (C H) Ussery Amaleno M (wid J Columbus) r 605 1st Ussery Benj slsmn r715 2d Ussery Herman student r629 Church (C H) Ussery Julius (c) car clnr CofGRy h247 (6501 Womack (EM) Utility Club Milk Clinic 1818 Broadway Utley June E student r722 Blackburn (N H) Utley LeRoy J (Edna P) photog h722 Blackburn (NH) Va(lNenHtitns)e Chas pntr h212 (17) Holt av Valentine E Henry (Belle R) dentist 516 Mulberry R1002 h204 Overlook av Valentine E Henry ir student r204 Over- look av Valentine Flavel (Kathryn) blr mkr r 3041 Houston av (SM) Valentine John (c; Martha) lab hl022 Power House al Valentine John B (Ruby I) fetywkr Happ Bros Co hi 12 Whitehead (SM) Valentine Maggie r212 (17) Holt av (N Hts) * VaMleinlltinaev Robt L (Maggie) farmer hl20 Valentine Versie R (Mary) fetywkr Happ Bros Co r855 Walnut apt 3 VaHleiltlte (ENMet)tie (wid Wm H) h401 Fort Van Danl (c; Phebe) lab r800 (115) Colquitt VanBuren B Machen (Evelyn) hll6 Brentwood av VanBuren Mary F cash Ethel B Davis Beauty Shop rl59 Laurel av (NH) VVaanncBeurFernaNnceeilsstu(cd) enrlt2r1ll6(1B5r9e)ntDweoBoodradve (SM) Vance Oscar F (Eliz) slsmn h218 North av (NH) Vanderchys C J elk r371 1st Vandergriff E C (Mary) mgr r301 Cherry Vandergriff Mary Mrs slswn Maysons VaWndoimveern EAlipzapar(ewlidr3S01amCi)hehrlr2y2 Napier Vandiver John M rl09 Ayers blvd Vandiver Sarah r3012 Forsyth rd DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every Oity in the UNITED STATES 1 and Canada These are for your convenience If you want In- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 368 J. GUY JACKSON, General Agent Where To Buy? Consult the Classified Business Lists In Directory GUARANTEE MUTUAL LIFE CO. Purely Mutual Legal Reserve Old Line Company--Organized 1901 Third Floor First National Bank Bldg. Telephone 1142 Vandiver W Horace (Wilson & Vandiver) rl22 Napier av Vandivere Wm J (Bertha B) dispr M D & S RR r810 Mulberry apt 2 VanLandingham Clyde H (Evelyn) soda mgr Mitchell & Williams Inc hl25 Carlisle av VanLandingham Dorothy student rl37 Appleton av VanLandingham Wm R (Bertha T) elk Sidney W Abel rl37 Appleton Vann Georgia (wid John C) rl70 Macon Vann Harrison W (c) h417 E 1st (EM) Varn A David student rl27 Stonewall pi (V) Varn Andrew D (Lulye M) loco eng hl27 Stonewall pi (V) Varn Mary student rl27 Stonewall pi (V) Varnadow Mattie (c) lndrs hl025 Broad- way Varnedore Perry (c; Daisy) h751 EdgeVawronoedr Havenry V (c) lab r304 Dover (B) Varner John (c; Lillian) lab hl61 (162) Hazel Varner Rosalee (c) lndrs rill (157) Eliza- beth (SM) Varnon R G elk Hotel Lanier r525 Mul- berry Varns Pearl (c) cook r509 (309) Hall (E M) Vaughan Carrie B counsellor of women Wesleyan Coll r do Vaughan Clayborne (Beatrice C) linemn hl40 Rembert av Vaughan John (c; Lillie) lab h252 Orange Street la Vaughn Berry (c; Mattie) labrll29 (1226) Napier av Vaughn Chas hi 03 Maynard (EM) Vaughn Chas (Hilda) mill wkr Bibb Mfg Co h225 (264) Willingham (EM) Vaughn Esoline slswn S H Kress & (Co r551 Main (EM) Vaughn Geo M mach CofGRy Vaughn Herschel J (Bessie) elk hl05 Oak av Vaughn Jas R (Louise) driver r822 Main OEM) Vaughn Jas R (Mamie) formn h551 Main (EM) Vaughn John (c: Pearl) lab h213 Patter- son (NHts) Vaughn John (c; Lillie) lab h252 Hill al Vaughn Robt (c; Mattie) lab h226 (232) Fargason (V) Vaughn Susie (c) lndrs h517 Coleman al Vaughn Velma elk Bibb Mfg Co r736 Oglethorpe Vaughn Virginia student Ga Academy for the Blind r Elberton Ga Vaughn Wm J (Lizzie N) gro 511 Cotton av h736 Oglethorpe Vaughner Amelia (c) cook r205 Grant av (V) Vaughner Israel (c) carp r205 Grant av (V) Vaughner Millie (c) smstrs h205 Grant av (V) Veal Agnes (c) r309 (206) Smith OEM) Veal Dolly M (c) maid r708 Elm Veal Forrest W (Mary G) pipeftr CofGa Ry r666 Hemlock Veal Jas (c) fctywkr r309 (206) Smith (E M) Veal Luther (c) fctywkr r309 (206) Smith (EM) Veal Marcus (c; Ida) lab h708 Elm Veal Mazie (c) cook hll4 5th av (V) Veal Oscar hall boy Hotel Southland r514 E 2d (EM) Veal Raymond (c; Ellen) lab h309 (206) Smith (EM) Veal Savannah (c) lndrs hl76 Park Ho- tel al Veal Thos (c; Maggie) lab r318 Ham- mond i Veal Wm M (c; Sylvesta) r708 Elm Veal Wm W tires 3021 Houston av (SM) h do Veazey. Fuller (c; Janie) janitor rl58 Guernsey la Veggreotab10le10BOoxglTethheorp(Ae lbert Mullend'ore) Venable Pearl (c) h31l Monroe Venable Pearl E (c) maid r311 Monroe Veniper Jesse (c: Emma) lab hl05 (2) O'Neal's al (EM) Vemer Hudson L (Montine) slsmn h3(10 Pierce av (V) Verner Norman student r310 Pierce av (V) Vestal Jack (Helen) fctywkr Bibb Mfg Co hl32 Log Cabin dr Vial Mary (e) rll3 Middle la (EM) Vickers Annetta (c) h235 Gilmer Vickers Artis (c) lab rl05 Mulberry Vickers Bertha M (c) cook Rosa M Brown rll-6 5th av (V) Vickers Beulah (c) cook h222 Carters al Vickers C Herbert (Martha H) sten Sou Ry System r460 Cherry av Vickers Chas E (Mary D) brklyr r651 Plum ViRckDers Georgia gro 225 5th r Colonial dr Vickers John (c: Sallie M) lab hll6 (15) Turpin la (T) Vickers Lillie M (c) lndrs hl05 Mulberry Vi3c-k4ers Nell Mrs rl09 Washington av apt Vickers Pearlie M (c) cook rl07 (599) Singletons la Vickers Robin A slsmn Union Furn CO r Colonial dr RD Vickers Virgil Rev (Mary M) hll31 Col- lege dr Vickers Wm H lab hl02 Brookdale av (B) Vidcrkyerson Louis (c) r5 (19) West BounVigal ,Eliz coml artist 716 Mulberry h do Vincent F T Realty Co Inc Frank T Vin- cent pres-mgr 154 Cotton av Vincent Frank T (Lula F) pres-mgr F T Vincent Realty Co Inc hll4 Pierce av Vincent H Pierson (Etha M) gro 505 (400) Crisp (SM) h do Vincent John H (c) lab r3Q8 Campbell av (SM) Vincent Lillie (c) h308 Campbell av (SM) Vincent Marietta (c) lndrs h513 Coleman al Vincent Mary (c) r204 (167) Elizabeth (S M) Vincent Ned (Bessie W) asst mgr F T Vincent Realty Co Inc hl03 Rogers av (V)' Vincent Thos (c) porter Gober Service Sta r513 Coleman al Vincent Wm (c) lab r308 Campbell av (S M) Vines Henry (c) lab r!203 1st Vineville Avenue Kindergarten Ruby Taylor director 425 Vineville av (V) Vineville Baptist Church (c) Rev Wm L Phillips pastor Services 11:45 a m 7:45 461 Chestnut Vineville Baptist Church 413 Vineville av (V) Vineville Baptist Church Rev J Ellis Sammons pastor services 11:30 a m 7:30 p m Sunday school 10:00 a m 1035 Vineville av (V) Vineville Barber Shop Allen T Ponder mgr 820 Vineville av (V) Vineville Barber Shop (c; Chas Brooks) 638 Washington av Vineville Court Apartments 99 Vineville Vineville Dog & Cat Hospital (Dr Ernest W Rackley) 646 Washington av Vineville Drug Vineville av C(oV1)(Homer E Burson) 815 Vineville Fish Co (Sami R Yeomans) 117 Hardeman av 369 MOTOR PARTS CORP. Complete Part* Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 6X9 THIRD ST. PHONE 4800 Vineville Furniture Co (Onan G Cooper) 1803 Vineville av (V) Vineville Improvement Co T Harrold Boone pres Edw B Harrold sec-treas 409 2d Vineville R321 Methodist Church (Soutth),, Rev Silas Johnson pastor Services 11:30 a, m Sunday School 10:30 a m 245 Vineville av (V) Vineville Packing Co (Wm J Stripling) meats 123 Hardeman av Vineville Presbyterian Church Rev Geo M Wilcox pastor Services 11 a m and 7:30 p m 439 Vineville av (V) Viney Geo (c) student r223 North (V) Vining John W mill wkr Bibb Mfg Co r 410 Jackson Vining Marshall L (Bella V) h410 Jack- Vinson Ada V (wid Thos S) r231 North av (NH) Vinson Anna (c) h&25 Middle (EM) Vinson Annie Mrs mill wkr Willingham Cotton Mills h51 Holt av (NHts) Vinson Beatrice Mrs emp Snow's Lndry & Dry Clng Co h614 Ross Vilnesgoen Belle (c) maid h rear 224 ColVinson Carrie L (c) maid r201 (213) Jones Street la Vinson Clifford (c) h527 (528) Middle (EM) Vinson Dollie (c) maid hl07 (355) Spring la Vinson (Dora (c) millwkr Bibb Mfg Co r504 ( 505) Edison (EM) Vinson E Lewis (Lillian L) mech Dunlap Chevrolet Co r321 Ross Vinson Edw millwkr Willingham Cotton Mill r51 Holt av (NHts) Vinson Elder (c) r573 Monroe VViinnssoonn EElirone(sct) l(acb; rBereaatrric2e2)4 Claobllehg6e14 Ross Vinson Hattie L (c) maid rl (146) Para- dise al Vinson Henry (c) blrwshr CofGRy r232 Edgewood av (SM) Vinson Ida (c) h815 Fort Hill (EM) Vinson Jas r2169 2d Vinson Jas B (Jessie R) h223 American blvd Vinson Jas D (Lila) cond h203 Villa Esta Vinson Jesse (c; Miley) lab r405 (412) Womack (EM) Vinson Jesse T (E Belle) lab r469 Elm Vinson John (Mattie) h2169 2d Vinson John H, (Nettie) slsmn Coleman- Meadows-Pate Drug Co hl403 Vineville av Vinson John W (c; Mary) h410 E 2d (EM) Vinson Leila millwkr Willingham Cotton Mill r51 Holt av (NHts) Vinson Lilia (c) gro 302 Telfair h304 do Vinson Lillie B (c) maid hill E Ell Vinson Lily (c) rl54 Broad (EM) Vinson Lucinda (c) lndrs h524 Calhoun Vinson M L (wid A J) elk Union Dry Gds Co h223 American blvd Vinson Mamie supvr WPA r331 Vineville (V) Vinson Mary T (c) hll5 Ritchey (EM) Vinson Mattie (c) fctywkr h232 Edgewood av (SM) Vinson Milton (Ella) dishwasher Wisteria Cafe r525 Middle Vilnesgoen Milton (c) lab r rear 224 ColVinson Minnie (c) rl210 Woolfolk (EM) Vinson Mitchel (c) lab Royster Fertz Plant rll5 Ritchey (EM) Vinson Oscar (c; Rosa) h603 (252) Hall (EM) Vinson Patsy (c) maid Hotel Gordon r 201 (213) Jones Street la Vinson Richd (c; Inez) h304 (305) Short (EM) Vinson Robt (c) r815 (838) Fort Hill (E M) Vinson Roesel S Mrs tchr GAB Sch of Commerce h257 High Vinson Rogers lab City r2169 2d Vinson Sami (c; Lily) rl54 Broad (EM) Vinson Sara (c) rl21 New Vinson Sarah (c) rll62 Ocmulgee Vinson Sidney (c) porter Wm J Brewer Vinson T Oscar (Roesel) asst health of- ficer County Bd of Health h257 High Vinson Walter (c) lab hll2 4th av (V) Vinson Wm (c) delmn Louis W Gunnels r524 Calhoun Vinson Wm (c; Veola) lab h404 (412) Womack (EM) Vinson Willie G (c) student r815 (838) Fort Hill (EM) Vinson Willis L (Marguerite) millwkr Willingham Cotton Mill r28 (89) Mill Virgil Sylbil (c) r709 (802) Maynard (EM) Virgil Wm (c; Rosa M) lab Mansfield Dray Line h709 ( 802) Maynard (EM) Vissage Beatrice M (wid Sami H) hl43 Piedmont av Vissage Eliz C rl43 Piedmont av Vissage Milton B (Sara) rll4 Forsyth Vissage Sami driver Dixie Dairies rl43 Piedmont av Vissage W Houston driver Dixie Dairies rl43 Piedmont av Vissher Janie (c) lndrs hill Jones Vocke Edw C (Geraldine) druggist Dan- nenberg Co r272 College Voellinger Alberta student r309 Mikado av (SM) Voellinger Otto R ship elk Dunlap-Peeler Hdw Co r309 Mikado av (SM) Voellinger Willis E (Alberta) baker 309 Mikado ay (SM) h do Voight Andrew W (Lula M) sec-treas Independent Lndry Co h864 Mulberry apt 3B Voight York (c; Minnie) lab h222 Plant (SM) Volk Theo J (Mary N) v-pres Murphey Taylor & Ellis Inc hl46 English av (V) Volkens Fred W slsmn r788 Montpelier Volkens Henry W (Ida T) gro 788 Montpelier av h do Volunteer Pharmacy (Wm W Holt) 470 1st VonMuller Heinreich (Frances) mgr Bruce Terminix Co h313 Orange VonSeeburg Eula M student r869 Orange Vornadore Wheeler (c; Christine) lab h 414 Curd (SM) Vought Edgar J fctywkr Happ Mfg Co r 858 2d Vullo Frances Mrs (Acme Cash Market) r253 Washington av Vullo Mary Mrs r459 Elm Vullo Michl (Josephine) r318% Main (EM) Vullo Russell (Mary) slsmn h459 Elm Vullo Sami (Katie; Sam's Market) h318 Main (EM) Vullo Sami (Frances) elk Acme Cash Market r253 Washington av W M A Z (Southeastern Broadcasting Co Inc) radio sta 211 Cotton av Wachstein Betty student r855 Mulberry apt 300 Wachstein Lenora (wid Louis) dept mgr Union Dry Gds Co h855 Mulberry apt 300 Waeter W Taylor atndt Hartness Service Sta r RD 2 Bloomfield rd Waddell Daisy (wid Wm W) h615 Walnut apt 4 WMadfeg ACrothh6W S(cMheilnlniaev) m(EiMllw) kr Bibb Wade Audrey hl64 High Wade Belle (wid Robt E) elk Jas B Lee rl90l Vineville av (V) We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 370 T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety L. 310-12 First National Bank Bldg. Tel. 64 Wade Bessie (c) cook r63 1st Wagnon D Sidney (Esther) sec-treas Wade Beulah Mrs fctywkr Happ Bros Co Union Dry Gds Co hll39 Vineville av W hl520 Broadway Wade Chas R (Virginia C) trav slsmn Wagnon Esther A student rll39 Vineville h322 Johnson av (HH) av (V) 0 Wade Chas R jr student r322 Johnson av (HH) Wagnon H Vaughn custodian U S PO 1-874 1st Wade Clara (c) cook hl02 (206) Amos Wagnon Jeanette bkpr Union Dry Gds (V) Co rll39 Vineville av (V) 0 Wade Curtis A elk rllO Ayers rd Wade Edna r224 Georgia av Wade Eug mgr r!901 Vineville av (V) Wagnon Wm C (Allie T) bgemn h467 Napier av Wagnor Harold (Thelma) slsmn r6 D Wadg Fanny L millwkr Bibb Mfg Co r27 (28) Taylor av (EM) Moore (SM) Wainright Frieda sten rllO Corbin av Plumbing and Heating The Wade Guy L slsmn r363 % Orange Wade Harry W elk hi 10 Ayers rd Wade Harry W jr lab rllO Ayers rd WWaaddee JHaBzeslls(mc)n srtuCdeanptitorll6H1 oCteollic al Wade J P student r3900 Houston av (S M) Wade J Willis (Beulah) hl520 Broadway Wade Jack A (Emily) rlOO Ingleside av Wainwright Essie I (wid Arthur) r209 (28) Holt av (NHts) Wainwright Ethel mill wkr Willingham Cotton Mill h55 Holt av (NHts) WwaiknrwWrigilhlitnRghaaymmoCnodttoRn (MEfilfliehlM35) m(33il)l Holt av (NHts) Waite Kath C adv mgr Burden Smith & Co hl96 Laurel av (NH) Best Plumbing is Always the Cheapest 512 1st TEL. Wade Jas Bakeries LCo(Hhaz!1e5l20E)3dbaker American Wade Jas W (Susie W) slsmn h321 Orange Wade Jesse (c) lab rl61 Coles al Wade John (c; Ruth) lab h6 Barnhart's Bottom Wade John W (Mary) h27 (28) Taylor av (EM) Wade Lilia Orange (wid Homer G) h863y2 WlainitgeshaCmlarCeontcteonLM(Ailllichel)31mRillowffkrHWomilela Waites J Wm (Gladys S) bgemn h328 Hanson (SM) Waites Jas (Louise) slsmn r905 Cherry WCaiotesr9L0o5uiCseheErrmy gr Coml Casualty Ins Waites Mattie V (wid Ernest) smstrs r 666 Hemlock Waits Arth C (Ruth M) auto mech h645 Ash 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your oonvenience If you want in- formation you are unable to procure elsewhere call on u9 R. L. POLK & CO. Wade Lois cash rl64 High Wade Lonnie (c; Izola) h5 (310) Han- son (SM) Wade Lorene sorter rl05 Mill av Wade Louise millwkr Bibb Mfg Co r6 Schell av (EM) Wade Marion P (Eliz) h266 Belvadier dr Wade Martha (c) lndrs hl61 Coles al Wade Myrtle millwkr Bibb Mfg Co r6 Schell av (EM) Wade Phelps (Sallie) h207 Buford Wade Robt (Jewel W) elk h360 New Wade Robt M mgr United Purchasing Co r Allen rd WUadngivThh5o0s7%L A(Mdaamrgst C) prof Mercer Wade Walter H (Minnie A) pntr hl05 Mill av Wade Willie (c) h466 (465) Log Cabin dr Wade Willie B (c) maid r429 Telfair Wadford May rl817 3d WmadullegyeeClarence (c) auto mech r964 OcWadley Frank H jr (Pauline) pharm h 207 Berkley dr Wadley Hollis M sta mgr Wofford Oil Co r80O Vineville av (V) Wadley John E jr (Wesleyan Pharmacy) r207 Berkley dr Wadley Lovie (c) lndrs h718 (628) Prince (SM) Wadley Richd B (Rosalie; Sunshine Dairies) h200 Forest Hill av Wadsworth Ella Z (wid John A) rl04 Vista cir Wadsworth Mary W (wid Earl) elk Union Dry Gds Co r630 Anderson CS M) Wadsworth Patsy E student r630 Ander- waits E Curtis appr CofGRy (Waits Edw (Dixie) millwkr Willingham Cotton Mill h59 (14) Roff Home pi Waits Emma (wid John) rl30 Concord (SM) Waits H Grady (Bertha) slsmn Frank Roberts r765 Spring Waits Jeanus H (Lillie M) mach CofG Ry hi 717 2d Waits Margt (wid Henry) rl25 Log Cabin dr Waits Ruth M Mrs gro 559 Telfair h 645 Ash Waits Wm M (Nancy) mech Adams- Buchanan Motor Co r205 Peachtree (EM) Waitt Carrie W (wid M G) rl09 Buckingham pi (V) Wald John (Nettie) h234 American blvd Walden Bonnie M fctywkr Happ Bros Co r521 Main (EM) Walden Chas G (Sallie L) cond hl24 Highland av Walden Clarence (c; Nellie M) fctywkr Bibb Mfg Co r218 Mitchell la (V) Walden Evelyn Mrs slswn r427 College Walden Francis student r315 Cutter's Green (EM) Walden John (c) porter rl52 Moore al Walden John B mech D H Adams Motor Co r616 1st Walden Lina (c) h921 Ash Walden Louis (c) r703 Hammond (SM) Walden Margt r308 Melrose (B) Walden Maria (c) maid h419 Damour la Walden Mary G tchr PS rl24 Highland Walden Roger L (Mamie) city firemn h 315 Cutter's Green (EM) Walden Virginia r308 Melrose (B) Walden Wesley (c) lab CofGRy r921 Ash DETROIT son (SM) Wages John T jr (Cathryn C) slsmn Mc- Kesson-Riley Div hl3:l Hines ter (V) Waggenstein Minnie r655 Hemlock Wagner Marie (wid Jos HT h321 1st Wagner Oscar B (Bessie) blrmn h301 Ell (SM) Wagner Wm M (Sallie) dairy 108 Kem- per av h do Wagnon Clifford L slsmn S H Kress & Co r467 Napier av Walden Wiley W (Rachel) carp h308 Melrose (B) Waldon Eug (c; Phoebe) lab hl640 1st Waldon Harry (c; Dessa) porter hi Ross Waldorf J S & Son (John S and Wm R Waldorf) gro 621 Poplar Waldorf John S (Caroline E; J S Wal- dorf & Son) hl04 Ayers blvd Waldorf Leila nurse 104 Ayers blvd r do Waldorf Margt waiter Wisteria Cafe r Coleman Hill 371 HOTEL Waldorf Sarah L opr SBT&TCo r221 Georgia av . Waldorf Stella smstrs r658 1st Waldorf Wm A (Bertie) h22l Georgia Waldorf Wm R (Annie L; J S Waldorf & Son) h905 American blvd (B) Waldron Eliz elk WPA r RD 2 Waldron Millard F (Myrtice) rnspr hl46 WEalldl ro(nSMW) G police C,,ount. y Sheri.ff r Bloomfield rd Walgreen Co Frank R Cooley mgr drugs Walker Clifford (c) millwkr Bibb Mfg Co rl07 Wall's al (NH) Walker Constance (c) lndrs Crescent Lndry Co r301 (421) Elizabeth (SM) Walker Cora r76 Arlington pi Walker Coralee (c) rl62 Coles al Walker Cornelia (c) cook h212 (216) Middle (V) . Walker D Albert (Fannie H) agt New York Life Ins Co h673 Hillyear av (CH) Walker D Albert jr student r673 Hillyear 518 Cherry Walker Abr (c) lab r207 Cedar (U) Walker Adline (c) cook r210 Moughon Wa(Vlk)er Albert (c; Luranda) lab h618 4th av (V) Walker Alice (c) hl208 Broadway Walker Alice V (wid Robt) 2d hd clothes 406 Main (EM) rl35 Ross Walker Anderson (c) h321 McClain la Walker Anna (c) lndrs h2 (2) Alexander Walker Annie (c) cook r454 Bay Walker Annie (c) cook r718 (628) Prince Walker Daisy G (c) nurse 235A Middle (V) h do Walker Dallas T (c) janitor Mercer Univ rlOlO Clinton rd (EM) WMalkidedrleDa(nVl) (c; Josephine) ch,,auf h320 Walker' Danl jr (c) student r320 Middle (V) Walker Dessau (c) lab CofGRy r503 E 1st (EM) Walker Dessie M (c) lab r526 E 2d (EM) Walker Dinah (c) rl61 Elbert (SM) Walker Dock (c; Sallie) h503 Hazel Walker Annie (c) lndrs h415 (542) Hen- rietta (SM) Walker Annie B (c) lndrs ,, ,, r204 mToombs Walker Dub (c; Emma) lab r246 (255) Elliott (EM) Walker Duncan D (Helen) phys 700 Spring R201 hl20 Stamislaus cir Walker Annie L (c) rl08 Gantt City rd (SM) Walker Annie L agt North Carolina Mut Life Ins Co r Creswell Hts Walker Annie L (c) student r469 Douglas av (V) Walker Arth (c) lab hlO Gunn's la (V) Walker B Sanders (Emily B). pres Robertson-Walker Inc h213 High Walker Benj (c; Annie) h46 Harris Walker Beni (c) lab h760 Ash Walker Benj (c) lab h431 Chestnut Walker Benj (c; Annie M) lab hll4 E Ell Walker Birda M (c) maid r206 O'Hara la Walker Brady (c; Nellie M) lab Macon Gas Co h222 Jordan's al (SM) Walker Burton (c; Henrietta) hlpr C of G Ry h742 (730) 3d av (V) Walker C H (c) delmn Hall's Grocery r 443 Chestnut Walker Calmer (Bessie) porter Dunlap Chevrolet Co r RD 2 Bloomfield rd Walker Carlton (c; Julia) h378 Long St la (SM) Walker Celestine (c) tchr rll5 Jones Walker Chas (c; Verna) hl97 Elliott (EM) Walker Chas (c; Lula) h511 Gilmer Walker Chas (c; Frances) lab r315 Divi- Walker E Hurst soft drinks 101 Ayers rd h do Walker Edw D (c; Maggie) lab hlOl (1) Orchard av Walker Edw L (Josephine) elk rl24 Cleveland av (V) Walker Elbert (c) delmn Moore & Boone r235A Middle (V) WWaallkkeerr EEllilza ((cc)) hh4l526 ((546610)) WCiltiknotownsk(iE'sMla) Walker Ella (c) lndrs r2 (2) Alexander Walker Eloise M student r620 Arch Walker Emma (c) lab hl04 (120) Thomas (EM) Walker Emma (c) lndrs h526 E 2d (EM) Walker Emma S (c) maid r306 4th av (V) Walker Enoch (c; Dolly) lab h800 Daisy (SM) Walker Ermie (c) cook rl07 Douglas av (V) WRaloksesr Ernest (Pearl) floor fnshr rl31 Walker Ernest millwkr Bibb Mfg Co r 1043 1st Walker Essie M (c) lndrs hl3 (6) Wit- kowski la Walker Eudora (c) h443 Chestnut Walker Eug (c; Ola L) janitor h201 (362) Craft (V) W4a2lk8erGEreuelna Mrs maid Darling Shop h sion (T) , ,, , . Walker Chas (c; Lucinda) lab r647 Elm Walker Fanny (c) lndrs h772 Moore al Walker Frank (c; Fannie H) h218 (161) Walker Chas (c) porter Corbin Service WSaltkaerr RCDhas3 (Dc)rysaBwryaenrchto.9G66aElm Walker Chas (c) student rl40 Roosevelt Grant av (V) . ,, _ Walker Frank (c; Viola) emp C of G Ry hl03 (9) Magnolia la Walker Frank (c; Ida) lab Natl Handle Co hl65 (317) Nussbaum (SM) Walker'chas W (May W) lawyer 409 2d R421 r687 College , . Walker Chester C (Jessie L) body repr Colbert Mfg Co h710 Pine Walker Claire J (wid Henry; The Oak Art & Gift Shop) h2514 Forsyth rd Walker Clarence (c) T760 Ash Walker Clarence (c) rl04 (120) Thomas (EM) Walker Clee (c; Josephine) lab h4 Ross Walker Fred (c) lab C of G Ry Walker Fred (c; Eliz) lab h213 1st av (ID Walker Fred H millwkr Bibb Mfg Co r 708 Napier av Walker Gaddie (e) lndrs r275 3d av (V) Walker Gainer (Gladys) millwkr Bibb Mfg Co h21 Bibb av Walker Geo (c; Ada) h rear Anola pi PX0O3) O' -i->J III w *9-.1 a o U 50Jw&9 iwNn DIRECTORY LIBRARIES We Have on File hi Our DIRECTORY LIBRARY Conies of the Directories of Practically Every City in the UNITED STATES ant) Canada These are for your convenience If you want in- formation you are unable to proeure elsewhere call on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 Walker Henry (c; Mildred) porter Ga WMalkaerkretHHeonuryse hA203(HMelaeung)hotnell(eVr) rll6 Walker Margt millwkr Bibb Mfg Co r 1043 1st Walker Marie (c) millwkr Bibb Mfg Co Magnolia h242 Waterville rd Walker Henry G (Beulah) millwkr h226 Ross Walker Horace D (Leila H) route agt Railway Express Agency h708 Napier Walker Hubert (c) chauf r454 Bay Walker Marietta (c) student rlOl (1) Orchard av Walker Mary (c) maid rll2 (955) Ocmulgee la Walker Mary sten r415 New apt 2 Walker Ida (c) h498 Gilmer Walker Mary L (c) h380 Monroe Walker J Clifford (Gladys) slsmn hl27 Walker Mary L (c) maid r434 Hammond (147) Glynn av Walker Jas (c) delmn Percy M Bray r Walker Matilda (c) lndrs r216 Elliott (EM) 227 Jefferson Walker Mattie (c) cook h469 Douglas av Walker Jas (c; Mary) driver hll5 John- son (SM) Walker Mattie (c) maid h265 Cowan Walker Jas (c; Roberta.) driver reprmn Toole Furn Co h507 Long St la (SM) (EM) Walker Mattie K (c) lndrs r206 Bartlett Walker Jas (c; Maude) lab r207 Coles al Walker Maude (wid Alonzo) h506 Telfair Walker Maxie (c) hl39 Hazel Walker Jas (c) lab r338 Middle (V) Walker Maxwell (c) lab r316 Green Wga6lk6er Jas (c; Anna) lab rl016 OcmulWalker Jas (c; Ethel) lab h rear 3 Wa- terville rd Walker Melvin -delmn Sidney W Abel r226 Ross Walker Melvin R supt Clark Memorials Inc rl20 Tyron bilvd Walker Jas B (Mary G) blrmkr hl08 Capital av WBalakger CMo inhnl6ie2 LCo(lce)s laalb Central City Walker Jas E (c; Emma) brklyr hI15 Jones Wha3lk06er 4Jaths LavRe(vV)(c; Emma S) pastor Walker Jas W (c; Mattie) lab r600 4th av (WH) Walker Jesse (c; Pearl) lab h346 Ham- mond Walker Jessie L (c) cook h316 Green Walker Jewell r760 Ash WearlkneravNan(EcyM)(c; Tommie) r422 NorthWalker Nannie (c) student r456 (460) Clinton (EMi Walker Nat R (Clara) chf yeomn USN Recruiting Sta hl93 Boulevard (NH) Walker Obie (c; Josephine) millwkr Bibb Mfg Co hl08 (4) Davis al (EM) Walker Olivia (c) r213 (353) Campbell .av (SM) Walker John (c; Grace) lab h936 Elbert Walker Pearl (c) maid r484 Chestnut (SM) Walker Reba (wid Owen W) r2036 2d Walker John (c; Susie) lab h210 (209) Walker Robt (c; Mamie) hsemn Ga Elliott (EM) Academy for the Blind r247 Madison Walker John (c) waiter Hotel Lanier r 115 Jones Walker John B blrmkr C of G Ry Walker Robt (c; Lilly M) lab h364 Hazel Walker Robt (c; Julia) h232 Moughon Walker John C (c) lab r25 (4) Buckner al Walker Robt (c) lab Willingham Sash & Door Co (plant) r New Columbus rd W1a1l0kerBJloouhnnt T (c; Pearlie M) delmn h Walker Robt (c) lab rl2 (561) Witkowskis 1st Walker Johnnie B millwkr Southland Knitting Mills r620 Duncan av Walker Robt A (Bessie) millwkr Bibb Mfg Co hl54 Comer ter (PM) Walker Johnnie M (c) r454 Bay Walker Johnny fctywkr Bibb Mfg Co rl8 (17) Lake City (EM) Walker Robt H doormn Ritz Theatre r 135 Ross Walker Robert J (c) lab r316 Green Walker Jones (c; Annie B) lab hll2 Walker Robt L (Ida M) mus tchr 506 Orange hl21 Inverness av Walker Jos (c) carp h304 Roosevelt av Walker Roger millwkr Bibb Mfg Co r739 (V) Hawthorne Walker Jos (c; Irma) lab h761 Ash Walker Jos (c) lab r803 Charles (SM) Walker Josephine M (c) tchr PS r320 Middle (V) Walker Rosa (c) r213 (353) Campbell av (SM) Walker Ruby (c) rl04 (120) Thomas (EM) Walker Josephine S elk First Natl Bank Walker Rufus (c) dishwasher Chas S & Trust Co rl24 Cleveland av (V) Smith Walker Jurine (c) cook rl54 Hill Walker Katie (c) rl052 Hazel Walker Russell (Martha) farmer hl248 2d Walker Kittye S sten C of G Ry h401 Walker Sallie (c) lndrs h431 Chestnut College apt 7B Walker Sami stereotyper Macon Teleg Walker L B (Fannie) porter Dunlap Chevrolet Co r RD 2 Walker Levi (c; Eula) lab hl28 Green Walker Lewis A (Mae D) pres Macon Cigar & Tobacco Co h336 Napier av Pub Co rl31 Ross Walker Sarah rl06 Culver (V) Walker Scott (c) hlpr Wilder & Jones Walker Solomon (c; Annie) lab h207 (123) Virgin la (V) Walker Lilian (c) lndrs r209 Roye la Walker Stamp (c) shoe shiner Hayes Walker Lillie (p) r212 Coles al Barber Shop r456 (460) Clinton (EM) Walker Lillie M (c) cook rill N Tatnall Walker Stevens (Sarah) millwkr Bibb la Mfg Co h214 (60) Clinton (EM) Wtaellkerr46L6illiBeaMy (c) maid Arlington HoWalker Lily (c) maid h406 1st av (V) Walker Lonnie (c) maid hl36 (132) Army Walker Susie L (c) r966 Elm Walker T Walker r601 Woolfolk (EM) WpalhkaeniragTeherlmFaormsyatthrornd HPeOphBziobxah22O2 r- Lot Walker Lucille (c) r760 Ash Walker Thos (e) lab rl07 Walls al (NH) Walker Thos B (c; Ida) barber John W Walker Luther (c; Dora) lab h605 (108) Peeks h306 Forest av (V) Elliott (EM) Walker Viola (c) maid h338 Middle (V) Walker Mamie (c) cook Ga Academy Walker W Andrew r3 Randolph pi for the Blind r247 Madison Walker W Brown (Mary) h317 Buford Walker Margt (c) rl26 (2) Fulton al pi (V) 373 ROBERT O. THOMAS 569 T6 Cherry St. REALTOR Telephone 1067 WKalnkoertt W(SMEr)nest (Hattie),,driver h224 Walker Walstein L (Mary E) mgr Bibb Investment Co hl75 Beverly pi Walker Walter (c) lab rll7 Hicks al WALKER WATSON (Emmie B), City Engineer City of Macon, h804 Spring, Tel 3941-W ,. , Walker Wm (c) rl3 (6) Witkowskis la Walker Wm (c) barber Foster Giles rlO Graham's Lot Walker Wm F (Minnie L) slsmn Dan- nenberg Co h620 Arch Walker Wm F jr mus tchr 620 Arch h do Walker Wm H (Johnnie) slsmn h300 Wa(3l0k1e)r HWiigllhietowDer (c) h318 Walnut Walker Willie E (c) student r521 3d av (V) Walker Winston (c; Avery) brklyr hl40 Roosevelt av (V) Walker Zanie (c) h422 O'Hara la Wall Allease (c) cook Irene Jones rlOO (148) Tupelo Wall Chas H student r371 1st Wall Elton student r270 Columbus Wall Eudell (c) cook hl23 (13) Franklin St la Wall Geo (c; Annie) lab C of G Ry h 100 (148) Tupelo Wall Henry C (Lillie) h565 DeBorde (S M) Wall Hollis r270 Columbus Wall J Brad (Zeta F) filling sta 714 Poplar hl26 (142) Pierce av (V) Wall Jos A (Sara H) transfer dept h270 Columbus Wall Leroy (Barbara) formn City hllO (200) Elizabeth pi (V) Wall Parker student r371 1st Wall Penelope tchr PS rllO (200) Eliza- beth pi (V) Wall Penelope (wid John T) hl29 Pierce av (V) Wall Sami (c) lab r321 Patterson (NHts) Wall Wm slsmn rl24 2d Wall Wm L emp C of G Ry Wallace Addie M emp Snow's Lndry & Dry Clng Co r344 Hammond Wallace Albert (Lois) r550 Pine Wallace Annie (wid John V) rl40 High WMallfagceCoBahiile1y6 (W46)(EHdyndar)olimail(lEwMkr) Bibb Wallace Beverly reporter Macon Evening News rl40 High Wallace Carson fctywkr Happ Bros Co r 209 1st Wallace Chas (c; Minnie) lab h206 Coles al Wallace Cleo (c) millwkr Bibb Mfg Co hl20 Broad (EM) Wallace Edison millwkr Bibb Mfg Co r 116 (46) Hydrolia (EM) Wa11ll6ace(46E) dnHaydmroillliwa kr(EBMib) b Mfg Co r Wallace Emmett (Ruth) soda elk Mitch- ell & Williams Inc h305 Chatham (SM) Wallace Ernest (c) porter Ga Market Service Sta r304 5th av (V) Wallace Evelyn M millwkr Willingham Cotton Mill rllO (5) Holt av (NHts) Wallace Fannie "Mrs r560 College Wallace Henry C (Maude) sta mgr The Texas Co r407 Forsyth Wallace John porter Firestone Auto Sup & Serv Stores rl32 Jones Wallace Lessie D (Louvenia) millwkr Bibb Mfg Co h20 Schell av (EM) Wallace Lorena (wid David C) elk Arthur B Moore h227 Chappell (SM) Wallace Louvenia Mrs millwkr Bibb Mfg Co h20 Schell av (EM) Wallace Mary B (c) maid rlOl Drew qtrs Wallace Mary E (wid John T) r5 Randolph pi Wallace May (c) lndrs rll3 (152) Cedar Wallace May E millwkr Willingham Cot- ton Mill rllO (5) Holt av (NHts) Wallace Mildred student r401 College apt 4F Wallace Milton K (Eliz) dep elk U S Dist Court h303 Corbin av (V) Wallace Myrtle millwkr Bibb Mfg Co r 108 (42) Hydrolia (EM) Wallace Noble B (Myrtle) millwkr Bibb Mfg Co hl08 (42) Hydrolia (EM) Wallace Otis B (Bennie M) lab h2010 Vineville av (Vi Wallace Raymond (Allene) flgmn h867 New Wallace Robt E (Bessie ,,T) ,loco eng h- 817 Mulberry ,, . Wallace man aRv oland B atndt , rl07% Harde,, Wallace Sarah F Mrs sten rl26 Napier Wallace Thos A (Eliz; Wallace & Wallace) r Wallace rd Wallace Truitt slsmn L B Price Mercan- Wallace Wm E (Stella) stone ctr h513% Cotton av Wallace & Wallace (Thos A and Milton K) lawyers 617 Mulberry R511 Wallenstein Stanley H (Debra) slsmn h 116 The Prado (I) Waller Anthony (c; Hattie) lab MD&S RR h!61 (15) Glen (EM) WBalrloeardBweanyj I (Carrie H) loco eng hl518 Waller Benj I jr rl518 Broadway Waller Clem H (Rubie) driver American Bakeries Co hl04 Ponce de Leon av (SM) Waller Danl (c; Viola) porter Regero & Regero) h219 Green Waller Della (c) r609 Ross Waller Harry H Rev (Mildred S) pastor Wrall5l1e8r IBnreozad(wc)avlndrs h609 Ross Waller J Kelley (Belle) mach opr Dixie Roll & Cot Co Inc r623 Main (EM) Waller Jas R (Vergie) millwkr Bibb Mfg Co h224 (7) Clinton (EM) Waller Jefferson D (Sallie M) millwkr Bibb Mfg Co hllO (43) Hydrolia (EM) Waller Jennie (c) lndrs hl51 Walker la Waller Jesse E Rev student rl518 Broadway Waller John W (Lola) millwkr Bibb Mfg Co h201 (200) Hydrolia (EM) Waller Jos (c) lab r609 Ross Waller Lena M millwkr Bibb Mfg Co r 151 1st Waller Linda rlOO Highland av (LCHts) Waller Lizzie (c) cook r422 Lawton av Waller Lola Mrs millwkr Bibb Mfg Co h201 (200) Hydrolia (EM) Waller Lonnie A (Bessie) millwkr Bibb Mfg Co h!51 1st Waller Minnie L rl518 Broadway Waller Nellene millwkr Bibb Mfg Co r 121 1st Waller Nelson (c; Lonnie) porter T M WRalaleinreOs LGloroyd C(oRohsla0M5 aMe aSy) aacvct (rNl5)18 Broadway Waller Oscar (c; Lizzie) lab h215 Braswell la Waller Reubin (c) lab h757 Edgewood av Waller Sallie M Mrs millwkr Bibb Mfg Co hllO (43) Hydrolia (EM) Waller Sarah E Mrs r2908 Houston av (SM) Waller Solomon (c; Sallie) lab r609 Ross Waller Thos F Rev hl518 Broadway Wallis Casper (Margt G) reprmn SBT& TOo r337 Adsnis Walls Dessie Mrs bkbndr r307 Chappell (SM) Walls Elsie slswn S H Kress & Co r409 Spring Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 374 A. B. LEE PLUMBING & HEATING CO. pJiBf'U Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Walls Harris (Lucy) plmbr Davis Plumb- Walton Henry J (Grace T) car repr C of ing Shop hl24 Garden (EM) G Ry hl41 Tenney av (SM) Walls Jas (c) janitor Macon Teleg Pub Walton Irene (c) maid r325 4th av (V) Co r589 (559) ISiam (EM) Walton Jas janitor r RD 1 Box 22 W4a0ll9s JSuplriiangslswn P W Woolworth Co r WHalttso)n Jas (c) lab rl09 Patterson (N 1% Walls Lena (wid Edw) h409 Spring Walls Lucy Mrs sten Union Dry Gds Co hl24 Garden (EM) Walls Sadie (c) maid r622 4th av (V) Walls Sami (c; Phyllis) lab h810 Ocmul- gee Walnut Apartments 915 Walnut Wa(EltMer) Jos (c) farmer rll2 (113) Glen Walters Alatia L (Carolyn) mgr r425 College Walters Aldean (c; Lucy) lab r204 (278) Astor (EM) Walters B Frank (Merle) asst supt County Court House h208 Spring Walters Benjamin A (Cora) carp hl65 (242) White (SM) Walters Clayton C (Ruth) cond h615 Adams Walters Coley R atndt Glawson Service Station r RD 4 Walters David (c) lab rl20 (213) Frank al Walters Eleanor student r489 Orange W6a3lt0erAs nEdleizrsaobneth(SWM) (wid Frank F) h WALTERS FRAJVK E (Anna M), Mgr Sears Roebuck & Co, r224 Georgia av, Tel 2985 WALTON JAMES S, Sec The J W Burke Co, r265 Hill Crest av (CH), Tel 1500-M Walton Jos (c; Lizzie) pntr h752 Center (EM) Walton Margt R slswn Collins Baking Co r534 Linden av Walton Rodus (c) r rear 377 Monroe Walton Ruth W r534 Linden av Walton Stella (c) r24 (23) Malloy's al Walton Victoria Mrs h26 Progress WALTON WALTER F (Lyde C), Pres- Mgr The J W Burke Co, h265 Hffl Crest av (CH), Tel 1500-M Walton Wm (c; Martha) lab rll9 (24) Magnolia la Walton Willie (c) lab C of G Ry Waitress Mattie J (c) Indrs h205 (358) Craft (V) Wammock Sami A (Johnnie C) ins agt Whalnla5maLkaewrtoMn arayv (wid Wm S) hllO Rogers av (V) Wanck digs (c) ydmn r!3 Parker av (V) Wansley Kathleen opr SBT&TCo r!06 Villa Crest Wansley W Hoyt sta mgr Gulf Oil Corp rl06 Villa Crest Walters Harry L (Ethel) mgr Friedman's Wansley Wm F (Mary) car repr C of G Jewelers h930 College Walters Henry W r630 Anderson (SM) WOalrtaenrsgeJos W (Eleanor) spec agt h489 Walters Kate R (wid Thos L) hll8 In- verness av Walters Lee (c) sawyer hl20 Short (EM) Walters Marie r403 Franklin (SM) Walters Mattie (c) Indrs rl20 (213) Frank al Walters Moses (c; Bertha) lab h314 (342) Tindall av (SM) Walters Robt (c) lab rl20 (213) Frank al Ry hl06 Villa Crest Ward Addie (c) h3l8 Gilmer Ward Albert (c) porter Ry Exp Agcy r 318 Gilmer Ward Andrew J (Willie M) formn h22 (23) White (SM) Ward Archie C (Theresa) fctywkr hl20 Pinson (SM) Ward Bess dept mgr Union Dry Gds Co r79 Arlington pi Ward C Felton (Bessie Ei gro 868 Hazel h866 do Ward Calvin R (Anne) barber Hayes Barber Shop r918 Walnut I? If Walters Rollin O r403 Franklin (SM) WWaalltteerrss SSaarraahh Msochiealadweklrk rM48e9t OLirfaengInes Co rll8 Inverness av Walthall Anne student r843 Courtland av Walthall Edw L (Laura E) blrmkr C of G Ry h301 Johnson av (HHi) Walthall Flrank W (Eula M) local mgr Woffard Oil Co plant h843 Courtland Walthall Nell E sten City Treasurer r 812 Hillyer av (CH) Walthall Wm W (Lula M) h812 Hillyer av (CH) Walton Benjamin (c; Geraldine) lab r 444 Shoals al (EM) Walton Betty L) slswn r534 Linden av Walton Broscoe (c; Lizzie) lab MD&S RR r424 Flanders (EM) Walton Clara (c) Indrs h239 Hurley la Walton Claudine tchr r265 Hill Crest av (CH) WALTON DeWITT T (c; Jimmie), Den- tist 419 K of P Bldg 556 New, Tel 785, r410 Pio Nono av (V), Tel 2633-J Walton Dock (c; Annie) lab r2 Barn- Ward Carl rl05 North av (NH) Ward Chas student r3319 Houston av (SM) Ward Clara (c) Indrs h28 Parker av (V) Ward Clifton P (Olivia B) mgr Noland Co Inc h360 College apt 2 Ward Cora (c) Indrs h Forsyth rd Ward Danl (Eunice) millwkr Bibb Mfg Co hl-2 Bellevue rd Ward Davis (c) lab h715 Whitehead al Ward Dewey W (Susie; Night Owl) rl08 3d av (SM) Ward Donald M (Roberta C) tchr Lamer High Sch for Boys h505 Beech av Ward Dope millwkr rl05 Riley av (CP) Ward Edw W (Minnie I) millwkr Will- ingham Cotton Mill h321 Dannenberg av Ward Emma (c) h425 Cedar (U) Ward Ernest bartndr Night Owl rl08 3d av (SM) Ward Evans F (Felica J) driver r570 Oglethorpe WBaradkiFngletcChoerhC918(EWvaaLln)utslsmn Collins Ward Frances picker Macon Peanut & hart's Bottom Walton E Bruce (Aurie D) inspr h848 Hillyer av (CH) Walton Frances elk J W Burke Co r265 Hill Orest av (CH) Stge Co r RD 6 Ward Geo (Nora M) h264 Winship (W H) Ward Hattie A (c) h60>5 Clinton (EM) Ward Helen nurse 736 College r do Walton Harold C slsmn Bankers Health Ward Irvin driver City r574 DeBorde & Life Ins Co r848 Hillyer av (CH) Walton Harriett S student r534 Linden Walton Hattie W (wid Enoch S) h534 Linden av Walton Henry C (c; Josephine) pntr h 559 Broad (EM) (SM) Ward Isaac (Lois) millwkr Bibb Mfg Co r270 Main (EM) Ward J W (c) ir606 Clinton (EM) Ward John (Bessie M) slsmn hl08 3d av (SM) 375 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Ward John T (Cumi) slsmn Bibb Mattress Co hl4 Schell av (EM) WMardainJoh(EnMW) (Lilia) city firemn h264 Ward Jos (c; Henrietta) h228 Cowan (EM) Ward Jos S (Lois) atndt Macon Auto Exch r267 Washington av Ward Jubal B (Ida) phys hl30 Fort Hill (EM) Ward Julia elk Bibb Mfg Co rl4 Schell av (EM) Ward Lillian L slswn r264 Main (EM) Ward Lizzie (c) lndrs h2 Barnhart's Bot- tom Ward Lizzie (c) lndrs h955 Pio Nono av (V) Ward Louis A (Stella M) restr 3499 Houston av (SM) h254 New Ward Lucille Mrs r240 Washington av Ward Lucy (c) cook 845 Courtland av Ward Major (c; Alzie) lab MD&SRR h 697 Ocmulgee Ward Margt Mrs waiter r220 1st Ward Mary (wid Harvey) r213 (207) 'Vil- la Crest Ward Mary K (wid Patk H) h736 College Ward Maude Mrs h656 New Ward Monroe (c; Ida M) lab h227 Jef- ferson Ward N Ardell (.Onte) driver rl27 Vir- ginia av Ward Narcissus (c) maid hl20 (115) Gib- son av (SM) Ward Nellie rl820 Broadway Ward Oliver R (Lula B) carp hdll White (SM) Ward Olivia B Mrs mgr Noland Co h360 College apt 2 Ward Reuben H (Mae M) pressmn Ma- con Teleg Pub Co h853 Cherry apt 4 Ward Robt W (Ruth) fctywkr Happ Bro Co r570 Oglethorpe Ward Ruby (c) maid r412 (716) Camp- bell av (SM) Ward Theodosia H Mrs h3319 Houston av (SM) Ward Thos (c; Mabel) lab C of G Ry r228 Cowan (EM) Ward Vurna (o) drsmkr r201 Ward (V) Ward W Homer (Mary L) auto mech r 401 Walnut Ward Walter (c; Clara) lab hl2 Parker av (V) Ward Walter (c) porter Ry Exp Agcy r Ware Vivian D (c) maid r452 E Academy (EM) Ware Walter (c) lab h418 Gilmer Waring Geo O trav slsmn h401 College apt 21 Warlick Freeman (Warlick & Co) r202 Clisby pi (V) WCarolitctoknHailvlyehr21C5 (LBaouurlaevAar)dph(oNtHog) 117 Warlick Josie V Mrs h623 Forsyth Warlick Will elk Crescent Lndry Co r623 Forsyth Warlick & Co (Hillyer C and Freeman Warlick) cotton brokers 516 Mulberry R406 Warn Arth (c) lab rl21 Edgewood av Warner Lee (c; Mattie) porter hll9 Lexington (EM) Warner Mara Mrs typist WPA r224 Georgia av Warr Roland L (Eunice H) barber Hayes Barber Shop r911 Cherry Warr Rosa (wid Herman) r620 Walnut Warren Alex (c) plstr hlpr h518 Bright la Warren Alf J (c) lab r722 Daisy (SM) Warren Carrie (c) lab h370 Flanders (EM) Warren Cecil (c; Marion) lab hl34 Lawton la Warren Chas (c) janitor Ga Power Co rl08 (8) Alabama (SM) Warren Chas A (Lorine) slsmn Friedman's Jewelers h403 Spring Warren Clayburn H (c) lab r722 Daisy (SM) Warren Cleophus (c) lab r241 Tindall av (SM) Warren Cleveland (c; Margt) lab hll2 Short la (EM) Warren Dana (Helen) meat ctr r516 Orange Warren Dayde (wid Chas) h476 College apt 3 Warren Delmar A archt designer Mrs WEalrlraemnaEedwE L(ce)ogpuoerterr47K6aiCrsotlelenge& aDpetn3son Co Inc Warren Edw student r774 Mulberry Warren Ervin H (Lois) emp C of Ga Ry Wha6rr2e8n AFnadnenriseon(c)(SMma) id h400 Stevens (SM) Warren Fanny (wid Andrew J) r363 Walunt 318 Gilmer Warren Frankie elk r215 1st Ward Walter A (c; Mary E) delmn rl2 Warren Grafton (Virgie) millwkr Bibb Parker av (V) Mfg Co h212 Jackson Ward Wm M (Nellie H) hl820 Broadway Warren Hubert E (Lillie M) meats 203 Ward Willie picker Macon Peanut & Hardeman av r501 Georgia av Stge Co r RD 6 Warren J Cleo millwkr Bibb Mfg Co r Ware see also Weir 250 Peachtree (EM) Ware Douglas B (Sadie L) contr h707 Warren J Wesley (c; Lula) farmer h316 Adams (317) Williams (EM) Ware Elmer r235 Washington av Warren Jas (c) lab McCord Used Auto Ware Ford (Janie L) phys 516 Mulberry Parts r309 Campbell av R901 hll9 Buckingham pi (V) Warren Jas (c; Lillie) lab h203 (222) Ware Henry (c) millwkr Bibb Mfg Co r Fargason (V) < 211 Powell (EM) Warren John r546 Log Cabin blvd WMarfeg HCeonryh45(2c; EMAabclaed)emmyillw(EkMr )Bibb Warren John (c) lab r345 Bookers al Warren John W (Ruby) millwkr Bibb Ware Herman (c) millwkr Bibb Mfg Co Mfg Co hl32 (419) Schell av (EM) r452 E Academy (EM) Ware Kate r2346 Forsyth rd Warren Johnnie M (c) maid rlOlO (1108) Main (EM) Ware Lawrence (c) millwkr Bibb Mfg Co r452 E Academy (EM) Ware Lizzie H (c) student r452 E Academy (EM) Ware Ruby B (c) tchr Green Street Sch r452 E Academy (EM) Ware Thos (Jessie) sta firemn h235 Washington av Ware Thos M (Lucille C) lieut Police h 785 Patterson (NHts) Warren Kasey C (c) porter rll7 Bostic la Warren Katie (c) lndrs r852 Foster's al Warren Luke R (Eleanor C) agt Natl L3 ife & Accdt Ins Co h479 Orange apt Warren Magnolia (c) maid rll5 (15) Alabama (SM) Warren Mamie (c) lab r205 Yates al (EM) Wra4r5e2UElysAsecsad(ecm) ymi(lElwMk)r Bibb Mfg Co Ware Virginia (c) maid r8 Clayton av (V) Warren Maudie M (c) h458 Hawthorne Warren Otis (c; Laura N) lab hl51 Hill Warren Reuben (Vickie) millwkr hl419 3d pn 5 ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT. EM. gr. YOUR CITY D I R E C T O R Y MIRRORS the Industrial LIFE Of Your CITY 376 PRINTING BINDING FREE STORAGE N N BMRoOdeArDn WaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. RUBBER STAMPS Warren Richd slsmn r479 Orange apt 3 Warren Sarah F (wid Andrew J) r313 Dannenbetrg av Warren Spencer (c; Evelyn) plstr hll7 Bostic la Warren Texas hll4% Grady (SM) Washington Geo (c; Martha) lab h375 Flanders (EM) Washington Gertrude (c) lndrs hll2 Ballard (EM) Washington Ida (c) cook rl04 4th av (B) it i THE BEST WORK CORRECT PRICES Warren Thos student r546 Log Cabin blvd Warren Thos N (Mary) elk U S PO h546 Log Cabin blvd. Warren Wm (Molly) rl61 Broadway Warren Wm (c) hlpr C of G Ry Warren Wm (c; Anna) lab h338 2d av (U) Warren Wm (c) porter B Jeff Champion r678 Dunlap la Warren Wm (c; Georgia) wtchmn h509 Fort Hill (SM) Warren Wm A (Thenie) mach Taylor Iron Wks & Sup Co r RD Warren Wm C (Mattie S) h436 Carling Wasden Chas N (Eugenia) phys 516 Mulberry R818 hll6 Buford pi Wasdin Jessie C (wid Wm F) h860 Mul- berry Wasdin Julia tchr P S r213 Bond apt B2 Wasdin Wilhelmina elk r860 Mulberry Wash Bertha Mrs rll58 Edgewood av WWaasshhiinnggttoonn JJaHcoabze(lc)(c)lablabrl5r1l05Fr3adnk(lUin) Washington Jas (c; Elconia) lab hl06 Johnson (SM) Washington Jas jr (c) student rl06 Johnson (SM) Washington Jennie (c) r810 Edgewood Washington Jessie (c) maid r311 Divi- sion (T) Washington John D (c; Gussie) emp C of G Ry h418 (218) Elizabeth (SM) Washington Kate (c) h902 Elbert (SM) Washington Leila (c) r305 Broad (EM) Washington Lessie (c) r810 Edgewood av Waalshington Lillie M (c) maid hl66 Coles Washington Louise (c) r311 Division (T) Washington Lula J r215 Telfair Washington Margt (c) cook h2ll Linden Washington Mary (c) hl51 Franklin Washington Mary (c) hill Linden av 406 Cherry St, MACON Where To Buy? Consult Wash Carl (c; Detress) lab h600 (601) Crisp (SM) Wash Essie M (c) r612 (706) Crisp (SM) Wash Maggie L (c) r600 (601) Crisp (SM) Wash Mary (c) h612 (706) Crisp (SM) Wash Willard (c) lab r612 (706) Crisp (SM) Washburn Abram C (Tillie H) fum rms 568 Walnut h do WASHBURN CHARLIE G (Annie), Pres Washburn Storage Co, h465 Orange, Tel 5677 Washburn Grady slsmn r715 Pine WASHBURN STORAGE CO, Charlie G Washburn Pres, Lloyd F McEachern V-Pres, Harrell W McEachern SecTreas, Storage of All Kinds, Pool Car Distribution, Local and Long Distance Hauling, 201 Poplar, Tel 5376 (For further information see front stencil and pages 30 and 33 Buyers Guide) Washington Alex (c; Mary C) lather r 20-8 Fletcher (U) Washington Alice (c) r810 Edgewood av Waalshington Alice (c) maid rl29 McKays Washington Annie (c) cook hl20 Jones Washington Annie (c) lndrs h505 (192) Lexington (EM) Washington Annie L (c) r915 Ash Washington Apartments 475-79 Orange Washington Avenue Presbyterian Church 221 Washington av Washington Avie (c) r810 Edgewood av Washington Booker T (c; Gertrude) lab hl45 Lincoln av (V) Washington Building 566 Mulberry Washington Caleb (c; Selemma) porter Washington Mattie (c )maid r921 Ocmulgee WASHINGTON MEMORIAL LIBRARY, Sally M Akin Librarian, 326 Washington av cor College, Tel 3376 Washington Memorial Library br 408 Main (EM) Washington Memorial Library (c; br) 554 New Wsaisohning(Tto)n Mozelle (c) maid r311 DiviWashington Park College at Washing- ton av Washington Patience (c) r502 (453) Ala- bama (SM) Washington Rosa (c) r220 Gilmer Washington Rosa (c) maid rl66 Coles al Washington Walter L (c) delmn Joseph Sagnibene r915 Ash Washington Wash (c; Letha) h271 Wil- lingham la (EM) Washington Wm (c) farmer r917 Clin- ton rd (EM) Washington Willie M (c) ironer r915 Ash Washington Woodrow (c) cook rl51 Franklin Wasner Geo elk r371 1st Wasner Mattie M (wid Sydney W) h209 Applewood (EM) Watch Shop The (Geo R Anderson) watch repr 156 Cotton av and 355 2d Waterman Frank B (Mary) r575 Ingle- side av Waters Clara (c) maid r651 Hazel Waters Clayton C (Ruth S) cond h615 Adams Wra6t1e5rs AEdMamerscer whsemn Gulf Oil Corp the Classified Ry Exp Agcy h915 Ash Washington Chas (c; Nannie) lab h705 (203) Colquitt Washington Council No 6 R&SM Chas R McCord recorder meets 2d and 4th Waters Ellis M sten r615 Adams Waters Emma (c) r923 Hazel Waters Eug (c; Mattie) rl63 (231) El- bert (SM) Waters H Marion (Tatnall Square Serv- Business Lists Fridays 8 p m 111 Cotton av Washington Curtis (c) lab h225 Calhoun Washington E L (c) hl216 Broad (EM) Washington Elconia (c) student rl06 Johnson (SM) ice Sta) r615 Adams Waters Harris (c) lab r452 Bay Waters Henry firemn r615 Adams Waters Jesse L bkpr Southeastern Opti- cal Co r718 Mulberry In This Directory Washington Emma (c) r9 (155) Bright al Washington Esau (c) porter rl51 Franklin Washington Ethel (c) rl05 Hazel Washington Fannie (c) r921 Ocmulgee Washington Fannie (wid Roy) slswn Burden Smith & Co h417 New Washington Geo (c) r705 (203) Colquitt Washington Geo (c) h rear 504 Log Cabin dr WWaatteerrss JJoohhnn ((cc;; LMizaag)gliaeb) hla4b03hC94o1lqPuiitot Nono av (V) Waters Lee (c) lab rll2 (107) Short (EM) Wa(Vte)rs Leroy (c) lab r941 Pio Nono av Waters Lillie (c) cook r206 (160) Peacock (SM) Waters Lucinda (c) lndrs r228 Jordans al (EM) 377 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 Waters Mose (Bertha) lab Taylor Iron Wks & Sup Co r342 Tindall av Waters Murray (c; Pearl) delmn W Edward Hamlin h542 E 2d (EM) Waters Oscar (c; Mattie) lab hl019 Pio Nono av (V) Waters Oswell (Mattie) millwkr Bibb Mfg Co hll4 Yates av (EM) Waters Phillip H (Jean) chf elk Swift's Ice Cream h864 Mulberry apt 5D Waters Pinky (c) h202 (160) Peacock (SM) Waters Sye (c; Alice) rl63 (231) Elbert (SM) Waters Thaddeus (c; Lucinda) lab Bibb Mfg Co h403 (23) Short (EM) WIagtgegrs Wm L (Emily) hl240 (1340) Col- Watkins Alonzo (c) porter r409 (727) Campbell av (SM) Watkins Barber Shop (Gordon L Wat- kins) 400 2d ,, . WPAoTliKceI,NCSitByEHNallT, T(eElth18e8l0,Bh)2, 1C5hHieefndo-f ley (NH), Tel 5578 Watkins Benj T jr student r215 Hendley (NHts) Watkins David (c) lab hi 18 Lawton la (V) Watkins Elliott (c; Willie M) lab hl20 Watson Albert P (Myrtle) pntr h3022 Houston av (SM) Watson Albert L (Corene) millwkr Bibb Mfg Co hl'6 (17) Brigham Watson Alberta (c) lndrs hl04 (164) Bartlet Watson Alice E r610 Elm Watson Allen (Jessie Mae) millwkr Bibb Mfg Co h21 Bibb av Watson Annie (c) cook r227 Dempsey av (U) Watson Annie (c) lndrs h9 5th av (V) Watson Annie L (wid Geo) h319 Duncan Watson Annie M (wid Paul L) treas T M Raines Gro Co Inc r821 Pio Nono av (V) Watson Annie R tchr Winship Sch r319 Duncan av Watson Arcleious dishwasher Wisxter.ia Cafe Watson Arth L (Mamie) h462 Church (EM) Watson Arzada (c) h216 (123) Plummer al Watson Bessie (c) maid r815 Daisy (SM) Watson Carl (c; Bessie) lab rl270 3d Watson Chas (c; Georgia) lab h7 Bears al Watson Clarence student r722 Mulberry Watson Cleon W substa opr Ga Power (780) Nussbaum (SM) Co Watkins Emma (c) lndrs r234 Jefferson Watkins Enice janitor WPA r515 E 2d (EM) Watson Clinton jr driver r866 Mulberry Watson Crowell W r763 Anderson (SM) Watson Curtis S waiter Thos H Watson Watkins Eug (c; Ivy) lab h724 (634) WPartkininces P(SraMn)ces (c) lndrs hl03 (124) r3141 Houston av (SM) Watson Danl W h610 Elm Watson Dora millwkr Bibb Mfg Co rl427 Simmons av 2d Watkins Geo R auto mech r760 New Watson Dorothy elk r247 High Watkins Georgia A (wid Thos F) h760 New Watson Dorothy A (wid John W) h763 Anderson (SM) Watkins Gladys T Mrs elk W Edw Ham- Watson Edwin (c; Annie) lab hl633 1st lin h448 NeW Watson Eliz tchr PS rl20' Coleman av Watkins Gordon L (Annie; Watkins (CH) Barber Shop) hl08 Ponce de Leon av Watson Eliz (wid Wm T) h460 Carling (SM) Watson Eliz M (wid Paul H) hl20 Cole- Watkins Henry (c) brklyr h262 4th av (V) Watkins Isaac B (c; Samantha) driver r 354 5th av (V) Watkins Isabel student r215 Hendley (N Hts) Wmatasonn aEvlri(cChH)sten Macon Chamber of Commerce rl20 Coleman av (CH) Watson Emma (c) cook r319 Dure (U) Watson Ernest W (c) student r309 Gor- don (CH) Watkins Jas (c) lab CofGaRy Watson Ernestine (c) rl206 3d Watkins Jas (c; Jessie) lab hl03 (502) Watson Evelyn fctywkr r402 Church Campbell av (SM) Watkins Jas (c; Mamie) lab hll2 Elm Watkins Jas (c; Lee B) lab hl5 Sparks al Watkins Jeff (c; Ella) lab h62 New Watkins John H (c; Hattie) loco firemn h409 (727) Campbell av (SM) Watkins John H (c; Maggie) porter Dunlap-Peeler Hdw Co r400 (461) Alabama (SM) Watkins Julia (c) cook r471 (462) Alabama (SM) Watkins Junior (c; Mary) lab h722 (632) Prince (SM) Watkins Lizzie (c) maid r227 Patterson (NHts) Watkins Mae W (c) cook 314 (334) Hill Crest av (CH) (EM) Watson Fannie (wid Gasxton) fcxtyw,kr Happ Bros Co rl22 Holt Watson Geo (c; Virginia) lab h947 Pio Nono av (V) Watson Geo A (Margt W) mgr Steve M Wright Drug Store r867 Mulberry Watson Geo w rl534 2d Watson Grady lab r610 Elm Watson Gussie T (Louise C) formn hl53 Williams (SM) Watson Helen E sten Freman Dent-Sul- livan Co r3022 Houston av (SM) Watson Henry E (Carrie) collr Day's Watson Henry M (Sarah) cond h812 Spring Watson Hiram A (Laura) emp CofGaRy hl9 (298) Grand av Watkins Mattie fctywkr Bapp Bros Co Watson Hubert C (Bertha C) emp Cof rl08 Whitehead (SM) GaRy h215 (53) Grand av Watkins Ola (c) lndrs r234 Jefferson Watson Hubert C (Annalu) filling sta Watkins Rebecca (c) maid r520 Monroe 801 Vineville av (V) h208 Ridge av (V) Watkins Renda (c) maid PS r262 4th av Watson Hugh A (Lucille) mech D H (V) Adams Motor Co h2904 Houston av Watkins Sallie fctywkr Happ Bros Co h (SM) 108 Whitehead (SM) Watson Ida elk rll7 Summit av (NH) Watkins Sherman (c) lab rl20 (780) Watson Irene (c) lndrs hl61 May av (U) Nussbaum (SM) Watson J Durward (Eliz D) sec-treas Watkins Thos M (Gladys) elk Chap- Dunlap Chevrolet Co hl07 Callaway man's Pharmacy h448 New (V) Watkins Wm (c) lab r227 Patterson (N Watson J F (Mattie) h350 Clinton (EM)i Hts) Watson J Lee (Minnie P) h617 Orange 25 Watson Agnes A Mrs bkpr Mercer Univ rll27 College dr Watson Jas (c; Anna B) h612 Hall (EM) Watson Jas (c) lab r815 Daisy (SM) SIGNATURE ONLY SAME DAY Macon Trailing & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 378 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES (,'JS Plymouth Watson Jas Rev (c; Lucy) h339 4th av (U) Watson John Stores r319 B (Eliz) Duncan satovre mgr Rogers Watson Jos O ship elk American Bake- ries Co rll7 Summitt av (NH) Watson Katie r763 Anderson (SM) Watson Laymon K appr CofGaRy Watson Leon student Ga Academy for the Blind r RD 1 Helena Watson Leon D (c; Jessie) shoe repr r9 5th av (V) Watson Lilia artist Capitol Art Studio rl22 Holt Watson Lillian r763 Anderson (SM) Watson Lonnie R (Vivian) slsmn Cen- tral Ga Baking Co rl240 (1340) Col- lege Watson Louis (c; Azilee) lab hl09 (500) Singleton's la Watson Louis D (c; Jeffie) lab crll2 5th av (V) WRatespoanirLSohuiosp)Dr9(c;5thMoadvern(Vis)tic Shoe Watson Lucy F (c) lndrs h430 (101) Wo- mack (EM) Watson Lureese A jr opr SBT&TCo r 3022 Houlston av (SM) Watson Martha E student r202 Coleman av (CH) Watson Martha W Mrs cash Penn Mut Life Ins Co h202 Coleman av (CH) Watson Wallis (Alma) slsmn rl07 Appleton av Watson Wallis jr slsmn rl07 Appleton av Watson Waltet (c; Nellie) lab hl208 3d Watson Walter C (Daisy) plant supt Heard Bros hl54 Parkwood av Watson Wm (c; Ida) lab h602 Ross Watson Wm C mach CofGaRy Watson Wm C (Annie) reprmn r252 1st Watson Wm D (Emily S) lab h420 Jack- son Watson Wm E (c; Modernistic Shoe Re- pair Shop) r9 5th av (V) WATSON WM H (Hannah T), Asst Sec and Director Macon Federal Savings & Loan Assn and Sec-Treas Macon Production Credit Assn, h227 Riverdale dr, Tel 3303 Watson Wm H jr student r227 Riverdale dr Watson Wm J (Katie C) millwkr hl543 1st Whatsdoon Wm T (Beulah) gro 304 Ell (SM) Watson Woodrow W millwkr Bibb Mfg Co r420 Jackson Watters Edw (c) r201 (213) Jones St la Watters Eliza (c) maid r201 (213) Jones S la Watters Howard (c) lab r201 (213) Jones St la Watson Mary (c) lndrs r5i29 Forsyth Watters Minnie (c) maid r201 (213) Watson Mary C Mrs r319 Johnson av Jones St la (HH) Watts Alma c Mrs slswn Darling Shop Watson Mary L r227 Riverdale dr Watson Mary L (wid Jos) r327 Dannen- berg av Watson Mattie B r866 Mulberry Watson Mattie J (wid Theo) boarding 866 Mulberry h do Watson Maude tchr PS r62 Arlington pi Wa(StsMon) Minnie (c) cook h815 Daisy Watson Nancy (c) r301 (302) Tindall av (SM) Watson Naomi (wid Sears B) rl58 Jeff Davis (SM) Watson Otho O phys 567 Walnut r Shir- ley Hills Watson Paul H (Mabel) mgr h207 Chero- kee av Watson Richd P (Eleanor) chf elk CofGa Ry h215 Corbin av (V) Watson Roger A (Martha W) ship elk Davun(lCapH-)Peeler Hdw Co h202 Coleman Watson Roy C driver City rl58 Jeff Davis rl07 Appleton ay Watts Arth B (Sallie) formn h224 W Grenada ter Watts Clifford (c; Hazel) lab r601 (575) Chappell (SM) Watts T C floormn W T Grant Co r860 Mulberry Watts Geo janitor Mercer Univ Watts Geo (c) lab rl208 Broadway Watts Hattie (c) * h528 Forsyth Watts Helen (c) cook r205 (302) Camp- bell av (SM) Watts Hugh (Eliz M) loco eng h816 Cherry Watts Irene W r314% Pio Nono av (V) Watts J Mote (Annie) mgr Central Ho- tel r do Watts Jas lab City Watts Jas student rl219 Oglethorpe Watts Jas I (Eliz) hl06 Forest av (B) Watts John r627 Main (EM) Watts John W (Minnie L) millwkr At- lantic Cotton Mill h314% Pio Nono av (SM) Watson S M Manufacturing Co (Albert T Bearden) harness mfrs 510 3d Watson Sallie (wid Joel T) r557 New Watson Sami (c; Annie) lab hl236 Broadway Watson Sara mgr Betty Maid Shop r866 Mulberry Watson Sarah (c) h335 Monroe Watson Sarah (c) maid 465 Douglas av Watts Radie Mrs hl30 Main (EM) Watts Robt B (Effie) millwkr Bibb Mfg Co hlll3 Napier av Watts Thos (c) lab hll3 (232) Kahn's al WCaottsrlW07CAjprpbleatkoenr American Bakeries Watts Wayland M (Bernice) trav slsmn h222 Hines ter (V) Watts Wm (c; Georgia) lab r601 (575) Chappell (SM) Watson Steph B (Florene) inspr h202 Ormond ter Watson Sussie (c) maid r542 3d av (V) Watson Terrell slsmn Dannenberg Co r 886 Mulberry Watts Wm T lab G Bernd Co rl30 Main (EM) Wlaexgeel1 baaputm Annie 2D (wid Gates) h401 Col- Waxelbaum Jos (Maude) h401 College 3pt 30 Watson Thos (c; Annie) lab hl02 (146) Waxelbaum Lewis I (Marian) mgr Lewis Eliz (SM) Pecan Co h554 College Watson Thos H (Bertha) restr 3141 Waxelbaum Marian student r554 College WHatosounstoTnhoasvJ ((EcM; )Maht3t1ie4lMd)odriver Ga Caroline Oil Co h533 Monroe Wayne Hugh W elk Crescent Lndry Co rl04 Wayne LLaomulaire1 (V) D rl04 Lamar (V) Watson Thos M (Flora) hl055 Walnut Watson Vanerette student r2904 Houston av (SM) Watson Vera V (wid Augustin jr) bkpr hllO (108) Hines ter (V) Watson Virginia student rllO Hines ter Weaks Hugh S (Mildred J) emp CofGa Ry h814 Hemlock WEATHER BUREAU (See United States Government) Weatherford Minnie Mrs h258 College Weatherford Myrtle tel opr Bibb Mfg Co r258 College 379 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement ~ Plaster 457 Third St. Phones 277-278-279 Weatherford Sami A (Theresa) slsmn Bankers Health & Life Ins Co h2oo WNeaetwherly Raymond J (Flora) slsmn h 656 Ridge av (V) Weathers Beulah (c) lndrs h470 Bay Weathers Fredk W (c; Bertha) lab h623 E Academy (EM) Weathers Grant (c) lab r702 Ash Weathers Mary F private sec WPA rll5 Callaway (V)' _ ,, Weathers May (c) lndrs h702 Center (EM) , Webb Hoyt E (Gerolyn; Webb's Place) hi23 Inverness av Webb Ida L Mrs r304 Carlmg.av WEBB J T JR (Mary S), Circulation Mgr The Macon Telegraph and Macon Evening News, r Shirley Hills, Tel 2827 Webb J T III (Dolores S) dept mgr Macon Teleg Pub Co r378 Orange Webb Jas ins agt r554 1st Webb Jas R jr student r648 Pio Nono av (V) Webb Jas R Rev (Lillian H) pastor Cherokee Heights Methodist Ch h648 Pio Weathersby Bertha (c) cook h866 WilWeaver Agnes B smstrs r240 Chestnut WEAVER ALEXANDER H S (Janie; Harris, Harris, Russell & Weaver), rl07 Cleveland av, Tel 1234 Weaver Anna prin Lanier High Sch h Webt? Jesse berry T (Dura) eleetn h869V2 Mul- Webb John C (c) mail porter Ry Exp Agcy r316 Patterson (NHts) Webb John P (Lena) wtchmn Central Sash & Door Co h440 Edgewood av 107 Cleveland av (V) Weaver Clara Mrs millwkr Bibb Mfg Co Wheal2v6er PCelaycdhetrWee ((HEaMtt)ie) mach CofGa Ry hl03 Beuna Vista dr Weaver Frances millwkr Bibb Mfg Co r 763 2d Weaver Fredk (c; Charity) lab h907 El- bert (SM) Weaver Herbert lino opr Macon Teleg Pub Co r530 College Weaver Howard A (Allie R) mail elk Ma- con Teleg Pub Co hl22 Emory av (SM) Weaver Hudnall G (Margt G) phys 700 Spring R230 h!20 Callaway (V) Webb1Julius (c; Henry D) lab hl06 May Webb Kath (c) janitor SBT&TCo r316 Patterson (NHts) Webb Katie (c) hl04 (133) Bay Webb Louise (c) maid r618 4th av (WH) Webb Lulu (c> cook rl025 (933) Montpe- lier 3v Webb McCullen (c; Mabel) barber Jas A Braswell h965 Pio Nono av (V) WeCboblleMgey1 rtle cash Milady Cleaners r258 Webb Pear Mrs emp Snow's Lndry & Drv Clng Co h305 (418) Elizabeth (SM) Webb Permelia (c) hl003 Pio Nono av Weaver J Curtis (Clara) student hl26 (V) Peachtree (EM) Weaver John N (Nettie M) slsmn L N Jordan h212 High Weaver Julia C student r702 Ridge av Webb Raymond (c) lab r501 (468) bama (SM) .. .. Webb Raymond (c; Gussie) lab ANNTlaaotf-ll Handle Co h8 (311) Hanson (SM) We(Vav) er Leroy (c; Hattie) lab h228 Sum- Webb Sarah L student r648 Pio Nono av mit Hill Weaver Louise opr SBT&TCo r212 High Weaver Mary home economist Ga Power Co Weaver May (wid Esmer) rlO Atlantic Village Weaver N Terrell (Lucile H) v-pres Bankers Health & Life Ins Co hi84 North av (NH) Weaver Olin H (Georgia) phys 700 Spring R230 h702 Ridge av (V) Weaver Philip (c; Effie) lab hl27 (207) Elliott (EM) Weaver Rosalea r850 Woolfolk (EM) Weaver Watson C (Rebecca) hl053 Wal- Webb Wm (c) r538 Grant Chapel al (S'M) Webb Wm B ,, (Rebecca) carp ,h305rn8 Tlniv Fair- view av _(EM) Webb Wilson H (c; Pearl) lab h305 (418) Elizabeth (SM) ,, ,, WCebobmeZr actekr R(PM(L) izzie) millwkr hl33 Webb's Place (Hoyt E Webb) beer 670 Cherry Webster Cora L (c) maid Hotel Ficklmg rl31 Franklin St la Webster Dam (c; Lessie L) h601 Gilmer Webster Herbert (c) lab r501 (401) Gantt nut Weaver Wm M jr (Edith) purch agt h204 Albermarle pi WWeeaavveerr WWimlliWs W(LRaeuvra()c;rlC3l4eoS)tehell2e0(TSMat)- nall Webb Ada (c) maid r354 5th av (V) Webb Ada L (c) hl025 (933) Montpelier Webb Alf (c) student r316 Patterson (N Hts) Webb Annie (c) laundress rl6 Fulton al Webb Bernard A (Kathleen E) coal h 310 Overlook av Wdbster^Isaiah (c) lab r501 (401) Gantt City rd (SM) Webster Jas (c) r50l (401) Gantt City rd (SM) , , . /cm-, Webster Mary (c) lndrs h308 (601) Prince (SM) Webster Percy G elk R C Cropper Co r Bloomfield rd . , Webster Robt (c; Fannie) porter hi04 (228) Hendrix al Webster Robt L elk Wm Burnett hl20 Chappell (SM) Webb Bernard A jr r310 Overlook av Webb Calvin (c; Hattie) lab h316 Patter- son (NHts) Webb Chas (c) elk Chas Mathis rl24 Rockhili la Webb Corinne (c) lndrs r207 (252) Prince (SM) Webb Daisy (c) cook rl025 (933) Mont- pelier av Webster Sarah L (wid John F) h910 Oglethorpe Weeks Edna r25 Bellevue rd Weeks Johnn'ie S appr CofGaRy Weeks Kath (c) maid rl76 College Weeks Ned (c) lab rl04 (4) Frank al Weeks Newton S appr CofGaRy Weeks Susie (wid Chas H) r25 Bellevue rd Webb Edw L (c; Isabella) r965 Ogle- Weems Arbie E (Ellen) mgr Capitol Ho- WtehbobrpEemily J (c) h519 Monroe tel r do ,, ,, , , Weems Geo W (Nell) embalmer Central Webb Ethel Mrs smstrs r601 Plum City Funeral Home r530 Cotton av Webb Fleta Mrs waiter r220 1st Weems Jas C (Sallie C; Four Point Gro- Webb Hattie L (c) maid r316 Patterson (NHts) Webb Herman (c; Carrie) lab hlOl Empire av (V) cery) h268 Maple Wehrcamp Edw r561 Boulevard (NH) Wehrcamp Paul A (Margt) 561 Boulevard (NH) driv1 er City h Linen Service DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on Pile in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for yonr conven- ience If yon want information yon are nnable to procure elsewhere, call on ns R. L. POLK & CO. DETROIT 380 HUTCHINGS' FUNERAL HOME "Hutching** Service" 518 New St. Phone 2044 Weilbaker Vernon (Lola B) driver Southland Barber Supply rlSll 3d Weinberg Louis (Janie) gro (515) (497) Hall (EM) h do Weinberg Mary J (wid John L; Pleasant Hill Cash Market) rl02 Capital av Weinstein Max (Reba; Globe Dress ,, Shop) hl35 Rose Park Wellons Shelley E jr (Lillian O) slsmn L B Price Mercantile Co h356 New apt 6 Wells Alice (wid Edw; Edwell's Trick & Novelty Co) hl04 Magnolia Wells Celestine (c) Indrs h207 2d (U) Wells Cora (c) indrs hl06 (505) Camp- bell av (SM) WWeeiirnsCtehianptMerilNdroed1 OstruddeerndterMl3o5laRyomseelptks Wells Danl (Marie) lab r910 Clinton rd (EM) 710 Mulberry Weir see also Ware Wells Emira rl06 Forest av (B) Wells Harriett ofc sec Macon Commun- WSepirrinCgynthia A (wid Marshall) h318 Weir Cynthia Park Plorine Raney supvr ity Chest rll9 Stanislaus cir Wells Harry E (Susie J) fctywkr hl34 Stratton (SM) Edgewood av sw cor 2d Wells Holt S (Jewel T) auto mech r461 Weir David R elk Dunlap Chevrolet Co WreirPaJrakckpi (aDpotnn3ilee) mech Dunlap New Wells Jos C car repr CofGaRy Wells Lottie (c) maid r204 Lynwood av Chevrolet Co r917 New apt 3 WdeiisrhMamrseheatsH 7A10CoMunuclbileKrrynights of KaWeir Marshall A Lodge No 448 F & A M meets 710 Mulberry Wpirap?3a t6ller SBT&TCo hl5 Park Wells M Mildred sten J LaFayette Davis r RD 6 Wells Mary (c) Indrs rl02 (302) Plummers al Wells Mary student Ethel B Davis Beauty Shop r RD 6 Weisiger Constance (wid Wm P) r317 Wells Osie (c; Phenie) lab h505 Fort Hill Forsyth (EM) Weiss Frank E (Lois M) mach hlOl (370) oa av (SM) Weiss Lathan O (Ruby) hl078 Walnut Wells Ralph E elk Karsten & Denson Co WIenllcs RrobRtD(c)4 lab r807 Dempsey av (U) r800 pOanraenlgsee ofc sec Dure & Beeks Co Weisz Genevieve tchr PS r800 Orange Weisz Jas G mus tchr 800 Orange h do Wells Thos (c) brklyr r207 2d (U) Wells Thos S mach CofGaRy Wells Wm D (Viola V) dentist 150 Cot- ton av R301 hl06 2d Weisz Mamie orange bkpr Macon Shoe Co r800 WeUs WiHie (c) lab r527 Academy av (EM) Welborn Ruby Mrs millwkr Willingham ,WtlCCelchint0A6;Pb7,,bMPieolIpMJlarrsr54beHauotlitciaanv D(NanHntesn)berg Wells Worth ck US PO r RD 6 Werden WR&Co Chas E Whalen mr whol gros 244 5th Wesley Addie (c) maid The Eleanor Shop r249 5th av (V) WBroadwayeS M Auustus) h2627 Wesley Annie (c) Indrs rl32 (245) Railroad av (V) WComef1tereW(PM)(Veria) millwkr h122 Welch^lyde E (Marguerite) r207 Wash- Wesley Arth (Sabina) barber h808 Hazel Wesley Eva (wid Robt M) h201 Burton Wr787 Poplar^ (Abbie) mach CofGaRy Wesley Jas (Josephine R) lab hl016 Oglethorpe Welch Earl M (Clifford W) rill (110) Wesley John (c; Lillie M) rl00 May av Pmeview av fas (Magdalena) plmbr r758 2d H J?A,T (Martha) pntr hl70 Macon Comer te? (PM) 6D "illWkr h141 Wesley Jordon W (c; Mattie) fire knocker CofGaRy hl02 Johnson (SM) Wesley Josie (c) Indrs h Lawton av (B) Wesley Lucy tchr r201 Burton av WWeMlchWeJlochhnnr2MJ138E(2Adnanni)e)shsthmtmtlw tlwkrkrJo4h1n1 Cotton av h2138 2d Wesley Mabel (c) rl27 Woodcliff Wesley Mildred Mrs opr SBT&TCo h 217 Hardeman av Wesley Moses (c; Dollie) lab r249' 5th av Welch Jir0ls !c> smstrs h603 3d av (V) Wejch Mja$rglte (c()Fcdook r603 3d av (V) F) h2210 2d rWl_rel(Pchi1PiMJleihlttonCoBrl3e8lkViMrgciCnilauraev Office (U) Wesley Pascal lab r808 Hazel Wesley Romeo (c; Mabel) lab Ihl27 Woodcliff Wesley Sarah (c) cook h254 5th av (V) Wesiey Wm (c; Annie) lab hl32 (245) W(EM)Pearl (C) lndrS h302'303 Pyrnett Welch Sami S (Etta) lab r914 Orange WResalielyroWadm aMv (c(V) h) 306 (307) Short (EM) WESLEYAN COLLEGE, Dice R Ander- Elltott (EM) (C: Anni6) lab h123 (212) Welfare Workers Cottage The Clara M Hayes casewkr in chge 69 Davis (PM) Wellons Augustus R lumbus h339 do (Sada) gro 280 Cuo- Wellons Augustus lumbus 1 R jr student r339 Co- WTelCloonsh5C2o0linLiEnde(Cnoraav) installer SBT& Webpns John L millwkr Bibb Mfg Co r 328 Columbus W WelJlonnss Jos B (Meura) cond Kenneth B (Blannie h657 Pine J) barber 1917 Vineville av (V) h Old Thomaston ra WteellloDnsemSphseellyeyBEarb(LerouSihseopP)h3b2a8rbCeorluHmo-- bus son Pres-Treas, Leon P Smith Dean, Joe B Hill Bursar, "The World's Oldest Chartered College for Women," Forsyth rd at Wesleyan Station, Rivoli, Ga, Tel 6371 (For further information see opposite inside front cover) WseosnleyparnesCo45n1serCvoaltloegrye Dice R AnderWesleyan Pharmacy (Prank H jr and John E Wadley jr) Forsyth rd Wesson Arnold D fctywkr rl9 Bellevue rd Wesson Frank fctywkr rl9 Bellevue rd Wesson Jas W (Lillie) fctywkr hl9 Bellevu rd Wesson Marie fctywkr rl9 Bellevue rd WWeessstonAlMicearisotundfecntyt wr5k5r3rlO9 rBaneglleevue rd West Allen emp CofGaRy 381 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 West Anna B (wid Thos) h446 Washington av West Anna L Mrs slswn r811 Poplar apt W1e2st Annie (c) student r926 Pio Nono av (V) West Anna M private sec Walter A Har- ris r504 Washington av West Cath r462 Oak West Cottrell (c) driver h265 Walnut West DeWeese rl04 Mill av West Edw W (Eliz) crane opr CofGaRy hll3 Willingham (EM) West Ella (c) maid h5 5th av (V) West Emory (Vola) elk hl04 Mill av West Essie (c) cook r926 Pio Nono av (V) West Estella (c) maid r231 (110) Hurley la West Frank B (Ruth T) property mgr h 504 Washington av West Frank B jr civil eng City Engineer r504 Washington av West Fred (c; Rosa) h200 Coles al West Geo (Annie) furn repr h247 Win- ship (WH) West Gertrude (c) r305 Gilmer West Gussie (c) maid h586 Monroe West Jackson L (Annie W) slsmn Ga Roofing & Sup Co h380 Jasamine av (WH) West Jas E (Mary C) formn CofGaRy h 112 Dixie av (SM) West Jas P (c; Rosa) lab r267 Woodcliff West Jean Mrs r533 Orange apt 23 West John E (Mervin J) elk h713 MontWpeestlieJor hanv T (Anna L) supvr h8U Poplar apt 12 West John W (Marion) slsmn Met Life Ins Co rl08 Cleveland av West Jos W associate Turpin & Lain r 504 Washington av West Kat'h smstrs Happ Bros Co r533 Orange apt 23 West Luther (Lula) loco eng r303 (301) Cutler's Green (EM) West Mary (c) lndrs hlOl Opera House al West Mary (c) maid h230 Madison West Mary S (wid Wm) hl34 Winship (WH) West Myrtle fctywkr Happ Bros Co r718 Hemlock West N Beatrice rll3 Willingham (EM) West Norman V (Lillian) cotton buyer Atlantic Cotton Mills h760 Hillyer av (CH) West Preston (c; Louise) lab h281 1st av (V) West Reno (c; Eva) porter Clark & Jordan hl91. Lincoln av (V) West Robt asst embalmer Central City Funeral Home r530 Cotton av West Robt (c) driver rl56 4th av (V) West Sami pntr Stroberg Body & Fender Wks r718 Hemlock West Thos (c) lab CofGaRy West Utah (wid Paul) smstrs r559 Oglethorpe West Vivian tchr PS h55:3 Orange West Waldo r660 Plum West Walter (Evelyn) mech Ga Power Co r207 Appleton av West Walter G (Lucile) hl05 Log Cabin way West Wash r213 (112) Cutter's la (EM) West Wm M lawyer 566 Mulberry R8 r Millsr Field West Woodfin G mach CofGaRy West Zon (c) loco firemn rl315 Broadway Westbrook Art'h V (Gladys) steelwkr Taylor Iron Wks & Sup Co hl07 Ponce de Leon av (SM) Westbrook Charlotte student rl07 Ponce de Leon av (SM) Westbrook J Robt (Lessie) blrmkr h3030 Houston av (SM) Westbrook Jas (c; Matilda) lab h30S (441) Alabama (SM) W3e0s4tb1roHookuVstioonla aMv (w(SiMd )Thaddeus W) h Westbrook Wm L (Margt) div supt Ga Power Co hlOO Ingleside av Westcott Ludie r341 Calhoun Wester Emma (wid John) r722 Pine Wester Mary A student r722 Pine Wester Roscoe driver h722 Pine Wester Wm chem r722 Pine Western Railway of Alabama Robt F Wynne div frt agt 403 Cherry R605 WESTERN UNION TELEGRAPH CO, L Roy Dublin Mgr, Main Office 455 Cherry, Branches Terminal Station and 244 Main (EM), Tels Call Western Union Whalen Chas E (Lillian C) mgr W R Werden & Co h425 New Whalen Lillian C Mrs opr SBT&TCo r 425 New Whalen Sallie E Mrs h342 Hydrolia (E M) Whalen Thos W asst eng Fire Dept r342 WHhayldeyrolCialau(dEeML) pres Ouzts-Mitchell & Whaley Inc h370 College Whaley Effie (wid Chas P) r913 2d Whaley Harvey N (Lillian M) mgr Capitol Theatre h213 Bond apt A Whaley Juanita waiter Wisteria Cafe r 905 Cherry Whaley Kath r370 College Whaley Loretta r208 Peachtree (EM) Whaley Martha Mrs smstrs rl46 Concord (SM) Whaley Odessa rl46 Concord (SM) Whaley Oscar (c) lab CofGaRy h509 E Academy (EM) Whaley Wm (c) lab r210 North (V) Whatley Clara lab rl23 Yates av (EM) Whatley O Floyd (Ida S) wood dir hi 38 Tenney av (SM) Whatley Mildred rl46 Concord (SM) Whatly C J firemn MD&SRR Wheaten Chas (Virgil) elk r309 Center (EM) Wheatley School (c) Anthony rd (SM) Wheaton Beatrice (c) maid rll6 (533) WOhecamtounlgeBeerltaha G (wid Sami A) hl35 Academy Wrhl3ea5toAncCadleemmmyie slswn S H Kress & Co Wheaton Wilmot D (Tupsie) pntr hl25 Academy Wheeler Albert W (Reva) driver City h 227 Washington av Wheeler Cath (wid Jas W) hlOl (98) Oakland av Wheeler Chas A (Norma) cash Swift & Co h761 Pine Wheeler Chas H student rll3 Heard (SM) Wheeler Chester A (c) lab R C Cropper Co h204 (225) Bowman (EM) Wheeler Chester A (c; Lillie) lab h80 (133) Forest av (V) Wheeler Clarence W (Hattie M) millwkr Bibb Mfg Co r654 Elm Wheeler Clyde M (Ruth G) slsmn hll2 Rogers av (V) Wheeler Doris (c) r517 Calhoun Wheeler Egbert S (Bessie) firemn hll3 WHheeealredr E(lSizM()wid Henry J) ir711 Orange Wheeler Ellis A (Agnes) lab r361 Church (EM) Wheeler Euba rll3 Heard (SM) Wheeler Eunice (c) maid r869 Ocmulgee Wheeler Francis E student rll3 Heard (SM) Wheeler Francis W D student r301 Hines ter (V) Wheeler Geo A tchr Lanier High Sch for Boys r525 Mulberry Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? IS Answered Ely the Classified Business Lists In this Directory 382 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Wheeler Geraldine D (wid Chas A) r 301 Hines ter (V) Wheeler Gladys (c) maid r732 (642) Prince (SM) Wheeler Hattie (c) maid r247 5th av (V) Wheeler Henry H rll3 Heard (SM) Wheeler Jas (c; Prances) lab rll5 (149) Hudson Wheeler Jas T rll9 Yates av (EM) Wheeler Jas W (Anna) carp hl03 (10o) Oakland av Wheeler Jessie (c) rl21 (120) Orchard Wheeler John R (Lottie) auto mech hlOl Mill av Wheeler Jos (c; Emma) h404 (726) Campbell av (SM) Wheeler Wheeler Julia Julia Lnu(rcs)em71a1idOlhr5a2n8ge(6)h do Grant Chapel al (SM) Wheeler Luther (c) lab CofGaRy Wheeler Marion A (Annie M) asst mgr Gulf Refining Co h750 2d Wheeler Martha J student rll3 Heard (SM) Wheeler Mary emp Snow's Lndry & Dry Clng Co Wheeler Mary J (c) maid r216 (123) Plummers al Wheeler Rachael (c) r204 (225) Bowman (EM) Wheeler Rebecca Mrs wrapper Atkins Bakery r206 1st Wheeler Richd (c) lab rlOO Peacock (SM) Wheeler Robt P atndt Shell Petroleum Corp r301 Hines ter (V) Wheeler Roberta (c) student r204 (225) Bowman (EM) Wheeler Sidney J (Ruth) lab h361 Church (EM) Wheeler Thos (Rebecca) driver r206 1st Wheeler Walter D (Lois) h212 Albemarle WPhieeler Wm (c; Annie) lab h517 Cal- houn Whelcher Sami (c; Eva) lab h863 Oc- mulgee Whidby Ellison L (Vertie L) millwkr Willingham Cotton Mill h317 Vine (N Hts) Whidby Finney (c) fireknocker CofGa WRhiydby Thos (c; Ethel) hl26 Jordan (EM) Whiddon Mary A (wid Jared) h824 Curd (SM) Whigham Julius (c; Lillie) driver h214 North (V) Whigham Lila r720 1st Whigham Luther (c; Pearl) dairywkr Dixie Dairies hll9 (123) Sycamore (V) Whigham Mamie (c) maid Bibb Mfg Co r214 North (V) Whigham Murdock B paymstr rl29 Cleveland av (P) Whigham Pearl lndrs Ga Academy for the Blind rll9 (123) Sycamore (V) Whigham Will (c) hlpr CofGaRy Whigham Wm (c; Genevieve) lab h201 (204) Alabama (SM) Whigham Wm (c) r302 North (V) Whipper Chas (c; Jessie) lab h601 (213) Charles (SM) Whipple Ada (c) maid r rear 117 Park pi Whipple Edw student r371 1st Whipple Everett (Thelma S) driver h 720 Plum Whipple Harvey (c) elk Chas Mathis r 341 Madison Whipple Jas (c; Dennie) porter R S Thorpe & Sons h257 Middle (V) Whipple Jos D (c) lab City Whippier Wm (c) lab rlOO 5th av (U) Whipples Chas (c; Maud) lab h206 Kitchens Whipples Leila (c) lndrs h204 Kitchens Whisby John (c; Margt) lab r538 E 2d (EM) Whisby Mamie (c) r452 Clinton (EM) Whisby Tamie (c) r201 Gantt City rd (SM) Whisby Wm (c) lab Willingham Sash & Dooir Co plant r452 Shoals al (EM) Whitaker Annie (c) h435 Elbert (SM) Whitaker Bennett (Martha) slsmn Car- staphen r874 1st Whitaker Cecil P (Mary W) mgr New York Life Ins Co hl31 Rogers av (V) Whitaker Cornelia (c) lndrs hl68 Astor (EM) Whitaker Dollie B (wid Geo) hl777 3d Whitaker Ella (wid Jacob B) r25 Mel- rose (B) Whitaker Emily student r523 Ash Whitaker Felton A (Ethel) lieut col Ga Natl Guard rl310 Vineville av Wrhl2it9akBerevGereloy pHi traffc mgr MD&SRR Whitaker John (c) r441 Peters al (EM) Whitaker Reuben (Pearl O) carp h523 Ash Whitaker Wm (c; Margt) lab h441 Peters al (EM) Whitby Finney (c; Malissa) h220 Lee (EM) Whitby Iola elev opr Hotel Macon r220 Lee (EM) Whitby John (c) r22Q Lee (EM) Whitby Lucille (c) cook r205 Cedar (U) Whitby Matilda (c) h205 Cedar (U) Whitby Mollie (c) lndrs h501 (468) Ala- bama (SM) Whitby Nathaniel (c; Ethel T) porter Idle Hour Nurseries h222 Thomas (EM) Whitby Oscar (c) r220 Lee (EM) Whitby Robt (c) lab r205 Cedar (U) Whitby Virgil (c) maid r205 Cedar (U) Whitby Wade H (c; Ada) hl06 Chestney (EM) Whitcomb Chas elk Bernard H Meeks r 102 Log Cabin av (LCHts) Whitcomb Eunice I elk Bernard H Meeks rl02 Log Cabin av (LCHts) Whitcomb Jack companion r421 Not- tingham dr (NH) Whitcomb Susie slswn Dannenberg Co r 468 Walnut White A Wilson (Madison) director The Chiropractic Health Home chiroprac- tor 501 College h do WWhhiittee Allie Mrs rl02 Almira cash F Pursley (V) W Woolworth Co W1(h*S1i1Mt5e' )ARnodsreewPaJrk(Allie E) lab hi 17 Daley "White Anna sten r232 Georgia av White Annie Mrs r64 Roff Home av (V) White Annie (c) cook r217 Jefferson White Annie (c) maid r713 Ash White Arth (c; Laura) h404 E 1st (EM) White Arth (c; Ola M) hl05 E Ell White Arth (c) lab CofGaRy "White Arth (c; Annie) lab h312 Cedar (U) "White Beatrice r561 Boulevard (NH) White Bert (Willie) lab r753 Plum White Bridgett (wid Michl J) h559 Boulevard (NH) White Burney (c) lab h233 Collins pi White C O batterymn Jack Mann Bat- tery Co r318 New "White Camilla (c) r263 4th av (V) White Cath (c) hl58 Guernsey la White Cath (c) maid rl315 Broadway "White Chas (c; Lena B) driver h9 Rose la White Chas (c) hlpr CofGaRy White Chas A (Josephine) collir L B Price Mercantile Co rl49 Laurel av (NH) "White Chas J interviewer rl06 Alabama av (V) White Cherry (c) r74 Oliver av White Clayton (Gladys) printer r60 2d White Cleveland (Lillian) cond h2301 2d White David (c) Emma) pdlr hl33 Holmes av (V) 383 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 White Easter (c) lndrs h263 4th av (V) White Eastwell lab MD&SRR r517 E 2d (EM) White Eddie (c) pntr hl6 Harris al WEhiltiezabEelltihs ((Sc;M)Mattie) lab h405 (332) White Emma Z (wid Jefferson E) r202 Coleman av (CH) WChoitehE60r6nes(t6)(c;GJiulmliear) lab Natl Handle White Ernest R (Clemmie B) h616 Broad (EM) White Eug student rl55 2d WBhritoes ECvao Lh6(2w3id OJoghlenthTo)rpmeillwkr Happ White Fannie (wid Frank) lab h307 (306) Flanders (EM) White Florrie C Mrs supt of infirmary Wesleyan Coll White Freeman lab MD&SRR r517 E 2d (EM) White Geo r326 Maple White Geo (c; Bertha) lab h9 Harris Row White Geo (c; Ethel) porter hl49 Hill White' Geo (c) student r227 Moughan (V) WChioteurtGeho864F M(MulabreyrryG)apetlk4AU S Dist WRhietaedy-GTloa-dWysearMrr6s0 s2lsdwn Snyder's White Grace M (c) tchr Hudson Indus- trial Sch h383 Madison White Guy M whol radios 654 Mulberry r652 Mulberry White Hallie (c) r602 2d av (V) apt 2 WhiJt)e Harvey (c; Alice) lab r211 1st av White Hattie (c) lndrs h77 Ernest (CH) White Hattie (c) lndrs h612 Washington av White Hattie Mrs librarian S B Price Free Library h2523 2d White Hattie Mrs tel opr r771 Spring White Helen Mrs r715 Forsyth White Henrietta (c) maid PS rl38 2d (V) White Hilda M pkr Southland Coffee Co r378 Orange WJhaisteamHinilel Aav co(WllrH)Kaybee Store r380 White Hubert (c) lab rllO Roff Home av (V) White Ida B (c) cook rl53 Middle (V) White Idelle (c) cook r555 Monroe White Irene (wid A F) h401 College apt 3F White Isaac (c; Julia) lab h218 Jordans al (SM) White Jackson (c; Mary) lab hl27 (153) DeBorde (SM) White Jas (c; Josephine) lab City Engi- neer h807 Elm White Jas (c; Kinney) lab h75 Forest av (V) White Jas B (M Helen) slsmn Fried- man's Jewelers h438 Duncan av White Jas M carp h292 Cedar (SM) Wlheigtee Jas W (Ann M) slsmn hl444 ColWhite Janie Mrs emp Snow's Lndry & Dry Clng Co r504 (603) Henrietta (SM) WChioteh3J6o3hnM(aMplaeggie) lab Natl Handle White John (c; Emma) lab r441 (466) Tindall av (SM) White John B asst mgr Life Ins Co of Va 617 Mulberry R508-10 Wh(Vit)e John D (c) elev opr rl53 Middle White John T (College) janitor hl76 College White Jos (c; Ruby) lab hl37 Davis (U) White Jos C (c; Mary) loco firemn h221 Morgan av (WH) White Jos M (Lucille) barber Dannen- berg Co h911 Orange Whhli0te3. JCosolNem(aMnarayv A()CeHlk) Bibb Mfg Co White Julia (c) cook h455 Hazel White Julia (c) cook rl33 (202) Railroad av (V) White Kate (wid Wm R) r568 1st White Kayto (c) rl38 (135) Phillips la (EM) White Lake Mrs office Meaders Mat- tress Co r425 Arch WChioterlL0a3vePrnieedmWonetlkavBurden Smith & White Lester (c) lab rl20 (552) Magnolia la White Lester A (Eva) carp h425 Arch White Letha (c) cook hl38 (135) Phillips Wlhaite(EMLe)wis (c) custodian US PO r303 P&ttGrson White Lillian (c) maid rl24 Walker la White Lillie (c) prsr Snow's Lndry & Dry Clng Co r227 Moughan (V) White Louis (c) janitor h303 Patterson (NHts) White Louise (c) cook rl Woodcliff White Louise (c) maid r200 Northwest Boundary White Lucius (c; Sarah) driver B F Merritt Coal Co h307 (304) Tindall av (SM) White Lucius H (c; Minnie) lab h602 3d av apt 2 (V) White Lula (wid Earle L) rl20 Florence av (SM) WBhietaeuLtyydSihaoMp rMl5r5s 2indstr Ethel B Davis White Mabel Memorial Baptist Church 2634 2d White Madison Mrs dietitian Chiropractic Health Home h501 College White Maggie (c) h324 Ward (V) White Mamie (c) cook rll5 (19) Wise av (V) W9h1i1te OMraannguee1l W stockmn Noland Co r White Marie (c) maid rl528 1st White Marvin student r2301 2d White Mary (c) r236 1st av (V) White Mary (c) ironer r901 Ash White Mary L (c) hl53 Middle (V) White Matilda (c) lndrs r209 (366) Railroad av (V) White Miller G (Allie) chf radio opr Police hl36 Hines ter (V) White Minnie (c) hairdrsr h.602 3d av apt 1 (V) White Monroe (c; Fannie) hlpr h332 2d av (Y) White Nettie r623 Main (EM) White Ohgerreter (c) h226 Telfair White Oliver (c) lab r207 Collins pi White Paul C (Martha) asst supt Bankers Health & Life Ins Co h225 North av (NH) White Pauline (wid Benj) fctywkr Happ Bros Co hl37 Park pi White Pearl (c) hill (69) Fulton al White Perry (c; Nicie) h458 Bay White Richd student rl37 Park pi White Robt (c; Mary) emp CofGaRy hi Woodcliff White Robt tester rl55 2d White Robt L (Minnie) h328 American blvd White Roberta Oc) maid r26 Buckner al White Roland E (Mamie V) agt Life Ins Co of Va hl03 Piedmont av White Roselyn E student rl03 Piedmont White Roswell P elk WUTelCo rll5 Rose Park White Roswell R (Mattie L) hll5 Rose WPhaitrek Rufus (c; Evelyn) lab h923 Pio Nono av (V) White Sallie (c) lndrs h243 Woodcliff White Sami L (Mattie L) elk rl21 Plant (SM) Macon Federal Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 384 00 COMMUNITY SAVINGS LOAN CO. S' 201 COTTON AVE. LOANS TEL, 6130 u ,8 d **1 < K I *oV u Q 2 < bo " .5 < <> o 2 -JG aoi White Taz P cook Wm H Hathaway r352 Clinton (EM) White Thos (c; Lula) hl050 Pio Nono av (V) White Trella (c) cook r202 (220) Fargason White Virginia r401 College apt 3F White Walter (c; Annie M) janitor Bilt- more Apts White Walter (c; Janie) lab r504 (603) WHhietenrWietmta ((cS; MM) attie) r9 (155) Bright al White Wm (c; Hattie) hl7 (135) Mal- loy's al White Wm (c) cook h551 4th av (V) White Wm j tchr rl03 Coleman av (CH) White Willie M (c) h517 E 2d (EM) White Woods W student r715 Forsyth Whited Agnes waiter r771 New Whited Julian waiter Benj F Lyles r771 New Whited Lois W Mrs sandwichmkr r771 New 'Whited Sally (wid C Walter) h771 New Whitehead Annie (c) lndrs h923 Hazel Whitehead Annie L (c) tchr Hudson Industrial Sch cr25'6 Middle (V) WGhiatRehyeahdl2A10nthWonoyolf(ocl;k E(sEsiMe)) emp Cof Whitehead Chas F (Mildred E) millwkr Willingham Cotton Mill r7 Randolph Wphlitehead Clara (c) maid r478 Log Cabin dr WbhiintegheHaodusDeoll (c) smstrs Dixie JobWhitehead Ed Tire Service Station (Edw 'S Whitehead) 600 New Whitehead Edw S (Sara W; Ed White- head Tire Service Sta) h309 Buford pl Wchaitnehaevad Eug (c; Irene) lab rl30 PeWhitehead Eunice T r9Q6 Orange Whitehead Eva (c) maid r772 Moore al Whitehead Guy T (Kathleen) civ eng hl204 Ridge av Whitehead Henry h906 Orange Whitehead Henry L (Sue) slsmn hl32 Buford pl Whitehead J- Berrien (Stella) slsmn Yates & Tabor Co hl04 Corbin av (V) Whitehead J Berrien jr teller First Natl Bank & Trust Co rl04 Corbin av (V) Whitehurst Burdick jr rll5 Grady (SM) Wwheitlel hhulr5s3t 0BuBrkroeaGdwealyk Andrew F CrisWhitehurst Eloise rl530 Broadway W1hsittehurst Eugenia J (wid Jas E) h258 Whitehurst Evelyn slswn rl44 Magnolia Whitehurst Wm M (Sarah) elec eng h313 Buford pl (V) Wh(EitMem) ore Carrie (c) r233 (124) Elliott Whitemore Ophelia (c) lndrs rl09 (205) Elliott (EM) Whitener Ellen office sec Dr C L Ander- son r261 Georgia av apt C2 Whitener Hazel dental asst C A Yar- brough r261 Georgia av apt C2 Whitfield Agnes (c) student rl22 Wise av (V) Whitfield Benj (c) lab r217 Calhoun Wlhaitfield Clara (c) maid rl27 Bartlett's Whitfield Emma (c) lndrs h314 (320) Monroe Whitfield Jack (Mary C) janitor SBT&T Co r217 Calhoun Whitfield Mack (c) porter Boston Leather Co r256 2d av (V) Whitfield Mary F (c) maid r314 (320) Monroe Whitfield Mitchell (c; Minnie) carp h.256 2d av (V) Whitfield Mitchell jr (c) shoe shiner Philadelphia Hat Clng Co r256 2d av (V) Whitfield Richd jr (c) auto mech rl22 Wise av (V) Whitfield Richd (c; Amy) lab hl22 Wise av (V) Whitfield Richd lab r500 Edgewood av (SM) Whitfield Sallie (c) rl32 Pecan al Whitfield Tyree (c) shoe shiner O K Shoe Shop Whitfield Wm H (Ann) atndt Jerome P Kennington h452 College apt 1 Whiting Geo (Jennie M) wtchmn h205 Leg Cabin dr Whiting Jerry (c; Addie) lab h304 3d av (U) Whiting Linconie (c) r900 Cowan (EM) Whiting Wallace L dist mgr Southeastern Greyhound Lines r Central Hotel 2 Q T3 -1-1 3 *h -jC +O-O1 05) 2) .3. 3 2 3 O S (3C<0O0 fi 3 3 -0oo P bo 3 C2Q -rl tS Tcct>i & Whitehead J T tmkpr WPA Whitehead Jas (c) ydmn r rear 3012 For- syth rd Whitehead Jaunita (c) lab r224 1223) Elliott (EM) Whitehead John H (May) mach hlOl Grenada ter Whitehead John H jr student rlOl Gren- ada ter Whitehead Julius (c) lab r99 Thomas (EM) Whitehead LaVitta rlOl Grenada ter Whitehead Louise '(e) maid r923 Hazel Whitehead Mamie J mgr Charis of Macon h253 New Whitehead Mary (c) tchr r256 Middle (V) ^WWhiitnemhegahdamOsCcaorttoJn (MMiyllrtrlel3) m(6i9l)l Mwkilrl Whitehead Roy C (Iva) millwkr hl55 Comer ter (PM) Wh(3i6te)heHaodltWavJa(cNkHsotns) (Emma L) hl29 WMhioteohreeadlaWalter (c) lab City r235 (110) Wshiiotnehe(aTd) Wm (e; Ruby) lab h323 DiviWhitehead Wm J (Dorothy) mill wkr Willingham Cotton Mill hl02 (10) Duncan av Whitehurst Agnes millwkr Bibb Mfg Co rl44 Magnolia Whitehurst Burdick (Berta) lab hll5 Grady (SM) Whitley E H driver r Hotel Pickling Whitlock Arth F (Mary) wtchmn h48-49 Davis (PM) Whitlock Howard H (Thelma) millwkr Bibb Mfg Co h60 Davis (PM) Whitlock Ralph R (Elsie) millwkr Bibb Mfg Co hl69 Gardner (PM) Whitlock Thos C (Rebecca) millwkr Bibb Mfg Co !h75 Short (PM) Whitlock Thos C jr (Mary) millwkr Bibb Mfg Co hlOl Green (PM) Whitman Iris L prof Wesleyan College r do Whitman's Pharmacy (Emory S Hey- ward, John G Fausett) 195 Spring Whitmore Eliz matron Julia Jones Benevolent Home r512 Walnut Whitney Alice Mrs M50 Walnut Whitt Ellison E (Mlary) electa rl07 1st Whitt Fred H (Kathleen) formn hlOl Highland av (N1H) Whibtemore Jack (c; Martha) laJb hll03 Coleman al Whittemore Jos I mgr NIatl Optical Stores Co r31!3 Cherry Whitten Jas hl'pr Acme Welding & Elec Co r825 CWange Whitten Jlas A inspr hilBl (135) Charles ((SIM) Whitten John H (Bessie) hll(37 Williahis ISM) Whitten Mattie E rl2ll (126) Ohlairles (S M) Whitten May rl21 (105) Charles (SIM) 385 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 Whitten Ralph (Anna) errip Burney Bros Co r637 Anchi Whitten Roy r825 Orange Whitten Theo J (Rosa) hl82& Orange Whitten Theo J jr (Laura) welder Aclme Welding & Elec Co r825 Orange Whitten Wm P (Edna) ship oik Burney Bros Co h6H Pairvietw Whitten Wm P ijir student i9a6vl!l! . , Fai-rview av (EM) .. . Whittington Ohas H (Corona) driver hi 094 Belmont av ,, ,, Whittington DOriis student rSfflt Belmont (Whittington Etwood O taxi driver r1304 Belmont av ., ,, . Whittington Estelle (wid Homer) rl069 H'SZgI (Whittington Johnson R (Jeissie B) hi920 (Anderson (SIM) (Whittington Johnson R jr 1620 Ander- son (SIM) .. Whittington Mabel office sec Metho- dist Orphans Home r:201 Pierce av (V) (Whittington Mildred Mrs fctywkr Happ Bros Co rl02 Whitelhead (SIM) IWhittington Rubin elk rlO09 Hazel (Whittington Sami B r620 Anderson (S Wilbur Sol (c) porter r3`57 Madison Wilburn Ada (c) h304 (376) Melrose (E IM)- Wilburn Chanie (c) h-359 Smith rowi Wilburn Prank (Lois) medh Central Bash & Door Co r219 Knott (SM) Wilburn Geo (c; Leola) lab h(75 Port Hill ,,, _ Wilburn H Lester (Ruth E) oik Ja's C Moore rli54i3 College Wilburn Irene (c) Mil Applewood (E M)- , Wilburn Jesse L (Alleyne) auto mech h <1(618 1st Wilburn Jos (F (Lois K) feftywkr h2UB Knott (SM) Wilburn Lizzie Mrs 1215 ISO Wilburn Louis (c) r Clinton nr River ird (EM) . Wilburn Louise (c) Indrs r Clinton rd nr River rd (EM) Wilburn Mamie (c) cook r411 (Aipple- twood (EM) Wilburn Minnie (c) 11411 Applewood (E IM) Wilburn Wm (c) W305 Norris (EM) Wiloher Elbert T (Tava) asst mgr Dime (Store r3lli8% Main (EMV (WIPhTitetlaelCJoashllCBB (H(1e2l0e)n)Csretosrceenmt garv G(OttH^z) (Whittle School Rosa Taylor prin 1 Hill park av , ,, Whittley Albert (Esthelr) fctywkr rlB Bellevue rd Whittley Zelimer millwkr Biibta Mfg Co Wrh2i4tto(n25)HaBrorilgdha'(mCarolyn) driver h620 Plum apt 4 ,, . ,,, Whitworth Coy slsmn Johnnie Johnson Beauty Supply Co r315 Mulberry Whoo'per Clhas (c; Dora) bltmfcr hlpr ICofGRy h'10113 Pio Nono av (V) Wilpher Geo (c) student 1203 (224) Tur- WUeheir Orlander B (c; Georgia) por- ter 180 (1313) Forest av (V) Wildber Tava Mrs mgr Dime Store r 0101/2 Main (EM) Wildher Zadie (c) h2O(0 (224) Turpin l(T) Wilcox Annie (c) 1K135 (Ml) Hazel Wjlcox Artlh (c; Beulah) lab h)3!3B El- bert (SIM) .. _ ._ Wilcox Calvin I Oc; Annie) swtdhmn M D&ISIRR h!377 Madison Wilcox Chlais (c; Marie) lab h'119 (118) Wiggins- Clhas L (Lo'rine) gro 478 Clin- Orchard av ton (EM) h do Wilcox Geo M Rev (Marion) pastor Wiggins Clifford W (Edith) electn Mor- Vineville Presbyterian 'Churdh hl02 ris Putzel U105I7 Walnut! Wiggins Gertrude (c) car clnr CofGRy h17 '(31113) Wotaack (EM)' Wiggins Great (c) maid rTTU (770) Oc- mulgee Wiggins Jesse J (c) 12156 3d av (V) Wiggins John (c; Mary B) hridgeiwkr h266 3d av (V) Wiggins JOhn (c; Corine) lab hS10 ((240) Hall (EM) Wiggins Lena rlOOT Walnut Wiggins Lennie opr Ethel B Davis Beauty Shop 1887 NeiW' Wiggins Ned (c; Exie) r408 (510) May- nard (EM) Wiggins Pearline (c) 1534 Clinton (E IM) Wiggins Ridhld W Rev (c; Bessie) h!5(34 Clinton (EM)' Wiggins Robt L Dr (Gertrude) tchr Wesleyian Conservatory 1401 college Wiggins Rosa fctywkr Happ Bros Co r 0322 2d! Wiggins Roy A (Agnes) slsmn hl09 Not- tingham dr (NH) Wiggins Stella r206 Center (EM) Wiggins Susie (c) r649 Oglethorpe Wiggins Thos (c) tchr 1*534 IClinton (E Culver (V) v Wilcox Geo M jr slsmn. Sears Roebuck Whcox0GerSdCE T(Loihse) supvr h9'9 WBcSxVHenryV (cflata 1309 (346) Bright 1113:1 Wilcox Marion , slsmn rl02 Culver (,TVTs) Wilcox Wilcox PMenarntyha(cr)lOc0ooCku^lvJe1r0 (V) Wilc'ox Sarah E itidhir PS 1102 Culver l(V) Wilcoxon Hubert W, (Sarah E) tar mgr Bou Oil Stores Inc r RID 8I Wilcoxon John R (Mattie) car repr U iPfGRy hllBSa 01I9I87) 3d Wilcoxon Rdbt E 11)982 (1087) 3d Wilder Abr <.c; Henrietta) lab h2I5 1(5158)' Moore la Wilder Addle (wid C Emery)s . . . ,, fctywkr 1522: Wilder Giles Albert <(ScM; )Anni.e)x lab hl-19 Key i(U) Wilder Amos (e) lata 1210 Hawkins av (Wilder Andrew P lab hil084 Oglethorpe (Wilder Annie L student r445- Duncan av Wilder Bankston elk r2111 2d Wilder Buster W (Genie) millwkr hl39 Wiggins Vivian Mrs marker r05 Ell i(SIM) Wiggins W Oa'rl (Adell) tilewkir hil'34 (Tenney av (BM) Wiggins Wade (c; Minnie) porter union News Co h38 (381) Melrose (EM) Wiggins Wm M (Bennie J) ins agt h 468 Duncan av Wikle ville Theo E av apt (EP3olly()V)s1 lsmn h9'9 Vme- Wilbanks Hazel lab nll26 Cole Wilbur Mary (c) h!3S7 Madison Wilbur Ozar (c) porter r357 Madison Wilder C Eug (Lucille W) gro 155 6th faSlO Holt av (NHts) , Wilder Ohas B (Wilder & Jones) r!22 Rembert av Wilder bert aCvhas J (Pattie M) . hl22 Rem^ Wilder Christine rH26 Stonewall pi (V) Wilder Clarence elk r25 Melrose (B) Wilder Clyde (Louise) millwkr Bibb Mfg Co riKTO Oglethorpe- Wilder Cornelia (e) indrs hW Forest kv (Vi YO/UR CITY D I R C T O R Y MIRRORS the CIVIC Of Your CITY 386 D. H. Adams TAYLOR STORAGE SHIPPING Motor TRANSFER COMPANY 458 PLUM ST. PACKING PHONE 388 Co. Studebaker Willys Hupmobile Wilder D Walker (c; Leola) Carp hl214 '(14312) Wpolfolk OEM) Wilder David (c; Katie M) lab rl635 Broadway Wilder Edgar B (Lena H) meter reprmn. Macon Gas Co h24 Log Cabin blvd Wilder Edw (c; Dela) lab h Clinton (E IM) Wilder Eddred (Lillian) gro h2S Melrose (B) Wilder Elmer (c; Ethel) lab 11212 Woodcliff Wilder Ernest (Allene) millwklr Bilbb Mfig Co r.302 Columbus Wilder Frances rl!39 Ross' Wilder Prances (c) maid r23t2 Plant (S Wiley Henry i(c; Eliz) driver r2o2 Broad KEM) Wiley Judith G (wid Sidney W) elk (Court of Ordinary r32!3 Georgia av Wiley Ruby (e) lndrs rl02 ( 304) Spring la Wiley Sudie (wid Jas M) h4i807 Broadwiay Wiley Wm (c) lab r25'3 Broad (EM)' Wiley Wm (c; Annie M) lab h2!10 (300) Lexington OEM) Wiley Wm (Addie !L) porter Dunlap Chevrolet Co rl22 (9) Franklin Street lai Wilford Oscar (c; Sarah) lab hll'2116 3d Wllketson Lula (c) h23 Spring Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D Wilder Green (c; Carrie) lab hi'lS (166) DelBorde (SIM) Wilder Grover C l'ab h4.i Melrose (B) Wilder Harold C (Lucia) taxi driver r 397 Belmont av Wilder Hattie E nurse 138 Stonewall pl (V) Wilder Henrietta (c) pdlr r'180 (2140) IRoye OCH) Wilder Henry (Dorothy) millwkr rl39 IRoss Wilder Howard (c; Celia) lab John T Smith M02I8 College dr Wilder J Clyde (Clifford E) trav sMnn h!249 Coleman av (ICEDI 'Wilder Jas (c; Annie) lab hl36 Broad- w!ay (Wilder Jas (Hattie) lab Builders Lbr Co ( r RD 5 (Wilder Jane (c) blTS Wood al (Wilder Jock student P44I5 Duncan av /Wilder John H (Minnie L) city firemn MIS' Duncan av (Wilder John T (c; Louise) porter hill Wyche (SIM) (Wilder Laura slswn r!21!l 2d (Wilder (Lee (c) r!480 (240) Roye (:CIH) 'Wilder Lillian Mrs gro Bellevue rd cor Melrose (B) h25 do Wilder Lizzie (c) lndrs hl32 Davis (U) (Wilder Louis (c) rlOTa Broadway (Wilder Lucia Mrs opr SBTE&TCo r3'97 Belmont hv Wilder Lula (c) maid M057 Oglethorpe Wilkerson Mary (c) lndrs h!229 WoodCliff Wilkerson Sol (c) janitor Y1M0A h'23 Buckner al (S(M) WrillkOels lAAmlleenreicsalnswbnlvpd w; Woolwortto Co Wilkes Chas W (Mlae) millwkr Bibb Mfg Co h703 Hawthorne Wilkes Harley (Drucila) millwkr Bibb Mfg Co hi31 Comer ter (HM) Wilkes Homer G (Verna M) slsmn hl021 Clinton rd (EM) Wilkes Jas N slsmn Dannenberg Co r559 2d Wilkes Jesse W millwkr rlB8 Rockdale av KB) Wilkes John P elk r3ITi is Wilkes Leona r21 2d Wilkes Lester (Mollie) mill wkr hlOl American blvd Wilkes Oliver IF (Beulah M) millwkr r 48 Grand av IWjlkes Ollie r21 2d Wilkes Paul R statistician WiPlA r YM IdAi Wilkes Thos M lab rl'28 Blrookidale av ((B) Wilkes Vera (c) m'aid r237 Jones Wi'lkes Wm l(Eva) millwkr Bibb Mfg Co h7 Bibb av Wilkes Wm T (Mollie) lab hl!28 Brook- daie av (B) Wilkins Jbhn (c) lab hil03 Sutley (U) Wilkins Sami L appr CofGRy rT20 Or- ange I Wilder Mamie (c) maid hl47 Wyche (S IM)' Wilkinson Evelyn student rtSSB Edgewood av R Wilder Mandy (c) rl'409 Broadway Wilder M'airgt rl06l4 Oglethorpe! Wilkinson (Prank L (Margt L) pres b855 Mulberry apt 203 JE Wilder Wilder Margt (c) cook rl49 Mary P (wid Wm E) hK!6e06y (U) Mont- Wilkinson Josie L elk r207 Forsyth Wilkinson W Chas (Annie) maJch r569 pelier av 1st C Wilder Matilda (c) r'209 Coles al Willard Mattie L (c) maid hlS (755) Wilder Nathaniel (c; Elmira) lab h;202 Sparks al 1(402) Roye (CH) / Willcox Geo (c; Lucy) rlili2 (441) Pow- T Wilder Nell sfewn r2Hlil 2d ell (iEM) Wilder Oscar O (Laura B) city firemn h Willcox Lizzie B (c) cook rll2 (Hill) O 211114 2d Wilder Patricia actress r2114 2d IPOweil ('EM) Willet Dora fctywkr Happ Bros Co r69 Wilder Rosa L (c) maid r8i22 Montpelier 1st R Wilder Ruth M (c) h605 (604) Straight Willett Hettie >(C) lnidins r936 Montpelier I(U). William Buck student r623 Adams Y Wilder Wm (c; Effle) lab hl21 Key (U) Wilder Wm (c) lab ril42 Pecan aV Williams A W (c; Sweet A) lab hlT59 lAshl Wilder (Wm L (Mary E) benchimn Wil- Williams Aaron l(c; Patsy) millwkr h MIRRORS the lingham Sash & Dodr Co plant r477 Duncan av Wilder Wilson lab V4I84 Newt 1025 EdgewOod' av Williams Albbie (c) ln'drs r4l25 Cedar ((O' Wilder & Jones (Ohias B Wilder, prank William's Albert S (c; Julia) caulnet US IF Jones) filling sta 501 Cotton aV IPO h445 Douglas av (V)' CIVIC Wilensky Jake H Leather Co Inc John IL Oarolan mgr 644 Poplar Williams Alberta D Mrs sten Willingham & Payne Inc r228 High; Life Of Your CITY Wiles J B maclh Builders Lbr Co ril22:2 Bd Wiley Alvonia ((c) rlOl E tBH Wiley Asa (c; Magnolia) hlOl E Ell Wiley Clarence (e) firemn Crescent ILndlry Co hllC4> (300) Spring lal Wiley Clyde elk rlSO'7 Broadway Wiley Co rDiloi!r3seNy e(wGbleardgys)(SmMa)d; h Hiapp Bros Williams Alfonia (c; Lula) lab ri02 Mutual av (V) Williams Alice (c) lndtrs r202 1st av (V) WMilliilalms Alice (wid Nbalh) hl3 (09) Williams Allen (c; Mary) lab rl5il cai- houn Williams Allen (c; Martha) lab h504 1(505) Crisp (StM)' 387 S MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 0 455-57 SECOND ST. TEL. 4401 u Williams Allie V program 'director S E Broadcasting Co 1*200 HillWrest av (C IH) Williams Amanda (c) lndrs r327 Mon- !roe Williams Atoios oik r5HI3< Mlain (EtM> Williams Amos D (lima) blksmich hl04 Rocky Creek rd , . Williams Andrew M (S Jones Co) h211 ICorlbin av (V) _ Williams Ann student r401 Hill Crest av (OH) Williams Anna Cc) hl208 Kitchens Williams Anna (c) ln'dirs h01H 2d av (V) Williams Annabelle (c) tdhr r609 Cen- ter HEM) Williams Annie (c) h'224 Carters al Williams Macon Chas h)3l C'(3!c6;'l%J)eaFnl)anbdeelrtsan(J3HMo)tel Williams Chas (c) fctywfcr Bibb Mfg Co h904 (992) Cowan (EM) Williams Chas (c; Lucille) lab h3 Buck- ner Willia'ms Chas (c; iEthel) lab 14811 El- bert fSM) WIiqlIliams Cfeas Cc) rl'13 (101) Jones St Williams Chas (c; Essie M) lab hi09 Linden av ,, Williams Chas (c; Annie) lab 1450 Mon- Wihiams1 Chas (c) lab r206' (200) Neal av (V) Williams Chas Cc; Mattie M) l'ab h rear T H L A N D HOTEL Williams Annie (c) r436 Chestnut Williams Annie (c) cook rSl Boss Williams Annie (c) lndrs r61 Craigs la ((SIM) Williams Annie (c) maid r7 Graham's ILot Williams Annie (c) tcfhr lOJlS Penn av l(V) Williams Annie Mrs rl07 Brookdaie av '(B) Willia'ms Annie (wid John W) r817 New Williams Annie G I (wid! P Leland) h!109 Napier av Williams Annie S (c) fctyivkr r431 El- bert (SM) Williams ATdecia (c) hl09 (48) Tracy's la Williams Artlher L (c) lab Co'plan Junk Co r857 3d Williams Arth (c; Mary) lab Masonic 'Home rl85 Worth av (NH) Williams Ar.flh E (Beauford) banker r ,463 Boulevard (NH) Wii(l4ll0ia9m) slabAaumgaustu(SsM)(c) student r410 Williams Beatrice tchr r609 Center (E Williams Chas (c; Annie) lab rOOS 3d av apt .3 (V) Williams Chas A maCh 4554 1st Williams Chas A i(iRosa M) millwkr h5 IGustin pi (V) Williams Chas C (c; Hannah) lab 14408 Toomb's (SM) ,, Williams Chas G (Lavinia) Carrier US IPO hl'lS' Ponce de Leon av' Williams Chas H (Vianna) gPo 101 Belle- vue rd h do Willia'ms Chas H (Annie L) loco eng h 131 Laurel (NH) Williams Chas W, KThelma H) asst supt Progressive Life Ins Co 14303' Hendley KNlHts) Williams Chester (c; Elnora) r858 Fost'er's 3,1 Williams Clara (C) maid rM8 (46`1) (Army Lot Williams Clarence (c; Annie M) barber (Gertrude Smith r Miller Field RID 5 Williams Clarence E (Marguerite) sls- WdliamrciMde11H (c) cook r308 Doug- "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 M> Williams Belvin (c) porter rail 2d av '(V) Williams Ben (c) fc'tywkr hlOO Smith I OEM) , Williams Benj lab Balrfield Feed Mills Williams Benj (c; ChiarloBte) lab r>403 1(731) Campbell av (SIM) Williams Bernard (Bernonace Dance1 IStudio) rl09 Napier avl Williams Berthia (e) cook r27B Madison WWiilllliiaammss BBeeuslsaieh ((cc)) cro!3oIUk9'hlH0f3azeSliapp av I(,U> W1i(l1l1i7a)mTs uBrbriicnk la(.c; (TA)lberta) lab . h. ll2 Williams Broadus T millwklr Willingham Cotton Mill rl3 (09) Mill Williams Bush i(c; Mary) lab hbOS (507) Crisp (SIM) Williams Claudia (c) lndrs r448 K447) Ballard (EM) Williams Claudie Mrs h23 Bellevue rd Williams Clem (c; Bessie) springmn G oUGIRy h'1120 Edgewood avi Williams Cleveland (c) lalb Cy Williams Cleveland (c; Eula M) lab h 105 Tindall av (SM) Williams Cleveland (c) porter Douglass Theatre rl21 Broadway Williams Clifford (c) r4 (3) West Boun- Whlrams Cora Cc) lndrs r2'212 Elliott (E GVDi ` . Williams Corson elk Mrs Minnie G Scott Wri6ll0i8amHs oClot sbayv E(N(WHtillslVie) elk 14807 Bine Williams Curlie (c) mlaid 14470 (City Hall lai Williams Daisy Cc) r50*4i (41515) AHaoama Polk's Bankers Encyclopedia The Bank Directory of the World Williams C DePew car repr CofGBy Williams C Walter (c; Mabel) lab hl009 Pio None av (V) Williams Carl Cc) ice delmn Kinnett- lOdom Co r rear 453 AWchl Williams Carl M elk Happ Bros ICo rl09 Napier av . Williams Carrie J (c) maid rll6 2d av l(V)i Williams Carrie M (c) h4 (3) West Boundary Williams Oath r501 Georgia av' Williams Catih P22I0 Highi IWilliams Ceipher R (c; Alice) hlpr Swift & Co 14244 Plant (SIM) Williams Celestine (c) cook 4254 Madi- son Williams Celia (c) elk Bessie dowers irons Telfair Williams Charity (c) cook rl:142 Biroad- way Williams Chas (c; Ola) h)li88 Coles al Williams Chas (c) rlOS Thomas (EM) Willia'ms Danl (c) r815 Elbert CSM) Williams Danl (c) lab 14201 Wlaterville rd Williams David belltan Hotel Grady r IIS'5 (141) Hazel Williams David (c; Lillian) lab r215 Rant (SM) Williams Dempsey M (c) driver Macon Transfer Co r01 Washington av Williams Dewey (Etstelle) pdlr 14130 Plant (SM) Williams Dinah (c) r470 Broad (EM) Williams Dollie (c) lndrs 14357 Eta Williams Dorothea student r807 Pine Williams Dorothy student r754 NOW Wii&lliaDmrys DClonrgothCyo Lr21e9mpMoSnnroowe'savLndry Williams Doty (c; Clyde) lab rll57 (313 Nussbaum (SM) Williams Douglas student r405 Ridge av l(V) Williams Dudley rlBB New! Issued Mar. and Sept. $15.00 per volume 0. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 388 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. MStoemckber{sExNch.anTge. N. Y. Cotton Exchange Chicago Board of Trade AssNoc. iaYte. MCeumrbbers Exchange Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 THIRD AT PINE GMC TRUCKS PHONE 5100 Williams Dudley (c) porter Ry iexp Affcv Miai Broadway Williams Duffie r!MI2 Montpelier av Williams E Jos (c) lab T3I29 Tindall av l(SM) Williams Easter (c) cook r809 North ICV) Williams Ebenezer Pc; Pauline) dhauf h H!32 (1128) Mougfhbn (V)) Williams Edna (Mrs millwkr Happ Bros C'o rli0 Orange WCillhiaemrrys Edna (wi'd Wm) smstrs r760 Williams Edna M (c) r20 Ball (SIM) Wfflliams Edna M (c) lndrs hll (18) New Street la Wfflams Edw Pc) ri20 K23I7) Clara (E Williams Edw (c) r505 (504) Marltlha KilnM) Williams Edw (c) lab MHO (5) Franklin Street la ^Neal^ay5^(V)' Lilli'a,n) lato 111,511 (102) Williams Edw T (Dixie P) office mgr ILee & Smith Mule Oo h214 Hines ter Williams Estella (c) waiter hSOl (105) Bay Williams Esther student r201 Pierce av Williams Ethel elk A G Rhodes & Son 11223 Adams Williams Etta H sten rl'34 Napier av Wiliams Eug (c) student n8 (127) Orchard av Williams Eul'a (c) h503 Fort Hill (EM) Williams Eula (c) r90 Ho Nono av (V) Williams Eula (c) maid h22 (245) New Street la WMili)ams Eva Pc) cook hlOS Thomas (E Williams Evelyn em'p Show's Lndlrv & Clng Co r219 Monroe aV Williams Fannie (c) i1215 Jefferson Williams Fannie (c) lndrs h18 Wash- ington ((.HiVL) av Fannie M :(c) h407 (979) Short Williams Frances (c) r273i 3d av (V)< row ^nances (c) lnd'rs r2*4!2 Plant Wniiams Frahcis E rl'29 Sumimit av (N Williams Effie Mrs rlOI75 3d! Williams Elijah Kc; Fannie) MIS'? Han tiers (iBM) Williams Ellj'ah (c; Chaney) lab M60 Phillips al (S(M) Williams Elijah jr (e) rW HJandeTs (E (M) Williams Elijah j;r (c; Golden) lab r53'2 Grant Chapel al (SM) Williams Eliza (c) cook rlOO Empire av Williams Francis E (Eliz A) bkpr Macon 'Gas Co rl29 Summit av (NH) Wi hams Frank (c) hlpr CofGRy TMSe^)(C: Ida) Iab h415 (260> ^Bright ('cl maid rlOl (9) Williams Fred elk r608 Holt av ONTHts) Wfiullmiam)5s1iaFrOedgleWthor(pFeloMren0c9eSAun) uM2dt hadv Who Sells It? Is Answered By the Classified Business Lists lu this Directory L Williams Eliza E r!07 Virginia av Williams Eliz (c) cook rl22 (223) Dan- nenfoerg aV Williams Fredk W (Louise C; Luther Williams' Son) h323 North av (NH) Williams Gaines slsmn r476 college apt Williams Eliz jr opr SBT&TCo r220 New Williams Eliz pc) maid r426 Lawton av Williams Eliz Pc) maid nil Lenox la Williams Ella (c) liid'rs h'414 (222) Eliz- abeth (SIM) Williams Ella (c) maid r3i29 Tindall av Williams Garfield (c; Lau'ra) lab h509 (Flanders (EIM) Williams Gay E (MJamie) elk hl94 English av (V) Williams Geo (Annie) h412 Belmont av l(SIM)' Williams Ella M h220 High! Williams Ella M (c) maid r857 3d Williams Elmira (c) lndrs ill Coles al liams la Williams Elmo r320 College Williams Elnora (c) ri60 Phillips al (S M) Williams El'oise student r24J49 2d Williams lEmma rl202 Taitnall Williams Emma (c) lndrs h!l209 1st Williams Emma (c) lndrs r328 Monroe Williams Emma (c) lndrs hil09 Patter- son INHts) Williams Emma Pc) maid M110 Bostic la Williams Emma D (c) student rlil02 Broad (EM) Williams Emma P (c) lndrs r400 Divi- sion (T) Williams Emmett (c; Elsie) carp h'101 Morgan (U) Williams Emory (c) pOrtet Weldon W IBIrown 1 Murray all Williams Enoch (c) rl3lS HandeTs (E M) Williams Ernest asst mgr Pig'n Whistle 'Sandwich Shop ri:24 Ponce de Leon av l(SIM) Williams Ernest (c; Ida) boiler washer CoflGRy rl!02 Brpad (EM) Williams Ernest (c) porter Ry Exp lAgoy rial Broadway ^pelfHpSIM)0 (C' Mfce) lafb 01,5154 ahap' Williams Geo (c) lab r432 Coles al Williams Geo /(c; Lizzie) lab h!H22 (222) Dannenlberg av Williams Geo (c) lab rl03 Sapp av CD) Williams Geo Pc; Pauline) porter Gulf Oil ICorp h!219 1st av (V) Williams Geo (c) porter 1053 Telfair Williams Geo H (Juanita M) bkbndr J IW Burke ICo M906 Broadway! Williams Geo J (Essie) millwkr Bibb IMffg Co r35 1(32) Taylor av (EM) Williams Geo R (Bessie) mstr mech h 04149 2d Williams Geo T carp bS Randolph pi Waillliams Georgia (c) MI19 (1'24) Wood Williiams Georgia (c) cook r210 Wood- cliff Williams Georgia M (c) rl5S4 Chiappel t(StM) Williams Gertrude (c) laJb hW2i (378) Melrose (EM) Williams Glovenia (c; Geotgia) lab h HI (27) Clara (EM) Williams Gordon (c; Lula) lab h.504 1(455) Alabama (StM)| Williams Grace Opr SBT&fTCo r379 Orange Williams Grady (c) lab r819 3d Williams Grady D h!720 list Wilhams Grant (c) lab rlO Sapp av Williams Ernest jr (c) lab Bibb Mfg Co kiliion Broad ('EM) Williams Ernest D (Rosemary)! slsmn h 104 Spring Williams Essie (c) cook r!208 (1122) Virgin la (V) Williams Gus (c) lab r242 Plant row W'WilluianmshsipH (WMZiHlt)on (Margt V) elk M46 Williams H R driver O F Davis Truck (Line `Williams Bailie (c) cook r7 Sparks al 389 The World's Largest Store Shop at Sears t 73 SEARS, ROEBUCK AND CO. and THIRD ST. MACON, GA. Save % O (Williams Hairmon (May) r518 Pine Williams Harry E lino opr J W, Bulrke Co rl3B Ridgeland av Williams Harry G (Allie) ship elk Southland Coffee Co h200 Hill Ctreist '(OH) Williams Hattie (c) h803 Ash Williams Hattie (c) r801 (814) Cowan KHM) Williams Hattie L (c) maid r410 (468) (Alabama (SM) Williams Hazel (c) lndrs r416 Ogletliorlpe Williams Hazel F sten SteTchi Bros Stores Inc al247 High WSiltloliraems sr40H5eRniddrgixe aevlk(VP) iggly Wiggly Williams Henry (c; Jewel) h'225 Mutual av i(V) Williams Henry (c) draw balrmn CoffG W!iRllyiams Henry (e; Rebdoc'a) firemn li 1424 Broadway Williams Henty (c; Ida) laJb h!443 Handlers (EM) Williams Henry (c; Josie) lab h970 Pio Nono av (V) Williams Jas B l(Ida G) h64 Mulberry lapt 4B Williams Jas B (Louise) slsmn h9 Vineville av apt B3 Williams Jas D ( Viola) h'lpr A G Rhodes & Son rl'3130 1st) Williams Jas E (Margt) elk E Clifford Davis h209 Park (I) Williams Jas R (Odessa P) slsmn rS5 Cherry Williams Jas T (c) delmn Coleman's Pharmacy r406 (467) Alabama (SM) Williams Janetta (c) r716 3d av (V) Williams Jeff L (Lucille J) slsmn Ster- chi Bros Stores Inc h Rose pi Williams Jefferson student r406 Ridge av (V) Williams Jesse (c; Maggie) lab h831 1(330) 3d av (V) Williams Jesse J Kc) hl02 Johnson al WILLIAMS JEWELRY CO, J P Wil- liams Pres, C B Garrafa V-Pres, Winsted Arnett Sec-Treas, Jewelers and Silversmiths, Representing J P Stevens Engraving iCo, 457 Cherry, Tel 737 Williams John (c; Dorothy) h508 E ! 00 S' pr gi. S' ff 5l & o z w n oCD 7* CA tn Williams Henry (c; Jennie O) porter Academy (EM) IRy Ex

<0 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 Williams Julius (Mattie M) mill hd (Middle Ga Lfor Co r Johnson's la Williams June Mrs rll'4 Holt Williams June student r401 Hill Crest av (OH) Williams K C (c) lab r3(10 (104) Bright la Williams Katie (c) r308 (307) Crisp (SM) WWiilllliiaammss KLaBtie i(Mc) brel'h1i2r P(S17)r(30TOurCpoinlleglae l(T) Williams Laura (c) r Coy Burton Williams Laura Cc) h87 Gas House al Williams Laura B (wid Erasmus D) r (60S Forsyth Williams Laura S Mrs (Williams Music Co) r RID 5 Williams LaUranee baker Collins Bak- ing Co r7120 Plum Williams Lawtson '(c; Mattie) lab h21'6 'Jefferson ,, Williams Lee (c; Hattie) car clnr ColG Ry hi06 OllO) Pringle (EM) Williams Lee (c; Louise) porter rill Curd's al ... ,, (WWiilllliiaammss Lee (c) Lennie porter r!204 (o) maid WoodlcMf rl (153) Bright al (Williams Leonard lab G Bernd Co r Dickey Brick yd Williams Leonard L rlOl BeUevue rd (Williams Leroy (c) lab rlOto Thomas l(0M) Williams Leroy student r2449 2d (Williams Lester E (Margt) elk hl32 Magnolia Williams Lillie (c) h5! Ross Williaims Lillie (c) lndlrs h!l'14 (77'8) Nussbauim (SIM) Williams Lillie Cc) tchr irl3C9 North (V) Williams Lindsey C ((Mattie H) slsmn ISteve M Solomon Jr r'3'20 College Williams Linton (c) l'ab r Coy Burton Williams Liza (c) rT2% Hazel Williams Lloyd Cc; W)lHe) lab 1)015 1(316) Campbell av (SIM) Williams Lloyd (c) truck ptor CdfORy Williams Lonnie (c; Alice) lab h7 (10) De'Borde (SIM) Williams Lorene (c) rl'0312% Broadway Williams Louis A r207 (Kl) Dannenberg av Williams Louisa Cc) cook r612 Ross Williams Louise (c) lndlrs 11709 '(619) Prinloe (SIM) Williams Louise (c) maid r208 Kitchens Williams Louise (c) maid h!8 1(442) New Street la Williams Louis T (c) rSIZl 3d' av (V) Williams Lu'cile (c) lndrs h'603 (9) Gil- mer Williams Lucille (c) lndlrs rl2S3 Broadway Williams Lu'cille Cc) smstrs Dixie Jobbing House rlOI2 Pringle OEM) Williams Williams Lu'cil'le LulciUs M!(cr;s hi51S Plu'm Edith) lab hl3'19 i(6i!6) Plummers al Williams Luty Cc) h'540 3d av (V) Williams Lucy (c) lndrs Crescent ILndry Co r54!2 Jackson Williams Lul'a (c) h'708 Guernsey la' Williams Lula Cc) b329 Tindall av (S M) Williams Lula (c) maid 11508 Smith row Williams Lula B Cc) maid rt21l3 1st av KU) Williams Lulu (c) lndrs r026 Calhoun Williams Lumis Cc; Arizona) tailor Hayes Clothing Co r209 (75) Craft (V) Williams Luther slsmn Williams Music Co r RD 5 WiIcLkLIWAMWS ilLliUamTHs ESRole&OSwOnNer,, F(Preridveart-e Bank, Not Incorporated, 565 Mulberry, Tel 1586 (For further Information see right top lines and page 7 Buyers' Guide) Williams M Eliza (c) maid rl330 1st Williams Mabel (c) 115012 (601) Henri- etta (SM) Williams Mabel (c) lndrs hll6 Hicks al Williams Mack H (c) h9 '(504) Smith I(BM) Williams Mae (wid Jolhn W) h82 Orange Wgilalinamasv M(WagHgi)e (c) lndrs b239 Mor- Williams Mamie B r95 1st W&illiaCmos rMl2a2rgMt Magrnsolsilaswn Dannenberg Williams Margt L millwkr r9 Randolph pi Williams Marguerite Mrs opr SBT&T Co rl40 High Williams Marie (c) cook r814 OOmulgee Williams Marinda do) hi204 Madison WBiloliuatmlhsllandM1 ai3riSo4n Cc) Pine bellmn Hotel Williams Martha (c) rt03 Broad (EM) Williams Martha (c) cook h809 North KV) Williams Martha student rlOl Bellevue ref Williams Mary (c) Mil4 i(370) Brief Williams Mary (c) h6()0 (1113) Colquitt Williams Mary lndlrs Crescent Lndry Co Williams Mary Cc) lndrs r601 Moore av Williams Mary (c) lndrs 1402 Peters al KHM) 'Williams Mary Mrs millwkr Bibb Mfg Co hl8 Gardner (PM) Willia'ms Mary mus tchr 107 Virginia av h do Williams Mary C Mrs slswn Williams (Music C'o r HD 5 Williams Mary J (wid Owen O) rl!12 Montpelier av Williams Ma'ry R (c) maid h'568 Siam (HM) Williams Mary S (wid Geo E) hill# 'Stonewall pi (V) Williams Mattie (o) rl019 Pio Nono av (V) . Williams Mattie 1(c) rH'14 (10315) Tracy's la Williams Mattie (c) lndrs hl'8'3 Phillips Wiialllia(mSsMM) aude E Mrs smstrs 11487 Cot- ton av Williams May r404 Hill Crest av (CSH) Williams Medora (wid Simpson F) r40l Hill Crest av (OH) Williams Mildred (c) rl24 (138) N Tat- niall to ,, _ Williams Mildred Cc) h5'3 (862) Fos- fceir's al Williams Milton Cc) l'ab r501 Mooire av Williams Minerva (c) ln'dlrs (hS'll (114) Smith (!EM) Williams Minnie I casewklr City Dept off Public Welfare r85'9` Pine Williams Miriam student f704 New Williams Mittie L (c) rl'10 Blount (Williams Molly Cc) hl'S30 1st Williams Murray C (Inez H) Optician WrI2L5L8IAOMraSngMeUISIC GO (Mrs Laura S Williams), Robt 1H Williams Mgr, Mu- sical (Instruments of (All Kinds, 419 3d, Tel 13831 Williams Myrtle r011 Corbin av (V)' (Williams Nancy (c) ln'dlrs MS Bay Williams Napoleon (c) lab r rear 2i3 1(2213) New Street Ha Williams Nathan (c) 11409 E 2d (33M) 391 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES 565 WE MULBERRY ST. WRITE INSURAMNACCONE, OGAF. ALL KINDS PHONE 1586 Williams Nathan (c) lab n2B Bufckner al (Williams Nellie (c) r315 015) Campbell Wailvliam(SsIMN) elson (c) lalb City Williams 'Nettie (c) maid r9 DelBorde OS iM) Williams Nettie M (c) tclir Hudson In, dustriial Skfli rH07 Douglas av (V) Williams Nicie (c) r468 Bay Williams Nora M (e) maid rlC'5 Tindall av (SM) Williams Odessa (c) lndrywkir fl01 (Blroadwlay Williams Odessa P Mrs (The Hat Box) H8S8 Cherry Williams Olivia (to) cook Irene Jones r 1104 Bay Williams Omer (Oderia) toaller bli24 Pontee de Leon av i(SM)i Williams Oscar hl7 Willingham (EM) Williams Oscar (c; MaJry) lab h4l 4tlh av (U) Williams Oscar (Beatrice) millwkr Wil- lingham Cotton Mill h'15 (6'8) Mill Williams Oscar E (Vera) atndt Cherry IStTeet Service Sta rlQO Port Hill (E IM) Williams Osceola (c) student r501 Pulton (EM) Williams Ossie (to) maid r432 Coles al Williams Ozie M (c) ttillOl (9) Blight al Williams Pate E (c; Lauda) h'7'50 Edgewood av Wwillaigamons mPiafursl 2C2o0 '(PPualutolnH(SWIMi)l'liams) Williams Paul H (Paul Williams Co) h 404 Hill OreSt av KCIH) Williams Paul W (c; Lutoille) barber Jos A Braswell h>810 Norris (EM) Williams Pearl (c) Indus hlB5 Middle KV) WiTliaJms Peggy marker Crescent Lnd'ry Co F204 Cole Williams Percy H (c; Trindie) ptrin IB S Ingram School r204 Madison Williams Perry B (Grace) blksmith C oflGRy W3IT9 Orange Williams Peter (c; Pronie) lab h205 Toombs (SIM) Williams Pink (c; Eler) h'1'3'6 (139) 5th av '(V) Williams Plummie (c) maid r!ll2 (1127) Paradise al Williams Piratt (c; Willie) lab h407 (210) Henderson (SM) Williams Quillie (c; Ola M) lab hl07 Williams Robt G (c; Clara J) porter h 427 North (V) Williams Robt H (Laura S) mgr Williams Music Co r HD 51 Williams (Robt L (Peggy) elk h204 Cole Williams Robt L (c; Bstell'a) giro 217 Williams la h219 (237) do Williams Robt Y maich opr cofGRy Williams 'Roberta (c) r801 (701) Crisp i GSM) Williams Roberta J (c) bundle wrapper Crescent Lnd'ry Co rial Broadway Williams Roger (c; Ida B) lab r Clinton hr River rd (SM) Williams Rome (c) lab hl2 Graham's lot Williams Rome H (c) lab r229 (305) 5th Williams Roosevelt (c; Mabel B) por- ter Ed Whitehead Tire Serv Sta hl'80 Lincoln av (V) Williams iRosa (to) rl07 Douglas av (V) illiams Rosa (c) Inch's h4!18 (4417) Ballard (EM) Williams Rosa (c) lndrs rlOO Smith (E M) Williams Rosa (c) student rll5 Douglas av (V) Williams Rosa B rl667 3d Williams Roy G (Ethel A) v-pres-genl mgr Mitchell & Williams Inc h401 Hill Crest av (CH) Williams Rubin E (Laura M) h202 Tatnall Williams Ruby B rl975 3d Williams Ruth (c) r276 2d av (V) Williams Ruth (c) student rl22 (222) Dannenberg av Williams Ruth (c) student r204 Madison Williams Ruth (wid Peter) h345 Hines ter (V) Williams Sallie (wid W Lamar) r424 Vineville av (V) Williams Sallie (c) r715 Whitehead al Williams Sally (c) r704 Center (EM) Williams Sam bellmn Hotel Lanier Williams Sami (c) r410 (469) Alabama (SM) Williams Sami (c; Addie) hlpr CofGaRy h369 Hazel Williams Sami (c; Victoria) lab h330 'Dempsey av (U) Williams Sami (c; Ida) soft drinks 891 Waterville rd hl24 Edgewood Williams Sarah (c) h431 Elbert (SM) Williams Sarah (c) h608 Hammond Williams Sarah (c) cook r rear 554 Orange t P O 5* 'C 3CO O 2. Sapp av (U) Williams Sarah (c) lndrs r501 Moore av Williams R G (Helen) tJdtor rll'2'8 College Williams Ralph J (Pauline) millwkr Willingham Cotton Mill h9 (71) Mill Williams Raymond 'A (Sussie P) h19 (DannenbeJrg av Williams Raymond M (Ethel) ro Gustin pi (V) Wsilolniams Rebecca (c) cook 113014 'Madi- Williams Ritohd A eletetn rl'34 Na-pier av Williams Ricihd H Rev l(c; Alice) hi609 Center (EM) , ... Williams Richiedean (c) student r603 Center (EM) , _, , Williams Robt (c) r4l48 (44'7) Ballard '(EM) Williams Sarah S (c) cook hl22 Hill Williams Savannah (c) r609 Central (E M) Williams Susie (c) lndrs h428 Lawton av Williams Susie A (c) porter r204 Wood- cliff Williams Sylvia (c) r308 Burnett (EM) Williams Talmage T (May) mgr h99 Vineville av apt D2 Williams Thelma (c) maid r rear 22 (243) New Street la Williams Thelma (wid Geo W) elk h416 Montpelier av Williams Thos (Rose) firemn City Water Wks r Monroe Hill Williams Thos lab rl08 Emerald (EM) Williams Thos (c; Rosa) lab h206 (200) 3 S' 1 C 3 o 3 HaS-3M>- i3CCcoDO C" SrC+O ' 0 -ft s>o1 t 3 (SM) Williams Thos J (Pauline M) farmer h Williams Robt A (Myrtle P) train mstr IMD&SIHR h'704 Neto 1501 3d Williams Thos L (c; Eunice) l, ab h773 Williams Robt D appr CofiGRy Edgewood av tr 23 ^a> Williams Robt D student rl'34 Nlapier Williams Robt P OLennie L) h401 (209) Williams Thurman 1st (Eula) welder r759 mJ * $*$ *5* 3 (Railroad av (V) Williams Thurman G car repr CofGaRy 392 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES BURKE'S 406 Williams Trindil (c) agt Afro-Am Life Ins Co r204 Madison Williams Ulysses (c; Mattie) lab h500 Edison (EM) Williams Valline D (Marie G) meatctr h605 1st Williams Vancy L (c) maid r224 Carters al Williams Velma (c) lndrs r242 Plant Row Williams Veonia (e) maid rl05 Tindall av (SM) Williams Virginia E student rl34 Napier WMilluialbmesrryWR7A1u0guhs2t4u0s S(tEalnizis)laupshycsir512 Williams W Coleman (e) r222 Elliott (EM) Williams W Worth (Nina M) mgr Jef- ferson Standard Life Ins Co h419 Adams Williams Wallace elk r405 Ridge av (V) Williams Walter B auto mech r756 Spring Williams Walter E (Fannie J) uphol C ofGaRy h693 Pio Nono av (V) Williams Walter E jr (Gladys G) elk h 704 Holt av (NHts) Williams Walter E III r704 Holt av (N Hts) Williams Walter F collr Dunlap Chevrolet Co r Shirley Hills Williams Walter L (Doris C) carp rl46 Winship (WH) WILLIAMS WM WORTH INSURANCE AGENCY, Wm Worth Williams Jr Mmogbr,ile,LifFei,reAcacniddentM, aCrianseualItnys, uArauntcoe310-311 First National Bank Bldg 409 2d, Tel 64 (For further information see left top lines and page 20 Buyers' Guide) Williams Willie (c) lndrs h242 Plant Row Williams Willie maid Mercer Univ r316 Campbell av Williams Willie M (c) lndrs h202 Wood- cliff Williams Wvatt (Ethel M) r518 Pine Williams Zachariah (c; Elsie) lab CofGa Ry h868 Douglas av (V) Williamson Addie M (wid (John) millwkr Bibb Mfg Co r3 Water (PM) Williamson Anna slswn S H Kress & Co r Clinton rd Williamson Benj F (M Lois) pkr rl3O0 Montpelier av Williamson Bessie elk Collins Baking Co rl02 Academy Williamson Carey K (Iva M) loco eng h2523 2d Williamson Clara slswn rllO Nisbet pi Williamson Clifford T (Myrtle) v-chair- man Macon Board of Water Comnrs Whil2l5ia5m4 soBnroaCdlwiffaoyrd T jr student r2554 Broadway Williamson Corbett formn r712 Mam (E Cherry St., Williams Walter T (Emma) pntr h756 Ml Spring Williamson Estelle sten r763 2d Williams Watson (Benie) slsmn h201 Williamson Eunice tchr PS r2554 Broad- MACON Polk's Bankers Forsyth Williams Wilbur fountain mgr Walgreen WCiloliamr4s18WMilbounrtpnel(ice)r satvudent r216 Jef- ferson Williams Wm (c; Rilsie) h9 DeBoide (SM) Williams Wm (c; Beatrice) h505 (504) Martha (EM) Williams Wm (c) hlpr Pilcher's Service Sta rl88 Gordon (SM) Wynn John H (c) lab h558 Wade's la Wynn Jos (c) r7 Berthadale dr (V) Wynn Jos A (Rola J) slsmn Met Life Ins Co r302 Lynmore Wynn Julius W elk rl07 Pio Nono av (V) Wynn Lily Indrs Crescent Lndry Co r5 Smith (SM) Wynn M Byron (Sarah) formn Ga Power Co hi03 Callaway (V) Wynn Martha C student rl07 Pio Nono av (V) Wynn Marvin (Cath D) bkpr Wofford Oil Co plant r221 Georgia av Wynn Minnie (wid Sami J) r305 Adams Wynn Osborne (Grace) elk US PO h707 Vineville av (V) apt L Wynn Robt (c; Gladys) h603 (1280) Elbert (SM) Wynn Rufus (c; Louise) lab CofGRy h 146 Middle (V) Wynn Ruth tchr PS r Lizella Ga Wynn Simon (c; Sarah) lab h7 Bertha- dale dr (V) Wynn Thos N (Donnie M) h2108 Vine- ville av (V) Wynn Wm (c) porter rl02 Ruby (V) Wynne Eug (c; Irene) lab h206 Roose- velt av (V) Wynne Henry M (Tommie) hl07 Heard '(SM) Wynne Jas student r371 1st Wynne Jas A sec-treas Macon Supply Co r371 1st Wynne LaFayette (c) lab rl34 Brooklyn av (S) Wynne Louis H (c) lab rl34 Brooklyn av (S) Wynne Martha (c) cook r206 Roosevelt av (V) Wynne Robt student r724 Ridge av (V) Wynne Robt F jr (Cecelia V) div frt agt GaRRA&PWRCo and Western Ry of Ala h724 Ridge av Wry4n0n4e IRngultehsiMdersadvep elk U S Dist Court XYaVleCs ljothEems oSrhyopjr(J(oGslNadNyse)el)h'435149 Cherry Forest Hill av Yancey Chas B (Nora S) wtehmn h251 Winship (WH) Yancey Evelyn cash Liberty Natl Life Ins Co rl05 Piedmont av Yancey Sidney T (Priscilla) sis mgr Am Oil Co h99 Vineville av apt C Yancey Tossie (wid Chas) hl05 Pied- mont av Yarboro E E slsmn Kingman & Burnette r Lizella Ga i SIGNATURE ONLY SAME DAY M 0 N E Y For Reliable Salary People Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 -- < YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Life Of Your CITY 402 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES {11444465 Plymouth Yarborough Albert (Agnes) bartndr Mrs Gath Bullock rl54 Broadway Yarborough Eug (c) rl34 Army Lot Yarborough Jas S (Clyde) barber Steph- ens Barber Shop r7l2 1st Yarborough Louis (c) plmbr h605 (206) Colquitt Yarborough Wm J (Kate) chf eng H2804 Houston av (SM) Yarbrough C Augustus (S Viola) dentist 717 Bibb Bldg 403 Cherry, Tel 3076 and 3077, h5235 Houston rd, Tel 5134 Yarbrough Clifford (wid Starling J) fcty wkr Bibb Mfg Co hl3'8 Ell (SM) Yarbrough E P CZelma) slsmn Bailey Auto Parts r418 Walnut Yates A Jos (Bertie E) ship elk Yates & Tabor Co r Wesleyan dr YATES CHAS H (Sarah M), Treas Packard Macon Co, Treas Yates Motor Co, hlO Plaza (Stanislaus), Tel 5347 Yates Dalice L (Ethel) supt Ga Roofing & Sup Co r Columbus rd RD YATES DURWOOD W (Arlena), Pres Yates Motor Co, Sec Packard Macon Co, 11374 Orange, Tel 238 Yates Durwood W jr slsmn r374 Orange Yates Edw baker American Bakeries Co Yates Elmer E (Lula W) ship elk Kingman & Everett Inc h780 Montpelier av YaMteosnEtplemlieerr Eav.ir (Louis F) elk r780 Yates Evelyn S sec Idle Hour Nurseries rS63 Mulberry Yates Flavrie C Mrs asst bkpr Idle Hour Nurseries r91 Lawton av Yates Fred H (Lillian M) dept mgr Dimlap Chevrolet Co r534 Log Cabin blvd Yates G Morgan (Maggie) mgr DunlapPeeler Hdw Co h404 Forsyth Yates Helen r20 Arlington pi Yates J Jos (Carolyn) slsmn h3I9 Vineville av (V) Yates Jas E (Rebecca) pres Yates & Tabor Co h29 Arlington pi Yates Jas M mgr Hickey's Coffee Shop r Central Hotel Yates Jas W elk GtA&PTeaCo r Columbus rd RD 2 Yates Luther E (Frances) lab h811 Clinton (EM) Yates Martha r29 Arlington pi YATES MOTOR CO, Durwood W Yates Pres, Alfred M Harrison V-Pres and Sec, Chas H Yates Treas, DeSoto and PPilnyem, oTuetlhs 1M44o5t-o1r44C6ar(sF,or70f7ur3tdhearnidnfo51r0mation see left top lines and page 3 Buyers' Guide) Yates Robt L (Christine P) slsmn Ga Roofing & Sup Co hl413 Edgewood av Yates Roscoe (Louise) mach American Bakeries Co r3024 Houston av (SM) Yates Thos (Flavrie C) sta mgr Stewart Oil Co r91 Lawton av Yates Wm E (Frances) elk r887 Walnut Yates Zonnie D (Sarah) formn h8Q9 Montpelier av Yates & Tabor Co Jas E Yates pres Otis H Hogan sec-treas whol gros 340 Plum Yaughn Amy fctywkr Happ Bros Co r301 Rutherford av (SM) Yaughn Corinne fctywkr Happ Bros Co r335 Calhoun Yaughn Crissie Mrs smstrs hl019 Ash Yaughn Ervin C (Nellie) elk 507 (415) Crisp (SM) h do Yaughn F Cicero (Mary L) gro 507 (415) Crisp (SM) rlOOl Pio Nono av (V) Yaughn Henry lab r335 Calhoun Yaughn Lula millwkr Happ Bros Co h335 Calhoun Yaughn Mabel Mrs smstrs hl55 Williams '(SM) Yaughn Mae F Mrs r660 Plum Yaughn Rubv nurse Clinic r567 Walnut Yaughn Tallis r233 Ross Yeager Frank (Myrti'ee) mach h2337 (2457) Forsyth rd Yeager Louise C sten Fenner & Beane r 2337 (2457) Forsyth rd Yearty Alpha B student rl0'3 Inverness Yearty Emmett F (Minnie B) elk Will- ingham Cotton Mill hl03 Inverness av Yearty J Thos (Nellie) slsmn h226 North av (NH) Yearwood Victor W elk Rogers Stores r 332 Main (EM) Yelin Benj (Dora) delicatessen 458 Cot- ton av h419 Forsyth Yellow Cab Transportation & Baggage Co Emmett H Baker pres Frank F Baker jr sec-treas Terminal Station Yeomans A C (Nettie) slsmn Bankers Health & Life Ins Co r RD 2 Yeomans Chas L (Annie B; Macon Fish Co) h2332 Forsyth rd Yeomans Ethel opr SBT&TCo r2528 2d Yeomans Helen F office sec Dr H C Atkinson x2332 Forsyth rd Yeomans Hershal V (Mary L) ins agt r616 1st Yeomans Louis W student rl355 Edgewood av Yeomans Sami R (Lula; Vineville Fish Co) h2332 Forsyth rd Yeomans Wallace A (Ethel F) supt Progressive Life Ins Co h2528 2d Yeoumans Obie B (Sybil) welder h406 Mikado av (SM) Yetter Geo D msngr CofGRy rl415 2d Yetter Geo F (Dollie) pres-mgr Geo F Yetter Inc hl415 2d Yetter Geo F Inc Geo F Yetter pres-mgr plmbr 451 Cotton av Yetter Minnie tchr PS rl415 2d Yoemans C Brooks elk Standard Oil Co ri08 Cleveland av (V) York H B (Belle) lino opr Macon Teleg Pub Co rl22 Helen York Mitchell student r629 Adams Youghn Wm F (Pearl V) h313 Dannen- berg av Youmans I D Mrs asst dining hall Mer- cer Univ rl'355 Edgewood av Youmans Jas student Ga Academy for the Blind r Valdosta Ga Youmans T Benj student r315 Coleman av (CH) Young Addie (c) r22 Powell (EM) Young Amos (c) lab h441 Elbert (SM) Young Arnett C r324 Cherry av Young Arth C (Emma) millwkr Bibb Mfg Co h726 Oglethorpe Young Arth C (Eliz) swtchmn ii2453 2d Young Beth student r324 Cherry av Young Bob Used Car Exchange (Robt S Young) 451 1st Young Chas (Evelyn) elk rl30 Rembert Young Chas (c; Annie) lab 11701 (700) Colquitt Young Chas T emp CofGRy Young Clara (c) cook ri26 (125) Sham- rock Young Clarence (c; Louise) lab hl04 3d av (U) Young Clarence T (Evelyn) gro 970 Mont- pelier av h324 Cherry av Young Danl R (Blanche K) trav slsmn h575 Orange apt 2 Young David H (Annie L) hll2 Rogers av (V) Young Docia (c) h353 (14) 7th Young Doiris r205 Oakland av Young Douglas (c; Lillian) porter Sears Roebuck & Co rl09 Neal av (V) Young Edgar C dist farm supvr U S Re- settlement Admin rllO Corbin av (V) Young Edna M (c) r!55 E Academy (E M) Young Edw (c; Ida) hlpr h Fulton al Young Edw (c) lab rl23 Walker la Young Evelyn Mrs sten WPA rl`30 Rem- bert av 403 WILLINGHAM SASH & DOOR CO. Lime -- Roofing -- Cement - Plaster 457 Third St. Phones 277-278-279 Young Floyd swtohmn h816 Cherry Young Geo elk Clarence T Young r324 Cherry av Young Geo (c) student r514 Flanders (E M) Young Harold R student r2453 2d Young Harry L (Alice L) carrier PO h 1201 Montpelier av Young Ida tchr PS r Lorane Ga Young Israel (c; Rena) hlpr CofGRy h 111 Rose Crest av (SM) Young J Wm (LaVernej mgr Ga Market House r HD 3 Young Jas (c; Emma) lab hl31 McKay's al Young Jas S (Ellen) cond MD&SHR h 205 Oakland av Young Jas T elk Riverside Lbr Co rRD 3 Young Jas W (Lucy M; Riverside Lbr Co) r HD 3 Young Jennie (wid Jas A) hl674 2d Young Jessie (c) lndrs rl'74 (415) Nuss- baum (SM) Young John (c; Channey) lndrs rl78 Lin- coln av (V) Young Lewis (c) lab r247 5th Young Lizzie (c) 'h226 North (V) Young Loette nurse 3004 Houston av (S M) r do Young Malinda (c) lndrs h200 (305) Neal av (V) Young Mary (c) cook h509 Pio Nono la Young Mary (c) maid hl24 Sycamore (V) Young Men's Christian Association Paul A McArthur sec 371 1st Young Mozella emp Snow's Lndry & Dry Clng Co r527 E 2d (EM) Young Oliver elk Crane Co r53'3 Orange Young Percy E (Nellie) plmbr hl27 Steele (SM) Young Pierce A (Ruth) cond h656 Pine Young R Alex driver Dixie Dairies r817 New Young Robt S (Eliz L; Bob Young Used Car Exeh) hl21 Clisby pi (V) Young Rosa (c) h368 2d av (V) Young Sami (c) lab rllO Elkton pi (S M) Young Thos elk r335 College Young Thos E (Ethel) slsmn Crane Co h292 Winship (WH) Young Wm (c; Stella) h357 GO) 7th Young Wm (c; Emma) lab h702 (320) Colquitt Young Wm jr (cj delmn r701 (700) Col- quitt Young Wm A (J Lou) pres Cornell- Young Co r99 Vineville av (V) Young Wm T (May) millwkr r302 Fair- mont av (B) Young Women's Christian Assn Mrs Alice Newton exec sec 453% Cherry Young Women's Christian Assn Resi- dence Maude Oliver matron 763 2d Young Zack B (Lucile) cond hl24 Lee (SM) Youngblood Benj (c) bellmn Hotel Gor- don r24'3 Woodcliff Youngblood E Otto (Bibb Body & Fender Works) r530 College Youngblood Howard J (A Ellen) pntr h 301 Carling av Younginger mgr Gulf B Oil Floyd (Fannie B) Corp h339 Carling avp1 lant Younis David (Mary D) gro 120 (2) Bay Zachary Edgar R (Nell J) slsmn L N Jor- dan rl31 Nottingham dr (NH) Zachary Susan sten Macon Gas Co r2814 Forsyth rd Zachary w Clarence (Susan) ydmstr h 2814 Forsyth rd Zachary Wm T bkpr Macon Cigar & Tobacco Co r221 Georgia av Zachery Alonzo (c; Mable) h200 Texas (SM) Zachery Daisy (c) r200 Texas (SM) Zaloumes Geo (DaLuxe Cafe) r340 Dun- can av Zaloumes Steve (Plaza Cafe) r34Q Dun- can av Zanders Lester (c; Mattie) lab Central Sash & Door Co hl70 Hazel Zarett Marion Mrs slswn Betty Maid Shop r855 Mulberry apt 407 Zarett Murray (Marion) mgr Mayo's r 855 Mulberry apt 407 Zarks Marion (wid Mark) hl24 2d Zarks Rachael sten Ga Loan & Trust Co rl24 2d ZaCrkos rRl2o4bt2dsec-treas-mgr Empire Furn Zarks Rose office sec Thos L Ross jr rl24 2d Zeal Mary (c) maid rlOO (5) Henry (SM) Zeigler Danl '(c; Emma) hi18 (1540) Johnson's al Zeigler Edw E slsmn Firestone Auto Sup & Serv Stores rl33 Summit av (NH) Zeigler John R (Grace B) mgr The Schwab Co rll8 Inverness av Zeigler Mary (c) h907 Ash Zeigler Robt F (Eunice D) sec-treas HHu) ckabee Auto Co hl33 Summit av (N Zeigler Wm (c; Carrie) lab H541 Pio Nono av (V) Zellaner Bettina (c) cook hl50 (147) Sy- camore (V) Zellars Geo (c) lab h25 (4) Buckner al Zellner Bettina (c) cook hl08 Price (V) Zellner Dudley (c; Martha) lab r96 For- est av (V) Zellner John roofer Ga Roofing & Sup Co r225 Maple Zellner Rosie M (c) maid r313 Madison Zellner Smith (c; Alice) carp h701 3d av (V) Zemlich Eliz Mrs elk Merritt Andrews h 1160 Oglethorpe Zemlich Karl V (Eliz) tailor 406 2d hll60 Oglethorpe Zerbal Lodge of Perfection AASR of Free Masonery meets 710 Mulberry Zerner Laura (c) cook rl20 (212) Rail- wood av (V) Zettler House Mrs Maybelle Gaston mgr furn rms 518 Pine Ziegler Wm (c; Alma) lab h304 5th av (V) Zierer H Lawrence adv mgr h2104 2d Zierer Henrietta slswn W T Grant r2104 2d Zierer Mamie E (wid Henry A) r2104 2d Zimmerman Earl (Pauline) slsmn hll6 Lamar (V) Zimmerman Herman (Josephine) confr 163 5th hSll Poplar apt 16 Zion Hill Baptist Church (c) 118 (83) Bay Zion Nora (c) maid r8 Reynold's al Zorzi Eug lab r451 Center (EM) Zorzi John M (Sarah) formn Carling Tile Co h451 Center (EM) Zuber Bessie tchr r804 Mulberry Zuber Hinton C (Mary V) agt Ry Exp Agcy h837 Pio Nono av (V) Zuber J Mason office mgr W D Griffith & Son r837 Pio Nono av (V) Zuber M Edna student r837 Pio Nono av (V) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 404 FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED Furniture Automobiles Endorsed Note Single Signature PROPERTY OF CITY COURT OF MACON. Who Sells \ It? !S Answered By the Classified Business Lists in this Directory 405' MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 SIGNATURE ONLY SAME DAY MACON Directory of Householders, Occupants of Office Buildings and Other Business Places, Including a Complete Street and Avenue Guide 1937 Copyright, 1937, by R. L. Polk & Co. In the following list the streets are arranged in alphabetical order, the intersecting streets being shown. The number of each building on the street is given in numerical order, and opposite the number is placed the name of the occupants or houseowner or tenant. In the business blocks containing offices the occupants are shown by room numbers where practicable, in apartment homes the number denotes the number of the apartment. In all streets both sides of the street are included in one list. The profession or business of individuals or firms is given only at their respective place of business; to find occupation of others refer to Alphabetical List of Names. Numerical Streets are compiled in with Named Streets in their regular Alphabetical order. The symbol @ following a householder's name indicates that we have received information during the canvass that the house is owned by some member of the family, but as the publisher cannot and does not guarantee the correctness of the information furnished, nor the complete absence of mistakes no responsibility for errors can be or is assumed, nor can the publisher furnish further information than that shown. Figures in parenthesis denote old numbers. * * * between two intersecting streets denote there are no houses between them. (c) denotes colored. The (A) preceding name denotes householders and places of business having telephones. ACADEMY -- From 614 Ocmulgee west to Walnut 10?; Williamson Lucy Mrs lOSAGlass Lula E 104 Solomon Wm L 106AMay Emmie L Mrs '-'-Kitchens Marvin O 109-0-Parker Ray 112 Moore Asa E Sherwood Lou D 115-i'Butts Walton E Greater Poster Adv Service Foster Eug R 121 Stallworth Asberry W 122AEnglish Robt B 112245ACWhihrbeaatsonChWaislmSot D Hinton Prank 128 Goette Maria Mrs 131*Briscoe S Walter 134ABridges J Sami 135-0-Wheaton Bertha Mrs 338 Hilley Addie Mrs 141*Adams Ernest R 145--Anderson Wm B P ACADEMY EAST (EM) -- From Elliott north to Clinton, bet First and Second 140 Patterson Wm (c) 146 Barnes Cora (c) 150 Howell Eula (c) 151*S:Parks Charity (c) 153 Horton Edw (c) 155 Butler Annie (c) 160 Chestnut Harriet M(ci)ddle i*nte*rse*cts Flanders intersects 432 (415) Lewis Jas (c) 436 (417) Douglas Bessie (c) 449 Woodall WadAerliHngt(ocn) al intersects 451 Johnson Jos (c) 452 Ware Henry (c) 453 King Ina (c) 455 Lyons Walter (c) 457 Collins Ida (c) 458 Brantley Tobe (c) 49 Brewer Willie (c) 460 Baldwin Lizzie (cM) artha intersects 502 Davis David (c) 506 Black Gus (c) 508 Williams John (c) 509 Whaley Oscar (c) 510 Jackson Wm (c) 511 Powell Nina (c) 512 Tuff Jas (c) 513 Jarrett Hattie (c) 514 (114) Middlebrooks Jack (c) 515 QIavton Mattie S(hc)oals la intersects Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY MIRRORS the SOCIAL Of Your CITY 406 MORE GOODS --ARE-- BOUGHT --AND-- SOLD THROUGH THE Classified Business Directory THAN BY Any Other Medium on Earth YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES I Plymouth ACADEMY EAST (EM)--Contd '516 (116) Morris Jas (c) 517 Howell Henry (c) 518 (118) Pitts Chas (c) 5.19 Grant Thos (c) 552210 1(510210)) LFougltuze CClaiflfvoirnd ((cc)) 522 (122) Woolfolk Thos (c) 523 Freeman Jas (c) 524 Merriweather Gus (c) 525 (521) Dennis John (c) 623 Weathers Fredk W (c) ACADEMY ALLEY (East Macon)--From end of E Academy south to E Second 502 Pearson Pink (c) 523 Ford Wm (c) 527 Rogers Josie (c) Peters al intersects 528 Glover Mary (c) ADAMS--From C of Ga Ry south to lim- its, 2 west of College 100 Bowden Henry (c) 101 Vacant 102 Parker Dolly (c) 104 Carter Charlotte (c) 105 (114) Vacant 106 (104) Austin Jas (c) 107 (115) Vacant 111 (117) Vacant .112 (148) Griswold Lewis (c) 113 Vacant 124 Hollid,ay Edw T(ca)tnall la intersects 129 Armour Vera (c) 130 Jones Dalton L (c) 133ASmith Larkin (c) 134 Jordan Wm (c) 137 Simmons Starling (c) Chestnut intersects 216-0-Geeslin Pearl L Mrs Maddox Mary nurse Burnette Annie L nurse 217 STmhoimthpsWonmERldora nurse 319 Joiner Dora Mrs 222210&CGaeinesliHnozLzoieuisBe Mrs 223&Seagroves Marion 224-0-Bragg Walter T 225APalmer Luther G 227 Chandler Wm L 229 Haskins Jos 305*Chapman HaOrrygleDthorpe intersects 307 Storrs JSdith R 311-Q- (312) McAlister Chas A 317ABaskin Wm H 325 Vacant 337ADavis Reuben G Richardson John C Barron Haskill E 341ATabor John S 405AJones Thos J Hazel intersects 409APulliam Robt L 417ABaggarlv 419 Williams WjasWBorth Rev 421 Harrison Ruth B Mrs 501-ADowell Spright Ash intersects 550033%ARAoBbainrnseosn HJoesnry S 505AAlien John D 505% Overton Elvin E 507ACurrie Brainerd 507%AWade Thos L 509-ARogers Henry 509% Singleton Gordon G 613-0-Epps Ruby BMMerrcser ter intersects 615*Waters Clayton C 617 Bond Bessie Mrs 624&Pierce Manson C' 662265-AAHduagmhses HJ KD 627APursley Sami C 6290Kappa Sigma Fraternity 703*Baker JohnEdGgewood av intersects 705 Johnston Prentiss W 707 Ware Douglas B 771019*EHlduenrt CWhmas GR 713-S-Clark Walter B 801 Mason Wm E AJAX (Formerly Commodore) --From Bartlett's la to Ernest, 1 south of Napier av 437 (1002) Dean Wm L 439 Vacant ALEAdBgeAwMoAod (aSvousthtoMaPcloann)t--From 1023 101(1) Hanks Lizzie (c) 102 (2) Keepler Lonnie (c) 103 (3) Vacant 104 (4) Chatman Martha (c) 105 (5) Hutchins Minter (c) 106 (6) Johnson Wm (c) 107 (7) Williams John (c) 108 (8) Bentley Thos (c) 109 (9) Beecher Hollis (c) 110 (10) Baker Pearl (c) 111 (11) Smith Lillie (c) 112 (12) Wilson Adelia (c) 113 (13) Haskins Peter (c) 114 (14) Harris Bessie (c) 115 (15) Jones Jobie (c) 116 (16) Jackson Lucy (c) Prince intersects 201 (204) Whigham Wm (c) 204 ( 430) Swint Beverly (c) 205 Tolbert 'Wm (c) 206 (432) Gibson Levi (c) 209 Shrem Jack gro 211 (431) Cummings Henry (c) 215 (433) Bartlett Sami (c) 219 (435) Vacant 223 (437) Wilson Chas (c) 227 (439) Daniel Annie (c) Elizabeth ends 231 (441) Miller Ernest (c) 235 (443) Stephens Henry (c) 239 (445) Vacant 302 (438) Gilmore Geo (c) 304 (430) Bostick Mamie (c) 306 (441) Westbrook Jas (c) 309 (443) Shank Jas A (c) 310 (442) Jones John (c) 312 (445) Howard Berry (c) 3.14 ( 447) Moore Jas B (c) 343 (437) Bledsoe Ervin R (c) shoe repr Richardson Wm C gro 347 (449) Ribbron Mack D Rev (c) 351 (J4) Stephens Wm (c) 355 (456) Driscoll Robt (c) 359 (446) Williams Wm (c) 361 (460) Simmons Edw (c) 365 (412) Coles Irene (c) 440020 ((.446631)) KBoilngdoreJerWomaleter(c()c) 404 (465) Hutchens Wm (c) 406 (467) Harris Homer (c) 408 (467) Pickens Thos (c) 410 (469) Williams Jack (c) 469 (460%) Hill John (c) 471 (462) Sharp Chas (c) 473 (462%) Solomon Jos (c) 475 (464) Collins Fredonia (c) 477 (466) Collins Jas C (c) Curd ends 500 (451) Jefferson Sol (c) 501 (468) Whitby Mollie (c) 502 (453) Collins Mattie (c) 503 (470) APitts Jas (c) 504 (455) Williams Gordon (c) 505 (472) Holloway Frank (c) 506 (457) Atkins Missouri (c) 507 (474) Hampton Henry (c) 509 (476) Porter W Riley (c) 511 (478) Samuels Elias (c) 407 WILLINGHAM SASH & DOOR CO. Lime 457 Third St. Roofing -- Cement Plaster Phones 277-278-279 ALABAMA AV (V) -- From 1318 Vine* ville av south to C of Ga tracks 104AFleming Harry P 106ARiordan Fred H 107ALamar Henry J 108ADoster Paul J 109 Pritchett Wm S ALBERMARLE PL (Ingleside) -- From Forsyth rd north to Overlook av, 1 west of Belvedere dr 201 Vacant 202AKline Wm R 22<0J34AAKWelelavverArWthmJ M ir 205ABuchanan Jos D 207ABrumby Lawrence R 208AStokes Thos W. 21QARussell Scott 212AWheeler Walter D 216ABirch John NOs\brorne pi intersects 221AGoodman Alex M 222ABrooks Chas H 224AMeElrath John Me 228AGrieve Douglas W ALBERT (South Macon)--From Boundary to Reid 2 w of Fourth ALEXANDER--West from 125 Park along C of Ga Ry, 2 s of Forsyth rd 1 Vacant 2 Johnson John H (c) 992 B(2a)coWn alHkearrryAn,(nca) (c) ALMOND (Unionville) -- From Anthony north to 3d av, 1 north of Mason AMERICAN BOULEVARD -- From intersection Log Cabin blvd and Grand av north and west through Bellevue 100 Swann Mary Mrs 101 Wilkes Lester 102ACarr Theo P 106 Durden Elmer E 110 Church of God 112 Oglesby Graham Rev llSATharpe Louise H 115AKing Wm L wood 119 Allen Otis G 121AAshmore Mary LAtlManrtsicintersects 201 Ross Dallas L gro 203AMillirons John L 204 Bond Chas 207 Johnson Sylvester B 211 Moulton Northrop S 2.12 Hing Wade H 216 Clay Jos I 222138 PVainttseornsonJasC BIvey gro 227 Post M Davis 228 Carr Quinton 234 Wald John 238*Lord John E 229 Ross Clive G 244 Cox Oliver BErookdale av intersects 305 Bellevue Bantist Church 307 Minor Carl 308AHarrison J Binyon 311AMinor Carl 315AJoines Vester F 316 Lamb Henry K 317 Sanders Wm L 327 Vacant 328 White Robt L 331 Willis R Ray 332 Tanner J W 336*Goldwire Bessie B Mrs 342*Erwin Geo F Rev 33446 BWroyrasnhaLm CWamrltoBn 397 Mansfield Willis S gro 399 Bellevue Service Station filling sta Fairmont av intersects 440012AHRaerdpmeronRd aJlpohs HP 407ABrice Wm H 408 Vacant 411 Bozeman Howard 412AMinor Frank L 415 Vacant 416 Geotte Phillip W 421*Booker Jerry M 424 Thigpen Emmett B 442357&WHoarrsphear mJosDaBvid W 440ARogers Lemuel P 454052AATrhaommoasMLaurglat F Mrs 550079AHOaattcehs e.rEdWwiinlbuRr 715ADavis Clarke A 716AGreene Lucille J Mrs Grand av intersects 802-0-Sasser Emmett 815ABritt John T 863 Butler Albert RAyers rd intersects 864 Bellevue School 905 Waldorf Wm R AMOS (Vineville)--From Ward east, 1 north of Vineville av 100 (205) Sutton Arth (c) 101 Howard Laura (c) 102 (206) Wade Clara (c) 103 (104) Evans Coleman (c) 104 (108) Burnam Fannie (c) 105 (102) Hunter Adam (c) 106 (306) Merrill Evie (c) 110 (815) Byrd Mary E (c) 112 (282) Sailor Henry (c) ANDERSON (South Macon)--From 2017 Second west to Jeff Davis 609/-,-Fittmari John H 615ALigon Hugh L 620 Whittington Johnson R 628 Osborne Jas F AWarren Ervin H 630AWalters Eliz W Mrs 663925ANSehwermwaonodAGlbuegret l ME 699-AEtheredge Jas N 701AJones Jas E 704 Vacant 709 Bailev Maude Mrs 710AMMaatttthheewwss MMailregst ES Mrs 718ABloodworth Robt H 719APryor Ridley R 720ALester Maurice A 724-OHarvey Maggie Mrs 772354 MVao_bclaenyt Alex W 773454-AASIveelyiersSuEsaldnridMgers M 749 Lancaster Ada Mrs Moon Thos 752 Camp Sarah E Mrs ARogers Minnie L Mrs 757 Ivey Thos H 760ARussell Cleveland L 763AWatson Dorothy A Mrs 764AJohnson J Lison ANDERSON AV (V)--Changed to Amos ANOLA PL (V)--From Corbin av west, 1 north of Clayton AMallary Edgar Y rear Walker Geo (c) ANTHONY (Unionville)--East and west from Pio Nono av, 1 south of Third av 385 Odom Tweedy D (c) 408 (334) Cummings Wm (c) 409 (333) Reece Beni (c) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L, Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 408 TP u Ed fcaJ taj wCO ,,^ ZU3 Oac c e i V Is t*. >> < o h> J2Ss * - - Xwa,O>sS* o ittnoo FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature ANTHONY RT) (South Macon) -- Continuation of Jeff Davis lOCK-Braswe'll Ida V Mrs Wheatley School (c) ANTIOCH RD (South Macon)--Changed to Gantt City rd APPLETON AV--From Columbus northwest to Monroe, 1 southwest of Orange 110065*BHealdwiknignsMOelrarillA PMrs 107 Evans D Fred contr 1i0,,8o*?SRvoagnesrs FRoLbatwrence contr ^Lockhart Gelston il09*Hart Madison G lllARowland Raymond H 120AAiken E Clack 121*Lewis Edw C Swisher Cleveland G 124*McCreay Wm T 126AHarrison Bernard J 129-0-Holmes Oliver C 130*Howayd Mary Mrs lSlAChambers Edw 137*Echols Forrest W 140AAVEdawnLaradnsdiRnguhthamVRMoyrfsord Fuller Edwin 2,,02 Wright Thos P College intersects 204*Crow Clinton M 207 Vacant 251.*A. r,t,hur Geo StPaul intersects 252*Hatcher Martha L Slocumb Howell E 254hGarrett Robt L 256AHays Oscar w 260ABritt Geo C 521 Nelson Newman B 550 Vacant 551AHorton Leonard W 555*Jones Jos H 556 McIntosh Emma Mrs 558*Thistlewood Geo S 560 Wimberly Wm M Ketchie Everett 561-OWoodell Luther F 562*Tendex Marvin S Second intersects 613ADoke Dora E Mrs 614 Perritt JLas 616*Thompson Minnie Spear Jewel nurse 617*Cutro Antonio Marshall Joe L 620*Walker Wm F Walker Wm F ir mus tchr 627ALeaptrot Mary L Mrs 655 MSkuirnpnheyr BJurliidage-tL MMrrss 658 Dixie Dairies 690*Williams Howard V First intersects ARDVINE'S AL --From Elm west to Edgewood ay, bet Broadway and C of Ga Ry 1402 Fail Lillian (c) 1403 Sanders Caleb (c) 1404 (404) "Murphy Kelly (c) 1405 (405) Boyce W Henry (c) 1406 (406) Pitts Nancy (c) 1425 Vacant 1426 (234) Preston Leola (c) 1429 (324) McGriff Ola M (c) ARLINGTON (East Macon)--Changed to Yates av Who Sells IS Answered Classified Business Lists In this Directory APBPaLlkEcWomOOtDo T(hEiardst avMacon) -- From 102 (105) Thomason Jettie M d07*McKay Wm L Balkcom intersects 209*CWaiansneRrobMt aRttie M Mrs 211*Balkcom Robt P 221143-0A-MmceDrsaonniel JMasacWkey L 215 Hawthorne Jas R 216 Braswell Edw W 217 VBraocoaknst Geo E 219 Vacant 220 (223) Lyles Rube H 223 (226) Sanders Mary W Mrs 224 Vacant 225 Curtis John Fairview intersects 301 Mann Horace J 303 Amerson Andrew A 308 King Jas E 403 Bonner Louis W (c) 404 Goode Florence (c) 406 Peeks John W (c) 409AButler Chas S (c) 411 Wilburn Minnie (q) 418 Tinsley Mary M (c) @ 419 Vacant 420 Vacant 421 Shiloh Baptist Church (c) ARCH--From Boardway west to junction of New and Orange, 9 south of river 411 Fraley Minnie (c) 417 Hamlin Hubert H 425 White Lester A 453ABMarefaideeldrs CMarartiteres(sc) Co mfrs rear Hose Peter (c) 455-57AEconomy Markets Third intersects 509 Davis Wm W 513 Spies Ritz ARLINGTON AL (East Macon)--From 115 Powell north ARLINGTON PL--From 450 Washington av to Forsyth 16 Vacant 17 Poe Lena V Mrs 19*Clary Geo E Rev 22:l0**MSmitcithhellJoFhrnanRk L B phys 282393-*King Minnie T Mrs 34*Newman Florida nurse 35&Hall Jas B 36 Palmer Florine H Mrs 37ADunlap Kinlook F 42AGreene Susan Mrs Tinsley's la intersects 51 Sevmour Esther ALeonard Floy E Burrus Claudia Mrs 53*Talbird Mamie M Mrs 54*Avrunin Louis 58Ajones Malcolm D Hon 61*Kennedy Georgia E Mrs @ 62AHarris Lula L Mrs 65AMundy Thos J 66 Vacant 70*Tuten Jas G 71*Boswell Eug ADonaldson Jarel 76Aclark Leila A 77AMoore John T 79*Kilpatrick Wm C 82AChaplin Arth W 83*Haffey Jas P 87ACusson Julia Mrs 88ABozeman Wm E 93ARiley_. dith C Mrs Forsyth intersects ARLINGTON PL N -- From Jefferson south to Georgia av, continuation of Madison lAMcNair Nell B Mrs 7*Coffee Andrew J 409 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 ARMOND AV (Unionville)--North from Anthony rd to Third 100 Vacant 101 Leaptrott Angie (c) 105 Howard Benj (c) 115 Toole Florence (c) 175 Ballard Emma (c) AR(MCoYntLinOuTat--ioFnroomf F82o2steAr'ssh atol) Elm -- 121 Taylor Aurelia (c) 123 Guyton Leonard (c) 125 Stallings Albert (c) 127 (526) Green John (c) 129 (522) Martin Lonnie (c) 131 (5iJ3) Roberts Ella (c) 133 (135) Woodall Hattie (c) 134 Matherson Clara (c) 136 (132) Walker Lonnie (c) 138 (130) Farrow Felton (c) 140 (128) Bell Henrietta (c) 142 (126) Brown Wm (c) 144 Belt Wm (c) 146 (459) Thomas Wm (c) 148 (461) Lewis Maybelle (c) ASH--From Division west to limits, 13 south of river 110 Brown Oliver (c) 112 Kendall Arth (c) 123 Patterson Nora (cG) ilm*er in*terse*cts Hammon*d in*terse*cts Elbert intersects 311 Carter Lewis (c) Fifth intersects 317 lElzie Allen (c) 321 Corbin Florine (c) Bright's al intersects 354 Grier Dorsey M (c) Byrom Ada (c) drsmkr 358Calhoun Clifford (c) 360 Smith Mattie (c) Broadway intersects 400 Coffee Ida L (c) 404 Praythor Josephine (c) 406 Wooding Mary (c) 408 Brown Chas (c) 410 Little Beeman (c) 416 Vacant 420 Bledsoe Sally (c) 421 Kendrick Andrews (c) Stein's al intersects 453 Richards Mary Mrs 456 Vacant 476 King Miles Third intersects 514 Vacant 520 Wilson Frank Turner Chas 523 Whitaker Reuben 553 McCormack Wm C 554ARaney Mollie E Mrs 556 Howard Lillian 559RBoricckemJoores JF Alice Second intersects S45AWaits Arth C 647 Sinclair Chas Beasley Wm C 649 Hudson Willie Mrs 651 Thompson Geo W 665 Davis Jas 670 Langford Geo H Childs Ellen Mrs gro First intersects 701 Gantt Willie M (c) 702 Smith Loke (c) 770130 MCaurrvcehsitsoAnnnMieagg(cie) (c) 711 Killebrew Jas (c) 713 Pope David (c) 715 Graham Jack (c) 718 Green Geo (c) 724AThomton Jos G (c) 726 Vacant 728 Baldwin Luther (c) 749 Bloom Bessie (c) 751 Ross Alice (c) 753 Thomas Sarah (c) 755 Mitchell Henry (c) 757 Griggs Marion (c) 759 Williams A W (c) Lovett Anderson (c) 760 Walker Benj 761 Mitchell Jos (c) 763 Reid Wm (c) 7644'Reddick Homer (c) 765 Taylor Frank (c) 767 Floyd Wm (c) 769 Hudson Dock (c) 770 Anderson Wm (c) 771 Dunn Annie L (cT) elfair intersects 803 Williams Hattie (c) 807 Herrington Clarence (c) 809 Felder Allen (c) 810 Daniels Wm (c) 814 Harper Beatrice (c) 816 Duck Tommie (c) 818 Brown Mittie (c) 819 Smith Rena (c) 822 Sword Wm (c) 885213 MChilunrecrh HoefnrGyod(c)in Christ (c) 852 Craft Wm C (c) 853 Allison Essie (c) 854-ABrooks Claude (c) 855 Magwood Robt (c) 857AJones Chas W (Jca)ckson intersects 901AWilliams Robt (c) 905 Toliver Nancy (c) 907 Zeigler Mary (c) 909 Ridley Mary (c) 911 Buckner Jeff (c) 912 Arnold DeWitt 914 Ne Smith Wm T 915 Washington Caleb (c) S17 Hood Isaac (c) 919 Kendall Anna (c) 921 Walden Lina (c) 925 Curry Lonnie (c) Calhoun intersects 1014 Abercrombie Jas E 1016 Patterson J Homer 1018 Vacant 1019 Yaughn Crissie Mrs 1020 Shultz Dock M 1023AEtheridge Dock >1024 Vacant 1054 Edwards Linder Mrs 1055 Moore Thos A 1061ATidwell Robt D 1068 Hunnicutt Mollie Mrs Ross intersects 1111 Hambrick Sanford H 1115 Fordham Annie Mrs 1116 Clarke Robt B 11117 Culpepper Wm J 1118 Allen A Oliver 1119 Childs John D gro 1120 Moore W Oren Shamrock intersects 1153 Sumlin Frank E 1155-OMays J Crowder Rev Mays Rachel J mus tchx 11165 Findlay Agnes Mrs 1171-AShroyer Clifford B Rev 1173 Shi Susie Mrs College South begins `^oeAFind'lay Prentiss E 1218 Bartlett Chas L Hardin Alene lawyer Bartlett Chas L lawyer College intersects Mercer University Tatnall Square Tatnall Square Baptist Church Adams intersects ASH (East Macon)--Changed to Edison 4i-^ ct n ca MULING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 410 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Bo. Publishers 431 Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 ASTOR (East Macon) -- From Melrose east to Center, 1 north Broad Clinton intersects 167 Ross Jos (c) 168 Whitaker Cornelia (c) 168% (169) Hunt Lizzie (c) 170 Vacant 172-SHunt Addie (c) 174 Houston John (c) 174% Hudson John (c) 476 Smith Louis (c) 180 (145) Lawrence Henry (c) 181 (146) Miller Homer X (c) Lexington intersects 200 Merriweather Arth T 202 (229) Butts Charity (c) 204 (278) Reynolds Annie B (c) 206 (276) Vacant 260 Pittman Mary Mrs 269 Scott John C 270 Bloodwood Wm H ASTOR PLACE (East Macon) -- From Astor north to Woolfolk 4 Hackett Wm M 5 Vacant ATLANTIC AV--(Bellevue)--From American blvd west, 1 south of Forest av 300 Hendley Wm T 308 Hammett Jas T ATLANTIC VILLAGE (Mill Quarters) -- East of Oak Haven av bet Delaware av and C of Ga Ry 1 Moore Goebel E 2 Atlantic Community House 3 Jones W Lorenzo 4 Allen Willie M Mrs 5 Stanfield Fredk 6 Entrekin Howard H 7 Evans Jordan J 8 Heath John R 9 Collins Jeremiah T .tr 10 Clein Dollie Mrs 11 Glore J C 12 Mimbs Laura Mrs 13 Wood Kemp G 14 Barber David M 15 Mailey Sami F 16 Ragsdale John T 17 Teel L T 18 Wingate Noah 49 Driver tester 20 Hobbs Freeman 21 Vacant 22 Ferguson J Oswald 23 Ray Howard L 24 Brooks Wm 25 Linderman Ella Mrs 26 Heath Ollie 27 Home Gus E 28 Barton Earley H 29 Glore Roy L 30 Harper Mollie Mrs 31 Speer Estelle 32 Collins Jas W 33 Mote tester A 34 Horne Chas 35 Lloyd Guy 36 Strickland Rolf 37 Vacant 38 Johnson Jos B 39 Clein J Veron 40 Hobbs Eunie 41 Davis Jack AUBURN AV (Ingleside)--From Forsyth rd north to Tyrone blvd, 1 east of Belvedere dr AUBURN AV (Stinsonville)--Continuation of Auburn av (Ingleside) 139 Adams Lilly (c) 141 Thomas Chas (c) 143 Daniel Jas (c) AVON RD (Bellevue)--West from Euclid av, 1 south of Forsyth rd 100 Elliott Boce M 101 (25)AFay Geo J 10'8AApplewhite Jos D 109APowell F Rogers 110 (100)ASikes Amos M 112CSatterwhite Amos D 113&Davis T Alton AMason Wilson Y AYERS BLVD--West from 156 Park, bet C of Ga Ry and Ayers rd 102 Toole Chas J ir 104AWaldorf John S Waldorf Leila nurse 109 Hunnicutt Thos F AYERS RD (Bellevue)--From American blvd west to Columbus rd 101 Walker E Hurst soft drinks 104AStaley Jas H 108 Merritt Nannie M Mrs Echo pi intersects 110 Wade Harry W 111293-AQ-PCautrtteisrsoWnmAnNnie Mrs 220 Cox Jessie Mrs 222 Vacant 223 Vacant 224 Hurst Walter E 229 McMichael Wm J 412 (411)AAlexander Della F Mrs BACON (South Macon)--From Hanson south to Rutherford, 1 east of Houston av 120 Holt Miles F jr 140AHolt Miles F Cleveland av intersects 217 Vacant 220 Smith Wesley L 221 Hightower Sump C 236*Avera Leonard E BACONFIELD (North Highlands)--From North av N, I west of Nottingham dr 200 Macon Women's Club Pilot Club of Macon Business & Professional Women's Club BAILEY AV (Cherokee Hts)--From Napier av south to Montpelier av, 4 blks west of limits 150ASutton Chas G 152 Rice John 115573ARCircoeweKllanJonhonn KM plmbr rear Lewis Nelle Mrs 300ABroxton Herschel R 303 Foster Wm E 304 Tucker Bruce S 440000 T(3o9m9)pAkSintesedHeWnrmy TO 403 Edenfield Anna 405 Bailey Avenue Mission Branch intersects 550013ANHoaomnlainn MSuisnaonr BE M rs 505 Rice Wade W BAKER (East Macon) -- From Broad south to Washington. I west of Duval BALKCOM AV (East Macon)--From 626 Main to Fletcher, 2 east of Hydrolia 101 (1) Garde'll Wm C 102 (3) Tharpe Bessie 103 Bray John A 104 (105)ATharpe Edgar J 105 (4) Brown U Iverson Myrtle intersects 106 (lll)AJames Wm A 1108 (12) AWrye Minnie L Mrs 109 (10) Cheshire Jos E 110 (14) Collins G Clifton 113 (13)AMeaders Wm T 117 (15) Thomas Walter N Peachtree intersects 41 f DUN LAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 BALK.COM AV (EM)--Contd 202 (102) Beck Edw O 203 (103)-0-Cowell David A 207 (107)*Ratliff Wm A 211 Mingledorff Robt S 215 (111) Land J Fred 224 (124) Brown Andrew J BARTLETT'S LANE -- From Napier av s to Berry, 1 east of Ernest 116 Thomas Benj (c) 119 (100) Coleman Edw (c) 123 Vacant 124 Calvin Lula (c) 125 (602) Reid Jos (c) 126 Chappell Lizzie Baptist Ch (c) BALLARD (East Macon) -- From Woolfolk north to Mitchell, 3 west of Fort 127 Holmes Lucinda (c) 129 (204) Wimbush Marion (c) Hill 112 Washington Gertrude (c) 114 Childs Rhoda (c) Cowan intersects 114489 AJothkninssonNoJoahhn(c()c) 275 Bonds Randolph (c) 327 Thompson Donnie (c) 331 Sanders Frank (c) 443 (440) Grey David (c) 448 (447) Williams CRlaorska's (lca) intersects 803 Hightower Jas (c) 805 (804) Johnson Jessie (c) 806 ( 807) Vacant Hall intersects 865 Vacant 866 (65) Roberts ErnMesittch(ecl)l intersects 900 (901) Russell Jos (c) 901 (508) Harris WalteTray(lco)r intersects 1001 Rice Moses BANKSTON AV -- From Montpelier av N, 1 west of Buena Vista dr 254 Baughcum Lovejoy D 256 Cheatham Wallace D BASS--South from 3202 Forsyth rd, 1 w of Parkwood av BAY--From Southern Ry west to Third, 11 south of river 75 Ross Lizzie (c) 86 Huff Merton (c) 93 Ingram Earl (c) 97 Stevens Mary (c) 100 (137) Turner Lawrence (c) 101 Oliver Will (c) 102 (136) Smith Dave (c) J04 (133) Webb Katie (c) 106 (95) Lee Henry (c) 107 Vacant 108 (96) Searcy Bertha (c) 110 (98) Perry Speer (c) 112 Rains Tabernacle Holiness Church (c) Harris Row intersects 114 (78) Vacant 116 (80) Oliver Geo W (c) 118 (83) GZiloennnHJilols B(acp) tist Ch (c) 120 (80) Reed Hattie (c) 120 (2)*Younis David gro 122 (92) Brown Ashley (c) 124 (102)Matut Jos BARBAIN LANE--South from 517 Mulberry to Poplar, bet Second and Third ABay Street Cash Grocery 126 (104) Vacant 136 (110) Thomas Mary (c) BARFIELD AL -- From 554 Plum, south to 555 Pine 329 James Lucille (c) 330 Glenn John H (c) 331 Barfield Sandy (c) 138 (112) Irby Wm (c) 140 Lawrence Ned (c) 142 Ashley Mamie (c) 144 Ross Lettie (c) 148 (146) Jefferson Annie (c) 150 (140) Sanford Jas (c) BARNHART'S BOTTOM--West from 604 Forsyth to C of Ga Ry 1 Moughon Wm (c) 2 Ward Lizzie (c) 3 Miller Laura (c) 6 Lawrence Jas (c) 6 Wade John (c) 7 Vacant 8 Vacant 9 Rose Robt (c) 115524 OJawckensosnPhLiyldipie (c(c)) 156 Gainey Harriet (c) 160 Miller Dora (c) 162 Rav Orlandus (c) 163 Hall Wm (c) 164 Clark Willie B (c) 207 (7) Vacant 209 (17) Jordan Wm (c) 209% (16) Stephens Judge (c) 211 (15) Cook Wm (c) BARTLETT -- From Napier av north to C of Ga Ry, 1 west of Inverness av 102 Thomas Claudia (c) 104 (164) Watson Alberta (c) 106 (147) Cliette Thos (c) 108 (148) Howard Augustus (c) 110 (172) Davis BrighGt or(dc)onintersects 220013&TBhaotmtleasMGoenoroe(c)(c) 205 Bronson Henry (c) 206Roundtree Minnie (c) Hill Crest av in*terse*cts 213 (14) Burney Mamie (c) 215 (12) Bryant Mattie (c) 217 X103) Searcy Henry (c) Gilmer intersects 301 (105) Williams Estella (c) . 307 (119)AStandard Oil Co whol oils 308 Vacant 309 (195) Amerson Curtis D gro 310 (210) Dickson AnnEalb(ecr)t intersects ns Taylor Iron Works & Sup Co shop cor Holster Della (c) 352 Kizzie DeWitt (c) Bay al intersects Roye intersects 402 Vacant 404 (309) Wyche Jas (c) 406 (150) Matthews Clara B (c) 412 (125) Holmes Amanda (c) 418 (202) Radford Mamie (c) 420 (204) Lockett Sallie (c) 354 Brown Mary (c) 356 Floyd Emma (c) 358 Lawton Wm (c) 360 Vacant 362 Richardson Edw (c) 364 Brown Anderson (c) 366 Brown Milton (c) 368 Gardner Chas (c) BARTLETT AV--South from 332 Demp- Broadway intersects sey av to Moore av 403 (401) Johnson Clarence (c) 2 Curtis Jas (c) 405 (417) Redding Arth (c) 6 Luster Pearl (c) 413 Kizzie Andrew (c) 7 Clayton Willie (c) 414 Brown Wm (c) 8 Huckaby Wm (c) 415 Randal Wm (c) 9 Bartlett Geo W (c) 416 Brown Mary (c) DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES ! and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 412 EDWIN S. DAVIS, District Agent Where To Buy? Consult the Classified Directory JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Rhone 1142 BAY--Contd 420 Thomas Fanny (c) 421 Bolder Chas (c) 452 Thomas Edw (c) 453 Brown Jacob (c) 453% McDowell Louise (c) 454 Mathews Rufus (c) 455 Hoskins Gabriel (c) 456 Smothers Ned (c) 458 White Perry (c) 466 Tucker Lula 468 Gary Maudel (c) 470 Weathers Beulah (c) 506OMartin Chas I 507-OJohnson Thos C 508OMoore John D 5510090R-MacckCsoomnmDonavJid Clarence 5lllOTarver J Clyde 5120Ryals Andrew J jr 6130Gibson Glenn 514515,5170Stephens Jos W 624 Winship SchoolPatterson intersects BAY AL--From rear 352 Bay Pio Nono*av in*terse*cts 1 Rozier Anna (c) 2 Robertson Wm (c) Courtland *av in*terse*cts 3 Sperry Leola (c) 4 Brown Carlton (c) 5 Vacant 6 Davis Dinah (c) Hillyer av intersects 809 Johnson Lafayette H 817 Lewis Otis B 8190Middlebrooks Silas H BEAR'S AL--From 628 Washington av, west to Forsyth Winton av intersects 935-S-Davis H Roland 1 Jackson Hattie (c) 2 Middlebrooks Jos (c) 3 Vacant 4 Vacant 5 Hopkins Moody (c) 6 Howard Frank (c) 7 Watson Chas (c) BELL AV -- From Roff Home av s to Roye 108 (107) Kato Harvey J 110 Nichols Wm E 112 (200) Vacant 116 (175) Clay Carrie (c) 118 (117) Lewis Sallie (c) BEECH AV--West from llSOPeacock Julius E 116117- 158 Hugenin av 120 (117) Hampton Rutherford (c) 122 (243) Williamson Floy Mrs O 0 112253 LRaonggerfsordJunJoiohrn (c()c) P-'Wowrieglhlt W Leo Geo T 1200-Garfield Howard R 1210Logan Arth M BELLEVUE--3 miles w of city limits 1250-Grechi Gueseppi mus tchr 126 Wyatt Dora L Mrs 130-ORay Thos J 1310-Lewis Lorien W 140 Shi Jas D 142AHarwell Chester A Holt av intersects 200'-0uzts Beni F 200aOHardison Henry C 202*Dohn Philip H 204&Deaton Harry W 207ATaylor Wm A 209-0-Sampler Wm M 221 Epps Hardin B '231-OStanford Augustus L Blackburn intersects BELLEVUE ROAD -- From Forsyth rd w to American blvd, 3 miles n of city limits C of Ga Ry intersects 0-Bibb Mfg Co cotton gds mfrs 1-2 Ward Danl 3-4 Cook Geo W 5-6 Caldwell Bennett 7-8 Horton Ellis 9 Logan Henry V 10 Parks Hubert D 11 Sapp Jason W 12 Cole John W 13 Adams Wm P 14 Haralson Perry F Cole Roosevelt V 301 Vacant 15 Cole Andrew F 331102-00SJhoihpnpsonBecni FRinley 3140-OxJley Mary D Mrs 16 Horne Jas 17 Hall Wm O 18 Kittle Carl C Oxlev Paul R 19 Wesson Jas W 3150Smith Lawrence O 21 Arnett Mattie Mrs 3170Cone Walker L 3190Brazzeal John J 22 Braddv Mary Mrs 23 Williams Claudie Mrs 323 Corinth Primitive Baptist Ch 24 Teague Wm W 3280-Bames Ernest V 25 Roberts Bowlin C 3300-Scheibe Louis W Hendley ends 402OLangston Alex T 410OScott Elbin P 4110-Wood Thos M 4180Ezell Jos R 25% Barfield Robt M restr 26 Peeler Wm H restr 33-AHendley Wm T gro lOlAWilliams Chas H gro Blossfield i*nte*rse*cts 419 McDuffie Walter B 421 Parker Jas R 4230Craddock Harry W 425 Vacant Lake intersects 125 (30%) Vacant 127 (31) Guiton Wm 129 (32)ADickens Jas W 430OGuy Ralph S 4320Green Lucius C 440OToole C Julian 4480Gaultney Edmond T 456 Vacant 131 (30) Sims Frank E 133-AWills Jos E gro cor Wilder Lillian MrMs elrosgerointersects 4640Tague Howard J BELMONT AV (Formerly Pink St) -- 4720-Brown Bessie Mrs West from 206 Winship av Birch intersects 191 Marshall Onian E 500'-'-Bloodworth Harvev B 193-0-Butler Sami L 501OMcCommon Robt L 1950-Priester Wyman J 5020Dixon Wattie E 1970-Johstono Hugh E 5030-K-endall Randall P 504OTidwell Oscar S Duncan av intersects 213-OHenderson Manoah F 505OWard Donald M 2160-Meadows Ralph A 413 MOTOR PARTS CORP. Complete Part* Service--Car*--Trucks--Busses and Tractor*--Automotive Machine Shop 619 THIRD ST. PHONE 4800 BELMONT AV--Contd 218 Ernest Lucille Mrs 219*Broach Alex H 220 Free Methodist Church 222ATurner Harry E @ 224 McGee Wm W 222256/-M'-Taucronner Wm E Eoline Mrs 230'2-McGinty Homer 231&Harvley Alf M 241 Clark Leon P 243 Roberts Thos 249 Pettev Oscar D 251 Brake Luther E 293 Hudson Nicholas C 294hChambliss Paul 296*Bruner Geo H Oakland av intersects 302 Shelton Otto 314AReid Amos G BERTHADALE DRIVE (Vineville) --West from Rogers av to Corbin, 4 north of Clayton 1 Hill Mabel (c) 2 Horn Lillie (c) 34 VRialceyantLee (c) 6 Howard Thos (c) 7 Wynn Simon (c) 89 TBhooykminas JoBhanrtoCw ((cc)) 10 Reynolds Lonnie (c) 11 Berthadale Baptist Church (e) 14 Foster Geo D (c) 16 Foster Felton (c) 22 Holster Fannie (c) 105 Carter Geo C (c) 107 Carter Geo C ir (c) 111 Cain Jas Rev (c) 116 Foster Herbert (c) 316-Kennedy Emmett E 391 Causey Wm H 394 Whittington Chas H 396AHowell C Marvin 397 Hampton Minnie Mrs 398 Orumpley Ruben F 399 McDaniel Harmon C BEUNA VISTA DRIVE --From Montpelier av N, 1 w of Brentwood av 103*Weaver Clyde W 104*Brown Harry B 110067*GCeonpoenlaendJ AElronnezsot T Virginia av intersects BEVERLY PLACE -- From 219 Vineville 410 Holland Jas F av w to Central of Georgia tracks 412 Williams Geo 413 Elder Paul O 414 Barksdale W Howard 415ABriggs Russell F 418 - Grimes Wm V 103&Jones Robt B llO'-Roberts Vivian H 111184-&C'PDeanvnis WDmanlJHjr 119AMason R Holmes BELVADIER DRIVE (Ingleside)--North from Forsyth rd, 1 w of Auburn av 204&Brant Willard E 206'i-Thompson O Richd 212iPoe Hugh J Osborne pi intersects H27ABazemore Wallace L 129ALane Andrew W 130 Vacant 135&Friedman Sidney L 141AWilliamson Odell W 142AThompson Wm A 146*Lowe Henry E .ir 232&Glenn Harry J 147ARogers Theo W 24H*Dayis Walter T 150*Flournoy J Everett 242-Q-Crowder Thos O 175*Walker Walstein L 247AHumphreys Thos H 251&Pair Sami G BIBB (East Macon)--Changed to Mill av 260 Kinnett Don D 264&Cullom Henry M 266*Wade Marion P BIBB AV--From First to Jackson, 1 s of Oglethorpe BENNETT LANE- -North from 711 Walnut, Vi blk 3 Summers Rabun L 4 Grant Dessie 5 Summers Raymond 1 107) Vacant 6 Chastain Lawrence B 3 (108) Vacant 4 (157) McKelsie Lilia M (c) 78 WChilekrersy WJomshua 5 (.1510) Vacant 6 (159) Crumbley Jas (c) 7 (1710) Vacant 9 Newton Cecil G 10-12 Nobles Wm 11 Smith Cannon C 13 Jones Dolly Mrs BERKLEY DRIVE (Bellevue) -- From 14 King Chas C Forsyth rd to Park, 1 east of Euclid av 115 Brown David 100 Dixon Malcolm R 16 Magahee Thos 104-0-Allen Harry T 17 Womack Rufus Euclid intersects 18 Jones Melton 201ASmith A Edw 202AMiller Wm W 204APeirce Clifford E Faircloth Geo K 205*Davis Wm J 207*Wadley Frank H jr 221009/*-DReradkde Ernest .ir Raleigh M 212ASalter Kirk 218 (216)AJackson Gordon L 220--Carson Carvel H 222 Johnson John H (c) 224 Vacant 19 Davis Dewey H 20 Cochran Chas 21 Walker Gaines 22 Epps Marvin C 23 Cotton P W 24 Fair Rufus 25 Long Elliotte 26 Dunn Elery 28 Howell Needham L 29 Driggers Pearl Mrs Dixon Elmer 30 Bacon Albert H 31 Collins Eulie M 32 Morgan Maude Mrs BERRY--From Bartletts la east, 2 south 33 Mitchum Clayton of Napier av 34 Fair Chas 304 (405) Denton Chas A (c) 35-37 Chastain Guy B 306 Denton Wm (c) 39 Bowdoin Stoddard W 308 Singleton Jordan (c) 41 Watson Allen 309 Barnes Wm T (c) 310 Vacant 315 Davis Sims (c) 321 England Judge (c) BIRCH (Napier Hts)--From Roff Home av s to Montpelier av, 1 west of Virginia We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 3S4 4th Ave. New York 414 T. L. W 0 0 D Plumbing; and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. 64 BIRCH (Napier Hts)--Contd 119-21 Barnwell Square Apartments Apartments: 1/.'-Forrest Robt L 2-Q-Conaway Paul M 3* Cohen Isaac 4ABaldwin Cecil A Street continued 122ABarnwell Bee Mrs 123 Till Frank K 124AJohnson Jas W ir 125 Barnes Geo L Evans Eug 127 Griffin Geo W Napier av i*nte*rse*cts Beech av intersects 701ABaird Robt T 703AThompson Clark A 707/Lester Robt M 770191-A0-CNaelwhbovunJaHsoLrace C BIRCH (Unionville)--From Mosley s to Parker, 1 e of Park 156 Cornelius Henry (c) 158 Beddenfield Carrie (c) 160 Cummings Wm (c) BIRD CAGE AL--West from 521 Broadway to Third BLACKBURN (NH; Formerly First av, WH)--Front 306 Napier av south 251 (350) Hunt Thos C Tidwell Lester E Napier av intersects 301&Willis Henry A Beech intersects 707-bAbel Harry B 722 Utley LeRoy J 728 Gospel Tabernacle 735 Holmes Oliver W 737 Marshall Douglas 749 Snckwell Chas H 755 Joiner Hubert W 763-bAbel Albert K 771/Carlisle Thos H 777&Gober J Fletcher 778 McCallum Chas L 785 Vacant BLOSSFIELD (Adams Mill) -- North from Water, 1 e Lake 22 Fuller Henry R 23 Miller Thos 24 Amerson Geo 25 Wilson Arth 26 Donaldson Sidney L 27 Fuller Sidney 28 Mills Lester 36 Fuller Maggie Mrs 37 Howington Jas 38 Murry Jas BLOUNT--From Rutherford av north to Nelson 3 e Houston av 100 (110) Daniel Walter E (cl 101 (1112) Tolliver Jas R (c) 110032(R22o0d)geTrshoimLoansniHe oRwar(dc) (c) 105 (101) Walker Henry (c) 110 (100) Walker John T (c) 200 (108) Vacant Cleveland intersects 210 (316) Bass Thos H (c) 299 Sanford Dock (c) 301 Jones Jessie (e) 303 Douglass Mollie (c) Hanson intersects 305 Jessup Lula (c) 307 Stephens Jas (c) 331010 SSimmimthonVsioRleotbt(c)(c) 315 Harshaw Wm M BOARDMAN'S ALLEY--From 321 First, bet Mulberry and Cherry 332108 VEvaacnasnt Rhodie (c) 322 Vacant 324 Murphy Cath (c) 332 Tolson Albert (c) 334 Rockmore Irene (c) , 335 Green Laura (c) 336 Curry Sidney (c) 337 Johnson Carrie (c) 354 Ryles Ruby (c) 355 Davis Putnam (c) 379 Jesse Robt (c) 388 Smith Wm (c) BONAIRE--From Turpin S, 1 e of Division 100 Edwards Acie C Rev (c) 102 Horne Lillie (c) 104 StJohn's Baptist Church (c) 105 Turner Sami (c) 107 Oliver Mark (c) 109 Losey John (c) BOND--From 218 Georgia av nw to College 138AO'Neil Benj P 213 Fredonia Apartments ApAaUrt1-mWehnatlse:y Harvey H A2/Powell Jas O Bl-O-Lovelace John W B2/Cbapman Corinne B3/-'Mang'ham Billie B4&McDuffie Sarah nurse CC2l!/AVnacdaenrston Louise C t C3A@trohecker Tallulah DD2HAVMacyarinckt 'Susan D3*Kenyon Adelbert C D4ASteele Frances Street continued 217AWood W Lee Bateman Robt L 221/Nisbet Tibbie K Mrs 227&Preston Chas M 233 Willow Apartments Apartments: l&/-'-BCuorotpoenr JSualriaahnunrusrese j 2 Jenkins Wilde E 3: Tyler V Curtis 4AEmerson Wm M SACotton Jos R 6 Vacant ] 7 Preston Maxine SAMorgan Mary Mrs Street continued 239/-'Hall Hubert H 245ALeaptrot Jas T ALpng John W /'Jordan Corinne Mrs ABramblett Hewlett L 255/-'Hurley Robt W 261 Vacant 263/-'Martin Wm E 265/Davis Collos R 267/DeMeritt Eug B Orange intersects 302AKemme Eugenia Mirs 304AMotte Chas I 305/Hardeman Giles G 311-0-Kendall Harry C /'Cowan John D /Willingham E Pringle 315/Z'H'Boroowksn Ina Jas C D Mrs //Hooks W Glenn 317/Jones S Gustavus 319/Coney Chas L 320/jSmitJh Robt L 322/Macon Ralph AScott Fannie L Mrs AWray P Herman ASmith Oscar B 415 HOTEL BOND (BELLEVUE) -- From Robinson rd n, 1 w of American blvd 1 Duke Warren N 2 Massey Ralph C 3 Hubbard Georgia Mrs Hubbard Roy M BOOKER'S AL--South from 420 Bay to Hazel 103 Lester Felton (c) 104 Lester Cora (c) rear Scott Claudie (c) 205 Jackson Jesse (c) 212 Finney Clyde (c) 263 Miller Buster (c) 337 Johnson Fanny (c) 330 Moore Edgar (c) 340 Clark Mary L (c) 342 Moultrie Mary L (c) rear Pain Lillie M (c) 343 Green Fletcher (c) 345 Preston Fredk (c) 358 Creamer Forrest (c) 362 Vacant BOSTIC LANE -- South from Woodliff to Stewart la, 1 east of Monroe 105 Ross Minnie (c) 107 Singleton Alberta (c) 109 Emory Mattie (c) 110 Williams Emma (c) 112 Vacant 114 Johnson Gussie 116 Grant Leola (c) 117 Warren Spencer (c) 111290 VHialcl anMt ary (c) 121 Vacant 123 Vacant 125 Howard Susie (c) 126 Early Lucius (c) 127 Howard Pinkie (c) 128 King Wm (c) 129 Vacant 130 King Essie (c) 131 Vacant 133 Bussie Annie L (c) 134 Brown Annie (c) BOULEVARD (North Highlands)--From 901 Clinton rd northwest 102AQwings John L 104ADaly Francis X 106hSullivan John L 108hJames Lucien L 109AKirven Ceil L llOACasson Adeline C Mrs 112-OMcBride John E 114*Rittenberry Harry 1160Ctow Aaron C 119-0-Levine David P 120AWoodruff Wm A 122ADublin L Roy 11237K-!ACAoolenxearndeJrohCnathGeyY 1354'Snyder Wm I 137 Allen M Everett A-Wood Chas G 153*Tebeau Claude Mrs 175 (207)*Blair John D 177 Clark Robt W 1855-Molloy Olah P Mrs 193Walker Nat R 1955-Hughes Otis F 1975-Harvey Chas B 2005-Sherwood Wm W 2025-Lineberger Eli J 2115-May Sami J 2155-Wa.rlick Hillyer C 2235Dunn H L 2315,Jones Walter P 2405-Turner Byron H 2415Crouse Jas E 2475>Parker Wm M 2495-Gibson Harry A 253AHendry Wm T 2595'Halliburton Minnie L Mrs 2675-Jordan Wiley M 260hFlynt Henry G Curry intersects 22775155-DJoahvnissonEdHwoinwaLr.d jrM Laurel av i*nte*rse*cts Summit av intersects 3321715A-BSwurinnsforJd CErbaewrlfeord jr 417501iver Frances E Mrs 4335-Reddy Arzado G 4455Knight Clarence E 4535Smith Marian W Mrs 46-15-Collier Wm L 4675-Hammack ChasNoErthav intersects 5035Deaver Bascom S Hon 515 Regero Frank 5-Cranford I Clyde 5315Hardwick D Frank Masonic Home pi begins 532AParker N H jr 534 Vacant 5365Tucker Jas H 5375Crossley Philip M 539-5Littleton Geo L 540 Royster Floyd jr 554593-0S-oBuecthkelattndGeWo WH 656APosey Oscar C 559AWhite Bridgett Mrs 5605-Batem-an Ernest E 561 Wehrcamp Paul A 5635-Lester Lula Mrs 564ATharpe Thos S jr >568ABums Robt L 5695 Woodall Wm A Clay av intersects 572AAdams Chas L H 574-5Smith Simms M 5765-Matthe-ws C Mason 5785-Davis Wm W 580 Bagley Leo V Highland intersects 5835-Clay Valeria E Mrs 5965-Wilson Ivanowna Mrs 5985Elder H Lester 9025-Kennington Henry A 9045Renfroe Carrie J BOULEVARD (Vineville) -- Changed to Elizabeth pi BOULEVARD AV (South Macon) -- Changed to Dixie av BOUNDARY--Changed to Edgewood av BOUNDARY WEST (Vineville) -- See Northwest Boundary BOUNDARY AV (Vineville) -- Changed to Linden av BOWMAN (East Macon) -- From 1226 Broad north to Jackson, 4 east of Fort Hill 100 (1225) Battle Minnie (c) 102 (101) Moore John (c) 105 (128) Redd Butler (c) 107 Jordan Jas (c) 109 Vacant 112 1J13) Austin Alonzo (C) 123 Reid Lewis (c) 125 Ballard Leroy (c) 144 (148) Carr Thos (c) 150 (148) Vacant Woolfolk intersects 200 Lundy Laura (c) 201 (116) Taylor Carrie (c) 202 (124) Gilham Henry (c) 203 (118) Sanford Dennie (c) 204 (225) Wheeler SChhoerstteSrtre(ect) la ends 206 (333) Hill Geo (c) Cowan intersects 300 'Savage Eug (c) 301 Jackson Eli (c) 302 (406) Barnes R Caesar (c) 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 416 WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Bloch, Entrance on Cherry, Second and Cotton Ave. Tel. 153 u 4coCJdO a: <2S 101 Vacant 103 Avant Ida (c) 105 Ross Robt (c) 107 Vacant 109 Vacant 111 Vacant 113 (7) Chambliss Wm (c) 117 Jessie Avinia (c) 119 (10) Bates Sulina (c) Wilder intersects 256 Home Philip (c) 260 Vacant 262 Ball Florence (c) 345 J'ackson John H (c)Wingal begins Telfair intersects BRIGHT AL--From 352 Bay to 321 Ash s 1M100 120 (330) Clifton Moses (c) 121 (76) Miller Mittie (c) 122 (300) Brooks Edw (c) 125 Hart Mary (c) 31 ((115523)) RWeiallmiasmsMaJorjsori(ec) (c) 5 (152) Snead Mary L (c) 7 (150) Thomas Emma (c) Patterson intersects 9 (155) Washington Emma (c) 205 (401) Vacant Hazel intersects 215 Waller 'Oscar (c) 11 (157) Floyd John (c) LlBBARtES We Have on File in Our DIRECTORY LIBRARY BRENTWOOD AV (Formerly Ninth av) --From Napier av south to Cherry, 4 west of Pio Nono av 105-0-Barnes David A jr 107 Craft Fisher A lOSAWolf Zelik 111 Suttles Claud H imeasey John W H11O4h-iVSaadnlBerurJeans BKMachen 117 McKay Marion L 1195-Green Lewellyn D 121&Schlueter Edw 100 (139) Smith Mattie (c) 101 (9) Williams Ozie M (c) 102 (114) Griswell Annie (c) 103 (10) Thomas Vallie (c) 104 (126) Tolliver Frances (c) 106 (12) Ransford Mitchell (c) 106 (436) Smith Payton (c) 107 (1) Williams Horace (c) 109 (3) Triswell Lawrence (c) 111 (2) Raines Frank (c) 113 (4) Sales Leonard (c) BRIGHT LANE--From end of Bright al - east to Elbert Contes of the 1985-Alley Aaron R 308 Olive Grove Bapt Ch (c) Directories of Practically Every City in the 2005Lewis Robt WBeech av intersects 2055-Brubaker Leonard H 2075Chestnutt Wm F 208 Spiers Chas K 310 (124) Brooks Carrie L (c) 324 Rhines Wm (c) 325 (444) Bivens Mary L (c) 327 (417) Smith Leland (c) 329 (346) Lindsey Thos (c) UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on u9 R. L. POLK & CO. DETROIT 2095-Garfield Kate B Mrs 2105Jones Patk W 212 HVaawcaknitns J Walter Date av ends 4300215C|ShilalsmbHliasrsryS Ellis 425 (915)5Carstarplhen Orin H BRcEhaWrdERaYv, A2L--weFsrtomof WHouoddsloifnf to Or34 Cedar Grove Bapt Ch (c) BRIEF (Vineville)--From 309 Douglas av west to 3d av 103 (109)5Swaing David (c) 105 (107) Brown Claude (c) 108 (264) Jones Alice (c) 109 (111) Callaway Louise (c) 110 (266) Jackson Wm P (c) 111 (271) Vacant 112 (268) Reese Nora (c) 114 (270) Williams Mary (c) 115 (275) Lawrence Ella (c) 116 (160) Braswell Jas H (c) 331 (144) Lowe Dollie B (c) 518 Warren Alex (c) 521 Calhoun Jesse (c) BROAD (East Macon) -- From Wilson, east to Main . 120 Wallace Cleo (c) 123 Smith Ann (c) 124 Crittle Pocahontas (c) 126 Hall Luellen (c) Duval intersects 152 Gilliard Julius (c) 153 (157) Hutchins Lucy (c) 154 Roberts Janie (c) , 155 Ford Louise (c) 156 Jones B J (c) 157 Randall Edmond (c) 158 Adkins Sally (c) 116610SBtLeunfkoer'ds EBdadpiteistJ C(hc)urch (c) 248 Underwood ScottM(ecl)rose intersects 251 Smith Henry (c) 252 O'Bryant Jack (c) 253 Jackson Mariah (c) BRIGHAM (Payne Mill) -- From Rose av south, I east of Bellevue rd 254 Billingslea Frank (c) 255 Morris Susie (c) 256 Payne Theo J (c) 417 ROBERT O. THOMAS 569 % Cherry St. REALTOR Telephone 1067 BROAD (East Macon)--Contd 257 Randolph Willie P (c) 258 Mitchell Arth. (c) 260 Gay Beulah (c) First ends 261hScott Wm (c) 262 Dorsey Henry (c) 264 Ford Irvin (c) 266 Bason Cath (c) 305 Sheppard J Edw (c) 307 (265) Stevens John (c) 400/-Morris Edw (c) Clinton intersects 402 Clowers Washington P (c) 404-0-Brown Edw (c) 451 Knight Frank (c) 454hingxam Wm H (c) 455 (468) Cruse Elijah (c) 459 (472) Newman Quintus jr (c) 460 Johnson Julius (c) 462*Rice Geo W (c) 470 Shaw Maud (c) Northern intersects 501 Carter Wm (c) 504-Q-Brown Andrew W (c) 551008AGArtekeinns GJeooshu(ca) (c) Siam intersects 520 King Wilbur iS (c) 552 Jordan Nancy (c) 555 Ford Margt G (c) 556 Epps Tymes R (c) 559-OWalton Henry C (c) Seos-Thomas Lula W (c) Lexington av intersects 660012 HPiattmsilTtohnosWEm (c()c) 602 Vi Finney Wm D (c) 604 Manson Clinton (c) 607 Jordan Clifford W (c) 608 Brown Arceloius (c) 610 Miles Benny (c) 612 Kitchens Floyd (c) 614hMatthews J P 616AWhite Ernest A 618-QKelley Thos E grCoenter i*nte*rse*cts Randolph intersects 700hKelly Thos E gro 701hSowell Oscar A gro 702*Hudson John E 770076hDJoaynesEdRwebecca L Mrs 708hMi'tchell Clifford 710hHightower John W 718hOwen Wm R 720 Taylor Evoyn Womack intersects 754 Barkley Hattie M Mrs Church intersects 806 Beck Callie Mrs Fort Hill intersects 815 Harris Atlee M 817 Andrews John W Maynard intersects 902, Pitts Homer B (c) 910 Viacant 934 Miller Sami (c) 935 Gates Walter S (c) 951 Coleman Thos E (c) 952 Rice Chancy (c) 953 Vacant 954 Rice Clarence M (c) 955 Martin David (c) 956 Bland Langster (c) 958 (957) Shinholster Daisy (c) Norris intersects 1003 Anderson Carrie (c) 1004 Caesar Wm (c) 1006 Shelton John (c) 1008 Thompson Viola (c) 1010 Ransom Josephine (c) 1014 Killens C Miles (c) 1018 Thornton Jesse T (c) 1020 Thornton Mary J (c) 1025 Ross Jas (c) Short intersects 1100 (920) Hill Robt L (c) 1102 (1008) Flewellen Purvis (c) 1104 (1010) Stevens Mary (c) 1129 McCray Chas G (c) 1131 (1135) McCrary Minus (c) 11113377A(1B21la4c) kBshraeayr HWarmmo(nc) (c) 1139 Vacant 1148 Anderson LucileBo(wc)man intersects 1200 Jones Sami L (c) 1240 Gorman Emma L (c) 1242 Davis Mark D (c) 1244 (.770) Jackson Terrell J (c) 1246 (1179) Laurence Wm (c) BROADWAY (Formerly Fourth)--From Ocmulgee River south to limits, 2 east of Second 102AMD&ISRR Co (frt agt) hMD&iSRR Co (coml agt) hMD&SRR Co (traffic mgr) iMD&SRR Co (chf dispr) 106hMD&SRR Co (traffic dept) 107 Vacant 120 Jackson Annie (c) 121 Williams Henry (c) 154 Modena DomPinaircakdise( al intersects 155h'City D6pt of Public Welfare 159 Mansfield Lizzie Mrs 160 Elsasser Lonnie B 161 Merriday Louis Walnut intersects 200btSou Oil Stores Inc (br) filling sta 217 Vacant 22251OAVAarcmaonutr & Co whol meats 225532 ^B3riCig8hiltlt Josephine L Mrs 257 Strotaerg Body & Fender Wks (side ent) 262 Smith Johnnie P Mrs 264 Herschel Merchant Tailor (c) 265hJones Thos M Mfiulllbsetrary intersects se eor-C'Central Hotel 330050-h-G'ClaamsseriPerhoarNmiacchyolas 307 Dixie Shoe Repair Shop 309 Lewis Levi L (c) 310-12hHickeys Coffee Shop restr 311 Silver Moon Cafe restr -- 313 Hatfield Geo W jr (c) barber 314A(Holt & Hanberry printers Scarborough Jas A rubber stamps 315 Brown's Barber Shop (c) 316*Silver Dollar The beer 318 Bateman's Barber Shop 319 Smith Gertrude (c) barber 319% Richmond Hotel (c) ASmith Relliford S (c) p'hys 320 Union Bus Terminal Southeastern Greyhound Lines Hood Coach Lines Bass Bus Lines Sou Stages Greyhound Sandwich Shop 321 McCook Clyde F beer 323 Hatfield Pelligrine M (c) billiards 351352353 Cole Edw R (c) restr 357 Douglass Theatre (c) 359 Hammett John R confr 360 Vacant 361 Douglass Chas H jr (c) billiards 361a Broadway Lunch (c) 363-ADouglass Hotel (c) Douglass Hotel Grill (c) restr 363% Howard Wm F (c) shoe shiner 365 Shier Sami shoe repr 367 Schwab Co The (side entrance) Cherry intersects 407 Jaques Building Rooms: 1 Vacant 2-3*Dixie Dental Laboratory Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 3 5 418 Phones 3266-3267 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 BROADWAY--Contd 570AKingman & Everett Inc Whol gras Jaques Bldg:--Contd 573ASands & Co Inc genl mdse 4 Vacant 5 Vacant eoOPAluKmenninmtegrtsoenctsJerome P 6 Vacant 7 Vacant 660083AVBarcoaandwt ay Service Sta filling sta SABroadway Trading Co loans 610-12A(Heard Jacob F auto parts 9 Vacant 6HAClay's Garage auto reprs lOASou inv Co ll-12ARoyster P S Guano Co fertilizer 613 Lane Clayburn B (c) barber 613%; Jones Dalton L '(c) restr mfrs 13AKline Prank W sign pntr 615 Vacant 617 Snipes Garage auto reprs 14 Vacant 618- 15ANorfolk Sou RR 619- 16-17 Redding W C Lumber Co 650-52ASOU Bell Tel & Tel Co (whse) 18-19 Vacant 653-55AMacon Cigar & Tobacco Co 20 Vacant rearABartlett Sheet Metal Works 21 Vacant 654 Vacant 22 Vacant 6S6ALoose-Wiles Biscuit Co wlhse Street continued 659ADuffell Richd S vet 408-'-'-M-Maaccoonn Transfer Co exp Transfer Co & Purn Exch 660 Vacant 667-73AMcCord Used Auto Parts 409AMatthews R H Inc jwlrs 410ABroadway Cash Market meats 411AJones & Coney printers 670-78AHapp Bros Co clo mfrs 667757|AVCarcawanftord's Barbecue Lunch 444444444444465515526511111579391401378A--AA-A--AA'BSV-LV"iVVANRMBMD-MMterRaaaaraeaddoeCAwuaetccaccxitncrrrahncclKocsaainaauuKddhwosuosnnnoneggaBnawneFnrottsrttssrrsPaseiddadsnPFoceyGesyoenaorrecneonndBa-WoBd&cRDenGrueruEiiaaacPlcBiCneRnrllkEtCyddgaciool'oibereSrolbn&hnianiDaobgnlvavlSltiiuiiiCotinvaTtnnTntuasirrgghsineddjlidslredIesisoanolCin&rtcasoCinrAwocLwtsehhohsrtoanoslnel cts- 1 r77777T777e7777777766656552522a00009134565783145932r616--AA----A-BVVT1FVOCF52BM5co8aeo0aadiamiuao(tAlbrabccArocAysdurrsceobaafatGmbyseAtoodhrnrnnoidsanWrnaadttAtsJmaDmnaCHogIcueSbmdrrseshaeltlyoedoh)esrarrnib-sBCusvnBeGMWaiulg&cruaAocte1uocrohPCehdtPdTaoScaejoasnrkrntwpaaiafnw(eCtaEnncucigrtPoooe)xcmlnniMSpMhdnCfrt(eeroeoocofrrscti)tseolsiokln-prriMtnrC5egCaCrAoscooesJoutcnatlisTetytepeMwriiltleinrg&C Street continued 767 Vacant 462 Solomon Steve M jr autos 708-7OANehi Bottling Co 463 Palmetto Barber Shop 769 -Kacsik Frank auto repr 464-66 Vacant 771AUnion Toney gro 465 Vacant Oak intersects 467 Kahdy Assif G fruits 4476,28A-7B0lAoeBlhernCdarGl Co real furs est ABibb Bag Co 473 Vacant Poplar intersects 5O0ACrane Co plmbrs' supplies 502-04ACorbin Supply Co mill supplies 503AWright Steve M Drug Store 505 Gray Robt W shoe repr Flynn Printing Co 507 Braswell das A (c) barber 507% Arlington Hotel Annex' 509 Vacant 509% Vacant 510-12ANU Icy Bottling Co Inc 510% Union Tailoring Co SlIAArlington Hotel 514-16ASou Sports Co sporting gds 515Apiantation Lunch restr 517-19ACity Storage Garage 518 Standard Paper Co 520ATerrell Auto Electric Co contrs 521 Vacant Bird Cage al intersects 550ANoland Co Inc plmbg supplies 553 Ahern J Francis news service 955 Lane's Hotel 557 Kennesaw The wines 559AChapman Lewis P news service 563ABibb News Co magazine dlrs 565 Southland Barber Shop 567ASouthland Coffee Shop restr - 569-7lAHotel Southland 802AGa Beverage Supply Inc brewers' agts 803 Vacant 804ASouthern Stages (garage) 805 Vacant 807 Henry Tailoring Co (c) Henry Isaac J (c) collections 809 Norris Wm J drug sundries 811 Souther Robt L auto repr 815AMacon Lumiber Co 816-18ACoplan Junk Co Inc 817 Vacant 819ALester Walter E wood 819% Lester Walter E 851 Vacant Hilliard al intersects 852ATank Car Service Station filling sta 858ADavis O F Truck Line 860AUnited Auto Co auto reprs 861 (867) Mapp Edw (c) 863 Delk Saw & Knife Works 865 Travers Tlhos restr lOOlAThomas LesteOr gAlethdorurpges intersects 1003ALeaptrots Market meats Jl005ALongs Barber Shop 1007 Busy Bee Lunch 1014-28ATaylor Iron Works & Supply Co 1025 Varnadow Mattie (c) 1029 Smith das (c) .1030 Vacant 1110033!32-'A35uAsMtinodMernilliGero(cce)ry Co whol gros Every Bottle Sterilized 416-420 Oak St. 419 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 BROADWAY--Contd 1034 ISkelly Edison repr shop 1034% Gireen Lois H(acw) thorne i.nt.ersect,s_ 1122 Cobh Lee Cc) restr 1122% Vacant 11112245-V5'Kacoalondtner Morris gro 1126 Vacant 1127 Macon Mirror Works . 1128 Lewis Lessie (c) 1129' Vacant 1130 Collins Iverson (c) 1131 Vacant ,, ., 1132 Anderson Walker (c) 1133 Vacant 1134 Fultz David V (e) 1135 Millbrooks Jesse L (c) 11113367ACBoalllkincsomA'slf SeCrcv) ice Sta filling sta 1138 Moore Wm (c) 1140 Lucas Sol W (c) ,1142 Smith Mary (c) 1144 Barlow Florence (c) Bay intersects 1200&Belson Max gro 1202 Vacant 1204 Vacant 1206 Coney Taylor Cc) 1208 Walker Alice (c) 1212 Clay Wrecking Co auto wreckers 1213 Lightfoot Robt Cc) (barber 1213% Riggins Jesse '(c) 1215 Sanford John H (c) gro 1216CStillwell Constr Co genl contrs 1217 Stephens Minnie Mrs gro 1218AClarke R L Co bldg material ,1219 Gullatt Wm E (c) Shoe repr 1220 (1232) Broadway Clnrs (c) elo 1221 Vacant 1223 Vacant 1225 Vacant 1227 Moran Chas A 2d hd Clo 1229 Vacant 1231 Moore Effie (c) 1232 Lee Nellie (c) 1232% Crew Inez (c) 1233 Redding Wm Cc) 1234 Hines Ruth (c) 1235 Spence Geder A shoe repr 1236 Dudley Elijah (c) ,1237 Kitchens Jas B beer 1238 Rembert Jas (c) 11223490ASPaolowoemr OCilasChoGCrobr) filling sta 1241 McCall Josephine Mrs restr 1433 Matthews Malachi (c) 1435 Thomas Janie (c) 1435a Thorpe Melissa (c) 1436 Jackson Mary (c) 1444 Vacant 1446 Vacant Elm intersects 1ll550001AVMacacaonnt Casket Co 1502ALackay & Lackay gros 1502%BoLialecrkmayakeHrsallUnion SBhroeethterMhoeotadl oWf oRrykeCrsarUmneinonof Am Lodge No 256 11550034AVSaacnadnetrs & Tripp barbers 1507 Vacant ISlOAHight Chas O 1155111'7-COBanakneor nGCeolarFence E 1518AWaller Beni I Waller Thos F Rev 1520 Wade J Willis 1521 Dix Wm D 1522 Oardell Barney 1525 Langley Henry V 1530 Whitehurst Burt 1531 Revels Lillie M Mrs 1]532 Jones Frank 1534 Andrews John R 1536 Vacant 1537 Sanders Homer L 1540ABennett & Co gros 1540% Vacant 1543 Bales WalteErdgLewood av intersects 1601ATinsley's Grocery & Market 1613 Beulah Baptist Church (c) 11662214-AJoDneeans WEthaletler(cG) gro 1633 Blackshear Lemon (c) 11663550AWPiolpdpeerll JBaseul(ac)h M Mrs gro 1701 Pryor John '(c) |1703 Vacant 1740 Dryb Walter 1741 Robinson Clarence W 1743 Hall Martha E Mrs 1745 Peyton Thos J 11774497 DBuennnnetRt oCy hLas jr 2d hd clo 1751AMoore Arth B groWood beg.ins 11880017 BWuilteleyr SWudilime an (c) auto repr 1243-45ASaloom Jos genHl amzedlseintersects 1811 Hall Esmer M 1818 Utility Club Milk Clime 1301ASagnibene Jos meats 1301% Saloom Sadie Mrs 1302 Robinson Chas W jr filling sta 11330034*HMoamcoenFLurinneisnhiSnguppCloy Co 1305 Vacant 1306 Thomas Fannie (c) 1309 Dudley Andrew (c) 1310 McBride Alonzo (c) 1314 Jolley Algie L (c) 1315 Teague Wm (c) 1316 Stough Geneva Cc) 1321 Willis Adele (c) 1325 Evans Rosetta (c) 1331 Harris Monroe (c) 1335 Hawtry John (c) 1343-0-Davis-Passmore Roofing Co 1368Shell Petroleum Corp (office) corAMcCook J W LumbAershCOintersects 1820 Ward Wm M 1821 Scoven O Raymond 1823 Barnes Elias L 1825 Vacant 1827 Banks Myrtle F Mrs * Gi*les b*egins Stratton ends 1905 Williams Geo H McGarrah Fabin 1907 Hill Beni F , _ 1911 Standard Paper & Paper Stock Co 1914 Adams Louis 1920 Hadaway Geo M 1922 Hall Cero G 1924 Edwards Sami Reid intersects 2001*Brown Wiley C 2003 Jenkins Sami G 2007 Kitchens Wm W 1402AJones Addison D gro 1406 Haywood Jas 1408 Vacant 1409 Buckner Orf (c) 1420 Howard Melton >(c) 1424 Williams Henlry (c) 1425 Robson Tommie (c) 1430 Ross Hartwell '(c) 1431 Jordan Sami ,(c) 1432 Parham `Parthena (c) 2011 Hambrick Edw C 2018 Vacant 2020 Hutto Monroe 2022 Vacant 2023 Harrington Jesse J 2024 Vacant 2026 Vacant Jenkins begins 2105 Boutwell Geo B 2106AGaines Chas M jr YOUR CITY D I R E C T O R Y MIRRORS the Industrial LIFE Of Your CITY 420 PRINTING ARLINGTON HOTEL BINDING FREE STORAGE BMRoOdeArnDWaAndY. RNeaEsAonRabPleOPRLaAteRs (tA Good Place to Sleep" THOMAS O. MOSELEY, Prop. RUBBER STAMPS THE BEST WORK CORRECT B21R0O7 ASiDmWoAneY--JaCkoentSd 2108 Bush Geo T 2109' Crawford Jas E 2125 Dyer John A 2127*Epps Glenn A 2129 Bruner Sulinda Mrs 2130 Mixon ,,W,,m ,,H DeBorde intersects 22113321*HSimckisth ABnlnuaforEd ME rs 2134*Griffin Ralph WE 2215 Irby Nora Mrs 2220*Bush Albert T 2223 VSlaoccaunmt b Mary Mrs 2224 Baldwin Jas C 2225 VFiaecldasnt Clarence C Johnson ends 103 Crawford Marie (c) 104 (73) Maddox Dolie (c) 106 Goodwin Ella McDonald av intersects 330012OOBCoaonnneonToCohfasA L 303OGill John J ^ 304OStevens Walter C 306OBarry Arth P 30i6ODoyle Edw B _ CABANISS AV (East Macon)--From 103 (Hill west to Center 100 Smith A Clinton 101 Vacant 102 Vacant 110034 AStdeavmenssoCnhaTsurDen B 105*Cook Albert P 105%' Carmichael Leonard N 106hFinney Grady P 107 Smith Mattie E Mrs 108 Cheatham Elbert H 109-0-Wood Sidney E 110 Steadman Andrew J 111 Jones Jas A CALHOUN -- From 270 Maple south to 307OMitchell Donald G jr limits 308OLittle Annie C Mrs 3O0OWhitehead Edw S 3160-Grinalds Archie S 3311!2O0BJoriynaenr CJalsaudBe jr 3130Whitehurst Wm M 314 Vacant _ 315*Mathews Thornton L 317 Walker W Brown 3180-Knight Otis D ' 319 Haley H Franklin 320*Thompson Leroy B 3210Talley Phil E 3220Hardy Fredk C 3230Lowe Edw M 32400romwell Jas O 3250Hay Roht L 3270Toole Glenn jr 3280Mathews Jas W C 3290McDuffie Wilbur E 3310Robertson Clifford M 101 Collbert Jas V (c) 110 Hinson Mary R Mrs 111 Roberts Jas T (c) 115-0-McCowen Jas C Oglethorpe intersects 209 Franklin John L (c) 212 Speer Hallie 216 Roach Eliz Mrs 217 Brown Monroe (c) 219 Gilmore John G 220 Lavender Jas A 221 Griggs Walter (c) 222 Sanders Earl (c) 225 Washington Curtis '(c) 226 Vacant 230 Thomas Alonzo (c) 232 Locket Wm (c) 234 Jones Geo (c) 238 Nelson Mary (c) 239-0-lrvin Wallace (c) Hazel i.ntersect.s BURKE (South Macon) -- East from Capital av to Mikado, 1 s of Davis 312 Turner Jos (c) 314 Harvey Mary (c) 316 Jackson David (c) BURKNER (Bellevue) -- From AmericHaonmeblrvdd west, 1 north of Industrial 318 Jackson John (c) 323 Durden Mae Mrs 325 Singleton Walter H 326 Henry Julia (c) BURNETT (East Macon)--From 431 (425) Elliott, east to Flanders 302-03 Welch Pearl (c) 308 Collins Henry (c) 311 (315) Reese Charlotte (c) 312 Patterson B 1(c) 315 King Georgia (c) James Laura (c) 316 McCray Jos (c) 317 Oliver Martha (c) 28 319 (310) Reid Ida B (c) 324 Stubbs Prince (c) 327 Pope Sallie Mrs 330 Mims Green D 331 Hudgins Chas C 334 Byrd Thos 335 Yaughn Lula Mrs 3375-Tucker Felder 338 Brown Drewie 341 Westcott Ludie ' Ash i.ntersects 408 Herrington Grocery 412AHerrington Herbert C 415*Ashley Murdock L SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 422 YATES MOTOR CO. 707 THIRD ST. PHONES { 1446 1445 DeSoto Plymouth CALHOUN--Contd 416 Thompson Mary Mrs 4181 Strong Wm F 42(K'-Dumas Maude W 421 Brady Thos E 424-C-DuBose Edwin A 442267 VJoanceasntVirgil 431-dMcLean Wm O 439 O'Neill Chas 440-0-Bush Nellie Mrs Elm intersects 507 Allen J Sydney 511 Simmons Norman (c) 512 Gallimore Floyd (c) 517 Wheeler Wm (c) 518 Winn Goode (c) 519 Bass Minnie (c) li 520 Quinn Katie (C) 522 Jackson Shuler L Rev (c) 524 Vinson Lucinda (c) 526 Dozon Fannie (c) 527' Guirr Lizzie (c) 528 Logan Claude (c) 531 Chappell Walter (c) 535 Knight Ezekiel (e) 315 (316) Williams Lloyd (c) 360 362 Bryant Vacant Willie (c) 401 (729) Rowland HReonbrtiet(tca) intersects 402 R(7o2w4)laGndordLoiznzieAd(ac) (cc)onfr 403 (731) Bailey Sarah (c) 404 (726) Wheeler Jos (c) 406 407 Vacant (725) Richardson Minnie (c) 408 (720) Nix Clara (c) 409 (727) Watkins John H (c) 410 (718) Cooper Raymond (c) 412 (716) Edwards Martha (c) 500 (714) Cole Lacy (c)Curd intersects 501 (713) Jordan Claude (c) 502 (712) Gullatt Wm E (c) 503 (715) Slocumb Wm (c) 504 (710) Hicks Richd (c) 506 (708) Nelson Ira (c) 508 (706) Evans Jas S (c) 509 511 ((770095)) Braswell Reuben (c) 539 Vacant CAMPUS AV (Western Hts) -- From 543 Willis Emma (c) 1353 Edgewood av south CALLAHAN'S AL (SM)--From Junction School and Second west to Phillips 276 Price Julia F CAPITAL AV -- From 552 Oglethorpe CALLAWAY (V)--From 531 Vineville av north 102ABurson 'Homer E 103*Wynn M Byron 104-S-Bailey Geo IS lOSAO'SIhaughnessy Wm J 107-'Q--CWoabtbsoWn iJltoDnurEward 1 ll&Lamon Harry V 1ll1S3-'--oiFpoinrctehrerCBlinentoj n HC 116hlSnow B Cufobedge 117hMallary Nelson D 1121080*-FWlaetaavuer IHsauadcnall G south to Hawthorne 100 Barker Clifford C 101 Harris Thos J 102 Garvin John C 103 Vacant 110045h-RMocdKgeenrsnaCWhams AA 110076ABAalilleeny WDmavidC 108 Walker Jas B 109 Leverett Edw 111 Sanders H Fuller 112 Gann Lizzie Mrs 115 Spears ;H Grover Hawthorne intersects CALLAWAY GROVE -- North end of Callaway CAPITAL AV (Mikado PI)--From Davis south, 1 east of Houston av 100 Molton John T CAMPBELL AV (SM)--From Edgewood av south, 1 west of Nussbaum av 100 (500) Bivins Monroe (c) 102 (501) Harris Geo (c) 103) (502) Watkins Jas (c) 104 (503) Hicks Mary (c) 105 (504) Akridge Nunar (c) 106 (505) Wells Cora (c) 107 (506) Vacant 1100981 (512) (508) Alhea Eva Vacant W (c) 111 (557) Pollock Oath (c) 112 (533) Anderson Edw (c) 113 (529) Taylor Frank (c) 114 (532) Birdsong Malinda (c) 115 (531) Bell El'la (c) 201 Johnson Arth (c)Prince intersects 110043AHDilulPrCeehaEs rnNest L 105 Pippin Thos M 107hSmith Beni T 100 Knight Winton 115 Hooker Henry C 119 Clarke Turner A 231 Hewell Arth M 233 Arnold Robt T 236 (136) Humphries Annie Mrs Chatham intersects 300 Killebrew Edgar L Moxley Seab J Toombs intersects 400 Lavender Henry J 407 Busbie Jefferson J 411 Jones Essie Mrs 505 Sauls Griffin B 203 Turner Perry (c) 204 (405) Glover Sallie (c) 206 (302) Summerford Mary (c) 206 (407) Howard Edw (c) 207 (205) Johnson Thos (c) 20 (409) Owens John (c) 209 (305) Coley Ella (c) 210 (270) Reeves Frank (c) 211 (307) Cody Amelia (c) 213 (353) Lucas Chas (c) 301 (302) Vacant Elizabeth intersects CAtoRLCIoNluGmbAuVs,--1Swouetsht ofrfoLminCdeonf aGva Ry 141 Goodwin Maude Mrs 142 Taylor John (c) 143 Heath Hutton H 144 Howard John (c) 146 Mills Ernest (c) 150 Addleton Seaborn J 154 Thomas Jas W Dannenberg av intersects Rembert av intersects 303 (304) Bailey H Woodfln gro 305 (310) Thomas Sami (c) 307 ( 308) Taylor Edw (c) 308 Vincent Lillie (c) 309> (310) Fluellen Lester (c) 310 (309) Cater Thos H (c) 311 (312) Solomon Wm H Rev (c) 313 (314) Vacant 201 Wilson Roy L 205-dFogarty Thos Z 209 Batdheior Atkins 213 IStewart Theo 215AHampton Bessie M Mrs 217ATucker Harry C I 219 Nail Maggie Mrs 237 Vacant 423 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement -- Plaster 457 Third St. Phones 277-278-279 $ C, 233333333343343334344A444444440413001410330023343222032332533339541R17201756438!-33966-4317128-3****-*&A*-*L0****VB******HC*O(J-CMLYK-KSSYWHIGLA'PBFFRBaRHiMDHaNaaanlcnoieocraaaaoruoatlczuntoiraeaeaeulolwGyikyln|cyruraeedtwgrngslrnrlrnrwmesdhgyncnldnoea1urgteggoLerrdiegrebnthGemtAsllJsHAsbrurelynotnnryiulaLosrelnmneESxVoFsEtvDooeAyWdMhfaGoaAJRJeW--OvCJruframeodrlaeSirgoCauAmbEllntrEehmwaWCBsaGirFibreldsccHtnyoorFtCrhCeBLMweutatrCLALnaooHFeoDCaG* soolO itnSwarltnlMndlgResokwePMBaaryMmrtncdodMaoLrnnMsnRrJstaearrvsvv i.innt,teerrsseecJMcot,tssneletsonCS11111E11112111122222222s65a55678012117177088112J338232D2o13265286l238984505003o83174291l9uAi**h**VDLFDGP*SeICFtCCC(BGCTSVHVHLRh(1MRrSnEriatrya2ruoaaaba1auar,noeieohaaeaerWlkcle3mmmam7rsncvldeolwlrdcdiecgdMlexasni)k5rk1imsdioangambpp(posawnsesev)aeeJSsntWneseMbb*brhhhyntMCrtaayroeaaeysotytHeeetaAsnnlnnsalmaullllLwlrJaAHAWalllsenDsrEtJoJreGlthsvRHdlHMWaedHolelheoiCLhmSzWruEcnnsasomannoeeaoeaeOhmyrcDdbMrwyaftynrypJaerTMwBttrvOaoasyiMsJdMaeiSnMeCtMsLJrncJeyHlesrWoRHCJsacMEnerBoLOL)vnnrG--iskdniilFnerssomiinntteeWrrsseoecoctdtss 455*Rankin Alberta Mrs 456*Johnson Thos R 235 Hollingsworth SaDmeBi oRrde i.ntersects 457*Smalley C Hugh 458*Casteel John B 459*Lary Nancy B Mrs ' 460*Watson Eliz Mrs 467*Hicks HerbMerotntApelier av intersects 228889 VScaocgagnitns R Thos 292 White Jas M 292 Demarest Mary F 294 Hunt Jas R RevWyche i.ntersect,s 501*Davis Maude 6 Mrs 503*Mosely T Hubert 310 Stokes Ennis WGhitehead i.nt,ersect,s 505*Laney John F 506*Laws'on Warren P cor Jones Chapel Cemetery 402 Vacant 508*Jones Wm N 404 McGee Sami 591*Ashmore Wm T 593*Domingos Walter D 595 Rogers Susie Mrs West End av intersects 602*Gilreath Zebulon H 405 Cannon John D 406 Felker Wm M CEDAR (Unionville)--(South from 822 Montpelier av 605*McConnell Odessa S Mrs 606*Davis A Jos 661167*BCloalcekmbaunrnBReroryy MW 620*Cassini Louis mosaic wkr 621 Hilley Dozier A 622*Cummings John M 662253**MSwaacnosnonShAirglenyes JE Mrs 101 Calloway John (c) barber 102 Fletcher Jas (c) blksmith 104 (115) Troutman Sarah (c) 105 Bowden Jas H (c) 106 (5) Hogan Wm (c) 108 (119) Johnson Lillie M (c) 109 (4500 Justice Butts J (c) 110 (122) Dawson Wm (c) 111 (154) Carr Hemry (c) CARLISLE AV--From Log Cabin Blvd south, 1 west of Burton av 105*Harris H Earl 107*Amerson Grover C contr 125*VanLandingham Clyde H CARMAN PLACE (Lynmore Est)--North from Gantt City rd to Marion av, 1 south of Melvin pi 601 Daugherty John O 658 Samples John C (c) 113 '(152) Tignor Oscar (c) 115 (150) Russell Hattie (c) 117 (123) Thomas Chas (c) 122 Hightower Love (c) 123 (156) Fambro Leonard (c) 124 (126) Smith Thos (c) 126 (127) Sanders Wm (c) 128 (155) Mitchell Della (c) . 130 (148) Howard John (c) 159 Chapman Silas (c) 161 (158) Rose Marion (c) CAROLINA AV--From 1410 Vineville av to C of Ga Ry, 1 west of Alabama 202 Vacant 3 204 Pendleton Annie M (c) 205 Whitby Matilda (c) CARTER (Bellevue) -- From Tharpe west, 1 north of Robinson rd 101 Bowman Monroe (c) 102 Wyehe Henry (c) I 103 Howard Ananias (c) 206 Jones Mattie (c) 207 Buckner Julia (c) 208 Bivens Emmett O Rev (c) 209 Strozier Emma (c)Sutley i.ntersects 211 (214) Ryan Robt L (c) CARTER'S AL--South from 618 Elm to 214 Elliston Wm (c) Edgewood bet First and Second 215 (216) Fletcher Wesley F (c) 221 Aiken Jenny (c) 217 (218) Smith Lula (c) 222 Vickers Beulah (c) 220 Davis Asa (c) 224 Williams Annie (c) 221 Lamar Aaron (c) 225 'Cummings Rosa (c) 227 Franklin Glover (c) 222 VIQraYvcHa->ni t Al rvrvzn ?! %% and Linen Service 20% DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information you are unable to procure elsewhere, call on ns R. L. POLK & CO. DETROIT 424 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 CEDAR (U)--Contd 599&Kurtz John H (c) 224 Carswell Danl W (c) Cowan intersects 225 Bowden Clifford (c) 600 Wright Nelson (c) 226 Wyche John (c) 602 Thomas Robt (c) 222278 M(23it0c)heRllainReusfuMs a(rcg)t (c) 604 Manson John W (c) 605 Hightower Emory (c) 230 (233) Leslie Edw D (c) 606 Brown Claude (c) 236 (235) Ballard Jas (c) 607 Graves Benj (c) Neel intersects 609 Williams Richd H Rev (c) 241 Smith Lonnie (c) restr 610 Pitts Jacob (c) Dempsey intersects 301 Woodward Boase (c) 661110%PaSrmkeirthJoJehsnseH(c)(c) 304 Johnson Lelia (e) 612-0'Goolsby Wm M Rev (c) 306 Jones John H (c) 690 Vacant 308 Barnes John (c) Hall intersects 312 White Arth (c) Straight intersects 700 Vacant 702 Weathers May (c) 314 Shelly Jas (c) 704 Pinkston Wilhelmina (c) 315 Sanders Marcellus (c) 706 Sawyer Wm (c) 320 Smith Ida (c) 750 Persons Dinah (c) 321 Hester Hillyer (c). 752 Walton Jos (c) 326 Floyd Joshua (c) 753 Carson Jas (c) 328 Adams Chas (c) 755 Mayo Mary (c) 329 Jones Wm (c) 403 (819) Thomas Mosley Mary (c) Mason intersects intersects 425 Ward Emma (c) 811 Barber Jas (c) Mitchell intersects 813 Crawford Freeman (c) 840 Clyde Jas C (c) 841 Scott Jas (c) 431 (430) Hester Mary (c) 435 Stanford Louis (c) 437 Vacant CE2N60T5RBArLoaAdwVay(Swouetsht, M1 ascoount)h --of FErlolm 203dGilbert D Wade CEDAR LANE (SM)--From 405 Cedar to Second between Smith and Ellis 403 Hill Jas F 205 Vacant 210-0-Pollock J Allison 212 Burnley John L 405 Nipper Andrew 340 Davis Wm B 345 Burns Mercer CEtoMEMTaEdRisYonLA--West from 125 College 126 Griffith Zachariah (c) 349 Lockerman Ernest C 335502-0O-HJaacrkvseoyn JoBhronwHder F 131 Vacant 355 Dansby Smith 133 Vacant 356 (300) Sullivan Ira B 135 Grazette Mabel (c) 137 Booker Belle (c) CENTER (East Macon)--From Arlington north to limits, 1 west of Church 100 (3) Hunter Hattie (c) Hydrola intersects 102 Rozier Stanley W 104 Kitchens Jas E gro Garden intersects 202 Joiner Wm E 204 Mathews Lemuel F CENTRE (Monroe Hill) -- Continuation of Forest av CHAPMAN AL--South from 620 Arch to Oglethorpe bet First and Second 614 Coats Luther (c) 616 Thomas Edw (c) 618 Morgan Osie B (c) 620 Smith Ruby (c) 624 Myers Lillie B (c) 625 Bates Mary (c) 205 Stripling Lawrence T 206 Fox Richd K 209 (155) Bryant Anna (c) 210 Schafer Raymond F soft drinks 211 (157) Turner Wm (c) 213 (159) Quinlan Lula Mrs 214 (156) Schafer Sallie T Mrs 215`0-Wilson Dollie F Mrs 221228 ((226680))*RRoobbeerrttss GEveoelyWn Mrs Lee intersects 300 McCullough Howard 301 Price Mamie Mrs 304 Bowers Lewis CHAPPELL (South Macon)--From 146 Church south to Whitlock 110 Turner W Jos gro 114 Moore J Lawrence 116 Bibb County Nursery School 120 Webster Robt L Steele intersects 215 Holmes Tillie Mrs 217 Wilson Jas P 218 Myrick Mary Mrs 219 Hester Jas T 221 Jones Jos N 224 Malone Hodge H 227&Wallace Lorena Mrs 339065-CR-iDceaugPhatruyl RBeedy W 307C'Cheves John L 223303*PRroebsetrotns JWHaletenrryE Stratton intersects 309 Stuckey Cecil 299 Tanner Harold H 310 Sapp John W 301 Vacant Brown Henry G 314 (354) Mullis Carlton E 318 (360) Dalton Anice Z Mrs 322 (364) Mullins Julius M 353 Balkom Tommie W 303 Reddy Racey L Mrs 305 Sanders Jas D 307 Hester Rachael Mrs 314 Kitchen Carl 315 Fincher Boone 450451454 Vacant Broat O d intersects 333111687 MSEmvaelirltiZBahdroagdDlrekzuciMLonaJmkaouthrtianBe rByMMaMnrstrsJ 319 DuBose Ernest 456-OMaund S Francis Mrs 320 DuBose Louis Woolfolk intersects 322 Davis Marion S 501 Mallary John B Rev (c) 324 Smith Aaron 503 Conner Danl N (c) 595 Orr Obie W (c) 412 Davis Harrold D Reid intersects 597 Daniels Frank (c) 413 Dixon Arth P 425 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET CHAPPELL (SM)--Contd 417*Jarrell Albert A 442251 SBmraanllawnooAdlbReratyB Henry i.ntersect,s 500 Croom Robt F gDreoBorde intersects 517 Rivers Walter H (c) 519 Braziel Mary (c) 521 Booze Chas (c) 552 Hudson Jas H ReJvoh(cn)son i.ntersects 554 Williams Geo (c) 556 Edmond Eug (c) 558 Harrell Jas (c) 560 Smith Elmira (c) 562 Fowler Jos (c)Johnson la intersects 564 Sears Isaac (c) 566 Eady Mattie (c) 568 Outley Lois (c) 570 Jackson Otis (c) 572 Hill Sol (c) 574 Bonner David (c) Ell intersects 601 (575) Burns John G (c) CHAPPELL LA--West from 723 First to New, bet Pine and Oak 22 Wood Beulah (c) 72 Vacant 73 Vacant 224 Thomas Emma (c) 226 Rogers Martha (c) 227 Reese Neal (c) 756 Boone John W (c) 764 Hodges Isaac (c) CHARLES (SM) -- From 2636 Broadway east to Watervilie rd 101 (151) Irby H Clifford 102 (142)*Jordan Jas C 104 (144) Lanier Robt C 105 (147)*Jackson Henry G 106 (146)*Bridges Wiley R 107 (145) ALane Absolom E 108 (140) Eubanks John S 109 (143) Grace Nannie C Mrs 110 (136) Howard John B 111 (137)*Poole Jos C DuPree Prentice E 112 (134) ABruridage Jesse L 113 (135)ACook Chas C 114 (130)*Binion Annie Wood Fred H Hollomon Zell 115 (l33)AFletcher John S 116 (126)AColquitt Jas E 117 (131)*Josey Alex A 118 (124) Irby Louis R 119 (127) Baker S Frank 120 (110) Vacant 121 (125)AWhitten Jas A 123*Hunnicutt Burney L 124 (102)*Shelton Jos W 125 (121)AHancock Jesse M 127 (105) Freeman John F 129 (lOl)ABarfield AJ nPtiaouclh rd intersects 200 (lOO)b-Bivins Thos V (c) 204 (104) Vacant 205 (105) Munson Maggie (c) gro Peacock intersects 300 Goodin Andrew (c) 330021 BRuosrns tlEedywW(ce)sley (c) 303 Mallory Early (c) 304 Lundy Robt L (c) 305 Green Melissa (c) 307 Mitchell Anderson (c) 308 Antioch School (c) 309 Mosley Arth (c) Mason intersects 400 (301) Thurman Lee (c) 401 Allen Carrie 0 402 (305) Gordon Henry (c) 403 Finney Henry (c) 404 (305) Murphy Chas (c) PHONES 946-947 405 Mason Geo (c) 406 (410) Bonner Robt (c) 407 Farmer Jas (c) 408 Vacant 409 Holloman John (c) 410 Smith Wesley H(ce)nderson i.ntersects 500 Moore Oscar (c) 501 (483) U S, WPA Home Center 502 Farmer Henry (c) 503 (481) Glover Mary (c) 504 Vacant 506 Stubbs Leila (c) 508 Pitts Richd (c) Stevens intersects 600 (119) Gilbert Herschel (c) 601 (213) Whipper Chas (c) 603 (214) Vacant 604 (328) Travis Adolphus (c) 605 (205) Butler Clifford (c) 606 (321) Jackson Wm (c) 607 (207) Reid Mann (c) 608 (301) Denkins Geo (c) 609 (309) Vacant 611 (120) Ruelford MTaortohmabs(cin) tersects 700 701 l((630612))hBBivroinwsnEEddww (c) (c) 702 (262) Palms Jas (c) 703 (445) Bryant Geo (c) 707 (207) Thomas Lee (c) 708 (446) Holloman Felix (c) 771101AJHenokllionmsaWn mRei(dc) (c) 712 Ringwood Robt (c)Texas intersects 800 (801) Terry Paul (c) 880012 V(1a0c7)anVt acant 803 Flowers Jesse (c) 804 Durden Lula M (c) 805 Durden Spencer (c) 807 Brown Dock (c) 810 (129) Hunter Aaron J CHATHAM (South Macon) -- From Houston av east to C of Ga Ky, i south of Davis lOOAEdwards Chas A 114 Miller Sami W Carpital av i*nte*rse*cts Mikado intersects 301 Creter Stuart A 305 Wallace Emmett CHATTAHOOCHIE--From Hill Crest rd to Habershan av CHEATHAM AL -- From Plum to Pino bet First and Second 1 Toomer Gertrude (c) 2 Vacant 3 Elliby Oliver (c) 4 Ballard Ollie (c) 5 Henderson Emma (c) 6 O'Kelly LiUie (c) 7 Jackson Geo (c) 8 Vacant 9 Vacant 9 (2) Harris Sidney (c) 10 Brown Carrie (c) 11 Brown Bertha (c) 12 Staples Jerry (c) 12 (2) Howard Chas (c) 20 Johnson Carrie (c) 28 Gallimore Leila (c) 34 Boydsman Spurin (c) 35 Blythewood Edw (c) 40 Fairfax Jennie L (c) 50 Reynolds Willie M (c) 52 Vacant 56 Daniels Retha (c) 89 Moses Caleb (c) 101 Vacant 124 Vacant 320 Barron Ceola (c) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells it? IS Answered By the Classified Business Lists In this Direetory 426 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 CHEATHAM AL--Contd 559 Burney Geo (c) 608 Josey Mack (c) 1272 Harge Fannie L (c) 1274 Collier Robt (c) CHEROKEE AV -- From Pio Nono aV west to city limits, 1 north of Napier av 100 (162)AMosing Wm M lOlARoberts Chas B 102 (164)AMcElheny Duffie L 103 (165) AWilson Warren G 104 (168)ACorbett Eva E Mrs 106 (170)ADucker Wm J Rev 107 (167)ACollins J Walter 111 (173)ADickinson Julia 115 (175)ASmith Pearl F Mrs Courtland av intersects 201 Winship Florence Mrs 203ALawson Andrew L 207-C'Haley Crawford J AWatson Paul H 208AMerkel Henry L 209AField Wm E 221101AHCoorlnemWanalGterrayP H 216AAmspoker Guy E 218AMontgomery Walter P Hillyer av intersects 302AWyche Roy W AHulgan Horace M 304ASaunders John L 305AKernaghan Chas E 308AHanson Wesley L 310ABecker Simon L Becker Ida Mrs mus tchr 311ABeall Olin P 312AKoplin Henry 314ABirch John H 315 (359)ARichardson Chas H 331166%VAacPahniltlips Clarence A 313ATaliaferro Henry R 319 (361)AArmstrong N Bruce 327AClay Calder B 334 (364)ACrump John D CHERRY--Principal thoroughfare running east and west from Eighth west to Spring, 4 south of river 101 Vacant 103AGa Hwy Express Inc 115 Robinson Ellen (c) 121 Vacant 130ABuilders Lumber CoSixth intersects 205 Vacant Fifth intersects 301AHotel Grady ABon Ton Cafe 303 Vacant 304APalace of Sweets confrs Andrews Jas 305 Vacant 306 Vacant 307 Vacant 308 Commercial Barber Shop 309 Crow's Toggery clo 310 Vacant 331112AAHCaarnrya'dsaCDafrey Ginger Ale Inc bottlers 313AHotel Gordon 315 Vacant 317ABullock Cath Mrs beer 342ATerminal Service Station fill sta 350AMoffett Transit Line trans 350%AAtlanta-Macon Motor Express 351AColeman-Meadows-Pate Drug Co Inc Whol drugs 352 Vacant 355-57ABuilders Lumber Co 357%ABehr Henry J archt 358-60 WPA (Offices) se corADunlap-Peeler Hdw Co sw corAsterchi BrosBSrotoadrewsayIncinfteurrsnects 401AMack's Alf Pharmacy Inc 402AMacon's Pharmacy 403 Bibb Building ASchwob Co The clothing bRsomotmAsS:ou News Co 201AJackson & Jackson lawyers 202-03AElkins Henry W loans AElkins & Co Inc loans 204ACooper Wm O jr lawyer 205 Vacant 206-07ABibb Brokerage Co 208ARoberts Warren lawyer 209ANC&StLRv 210-12AHarris Morris Insurance Agency 213 NC&StLRy (stock rm) 214 Vscsnt 215-16ARobinson Estelle beauty shop 221177AACJoitniezsenCs 1 Loan H & Co Co finance 219-20AChaplin Arth W osteo 301ASmalling's R H Sons contrs 302-03ASALRy 304- Corp 305307AStevens Jas B chiropodist 308ANelson Peter J lawyer 309-10-UASolomon Robt D dentist 312ANatl Optical Co 313ASoutheastern Underwriters Assn 314AGa Insp & Rating Bureau 331158--1280ALMifeari&nelCloasBueltayutIynsSChoop 403-04-05-06-07-08-09 Vacant 410-19AMet Life Ins Co farm loan div 420-21AHalligan & McLellan Inc Ibr 501AOrkin Exterminating Co 502-03 Vacant 504 Bldg Office 550057-C08oAx SHpuorbloacrkt CBecnhjirHoprdaecntotirst 509-10AHarris Ernest phys 5U-14AHarden Timothy dentist 515-17AMoses Harry phys 516AWilliams Wm C jr phys 520'-23ASmith & Smith lawyers 552245A-2L6ewHisatWcheCrhSaipdmneayn oWfficlaewyer (JOlAMurphey Otis A Co Inc ins adjusters 602-03AOtis Elevator Co 604AMcFerrin Jas M aect 605-06AAtlanta & West Point RR Co AWestern Ry of Ala AGeorgia Railroad 607-09ASlade Truman J dentist 610-12AJones Grover C osteopath 613-17AEngland Arch chiropractor 618-26AMartin Martin & Snow lawyers AEdwards Miller G jr lawyer 702-03AWilson John E & Son ins 704 Akers Wm D mfrs agt 705-06APindar Geo A lawyer ADunaway Ralph T lawyer Apindar Mary R Mrs lawyer 707-08 Vacant 709-10ADun & Bradstreet Inc coml reports 711-12Aclark Gilliam dentist 713-17AYarbrough C Augustus dentist 718-19AMartin John W phys 720-22AToole Chas L dentist 723-24APalmer Sami B phys 725-26 Vacant Street continued 404Aplynt's Barber Shop 406ABurke J W Co The stationers 409 Vacant 410ASouthern Textile Co women's 411AKfuerrnngags han-Goodman Inc jwlrs 412AHat Box The mlnrs Ellberta Dress Shop 414 Vacant 415AMacon Cafeteria 416AMacon Hat Cleaning Co 427 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 CHERRY--Contd 417-21AUnion Dry Goods Co The dept store 441280*RWitizsteTrhiaeaCtraefe Alley intersects 608 Betty Maid Shop 609 Toole Furn Co (side ent) 610-12AKress S H & Co dept store 613 Wood Peavy Fum Co (side ent) 615 Vacant 615% Vacant 450- 5256-1M6 aVcoancaTntelegraph The news- paper AMacon AMacon 445513- -bMacon 617 City Bank & Trust Co Building TEOvepleetnigcirnaaglphCNb oePwusb nCeowsTphaeper Pos6t1a8lAAAATASSchieicntamlygerepegrB'rsaSaSpinSghekwn-hCoi&neaSgbelSrTevMhrioucaCepscothisCnheooeCoreprs 453% YWCA Rotary Club Social Workers Club 454&X V Clothes Shop 455*W U Teleg Co AAm Dist Teleg Co 620AHilbun's optometrist 620% Macon Pleating Shop AMMiazrey CAlanrenncBe eSauptyhotSohgop Brown Ola Mrs 622ASnyder's Ready-To-Wear clo 456-60ANeel Jos N Co clo Alley intersects 457AWilliams Jewelry Co Stevens J P Engraving Co 459-ABurden Smith & Co (side ent) 462AAmerson's Sandwich Shop restr 464*Chandler Jas K shoes 446668/-M'-MaadriyerLaouLiSnheonpSchloop 470AMurphey Taylor & Ellis Inc real est City Investment Co real est owners Mikado Realty Co Mortgage Investment Co loans b-Northwestern Mut Life Ins Co Third intersects 501AUnited Cigar Stores Inc 502-10ANewberry J J Co dept store 503 Brown & Groover brokers 505AKeily Wm B optician 509 Hotel Dempsey (side ent) 511AOrr S L Co jwlrs 512-0-Liggett Drug Co drugs 650ASherwood John H jwlr 652ASpratling J Hook optometrist rearAParcel Delivery Co 652% Mitchell Mae AMerriman Sch of Business The 656AMitchell WilliamCos ttIonnc advruignste(rbsre)cts 664AMartin Chas I vending machs 666 Vacant 667 Ga Power Co repair shop 668ARoberts Cafeteria 670AWebbs Place beer 667732AASCuhgearrryBSotwSl ecrovnicfey Sta filling sta First intersects nwcorAMacon Chamber of Commerce AAm Natl Red Cross Macon Chapter All s Natl Reemployment Office AU S Marine Corps Recruiting Office 551134A- Betsy Ross Coffee 1 Shop restr 65-WAoSoDtlawetevoertFlhooprPmeseWtnryt CFaoonr5des&tGeS1o0elcorvgiicceal store 7il3ADuBose Ella Mrs re55555555555555555211a66551655151482008r95713952%AAAAA-**AAA-V-bCCIDHB5HpLWnAEPSlea6aeoaVDeduaacmrgc&naLyryyctoregranzalnakdaeeunpDgyeynecrdssoxorletraSateemenWCnrnCBHehMSlHdytnilBoClaaahnneSooeelrligoarSnCethtlrbrshfplebrhtSooeeiSiirsaDoeesnrthrLoredglrFdtSoarInerSednuRphsCdCPitscgsoyeeoohlaswpsporSoer'eca1 tolh(lehloiegmcsooricrlasnpoergnae&'gqseCu)FiocprlmoeInneccnht 777777777788877516155560660068A7485425683030A%AAAAAAAAAATDPHCMBGHSMHhBFCABeutaaomlunoBoaaeauMulluardilrryslnrrnimropitpdhstigewitsynhsdeTinemrihneindsergMcaMaasLllRtulMerlSnFIkoEmduootinatam-HGiilBrSameLCrnatEmgSusoAeamnioizyeamrPa&innezAeberdCFrninrmyteaLeMtaaiSrheMHasltEolrkMysnrMMeGMssrtsrrNfrssCuscelnofoweurrainnl tremdrsisreecct-s 5635-Kalish Optical Co 804ABakewell Frank P 556646Ai'-HFerlidesdmDarens'ss SJehwopelers 806ACooley Conley H 807 Harbin Dewey 568 Suzanne Hat Shop 569 Willingham Building 808 Vacant 809AEllis Jas T 569%AThomas Robt O real est AAnderson Otis C dentist 809%ACarter Geo K 810 Vacant Edwards Thos E contr 811AReichert Fredk W AAll States Life Ins Co 570 Kinney G R & Co Inc shoes 572AReliable Outfitters men's clo 811%AGans Sanford N 812 Starr Herman 814ADozier Geo I 572%AMetro Studio photogs ALueree Beauty Shop 576 McAn Thom shoes 815AHudgins Willie H Mrs 816 Watts Hugh Young Floyd 578*Marilyn Slipper Shop Second intersects 602-04 First Natl Bank Building AFirst Natl Bank & Trust Co in 818 Cherrydale Apartments Apartments: 2lAGBoclhdwmaarntz LMoouritsimEer G Mason 603APekor-Cook Jewelry Co Cook J Tom 604 Mayo's clo 605ALovelace John W dentist Harrell Sandy B phys 3 Nussbaum Robt N 54AAGGoalndsstNeinathCahnas Str6eAetLcaoznartuinsuJeadcob 821 Hinton Wm N Curley Top Beauty Shop 607 Philadelphia Hat Cleaning Co 852 Vacant 852% Vacant Macon Federal Savings & Loan Ass'n Loans on City Heal Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 428 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 CHERRY--Contd 853 Newman Apartments Apartments: lAParker J Bart 2-0-Newman Horace L 3*Richardson Jas T 4 Ward Reuben H 5 Roberts Ruth V Mrs Street continued 854 Littlejohn Chas 858*0'Connell K Marie 859*Sapp Ellis R gro 886623**LRoayyd RAolbbtertAA 865 Smith Travis H 866 Morris Geo W 867 Turner Warren S Thomas Bonnie 869 English Norman E Canter Nathan 870 Temple Beth Israel 871*Sandefur John W Spring intersects Magnolia intersects 901*Wright Minnie Mrs 903-0-Smith Geo C 904*Wood Etta Mrs 905-0 Davis Nancy O Mrs 9060-Doctor Jacob 907*Methvin Wm H 908 Union Thos S 909*Childs Jas R 9110-Smith Geo C 925 (926)*Andrews Wm E 961*Kell Alex 9630-Brown Bessie Mrs 9650Shafer Wm C Nisbet pi intersects CHERRY (Unionville)--From Pio Nono av west, 1 south of Columbus rd CHERRY AV--From Courtland av east to Brentwood av 288 (292)OMalone Robt H 290OBennor Rudolph D 294 Wolf Chas T 296*Engelhart Edw A 300OBooth John C 302ORoberts Geo A 306 Shi s Robt 308*Woodward Theo E P osnook Russell A 3180Roberts Jos A 3190Linch Howard L 320*Bailey Wm J 322-OMerriman Wm W 3240-Young Clarence T Winton av intersects 426*Glassman Sami J 4520Poland Dewitt M 456 VCaarcvanRt obt F 4570Rhodes Clarence C 446601O0NThuunnrmDanShCehlatosnS 490OBridges Irene J Mrs CHERRY'S AL--From 759 Spring east CHESTNEY (East Macon)--North from 112 Mitchell 106 Whitby Wade H (c) CHESTNUT--From 709 College west to Duncan 107 Shefton Cat'h (c) 115*Smith Mamie (c) 121&Epps Susie A (c) 123 Worthy Lizzie (c) Tatnall intersects 207*Davis Chas (c) 211 Lawson Frank (c) 217-QGarner Patience C (c) 218 Vacant 2200-Grant Katie (c) 221 Glover Ernest (c) 222 Holbrook Marion J (c) 224 Norwood Ernest (c) 225 Collins Nancy E (c) 226 Holbrook Cla'rabelle (c) 227 Davis Jas T Rev (c) 237 Hunter John P (c) 240 Cowan Mattie 243 Vacant Adams intersects 353 Green Mollie (c) 357 Jenkins Louise (c) 361 Manuel Henry (c) 365 Lewis Willie (c) 371 Dewberry Jas (c) 373 Vacant 401 Vacant Linden av intersects 403 Rountree Geo W (c) 405 Alford Mattie (c) 407 Porter Clarence (c) 408 Vacant 410 Jefferson Elbert (c) 411 Vacant 415 Nixon Clifford (c) 427 Daniels John (c) 429 Maddox Wm (c) 431 Walker Sallie (c) 432 Maynard Elijah (c) 433 Andrews Powell W (c) 434 Edwards Heyward (c) 435 Turner Artella (c) 436 Hubbard Sallie (c) 437 JHounbebsaArdugEudswtus(Jc) (gc)ro 438 Haynes Obie (c) 440 Carter Gus (c) 441 James Henry (c) 443 Walker Eudora (c) Chestnut la intersects 454 Wynn Georgia (c) 455 Hawkins Christine (c) 456 Battle Ella (c) 445618 RVoinbeevritlsle CBruamptliesyt C(ch)urch (c) 462 Hopkins Nettie (c) 464 Alford Robt (c) 465 Goodrum Arth (c) 468 Taylor Wm (c) 469 Dixon Colonel (c) 473 Kendall Evie L (c) 475 Lewis Minnie (c) 447787 PVeancnainntgton Leola (c) 479 Vacant 480 -Chaney Edw (c) 482 McCloud Washington (c) 484 Harper Lee (c) 485 Jenkins Fannie (c) 486 Kimbrow Alice (c) CHESTNUT LA--From C of Ga Ry to Chestnut, I west of Linden av 3 Robinson Laura M (c) 49 Fambro Annie (c) 51 Redding Mattie (c) CHREST HILL AV (Dell Park, Bellevue)--From end of Dell way north. 1 west of Log Cabin blvd 106 Glover Oza C CHURCH (East Macon)--From 304 Hydrolia north to Fort Hill 100 East Macon Methodist Church 104105106 Collins Jamison Garden intersects 2025-Guest Lewis H 204 Hyatt Herman E 208 (248)*Matthew Cleo L 210 (250)AStitt C Wm Rev 214 (254)*Johnson R Aldean 216 (256) Blankenship T Wesley 220 (260) Evans Odessa Mrs 222 (258)5>-Durden CPharillliBps la intersects 249 Hinson Homer 253*Fountain Jas MUnion av intersects 429 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 CHURCH (EM)--Contd 255 East Side Baptist Church 259 McElheney John W Lee intersects 302 Ryle John G 303 Jones Casey P 304 Graham Monroe 305 Durden Geo 307 Gay Owen V 308 Hatcher Zollie C 331107ACCaosuecyh HJeonsryL 356 Townsend Geo C 335579-0V-Hacowanartd Walter WC il,,ling-ham begins 360*Howard. S Paul Randolph ends 361-AWheeler Sidney J 365-ASmith Annie M Mrs 375 East Side Church of Christ 402 Watson Arth L 404-0-Motes Arth G St John intersects 406 Hightower Jas H 406a McCrary Geo D gro 408 Canfield Sidney F 412 Vacant 415-AArnold Respess Broad intersects 506 Johnson Wm P 508 Davis John D 510-AColbert Geo W 512-0-Cochran Pearl Mrs 514 Barnett Sami gro CHURCH (SM)--Changed to Concord CHURCH (CH)--From Bailey av west, 1 north of Montpelier av 608 Tidwell Elmer T 610 Chitty Clarence J 611 Britt Wiley F 612 Vacant 614 Shine Tommie Mrs 616 Peterman Oscar E 622 Hales Leonard L 623 Vacant 624 McClanahan Paul 626 McClanahan Geo A 629 Ussery Alphonso 630 Reynolds Jean Mrs CHURCH AL (South Macon)--From Elbert to Broadway bet Edgewood av and Church 200 Nelson Dan (c) 212 Key Mary (c) 214 Vacant 335513 JAolhlennsoWn iJllaiceoPb ((cc)) 354 Fary Steven (c) 356 Chatfield Jessie (c) 701 Thomas Geraldine (c) CHURCH LA (South Macon)--From Elbert to Fourth bet Edgewood av and 24C0hHuricnhes John (c) 241 Morris Jos (c) 242 Tuft Wm (c) 244 Jones Raymond (c) 246 (244) Fed Wm (c) 248 (246) Tory Love (c) CITY HALL LA--Rear of City Hall from First to Cotton av 448 Burns Raymond (c) 450 Newman Julius (c) 445542 BThuonmn aSs aOvascnanrah(c)(c) 456 Russell Rosa (c) 458 Humphries Louis (c) 460 Stephens Emma (c) 462 Sutton Lula (c) 464 Appling Eliza (c) 446668 SWtervigehnts DAollblieert (c()c) 470 Williamson Curlie (c) CLWAoIRodElanPdL--avFrom Ingleside, 1 east of CLARA (East Macon)--From 422 Flanders west to Elliott 101 Mitchell Julia M (c) 102 (6) Hutchen Lila M (c) 103 (1) Glover Thos (c) 104 (8) Balkcom Naomi (c) 105 (2) Fowler Ida M (c) 106 (20) Gresham Anna (c) 110 (153) Lamb Ida M (c) 111 (14) Evans Bell (c) 112 (152) Plowden Willie (c) 113 Reese Rebecca (c) 115 (27) Williams Glovenia (c) 116 (157) Vacant 117 (210) Scruggs Granzy (c) 120 (237) Purnell Jas (c) 126 Rozier John (c) CLARK (East Macon) -- From Cowan Wnoormthackto Hall bet Fort Hill and 130 Bronson Jack (c) 132 (131) Goddard Lizzie (c) 135 (325) Snipes Wayne (c) 136 (214) Davis Falola (c) 137 (327) Finney Kate (c) Clark Hill intersects 200 (213) Barnes Vesroe (c) 204 (212) Stallworth Thos (c) 206 (211) Clemmons Lillie (c) 210 Stallworth Felton (c) CLMAaRyKnardLAb--et FCroowmanWanomd aHckall east to 123 Childs Mamie (c) 214 Singleton Mary (c) CLARKS AV (V)--From 275 4th av north to 5th av ,. _ 302 (303)-0-May Lucius J (c) 304 Jolly Robt (c) 306 Small John (c) 307 Burrell Marion (c) 308 Bush Clara (c) CLARK'S HILL (East Macon) -- East from 319 Womack to Maynard, 1 north of Cowan 123 Vacant .. . . 204 Vacant _ 520 Bryant Horace (c) 521 Childs Mamie (c) CLAY AV (North Highlands) -- From Boulevard southeast to Curry pi, 1 southwest of Clinton rd lOObGraham Louis H 102ADarden Jethro A 105hSteed Wm H ' 108 Clay Lamar jr CLAYTON (Vineville)--West from junction of Third av and Douglas av 4 Hampton Mattie E (c) 8 (908) Solomon Leola (c) 10 (910) Wimbley Willie B (c) 13 Finney Beni (c) 15 Vacant 17 Reese Florence 23 Carithers Emma (c) 25 Vacant 28 (528) Mims Abbie (c) 32 (532) Johnson Frank Rev (c) 36 (536) Johnson Andrew L (c) 40 (540) Powell Herman (c) 91 AQluleinnn JJaessseOB 93 Sowell Oscar R 95 Sowell Oscar R gro 97-0-Drinnon Wm C 98*Harp General M gro 99 Harp General M Rogers intersects lOlALumpkin Zora L Mrs 103-ASmith Jas A Rev MERRITT COAL GO. 1414 FIRST Cor. Ash YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Life Of Your CITY 430 D. H. Adams Motor Go. Studebaker Willys Hupmobile Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D I R E C T S O i R ! Y j MIRRORS the i CIVIC I life Of Your CITY TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 CLAYTON (V)--Contd CLINTON (East Macon)--From C of Ga 104bSmith Leon P Ry northwest, 5 north of river 105AColquitt Lelia Mrs 101 (102) Jones Carl Colquitt Mary music tchr 103 Stinson L Sol Massey Eug M 105 (261) Stinson Alf 106-iSasser Everett DeWitt begins 107 Slocumb Henry L 163 Price Gilbert 109 Bush Thos S Taylor av begins llOABrooks Mary C 202 (59) Gordon W D 112AForbes Evan H 204 (62) Bibb Mfg Co Sunday School 113*Moore Chas B Room 114AAldred Florence S Mrs 208 (58) Gordon Ivey llO&McClure Francis M 118 Bruce Claude W 210 (52) Maxwell Jas 212 (61) Vacant 119 Reese Florene (c) 213 Bibb Mfg Co Sunday School Room Corbin av intersects 214 (60) Walker Stevens 202AArnett Claude C 215 Lavander Lydel 206AHoltzclaw Benj W 216 (56) Renfroe Forest 207AFelton Wm H 217ALayfield Allen B 208-bArmstrong Ethel Mrs 218 (29) Callaway Roy A 211AClark G Clisby 219 (226) Bibb Mfg Co Community Callaway intersects House 301 Pellew Jas H 303*Hamilton John R 220 (28) Smith Robt E Olive intersects 305AJossey Paul H 308-dMerritt Benj F jr 221 (210) Bibb Mfg Co Social Workers Home CLEMONS LA--From 952 Ocmulgee S 2 Crowder Geo (c) 101 Hill Augustus (c) 103 Allen Annie (c) 104 Farley Rosa L (c) 106 Vacant 223 (24) Haddock J Willis 224 (7) Waller Jas R Lake City intersects 225 (23) Carr Walter L 226 (227) Bibb Mfg Co Clinic No 1 228 (224) Vacant 230 (220) Allen Lizzie CLEVELAND (South Macon) -- From 234 (8) Massey Hattie F Mrs Blount west to Houston av, 4 south of 236 (5-6) McGahee Chas Junction of Second and Broadway 255-bGlisson Wm J 100 (103) Andrews Walter (c) Main intersects 104 (105) Gaultney Robt L 106 (107) Vacant Simmons intersects 301 Stone R Raymond 303 Stone John C 304 Bivins John J contr 306 Elder Clarence C 309*Hatcher A Marion 312 Hammond Wm A 317 Goodson Redding 318 Davis Pauline Mrs 322*McLeod John W jr 324*Land Jas L Bacon intersects 317 Bass Chas T 319 Beck Fredk 324 Smith Patton 325 Barlow Robt 327 Smith John T 330 Nasworthy Jas 331*StClair Wm 333 Sanders Ralph 334 Riggins Edgar G 338 Christian Alma L Mrs 34K'-Sterman J M 345bSmallwobd John J 350 Watson J F Gants al intersects 440023-405&Cofer Grady L 410 McKinney Henry C 417 McCarthy John F 420 Richardson Pompey B 424*Chance Albert R O 0 352 BEtyhrrdidHge Jas C-Kheamncpeer LMulaaryBRMMrsrs 359*Smallwood Susie A Mrs 363 Carroll S Penny 372 Fox W Harold Fox Sallie E Mrs 373 Scallieir Dessie CLEVELAND AV (Vineville)--From 1009 1V00in*eMvicllEelraavthsoFulothren1 cbeloMckrsto Talmage 102 McGee Edmond C 374 Maddox Edgar M 377 East Macon Presbyterian Church 386 Branch Gordon Center i*nte*rse*cts Temple Junius A Massey Wm W 103ABernd Florence 104-Q-Scheider Lucile Mrs 105 Ellis D Talmage Hydrolia intersects 390-0-Byrd Michl 414*Culpepper J W Edw Powell intersects 106*Finch Walter R 448 Vacant 107&Weaver Anna 109 Ellis Hallie S Mrs 450 Ross Mary (c) 452 Neu.bet Janie (c) llOAMcClure Andrew W 453 Smith John T beer lll&Latimer Ida E Mrs 454 Raford John gro Latimer Florine music tChr 455 Milner Willis (c) restr 112-C'Davis Stuart C jr 456 (460) Walker Eliz (c) 113bParker Thos W 458 (456) Horton Laura (c) 115&Steed Philip S 459 Vacant 116*Winslett Usher T 117*Deming J Harvey 445690%(45P6a)rkFsulNtzelHsoonme(rc) (c) restr 119bWinn Geo B 462 (486) Faulk Mahala (c) Delaware av intersects 465 Turner Jas O gro 120AHaas Albert A 474 McArthur Henry (c) 121ASlocumb Burke L 478AWiggins Chas L gro 122&Rainey Sami C 124 Scruggs Wm E Gard* en* en*ds 126-dLovejoy Iverson J 129-bRhodes Genevieve Mrs Sec*ond* en*ds 130&GUbert Kate Mrs Siam begins 431 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios TEL. 4401 455-57 SECOND ST. CLINTON (EM)--Contd . 506ADempsey Clifford R (c) gro 507 Nebraska Paul (c) 508 Stephens Geo H (c) 511 Richardson Henry J (c) 512 Green Thos M (c) 518 Adams Warren E (c) 552203&PHriaclel WLomttiMe MRev(c)(c) 530 Gibson Daisy L (c) 534 Wiggins Richd W BRroevad (cin) tersects 600^Jones Lamar gro 660160AWGarrifdfinHaHtteineriAett(ac) (c) 655 Ervin Dock (c) Astor intersects 700 Brantley Clara (c) 701 Hoskins Danl H 702 Hicklin Geo (c) 703 Brown John (c) 706ATuff Jackson (c) 775085ALEodgwanardCs laWremnceMWS oo(clf)olk intersects 801 Davis Jas M 809 Reynolds Robt D Fulton intersects 811 Yates Luther E Jackson i.nt.ersect.s 901 Sawyer Wiley 903 Johnson Roy E 905 Smallwood Wm 907 Turner Wm M (c) 909 Lassetter Robt L gro 909 Vo Vacant AGBheoallesoWn mChas A gro Williamson Minnie M Mrs CLISBY PL (Vineville)--South from 140030ADVeinnetovnillMe aavrytoR CMorsf Ga Ry 110068AHSatrrudbeymCanhesGteorrdAon I llOASimmons Lance B 116AHawthome Hubert inAHogan Jasper T 120ARogers Thos E Dr 121ABethune Ben.i T 112234VARacoaunssteau Jas C 125ABrantley A Cheney 127 Darby John J 129 Vacant 131AEhney D ConstaRnacnesoMmres intersects 200ATalley Ben.i H 201ARyals T Edw 202AHart J Freeman jr 203ALong Margt M Mrs 204AChapman Holt 205ABemd Henrietta Mrs 207APlatt Mary S Mrs 208ABrown J Holland 209AHouse Nellie D Mrs 210APeacock E Julian 212APark Chas L 213AMorrison Otis A 214AMartin John W Dr 215ASandefur Ewell L Lifsey Hewlitt M nurse 216AUsher Emmett C CLINTON RD--Continuation of Clinton (EM) 907 Turner Wm M (c) re90a9r SEhliaaws REonsosch(c)(c) 910 Logan R A , 912 Elizabeth Primitive Baptist Church 914 Swanson Clarence (c) 917 Lester Rosa (c) 921 Marion Rosa L (c) 923 Ross Jos (c) 1902078AMMoororrise LCillalyrenBce(cW) (c) 1010 Jackson Mitchell J (c) 1011 Rogers Mary A Mrs 1012 (1135) Glover Alford (c) 1014 Humphries Chas L 1015 Pickett Ida W Mrs 11001167B*Juarcnkesyon.MDaortuhgalaCs JMrs COLE--From 862 Orange southwest to Oglethorpe 114 Apartments 1 King Mollie Mrs 2 Vacant 3 Long Bessie Mrs 4 Vacant Street continued 115AMyers Wm Y 122AMcGee Ennie C 124 Brown Jessie G 112245%AJoRnoebseWrsomn CWA 126 Carter Harvey 112268%BeSdmgoiothd HHoamneserllE M 131Awoods Lummie nurse 132ABazemore Crowell O 136AMartin John S 137 Simpson Etta Mrs 11001189-VVSamcaitnht John I 1020&Elder Erwin W :i!021 Humphries Eug T--** 1022*Elder Erwin W gro 11002234**TScyolenryAersCuEldlwen A 143 Taylor Julian S 145AShinholser Jesse R 148 Hatcher Florence E 150ATemple Thamer E 151 Hattaway Wm C 153 Long Albert C Maple intersects 1025*Barfield Wm E 200 Coulter Vollie 1026 Graham Ralph 202 Fambro Luther F 1027 Baggett Scholey A 11002289-AVAPepnpnlinHguPlonGeEo(c) 204 Meeks J B Williams Robt OLglethorpe i.ntersects 1030VGuy Lloyd G 1032 Powell Clara (c) 1035 Central City CoRllievgeer (rcd) intersects 1140 DCaruvticshOfiereldn's Gash Grocery genl mdse AEllis Ida (c) gro AHudson Chas N Basser Bath restr Forrest Elder (c) APickett Eug W jr ASmith Felix (c) gro ASmith Wm G gro ASnyers Cora L Mrs Wilder Edw (c) Addleton John F AJohnson Willie M Mrs COLEMAN AL--From First to New bet Plum and Pine 21 VJaacckasnotn Frances (c) 12 Lawrence Millie (c) 75 Vacant 123 Whittemore Jack (c) 124 Adams Nelle (c) 125 Clark Agie (c) 126 Fuller Jennie (c) 132 Richard John (c) 507 Bell Lillie (c) 509 Rice Maybelle (c) 511 Boland Hattie (c) 513 Vincent Marietta (c) 514 Hogan Hattie (c) 515 Hood J B (c) s 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 432 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. THIRD AT PINE GMC TRUCKS PHONE 5100 Members N. T. Stock (Exchange N.ExYc.hCanogtteon ChicagoTraBdoeard el AssNoc. iaYte. MCeumrbbers Exchange Local Stocks and Bonds Government Bonds Home Owners Loan Gorp. and Fed. Farm Mortgage COLEMAN AL--Contd 516 Bryant Eva (c) 517 Vaughn Susie (c) 523 Troutman Mary (c) 524 Bruner Carrie (c) 652 Johnson Wm (c) Am vacant 308 Campbell Wm (c) 309 Vacant 310 Hill Annie (c) 311 Huff Leola (c) 315 Griggs Miley (c) CO50L1EMAAdaNmsAVwes(tCthoerDokuenecaHn tsa)v--From 91&Hartness Service Station filling sta 93 Jolly Wm A 95*Smith Henry P 97-ODillard Elba L Mrs 99-OAdams Edith C Mrs 317 Vacant 319 Vacant 432 Williams Ida (c) Elm intersects 444498 DThoorsmeyasHJarDriet(c)(c) 450 Merker Mattie M (c) 451 Lawson Herman (c) 1.0..1.0.-Mozo Henry BLinden 102-OCason Edw J 103AWhite Jos N 1111410E-Wdwriagrhdt sLePweniselHopeReJv 119- av Mrs intersects 452 Jones Fred (c) 453 Wimberly Gertrude (c) 454 Vacant 455 Gilliam Jas (c) 464 Vacant O 466 Vacant Glover Clifford Mrs 1201210'Clements F Larcus A COHLdLl ECGeEm--et7erwy etsot FoforSseycthonsdoufrtohWmwaeRtsstoostnoe Eliz Mrs Corp. Bonds 126-0-Long Kate U Mrs 1270.Peeler Eliz J Mrs Oglethorpe and south to limits Rose Hill Cemetery Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. 130ASpangler Geo C Johnson av intersects 2010-Sammons Jas P 202AWatson Roger A 22117000-'HCaaitrer JTohhons PJ @ 218 Shealy Philip C 221291--0O-WMialdttehrewJs CAllyledne R jr 125 Vacant Cemetery ^ intersects 141 Denson Cleveland (c) 145 Layfield Ella (c) 152 Dennis Inez (c) 153 Brown Mary (c) 156 Pond Wm (c) 160 Brown Mary (c) 161 Barnes David (c) Phone 1681 222 Kinman Russell B 223-ocropper Raymond C Carling av intersects 3150-Kapp Alpha Fraternity 320 Rogers Thos W 321 Dewberry Mamie Mrs 322 Stewart Fred D 162 M,,ason G_eo (Jco)nes St la intersects 170 Millirons Mary E (c) 174'-Clemons Mary J (c) 176 White John T (c) 200&Hutchmgs Wm p J(oc)nes intersects 205-o-Danforth Remus J (c) COLEMAN'S LA--From end of Fort Hill east 1016 (1017) Eppings Minnie (c) 1020 Vacant Sons & Daughters of Jerusalem (c) 1022 Sons & Daughters of Jerusalem 220098HDaolglwWooadrrMenary(c)(c) 210 Coley Allen (c) 211 Hill Cleveland (c) 212ALee Walter C (c) 215- Hall (c) Fort Kill intersects 1060 (1065) Thorpe Frank (c) 1070 (1071) Brown Mingle B (c) 2o211i76r--ah/t d i Williams la intersects Mann Robt E jr 221hSatterfield Dell B Mrs Who Sells It? Is Answered By the Classified Business Lists COLES AL--West from 918 Oglethorpe to Edgewood 115 Atwell J B (c) 152 Vacant 154 Vacant 155 Morgan John (c) 156 Vacant 157 Jones Wm (c) 158 Vacant 159 Chapman Claude (c) 160 Anderson Willie M (c) 161 Wade Martha (c) 162 Walker Minnie L (c) 163 Willis John (c) 164 Haynes Isabelle (c) 165 Rutherford Sara (c) 166 Washington Lillie M (c) 168 Williams Chas (c) Hazel intersects 200 West Fredk (c) 201 Irvin Randolph (c) 202 Sutton Alberta (c) 203 Phillips Bessie (c) 204 Miller Ida (c) 205 Slaughter Louise (c) 206 Wallace Chas (c) 207 Johnson Lizzie (c) re2a24r-0V-NineswomnanBeLllue(lc)B Mrs 223276/A-`BKairlkvcenomLiTstoNnorCwood 239-0-Massie Anne C Mrs 240Buie Edgar J 242 McMillan chas A ir 246 Vacant 250 Apartments lAJones M Luther 2-0-Hills Howard S&Twilley Maude nurse Str4eehtLoceoknlitninuSeadmi H 254-0-Wright Geraldine L Mrs @ C'-Hyatt Jas P jr 258hRiley E^mory W StPaul intersects Hurt Kolin 263 VWaecaatnhterford Minnie Mrs 271&Bracken Manilla Mirs Hamlin Jas O 272'iHumphries Chas C Bond Rayme nurse Phillip Abbie nurse 2,,,,77bBGalrerdohnill MAarrtthhaCnurse In this Directory 208 Butler Harden (c) 209 Brantley E L (c) 210 Moon Emory (c) 212 Braswell Liza (c) Ash intersects 302 Raines Wm (c) 330063 DFruenecnaenv MRoazleicehr i (c`()c) 278A(*`MMSmcaLcithehenndEomJnamsAanEnie V Mrs 279*CLoifpseeylanCdhaMs aLry nurse NGeaarlreSttteJpohs F Evans Cloyde C 433 The World9s Largest Store Shop at Sears SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. and Save COLLEGE--Contd 280"Anderson Carl L Redding Mattie M nurse "Farrar Wm E photog 284'-RCulasshsinJoWhn CFliffvoarpdopath 287"Wortham Nettie D Mrs Woodliff begins 2S0"King Campbell T 296 SStluobanbsALpiallritamnents -Brown Walter V H "Price Sami J T 239080A"EAUrmis sWtromng LOctavius A Jones Collins E 305 Lafayette Terrace The Apartments: 1'-'-Sutton Jas R 23"MLeaargtuine RElolbamt aDe E Mrs 4"Matthews Dee 5"Fowler Harry C 6 Vacant 7 Rankin Jane 8"Copeland Geo P Street continued rear 305 Henderson Raymond (c) Bond intersects 310'- Henderson Howell H 314-C`McCormick John E 317"Coleman Sami T 320"Carswell Hattie W Mrs 322"Gwaltnev Eug C 324"Wright Jesse E 329"Bloodworth Geo T "Harvey Mary Parker Ves Christian Percy Ackis Jas C 335"Chatfield Belle Mrs 341"Brown R Lawson "Gibson John M 354"Carswell Mary L Mrs 355"Butler Earl W 360 Apartments _ lACollings Thos L 2"Ward Clifton P 3"Crews Jas `S 4"Menard Albert R Street continued 362 Boone Walter IS 363 Apartments lARoss Jas T Dr 2"Barefield Wm C 3"Adams Carl M 4"Dixon Robt P Street continued 364"Crook Chas E rear Rains Hilliard (c) 367"Stevens Lillie D Mrs 368"Bennett Walter D rear Howard Steph (c) 370"Whaley Claude L 375"Worsham Lee S 376"Felton Augustus C 401-05 Massee Apartments Apartments: lA"Mobley Walter E phys IBAHarwell Clara Mrs 1C Harwell John I2DAA-2H'Bay"eDsanYneEnbuegrg Walter F 2C Burnette J Henry 2D"Waxelbaum Annie Mrs 2E"Worthy Cleone 2F"Sammons Jack 2G"Dossey Nettie C Mrs 2H"Arnold Patsy 2I"Warning Geo O 3A"Hay Park L jr 3B"Fiske Kate Mrs 3C"Stelljes Geo 3D'--Waxelbaum Jos 3EABarfield Bertha W Mrs 3F"White Irene Mrs 3G"Adams Gladys O Mrs 3H"Jenkins Wm A 3I*Slade Truman J 4A"Smith Marshall D 4B" Atkinson Lott 4C"Jackson Wiley P 4D"Rushin Chas A 4E"Hertz Hermina 4F"Wallace Mildred 4GABerckmans Robt C 4H Allen Emily - 4IACarr H Eleanor 55ABAHAedaadmsMDaravnina H SCAJackson C N 55DEAHTarrebnearryDWillmardFDjrr SFADavenport Wm H jr SGAFarmer C Hall 5H McRae Ruth SIACosta Fredk J 6AAHarrold Eliz 6BAFried Irving 66CDAARCooslsemTahnosIdLa Mjr Mrs 6EAPruett Joel F 6FACameron J Kenneth 6GAAinsworth Wm N Rev 6H Akin Sallie M 6IASikes Hattie 7AAMitts Keys 7BAWalker Kittye S 7CABewley Wm C 7D Goldstein Ellis 7EABritt Fred E 7FAHall Chas H 7GALamar Julia S 7H Hackett Geo 7S1ALAeMviaeybOertriys JHas A 88BCAAGHeaockgehtetgaFnraBnrkooLks 8D"Kerr Jas F 8EAThomas Lester A 8G Hinton Allene Mrs Street continued 404AGrace Walter J 40`9ASheridan Jos A 410AWillingham Alf R 411AWilliford W Thos 414AMcGhee Marie Mrs 415AWillingham Eunice Mrs 418"Hart J Freman 425AFaulk Henry G ABurkett Wm A 427AMoorman Arth L 445AHunnicutt Irma L Mrs Georgia av i*nte*rse*cts Jefferson begins 451AWesleyan Conservatory "College Beauty Salon 452 Apartments 1 Whitfield Wm H 2ATomlin Ernest A 3 Stamps Dolores Mrs 4 Gordon Bess Street continued 456AAdams Danl D 468ASparks Willis B 470AEllis Eva 476 College Hill Apartments Apartments: lASmith John C 2AHawkins Willis A 3"Warren Dayde 4"MdEwen Harry L 5"Massey Jo B 6AMitchell Robt L 7 Heyward Emory S 8"Kirby Harry C 9AHill Geo W "Thompson Gene A 10-ABein Edwin E llACloud Arth M 12"Lavender Clyde T 14"Smith Simms M 15"Parkerson Theo M Street continued DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 434 OSS o3jcr O ^2 H oo ufc CD CD A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 COLLEGE--Contd 478 Ellisonian Apartments 687*Jemison Lannie H Mrs 689*McKenney Steph P Apartments: 689% Davis John R l*Nye Elbert C 690*Howard John R 2-0-Winn Augusta J Mrs 692*Milady Cleaners clo clnrs 3 Vacant 694 Vacant Toole G Glenn 696 Vacant 5 Vacant ,, 698 Vacant 6 Vacant Washington Park Magnolia ends Washington av intersects C of G R*y c*ross*es Shamrock i*nte*rsec* ts 501'iChiropractic Health Home The Chestnut intersects *White A Wilson 709* Taylor Pearl J Mrs -Heaps Louis P 50'7-0-Smith Julia Mrs 509*Nash Chas E 711*Clarke Robt L 715/-DSilaohcnumAdBoelnpjh jr F 51&*Hill Maude S 719 Mailey Junius S 520*McCook Jas W Haynes Wm P 521 Taylor Eden jr 720*Chastain Bert M 525 Apartments 722*Bradley John B 1 Payne Wm S 723*McMurray Edith Mrs AWillingham T Marion Dumas Carlton 2- Q 724 Vacant -Chandler Robt 34-- h O 772267*VCaacrastn,atrphen Taylor T WBairllniensghMamargWt Street continued 728*Dopson Jas M 630*331115 Florence Mrs 735*Hart Mamie S Mrs 631*Boone T Harrold ^-Montgomery Paul A 632*Porter Jas H 634*Ross Murrell G 545*Willingham Sarah Mrs 550*Barfield Henry L 554*Waxelbaum Lewis I 555*Com Ernest 736*Ward Mary K Mrs Ward Helen nurse 739 Vacant 741 Vacant 742*Smith Chas B 745*Bradley W Jos 556 V, acant Dura la intersects 558*Massee Wm J 747*Huthnance Alice C Mrs 748*Loh Mary W Mrs 751*Drew Sallie Mrs 560*Harris Walter A 563 Siesel Apartments Apa1rtHmaesnktisn:s Arth 752 Tatnall Square Presby Church Oglethorpe intersects 800 Gulf Refining Co filling sta 810 Apartments 2*Derlien Peter 3*Russell Lake F 4*Tudor Eked W S6*A0S'tDriacnkilealndPeEaarrll MHrs 8*Lee Jas B 9*Holdcroft F Spencer lACarstarphen Taylor ir 2*Smith Wm A 3*Kirkland Ernest T Stre4e*tSpceoingthitnuBerdooks W Tatnall Square Park 836 Alexander School No 2 10*Francken Fkitz H Stlrle*eSt cchoanlltinRuoebdt B 565*Flournoy Jos A 567*Harrold Thos .ir phys 569*Canipelli Vincent 570*Smith Beni C 571*Chambers Avner re5a7r6*HTaernvneiylleSEussatenlle(c) 587*Wright Horace A 597*Battle Annie M Mrs ne cor StPaul's Episcopal Church 838*Long Augustine J 840*Redmon Annie Mrs 846*Thompson Fredk W 9,,0,,6,, Perk, ins Thos Hazel intersects 910*Medlock Milo B 912*Holder Isabella Mrs 920 Albion Apartments Apartments: lbFinney Robt A 2*Lockhart Leah G 3*Hatfield Paul 4*Caut-hen John C Forsyth i*nte*rse*cts Street continued 926*Findlay Richd E: eiOARoberts Chas E Cotton av ends 624*Neel Jos N 632*Roberts Warren 635*Clem Walt W Rev 656*Riley Julia C Mrs Adams Ralph 930 Tatnall Apartments Apartments: 1 Stout Wilbur W 2 Walters Harry L 3*Willingham Benj B 4*Lewis Arth Street continued 657-0-Adams Eva C Mrs 659-THimarmt eJermssaen BJ Warren 662*Allen Kelly P 936 Sigma Alpha Epsilon Fraternity 940 Centenary M E Church Ash i*nte*rse*cts 664 Harrison B Franklin jr Derry Wallace T *Derry Henry P Dr 666 Vacant 670*Barfield Elma Mrs 679*Erwin Helen P Mrs Appleton av intersects 680 Craig M Eliz Mrs 681*Humphreys Chas H Peacock Chas H 6831 Vacant 686*Smith J Lundie Smith Rosser M Bailey Chas E 1126 Howard Amphus D ERlemv intersects 1128 Oakes Wm C 1132 Vacant 1134 Currie G Ernest 1136 Pickens J Bennett Rev 1138*Forrest Clifton A Rev 1224 Clements Chas E 1226-Q-Huff Wm P contr 1228 Vhcant 1230 McClung Plinie J 1231 Harrell J Henry 1232 Smith John T dairy 1234 Wyatt Dennis R 435 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON. GA. PHONE 1586 COLLEGE--Contd 1235 'Higginbotham Rufus Rev Brown Wm O Rev 1240 Waters Wm L 1243 Brantley Wilbur E 1344 RRiheogdeernhMisaerry RFoyMBrs 1346 Eddington Herman L 1350ALong Barney L Mary intersects H1443460hAPSuosusthJwePllelMhaamrvin L 1444 White Jas W 1446*Bragg Edgar R 1450 Melton Jas 1452*Gratigny Jerome A 1454 Radney Zelma CDempsey av begins 1537'1-Campbell Chas B 1539hMcLendon Augustus C 11554431AABShaeilrewyooHdenTlrhyosX B 1544 Asbell Geo IE 1545 Asbell Emory E 1546 Vacant ,11554478hMCeheakislanBeJrenffaired MH First i.ntersects 11660013 VNaocrmanatn Grady L COLLEGE S--See 1200, 1300 and 1400 Blocks College COLLEGE DRIVE -- Formerly College, Johnson and Rebecca south from 1171 Ash, 1 east of College 1004 Hall Sami (c) 1008 Harris Wm J (c) 1015 Vacant 1016 Albea Robt (c) 1020 Akin Rosa (c) 1024 Burman John H (c) 1025 James Ralph (c) 1026 Wilder Howard (c) 1027 Palmer Clara (c) 11002482 MVaacrtainnt Luther (c) 1045AJones Edw L Elm intersects 1120 Pinholster Jas C1 1121 Harper Jos W Rev 1123 Vacant 11112267 VBuaiccaentR Lee Rev 1128 Bcyd Wm T 1129 Vacant 1130 Shrem Abr 1131 Vickers Virgil Rev 1130 Gilmore Starling S 1133hTaylor Henry L Rev 1134-OKent Sami EEdgewood av intersects 1234 Putnam Amanda Mrs 11223367hRlsirlaeeyl SGaemoi MH 1238 Parker Richd M 1240 Richardson Jas D 1241 Lyles Ella Mrs 1242 Larkin Clifford Prince i*nte*rse*cts Mary intersects 1400 Hill Lena (c) COLLEGE PL--From Ross west to College, 12 south of Ocmulgee river 108*Avent John T 109 Arnold Ollie O Etheridge Lennie C 110 Adams John H llK'-Samples Daisy Mrs Shamrock intersects 20OAHarris John J 201 Favors Homer 202-aWrigley Henry P 203*Tarver Lettie Mrs Griscom Harley A 204hKnight Brozier D 205*McDaniel Julius A 206 McDaniel Van H 207hMorris Robt B 200 Sherrer Wm H COLLINS PL--From Jefferson to Jones bet Madison and Monroe 202 Edwards Wm (c) 204 McKenzie Wm (c) 206 Coleman Susie (c) 207 Davis Ulysses (c) 208 Redding Janie (c) 210 Mills Ijeila (c) 212 Morse Carl (c) 214 Dawson Mollie (c) 215 Jamison Lillian (c) 216 Jones John (c) 216 Moss Ola M (c) 220 Willis Elijah (c) 222212 MGruilflfiinn APnenteier ((cc)) 224 McKinley Rufus (c) 226 Anderson Jennie (c) 227 Adams Lizzie (c) 228 Reeves John (c) 230 Reeves Mollie (c) 232 Smith Jessie M (c) 233 White Burney (c) 234 Mullen Geo (c) 236 Hughes Tillman (c) 236 Mitchell Wm (c) 238 Flournoy Mary L (c) 239 Richardson Jas (c) COLLINSVILLE LANE--From Green's Lane to Jefferson 408 Floyd Lillie M (c) 440 Swain John W (c) 442 King Essie (c) 450 Ellison Louise (c) 451 Curtis Benj (c) COLQUITT (South Macon)--From 2642 Broadway east 97 U43) Chambers Howell C 99 (141) Etheredge Emmett D 100 (144)hEstes Geo P 101 Boy Scouts of Am Troop No 32 100 (142) Stamatis Louis 103 (137)AHunnicutt Jacob R 104 105 ((113358))**ID>reeasnsleSyamHiarAry M 106 (136) Davison Chas 107 (133)hBurden Jas W 108 (134) Hollingsworth Thos F 113 (125) Hightower Labon L 115 (123i)AHatcher Arth E 117 Sent Henry F 118 (124) Cook Clarence A 119 Stringfellow Lee R 120 Hayes Sami L 121 (115) Daniel Lonnie 124 (116)hHight Henry H 127 (lll)hMcDaniels Grocery 128 (112) Field Edw G 130 (110) Myers Lonnie W 136 (102) DriggarsASnetiyomchourrd Bintersects 200 (201)hRoss Lee (Pc)eacock intersects 300 ( 609) Chapman Dora (c) 301 (204) Chapman Edw C (c) 303 ( 608) Miller Leila (c) 305 (606) Jackson Dorothy M (c) 307 ( 604) Johnson Ida (c) 309 (602) Winn Ida (cM) ason intersects 401 Moore Levorse (c) 403 Waters John (c) 405 King Edw (c) 407 Stephens Isaac (c) 40.9 Jones Melvina (c) 411 Dillard Geo (c) 456 Reeves Emma H(ecn) derson intersects 600 (113) Williams Mary (c) 601 (208) Bryant Viola (c) 602 (112) Razor Danl (c) 603 (207) Spivey Wm (c) 604 (111) Hill Robt (c) Snow's Laundry and Dry Gleaning Go. Licensed "Sanitone" Gleaner Phone 6000 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sepi. $15.00 per volume . L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 436 AUTHORIZED DEALER R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 COLQUITT (SM) --Contd 605 (206) Yarbrough Louis (c) 606 (110) Hill Wm (c) 608 (107) Vacant Toombs intersects 700 (519) Gale Lucille (c) 701 (700) Young Chas (c) 702 (320) Young Wm (c) 703 :(207) Jenkins Jacob (c) 704 ( 208) Greens Tabernacle (c) 705 (203) Washington Chas (c) 706 (205) Booth Wm (Tc)exas intersects 707 ( 202;) Harvey Chas (c) 800 (115) Story Chas (c) 801 (181) Porter Lucile (c) 145 Farr Noel 146 Riley Chester E 147 Morrow Eug 148 McDougal Ralph 149 Robinson David M 150 Hannock Hobson S 151 Tanner David H 152 Keen Geo L 153 Gordon John 154 Walker Robt A 155 Whitehead Roy C 156 Griffin Geo 157 Brewer Nathan 158-59 Brown Harry T COMMODORE--(Changed to Ajax) COLUMBUS -- From Orange west to Oglethorpe, 1 south of Forsyth CONCORD (South Macon) -- From 523 Elbert west to Broadway 2500Dewberry Annie L Mrs 105 Collier Robt (c) 225582/-LKeiengWVmirgEil E 261262- Mathew Erma nurse Olive Verna nurse Todd Kath nurse 264AShipman Alex H Emerson Martha nurse 2654'Etheridge Bobt N jr 266&Clark Seth E 270*Wall Jos A 272 Hambrick Horace O 106% Union Bros & Sisters of Zion Q C 110180 TBhrHiocamellaRs(ecuG)beeon ((ce)) LRaamv isNoJraas M Mrs 112 Barnes Mandy (c) 116 Howard Robt (c) 120 Turk John (c) 124 Price Thos (c) 128 Prince Benj (c) 130 Posey Jos 138 Barrington John O 146 Turner W Jos 274 Taylor Nancy E Mrs 280-OWellons Augustus R gro 282 Vlacant Appleton intersects 315Johnson Ida B Mrs 319ASchmidt Arth W 327AAllen Anna Mrs 328 Wellons Shelley E 330 Vacant 334 Means Sarah E Mrs 339AWellons Augustus R 340*Smith Stella Mrs 341 Brown Carlton H 343 Giddens Wm S 345 Thomas Ovin G 348ALines Rayfield 350 Langston Wm W 352 Mote Andrew J CORBIN AV (Vineville)--From 529 Vineville av north (formerly Virgin) lOO&Skinner Walter A 102*Murphy Robt H 104AWhitehead J Berrien 105--Griffith Arth 106AChilds Wyatt B 107ABurgess Malcolm 1110084AMMitactthheelwl sHJoorhranncTe N 1124-Chrisman Wm W 113AGreen Malcolm L 1144-Gardner Paul E AThomas Maurice C 111156-AftNSoanrrfiosrdWPmauMl H 117'-'Jones Mamie W 118-ATowler Silas C COLUMBUS RD -- Changed to Mont- 119AStewart Louise J Mrs pelier av 121AMcWilliams Manley F COMER TER (Payne Mills)--From Rose av S, 1 east of Green 112 Dukes Louie M 113 Pope Maggie Mrs 114 pollock Walter K 115 Orick Clyde B 116 B'rickle Claud M 117 Rice Chandler 118 Mason Clem 119 Noble John W 120 Sapp Geo 121 Fincher Raymond 122 Welch Andrev/ W 123 Gordon Wm T 124 Hammock Wm T 125 Salter Benj L 126 Pope John W Clayton intersects 203AOliver Jas W 204-'-'Kingman Robt D 205*Stukes Jos T 206AAtkinson. Harold C 207 Vacant 2084 Beach Donald D 209-ARedding Edw B 210AKnott Jas A 221121/A- JWonilelisamGsroAvnedr reCw M 213ARiley Jos T jr 2144-Dunwody Danl D 215AWatson Richd P 216'AAtkinson Mallory C 217ABlum Arie I McDonald intersects 1:27 Johnson Leroy R 301AFitzpatrick Benj S 128 Tyson Lloyd L 302-tSilvers Mark 129 Rainey Horace T 303AWallace Milton K 130 Benton Bennett H 304AChichester Helon L 13.1 Wilkes Harley 3Q7ADurham Clifford S 132 Kitchens Arnold E 315ADavis Wallace M 133 Webb Zack R 317AManget Victor 134-35 Cobb Ernest F 319AThombley Robt L 136 Jackson Otis 325 (311) Jackson Alonzo (c) 137 Dunn Chas G 327i (315) Scott Florence (c) 13 Layfield Hillery V 329 (316) Burke John E (c) 139 Chambley Jesse 330 (312) Brantley Alf (c) 140 Clifton Aury end Ocmulgee Park (c) 141 Welch John H 142 Braddy Jas L COTTON AV--1 west of Second, runs 114434 DCuoBleomsaenHMowobalredy P southwest to Spring 103'lClark Drug Co 437 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 COTTON AV--Contd_ 105 Hardeman Building RoolAmAs:vant Norman A rea,l es.t 2AFeagin R Douglas jr lawyer 4SABRliogohdtwWorathy &FinBalnocoedwCoorth lawyers 5-6AGa Retail Lmbr & Bldg Sup Assn (dist No 3) 8-9 Vacant 1123-V14a-cTainptton Edw W lawyer AUrquhart Julian F lawyer 15AClements F Larcus lawyer Johnson Arth M real est Campbell Robt D C lawyer 3SdtrefletSacnodnetirnsueJudlius 107ARoyal Typewriter Agency AMillirons Plmbg & Htg Co 109Aldle Hour Nurseries 111 MWaassohninicgtHonallCounci,,l No 6 R&SM Central City Chapter No 28 OES Macon Lodge No 5 F&AM StOmar Commandery No 2 KT Constantine Chapter No 4 RAM 113AExchange Furn Co AAEBvraonws nR-Sutfaurrs ERlecradCioo croenptrrs 115AHill Dry Cleaning Co clo clnrs 117AWarlick: Hillyer C photog ASchelling Shoe Shop shoe repr ASilk Stocking Hospital 123AFilm Shop The photogs 112235%APAucdkaemttss TBheoaustyMSalon 12'7AAMElakscoCn luLbodge No 230 BPO_E United Spanish War Veterans 131-Lowe Elec Co Wa,,ll i.nt.ersects R1o5o0mHs:app Building 201 Vacant 202 Vacant 203-05 Vacant 206 Vacant 301-02AWells Wm D dentist 3O3-04APerdue Chas H dentist 305AWilson & Vandiver lawyers 330067AVGarcaaynsotn Dolly Cosmetic Co t.o.i.le.t articles 308 Vacant 440013--0076AVMacaaynnat rd Elijah W lawyer AACTaityyloAr tEtodrwneyF lawyer Ajones S Gustavus lawyer 408AMacon Savings Bank 550014--0068A*CGaeroligshleeg&an B&ooNtleorrliaswyaoercsts Street continued 151AArtistic Beauty Shop l/53AMacon Memorial Park Inc 154AVincent F T Realty Co Inc 155ANatl Cash Register Co 156AStokes Thos W real est Aindustrial Loan & Inv Co Inc (side ent) AWatch Shop The watch repr 157ABurns Kenmore Inc real est. 158ASmith Virginia dancing studio 159AWoman's Exchange novelties 160-66 Rhodes A G & Son (back ent) l'6HATaylor Furn Co 161%ACokes Studio photogs 116791AWNouottdin-PgeaFvlyoraFlurCno* Co (stge) 17!3ARialto Theatre 179AGeorgia Power Co Cherry intersects 201AEClloismmBuunilidtyingSavings & Loan Co 201%ARogers Jos W phys AEarles Nancy toilet articles 203AStanton Sound Service radio reprs 205ACollins Baking Co 220067ASGterpeahtenAs &BaPrbeTreaShCoop (br) gros 2200&8AACPiagngtleyr WNiagtghlaynSdtoerleicsat(ebsrs)engros 210 Rogers Stores gros 210%AAtwood Pleating Shop embroidery AAtwood E Jay photog 211ABBaannkkeerrss HIns&urLanIcnes BCuoilTdihneg (home office) AAWSoMuAthZeasRteamdioBsrtoaadcasting Co Inc 221123ARSooyiaitlhePrneanBuetll CToeln&utsTeleg Co 2i4ALinenlkohl's Shoe Shop reprs 216ACentral Georgia Baking Co 218 Nu Way Weiner Stand restr 222202ARMainllkeirnBCrolasrepnlcmebrMs beer 222% G(maedNicaatll Gdeutaarcdhm12e1nstt) Infantry 224AMoore's Dity Lunch Room 226 New Life Lunch 226%ABell Junius J (c) dentist 228-28% Vacant ,,First. i.nt.ersect.s 359ALucky Strike Bowling Alleys 361ABarhes & Barnes Inc ins ARoberson Realty Co ACalhoun Horace C real est 361% Vacant 363-65ASullivan & HillPeoyplfailrliningtesrtsaects 407 Vacant 407% Vacant 409 Vacant 411ACriswell Andrew F plmbr AWelch John M sheet metal wkr 411%CeMntarsaoln-iCcityHLaloldg(ec)No 8 F&AM (c) Smith Robt L (c) lawyer 441135 BVaaicleaynt Iola (c) barber 441179-V21aAcBanlbtb Poultry Co 421%ASanford Clyde R (c) tailor 423i 'South Side Social Club (c) 442259&AJinoghrnasmon SWamailte(rc)Nre(sct)r tailor 451AYetter Geo F Inc plmbr 451% Melba Lodge No 555 I B P O E (c) 452AHurley Electric Co 458 Vacant 454ABradley Oscar gro 455 Vacant 456 Union Shoe Shop shoe reprs 445567%AmVdaecpaenntdent Funeral Home (;c) 458 Yellin Benj delicatessen 460-62 Duv'al Paul & Son (c) furn reprs 461 Vacant 463 Vacant 446635%ACBlermyoannst SJoolhnC ((cc)) real est 466-68AHubbard Co (c) funeral directors 466% Riley Fannie (c) 446679-W71iAllSiaixmsPoMinatudLeunEchMrs 474ADavidson M L Elec Co contrs 476 Vacant 478ADean Otis W Grocery Dean W Bonnie Plum i*nte*rse*cts New intersects SOOARivers & Chambers filling sta 550017-W09iAldAenrdr&ewsJoSnheseeftilMlinegtalstaWks SllAVaughn Wm J 5111% Dye Taylor 513AOdom Variety Works cabtmkrs 513% Stephens Wm A AWallace Wm E 515 Jenkins Maggie (c) restr 517AShropshire John T plmbr 519*Lubach Anthony P veterinarian SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 YOUR CITY MIRRORS the SOCIAL Of Your CITY 438 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES I !JJJ Plymouth COTTON AV--Contd 523% Harris Vinie (c) 525. Vacant 527-'-Kyle's Drug Store (c) 52'7%-O.Pilgrim Health & Life Ins Co (c) 528 Vacant 529 Vacant 530'-'Central City Funeral Home (c) 531 Powell Wallace (c) 534 Vacant 538 Vacant 546 Vacant 561 Leak Daisy (c) 565Astewart Chapel AME Church (c) Spring i*nte*rse*cts Pine i*nte*rse*cts Forsyth begins COURTLAND AV -- From C of Ga Ry south to Montpelier av 5Q5AMoCord John S SIQADavis Chas H 515-0-lSlocum Karl R 520ARankin Goodwin S 5532(5KA!DSetenptheJnsTohnosJas L 540APreston John G 555405-rA-HTihcokms aJsasGeRo N jr 555AHU1 David W Hill Winnie M kindergarten 5S0--Murrah Bascom W 565 Vacant 570 tStJames Episcopal Church 575ARoller Howard F 585 Vacant Napier av intersect* 667*Lowrance Jas L 6666779'08-AAdBCSatharaflpliwemlodarntJhoChPhnaauslRCBagwell Bernice L Mrs 679 Vacant 680AMarshall A Roy 695AEmerson J Fred jr 6962'Leverette Oscar E Beech intersects 708-McCowen Geo S 709 Stone J Lindsey Maddux Kathleen 717 Lester Effie H Mrs 730AMillican Wm T 731ASheehan L Clyde 774423-AOT.piectkzninogrerEuCghaTs F 750 Alexander Geo W 761&Smith Allen J 777AHarp Melvin 782AHudson Harry H 793AMcWaters Chas L 794AGolsan Wm R Date intersects 806-O Jones John A 808AGallemore J Parker 815--'Rankin Benj N AJones Elma D Mrs 840AMarshall Onan W 841AFarris Walter L 842*Gilman Jesse P 843AWalthall Frank W 885405AAGJarcekesnoen BLeonujisWL 852ASuarez Raymond ASykes lElmer E 854 Oxley B Thamar Cherry i*nte*rsects Napier intersects COWAN (East Macon)--From 909 Clinton east to city limits, 3 north of Broad 104 Cowan Susie (c) 106 Roland Emma (c) 108 Mercer Thos (c) 110 Forrest Atheline (c) 112 Middlebrooks Edw (c) 114 Gooden Albert (c) 116 Brantley Marshall (c) 118 Collins Edw (c) 120 Thomas Andrew (c) 121 Vacant 122 Wright Susie (c) Northern av intersects 124 McDowen John (c) 226 (126) Ross Roosevelt (c) 228 Ward Jos (c) 230 (130) Thomas Moses (c) 232 (136) Brown Ella (c) 234 (138) McCrey Albert (e) 236 (140) Hunt Fannie (c) 245 Hunt Wm (c) 247 (246) James Noble J (c) 249 (248) Mercer Lizzie (c) 251 Billingslea Otis (c) 253 -Canty Jas (c) 255 Ford Julia (c) 257 Tharpe Augustus (c) 259 Woolrust Barney (c) 263 Ross Carrie (c) 265 Walker Mattie (c) Lexington intersects 303 Goddard Calvin (c) Little Short intersects 305 Bowman Delia (c) Center intersects 440001 T'(2u9g8g)lAeBCirohnasson(cW) m jr (c) 402 Stallworth Mack (c) Ritchey al intersects 403 (300) Ritchey C Moses (c) 404 Reeves Wm (c) 405 Quick Judson (c) 408 (345) Carson Jesse (c) Womack intersects 500 Card Sallie (c) 502 (129) Byrd Geo (c) 508 (430) Powell Mose (C) 510 (650) Thorpe Jas (Cc)lark intersects 520 East Side Funeral Home (c) AJohnson Amy (c) 602 (516) Jackson EuFloart(Hc)ill intersects 604 Lewis Eulis (c) Smith intersects 606 (593) Glover Wiley G (c) 661028 ((658985)) JRoeneesse TCalbaerrennaccele(Cc)ME Ch (c) Maynard intersects 700 (620) Bryant Arth (c) 701 (117) Gross Danl (c) Ballard intersects 702 (122) Lowe Mattie (c) 703 Childs Beulah (c) 704 (118) Bryant Andrew (c) 709 Harris Lucius (c) Norris intersects 800 Jackson Thos (c) 801 (814) Harkless Ida (c) 803 (816) Garmon Carrie (c) 806 (820) Perry Patsy (c) 809 (852) Sinclair Jos (c) 811 (854) Johnson David (c) 812 Childs Ida (c) 813 (856) Jelks Alf (c) Short intersects 900 Banks Richd (c) 901 (917) Hilliard Frank (c) 902 (991) Nelson Wm (c) 903- (916) Green Chas (c) Society intersects 904 (992) Williams Chas (c) 909 ( 993) Lindsay Andrew (c) Bowman i*nterse*cts Glenn intersects CRAFT (Vineville) -- From 301 Hardeman av east to Second av 101 (312) Smith Carrie (c) 102 (85) McCrary Alex (c) 104 (303) Taylor Bishop (c) 106 (305) Branch Fannie (c) 108 (299) Gibbons Irene (c) 110 (295) Bryant Sandy (c) 439 WILLINGHAM SAA SH a & mD_ O _ A. OR CO. Lime - Roofing - Cement - Plaster 457 Third St. Phones 277-278-279 CRAFT (V)--Contd 111 (302) Bailey Jos J Rev (c) 112 (.300) Thomas Blester (c) 114 (523) Vacant 115 (298) Jackson SoFl ir(sct) av intersects 115 (366) Parker Anna (c) 117 (525) Moughon Jennie (c) 118 (37) Davis Chas (c) 120 (448) Jones Mary (c) 201 (362)AWalker Eug (c) 203 (365) Hill Alice (c) 205 0358) Waitress Mattie J (c) 206 (5231) Gunn John B 207 (73) Denson John (c) 209 (75) Carter Wm (c) 211 (79) Edmondson Frank (c) 2(13 (369) Simmons Gussie (c) 215 (393) Howard Thos (c) 441 Gray John T (c) furn repr CRAFT LANE (Vineville)--South from 211 Craft 402 Graham lizzie (c) 403 Moseley Rosalie (c) 404 Kimball Clarence (c) 406 Vacant 407 (167) Jdhnson Sallie (c) 408 Vacant CRAIG'S LANE (South Macon)--From Ell south bet Second and White 50 (51) Vacant 5534 FVoaucnantatin Benj (c) 56 Talton Geo (c) 61 Maddox Lizzie (c) CRESCENT AV (Cherokee Hts) -- From Suwanee av south to Napier av 117ATarver Danl A 119ANutting Geo G 121*Nutting John B 123AMcAfee Chas O 127 Berry Russell R 153AJarvis Elmer L 157-0-Bledsoe Walter C 194 (108)ABateman Ross C 199 (120)AWhittle Jas C 198AHunt Eunice J Mrs 200AStephens Hugh L 202&Hitchcock Roland M 204 Greene J Millard 206 Fisher Albert 208*Miller John M 21O0Rockwell Beverley H CRISP (South Macon) -- From Houston av east to Antioch, 3 east of Enterprise lOOALyles Benj F 110012 ((9160)5)LAiCndlesveeylanWdmGrFover C 110034 ((l1O0O7))AABCaauissdeeyn ARrothbt LE Terry Marion P 106 (100) Burke Lee R 107 (110) Mathews Mary A Mrs 108 (lll)AClifford Geo R 109 (112) Boland J Lee 110 (113) Ong Benj F 111 (114) Taylor Jesse J 112 (117) Lindler Wm P 113 (ill6)ABius Earl M 114 (115) Rawlins Thos J 115 (118)&Ivey Wm C 117 1120) Reeves Jas L Rev 119 G56)AWoodall Jas R 121 Thames Earl T Blount intersects 201 (202) Dyes S Lee gro Antioch rd i*nte*rse*cts Peacock intersects 300 (301) Burke Ola (c) 301 (300) Johnson Lee J (c) 302 ( 303) Driskell Beulah (c) 303 (302) Brazell Hudson (c) 304 (305) Holt Frank (c) 305 (304) Anderson Annie (c) 330076 P(3a0u6l)doMCanlisfofnordJo(hcn) W (c) 308 (307) 'Smith Lula (c) 310 (309) Dean Elijah M(ca)son i.ntersects 400 (8) Thomas Aug (c) 401 (402) Hawkins Annie K (c) 402 (9) Sipp Kirrie (c) 403 (404) Burns Lilia (c) 405 (406) Johnson Henry (c) 407 (408) Holloway Ruby (c) 408 (501) Smith Archie (c) 409 (410) Mallory Maggie (c) 411 Thomas Lee (cH)enderson intersects 500 (501) Jones Fannie (c) 501 (471) Humphries Silas (c) 502 ( 503) Vacant 503 Church of God in Christ (C) 504 (505) Williams Allen (c) 505 (400)AVineent H Pierson gro 506 (507) Williams Bush (c) 507 Y(4a1u5)ghYnauEgrhvnin FC Cicero gro 508 (509) Vacant 510 (511) Brown Robt (c) 512 (513) Davis John STtev(ecn)s intersects 600 (601) Wash Carl (c) 601 (275) Jones Albert (c) 603 (274) Paul Eunice (c) 605 (406) Reeves Augustus (c) 607 (606) Howard PerTroyom(cb)s intersects 608 (56) Harris Frank (c) 661102 ((75046) )JoWhansshonMRaircyhd(c)(c) 614 (615) Flewellyn BTrooowmnbs(ci)ntersects 701 (608) Bell John (c) 703 (610)ABeall Claude (c) 705 (612) Dill John (c) 707 (3) Johnson Floyd T(ecx) as intersects 801 (701) Jackson Hattie (e) 803 (789) Jackson Annie (c) 805 (788) Porter Buster (c) 806 (700) ATerrill A Jack (c) 807 (108) Green Foushions S (c) 808 (110) Vacant 809 ( 223) Johnson Ethel (C) CRUMPS PARK -- From 405 Ridge av north, 2 west of Park av 105 Cook Arth C 108AMcCord Ca.iah R 115 Clifton Walton H CULPEPPER'S LA (V)--From 139 Pierce av west CULVER (V) -- From 461 Vineville av north to 3d av 102-OWilcox Geo M Rev l04ABaynard Geo A 105APittman Marvin C (c) 110067AARkeeargmananFCrahnaks lawyer 109 Holt Frances M ASheehan John C lllASmart Herbert 113 TKaeyelnourmDJHBuegnhjes Simmons Thos 115AJones Thos M 117 Thomas Jas A AThomas Fannie H Mrs 119AMiller Boyce E 121 McKay Chas P 123ACherry Henry T 125ABarfield Thos 127ADeaust Annie [WS Mrs 129 Frierson Mary N Mrs lSlAHolliman Roy B 133 Bowman Alice M Mrs 135 Cheves Jesse R 137 Drinnon Wm M 139 Randall Viola (c) Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume ft. L. Polk & Go. Publishers 431 Howard St. Detroit 3S4 4th Ave. New York 440 Who Sells It? IS Answered By the Classified Business Lists In this Directory FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature CURD (South Macon) -- From Telfair west to Alabama, 4 south of Edgewood av 312 Howard Artis (c) 414 Vornadore WhTeeinledrall(ca)v intersects 446 Brewer John H (c) 448 Smith Eug S (c) Campbell av i*nte*rsects 800 Vacant Nussbaum intersects 801 Price Eva (c) 803 Hall Mary L (c) 815 Ross Wm G (c) 882231/-AKdimamblse Herman Wm W 824-OWhiddon Mary A Mrs Jones Ewell C CURD'S AL -- North from Woodcliff, 1 west of College 101 (78) Vacant 103 Johnson Prank J (c) 105 0126) Layton Rebecca (c) 109 (365) Smith Henry (c) `111 Phelps Wm (c) CURRY DRIVE -- From Nottingham north to Boulevard, 1 north of North av ISOORankin Geo P 132*Herron Hugh J 138*McGhee Connor 140*Daly Augustin CURRY PLACE (North Highland) -- From North av east to Clinton rd 108*Dunn Roy L jr 125*Joanis Marian Mrs nurse Joanis Wm C 127*Dove Wm B 129 Vacant 131*Bragg Earle S 132-OBergman Carl A CUTRO AL--From Roff Home av south to Roye, 2 west of Pio Nono av 101 Middlebrooks Clara (c) 102 Thomas Susie (c) 103 Simmons Collier (c) 104 May John (c) CUTTER'S GREEN (East Macon) -- North from 503 Main 301 (303) Lunceford Clifford E 303 (301) Morrison Wm T 305 (306)*Colbert Wm H 308*Heath Linda E Mrs 310*Smyly Jas T 311 Booth Merritt E 314 Smith Jas Allen Harry Brown Mary Mrs 315*Walden Roger L 318*Smith Benj F CUTTER'S LANE (East Macon)--From 602 Main north 200 Taylor Tullie M 202 Brannon Jas H 213 (112) Lavar A Leonard 219 (120) Dudley Averilla M Mrs 220 (121) House Mitchell P 223 (122) Land Viola Mrs 233 (203) Everidge Dozier 235 Dukes Jas M DAsoISutYh t(oSoPultahntM, 2acsoonu) th--ofFrCoomllePgerince 701 Williams Jas (c) 702*Shrem Jack 703 Anderson Robt (c) 710 Solomon Jas (c) 711 Fudge John P (c) 712 Stephens Earl (c) 713 Oliphant Lee (c) 714 Little Chas (c) 715*Solomon Chas (c) 716 Ross John (c) 717*Hill Jas (c) 718 Glover Cecil (c) 719 Hart Orange (c) 720 Simmons Arth (c) 721 Ross Major (c) 722 Hamlin Gertrude (c) 723 Wood Albert (c) 724 Brown Annie (c) 725 Clayton Cleveland (c) 726 Brown Jordan (c) 800 Wlalker Enoch (c) Mary ends 801 Thrash Wm (c) 803 Thrash John (c) 805 Evans Victoria (c) 809 Jones Leola (c) 811 Dandy Frank (c) 813 Woofolk Annie (c) 815 Watson Minnie (c) 817 Robertson Wm (c) 825 Thomas Leroy (c) DAfrIoSmY PSAprRinKg --noCrthonttionuOatriaonnge,of Pine, 99 Hobbs Robt E 100*Smith Mary L Mrs 135*Giles Wm M 137 Eidson Allen O 139'-'-Chambers Woodfln C `Chambers Minnie L Mrs mus tchr 147 Faircloth Jesse J 149 Fann Brooks 161*Chiles Mack S DALEY (South Macon)--From Broadway west to 2d, 1 south of Ell 117 White Andrew J 119 Thomas Margt E Mrs ,122 Wood Michl D 125 Brown Geo T 130 Jessup C Hickman 131 Andrews Jos E 139 Moss Allen M DAMOUR LANE:--From Fourth north to Third, bet Ocmulgee and Walnut 419 Walden Maria (c) 421 Joiner Bee (c) 423 Crawford Thos (c) DA2NsNoEutNhBEofRGC AoLf --GFaroRmyHolt av east, 61 (12) Narrell Cecil J 92 Cranford Cecil E `94 (324) Stroud Curley Mrs 99 (11) Newberry ESsie Mrs DAwNesNt ENBERG AV--From, SOI Linden av 119 (219) Wright Gus (c) 121 (211) Murray Danl (c) 122 (222) Williams Geo (c) 123 (215) Banks Walter (c) 124 (224) Collier Elder (c) Carling av intersects 203 (3) Darley Doshia Mrs 205 (2) Gregory Annie M Mrs 207 (11) Jordan Alpha Mrs Duncan av intersects 369 Bechman Chas A 313 Youghn Wm P Ethridge Chas A 315 Lynch Joel L Randolph pi ends 317 Alton Ormond Birt Oscar H 318*Hogue Sami B 318% Allen Ernest C 319 Williams Raymond A 320 Hogue Sami B gro 321 Ward Edw W 323 Kennedy Jesse C 324 Herring Robt A 325 King Annie Mrs 326 Vacant 327 Gibson Geo W gro 330 Goins Robt W 332 Moore Wm H 336 Bagley M Ruth Mrs 441 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 DASHERS AL--From 354 Oak south to 323 Oglethorpe DATE aV--From 797 Patterson west, 1 north of Montpelier av 794 Adams V JaS 705 Vacant 771197/A-'FMlocoCdraHryarNryolaTn 721AArd John D 726 McElroy Jack Rev 728 Sawyer J Carlton jr 733ACleveland Miary Mrs 738AFinison Ernest H 750 Edwards Bennett H 760ABradford Floyd V 774APeddicord Geo W DAVID--East from Burton av, 2 south of Log Cabin blvd 1010 Elhe Harold J DAVIDSON'S AL--Changed to Davis a1 DAVIS (North Highland)--From Clin- ton rd north bey limits, 1 west of Broad 102 Morris John T (c) 104 Davis Wm (c) 105 Lizaboro Baptist Church (c) 106 Groce Albert H (c) house mover 107 Vacant DAsVouTtSh, (P1ayenaset MofillsB) ri--ghaFmrom Rose av 48-49 Whitlock Arth F 50 Moon Carrie Mrs 51 Herring Wm T 52-53 Cochran John H 54-55 Rice Strouthers A 56 (57) Perkins Robt J 58 Giddens Danl B 60 Whitlock Howard H 61-62 Jordan Jesse J 63 Petat Willie 64 Purser Hudson 65-66 Jordan Woodrow C 67 Boy Scouts of America Troop No 2 68 Payne City Auditorium 69 Welfare Workers Cottage The Hayes Clara M 70-71 Payne City Clinic 72 (73) Cobb Thos J DAVIS LANE--North from 263 Fifth av 101 (57) Marlowe Lizzie (c) 102 Glover Murger (c) 103! (155) Lowery Jos (c) 104 (111) Sutton Gertrude (c) 106 (113) Guyton Win B (c) 108 (115) Jordan Louise (c) 110 (117) Cooper Lucius (c) DeBORDE (South Macon)--West from Elbert to Second, 1 north of Henry 7 (10) Williams Lonnie (c) 9 Williams Wm (c) 10 (78) James Hattie (c) 100 (172)AStephens Robt A (c) 101 (179) Bedney Mattie (c) 102 (170) APharm.es Jesse (c) 103 (177) Burns Murray (c) 104 (164) Goodrum Geo (C) 110056A(1S7n5o)wdEennglAannddreJwos ((cc)) 407 (173) Cleburne Cornelius (c) 108 (160) Ransom (c) 109 (171) Pine Isaac (c) 110 (158) Mathes Wm (c) 111 (169) AHudson Wm (c) 112 (156)AGill Arth (c) 113 (167) Harrell Wm R Rev (c) 114 (154)ACrowder Jesse (c) 115 (165) Wilder Green (c) 116 (152) Guv Jos A (c) 117 (163) Lamar Millie (c) 118 (150)ABolden David (c) 119 (161)ABen.iamin Wm (c) 121 (159) Murphy Robt (c) 123 Horne John H (c) 125 Hill Jas (c) 127 (153) 'White Jackson (c) 129 (151) Simmons Jas (c) 542 Vacant 544 Vacant 546 Vacant 548 Vacant 565 Wall Henry C 574 Heath Sara DEL WAY (Dell Park, Bellevue)--From. 1933 Log Cabin blvd west to Chrest Hill av lOlACarlisle Lewis W 106ADonnan Albert B DAVIS (South Mdcon)--From Houston ay to Mikado av, 1 south of Troup 100 Smith Jerry T Byrd Lee C Capitol av begins 101 McKinney Harvey C 102 Emerson Susie Mrs lOSbByrd Geo H 110 Campbell Isaac J Mikado intersects 202 Harper Wm W 207 Mosely Von V 210 Ford Thos V 212 Morris Henry J DAVIS (Unionville)--From Mosley south to Parker, 1 east of Woodard 122 Wilder Lizzie (c) 137 White Jos (c) DAVIS AL--From Ocmulgee north to river, bet Fifth and Sixth 189 Kornegay Eliz (c) 267 Logan Lela (c) 432 Bailey Essie (c) Jones Sol (c) DAdVenISnAoLrth(Eatsot MWaiclboonr)n--From 273 Gar110024 ((22724) ) HSamllsithHaAmnnpiteon(c()c) 106 (3) Bonner Mamie (c) 108 (4) Walker Obie (c) 110 (5) Morris Julia (c) 112 (6) Beal Jas (c) DELAWARE AV (Vineville)--East from 117 Cleveland av to Buckingham pi, 1 south of Vineville av 104Agmith Carl B 106AMiddlebrooks W Fred 108AComer C Johnson llOARainey S Clifford jr Oak Haven av intersects 206AThorpe Daisy W Mrs 208-'ammons J Ellis Rev 210AKimball Clyde W DEMPSEY AV (Unionville)--From junction of S College and Plant west 210 (300) Jackson Jessie L 226 Banks John (c) 240 Ross Jas M (c) Fourth av intersects 240 Scott Frank (c) 247 Thomas Arth L (c) 323 Scott Ada (c) 324 Barker Essie (c) 328 Gray Cora A (c) 330 Williams Sami (c) Bartlett av begins 332 Hunter Jas (c) 334AChilds Georgia (c) 338 Odom Palmie (c) 339 (238) Leary Wm B (c) 340 (79) Powell Arth (c) 341 (277) Hollis Chas F (c) Pio Nono av intersects 807 Kellum Troy L (c) 808 (809) Wright Henry (c) Middle intersects !--Ck1 V1 2 in to tton MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L. POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 442 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Go. Publishers 43 X Howard St. Detroit 354 4th Ave. New York MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY RONDS Telephone 1811 DEMPSEY AV (U)--Contd 811 (1004) Burkett Bailie (c) 813 (724) Davis Thos (c) 226 (3) Vacant 227 (561) Parks Frank (c) 229 (112) Ridley Anne (c) Cedar i*nte*rse*cts 236 (161) Smith Wm (c) Fifth av intersects 905 (107) Stewart Wm (c) 907 McFarland Mabel (c) 909 Banks Harry (c) Fourth av intersects 1001 (222) Colbert Louis (c) DIVIDEN AV--From Cherry to Walnut bet Fifth and Sixth DIVISION (Tybee) --From Sou Ry Yds south to Edgewood av, 2 north of Hammond 1005 (224) Jones Roger (c) 1007 Vacant 140 Parker Ernest (c) 207 Jones Irene (c) restr 1103 Manard Chas HTh(icrd) av' intersects 207a Lewis Jos (c) rear Vacant Second av i*nte*rse*cts 1233 Smith Nancy F(co)urth av intersects 1235 (40) Jones W.m M Rev (c) 1237 Ellison Wm (c) 1239 Perkins Annie (c) 1240 (1008) Moseley Sank (c) 209 Bivins Howard (c) 221110 BAadratmlesy HIroteseda (c(c)) 214 Hicks Henry (c) 216 Chandler Phyllis (c) 217 Vacant 221198 VThaocamnats Mary (c) 1301 Wolfolk Albert F(ci)fth av intersects 1302 (1411) Slocum Jas (c) 220 Corker Gordon (c) 221 Vacant 222 Vacant 1625 (1245) Perkins Wallace (c) 1639 (1411) Bivins Owen (c) 1640 (1412) Vacant 223 Baker Annie M (c) 311 Jolly Hazel (c) 315 Gordon Emanuel (c) 1710 (1514) Calloway HandyPa(rck) begins 316 McCrary Ella (c) 317 Cleveland Chas C (c) 1714 (1516) Brunson Wm (c) 319 Jefferson Millie (c) 1716 Johnson Robt (c) 321 Cummings Arth (c) 1717 McBride Wm R (c) 323 Whitehead Wm (c) 1718 Davis Sami (c) 325 Searcey Annie (c) 1802 Cliett Lonnie (c) Key begins 327 Vacant 329 Brown Henry (c) 1805 Calhoun Lavonia (c) DE SOTA PLACE (Formerly Texas av) --From 1320- Vineville av north 340 Parker Ernest (c) 400 Williams Julia (c) 402 Cooper Geo (c) 404 New Bethel Baptist Church (c) 102ABivins Howard J 103110045- Askew Benj R 106AMcKinney Otis L 108109111 Roberts Calvin W 112-bClark W Egbert 114ABaldwin Chas W 115 Land Wm O 116 Allen Thos J 118AFaulk Wm 119AHovey Edwin R 608 Brantley Jordan (c) O O 666011959 BTCyroollelwirnnsRVRoibiocelhartda (c(()cc)) BPorapdpbeur ryJosJohWn L 620-'-Macon Cooperage Co b K 666222315 GPAasalhzmlaeweyrayJJoohLhninzzi(e(cc))(c) HeairninnetEt-lliJsasR T 626 Kemp Sami (b) 627 Eveready Lunch Room 632 Carr Edw S 633 Vacant 635 Palmer Alex (c) Elm intersects 1l2210/.,MCoazyineNaJtohhann D E jr 122-OMcMichael Victor H corAT & T Packing Co whol meats Edgewood av begins corAgtandard Tool & Handle Co plant DE SOTA (Lynmore Estates) 770ATexas Co The whol oils ABuckeye Cotton Oil Co DESSAU PLACE--From 243 Hardeman av to First 3*Jones Allen A DIVISION (South Macon) - -Changed to Alabama 5-bPritchard E Hanson Mrs 79&*BKrnoiwghnt MGaeroy EMrs ll-CLamb Paul R DIVISION ST LANE -- From Division west, bet Bay and Turpin 102 Kaigler John (c) DEWITT (East Macon) -- North from Clinton to Hydrolia, 2 east of Main 104 Vacant 103 Ross Elnora (c) 122 Sanford Ida (c) 197 Stafford Floyd (c) 221 Lundy Laura (c) 106 Knight Benj 222 Colbert Adolphus (c) 108 (104) Register Lucile Mrs 110 (105) Graham John 112 (107) Rammage Ruby 225 Vacant 244 Griffin Bessie (c) 248 Howard Jos (c) 114 (109) James Minnie Mrs 264 Hines Chas (c) 116 (111) Turner Jack DIXIE AV (South Macon)--From 2719 DISROON AL--North from 122 Spring Houston av west to city limits to Franklin, bet Walnut and Ocmulgee 217 (117) Bryant Tabernacle Baptist Church (c) 103 Langston Raymond E 105 Thomas Ezekiel G 110 Shirah Henry N lllAParnell Lorena Mrs 220 (156) Banks Frances (c) 221 (6) Mayfield Mamie (c) Clemons la intersects 112AWest Jas E 113 Mannheim Jos @ 115 Shine Lillie M Mrs @ 223 (564) Jackson Wm (c) 224 (2) Vacant 116ANewby Burns 117 Knowles Mattie E Mrs 443 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 DIXIE AV (SM) --Contd 125 Hysler Wm H 135AMcDonell Wm SFlorence av ends 150*Carmichael Henry G DIXIE ROW -- West from 752^ block Ocmulgee, bet First and New DOUGHERTY (East Macon)--From 315 Church west to Center DOUGLAS (South Macon)--North from Chappell to Broadway, 1 west of Ell 121 Stanley Hayes (c) DOUGLAS AV (Vineville)--From junction of Moughon and Fourth av west 103 McGaugh Wesley (c) 107 Fish Spencer (c) 115 Williams Albert S W(ca)rdintersects 117 Stewart Richd C (c) barber Smith Chas LLinrceostlnr av intersects 202 Chaney Annie L (c) 220043&SRhoesfsfieCldhasMHattie(c) (c) 206 Jenkins John (c) 208 .Lavender Ernest (c) 259 Vacant Forest av intersects 306 Tanner Frank (c) 308 Clyde Jas (c) 309 Winn Wm (c) gro 32lhPowell Willie (c) 339 Vacant Ruby intersects Penn av intersects 342 Brookins Helen (c) 343 Thweatt Edw (c) 405 Vacant 411 Smith Thos (c) 419 Green Wiley (c) 421 Jones David . (c) 429 Hunt Frances (c) 435 Howard Wm F' (c) 441 Smith Jot (c) 444 Gibson Jeff (c) 445 Jackson Willis (c) 448 Taylor Magnolia (c) 453 Lundy John W (c) 457 Edwards Wm (c) 461 Chandler Robt (c) 465 Howard Lizzie (c) 469 Walker Mattie (c) 473 Holmes Garrett (c) 475 Gordon Sami gro 481 Thweatt Alex M (c) 668 Tharpe Jas (c) 674*Shorter Butler E (c) 868AWilliams Zachariaih (c) DO--VFEroRm(B10e8lleAvyueer)s r(dfosromuetrhlytoEVchilolapaiv) 300 Bales Vernon W 302 Criswell Roy E 304 Jones Columbus (c) 308 Corbin Reano (c) DREWS QUARTERS--South from Winship, 1 west of Fourth av 101 Jordan Steph (c) 103 Scott Brady (c) 105 Coley Geo (c) 107 Marshall Chas (c) 109 Jones Cook (c) 111 Blue Edw (c) 113 Shirley Danl (c) DRURY AV (Ingleside) --From Ridge av, 1 north of Merritt 1 Hines J Claude 3 Tabor Hugh L 46-0B-LoereomArtShamHi T 1184-0S-acournledyersThWosmAH 22AUpchurch Phillip R 26 Brown G Wright DUFFEY'S AL--From Elm to Edgewood av, bet Telfair and Jackson 2 (355) Carter Minnie (c) 3 ( 3566) Hart Richd (c) 5 (567) Moore Jesse (c) 6 (157) Rumph Edw (c) 7 (3565) Childs Sallie (c) 9 (3559) Shoates Jas (c) DUNCAN AV--From C of Ga Ry south, 1 west of Edgewood av 102 (10) Whitehead Wm J rear 102 (10) Abemathey Benj 104 (11) Johnson Lonnie H rear 104 (11) Dykes Henry A 107 (108) Vacant 109 (110) Vacant 111 (112) Clanton Ozell H 113 (114) NewDbaenrrnyenJboehrgn av intersects 201 DuPree Jas T 202 Batson Walton G 203 Hicks Jesse W 206 Spear Euria. 210 Stewart Henry S 217 Grant Fred E 219 McCord J Alf 221 Livingston Grady C 224 Wood Minnie A Mrs Lagrone Minnie Mrs 226-ACarpenter Arth B 230 King W Ponder 233 Gregory Jas T 240 Fowler Chas J 242 Michael Jos gro 243&Carpenter RalLpahwtEon av intersects 301 Folsom Gussie A Mrs gro 302'iDixon Tobias A 307-OPilcher J Alton 310ALangston Arth R 311*FSeihaegriwnooLdillTiehoMs rsB jr 312-0-Fetner Leo A 315ASires Melvin J 331295-hdBWaalltasordn JAonhnnie WL Rev 340*Callianos Peter A 342 Braddy Clifton T Napier a*v b*eg*ins Coleman av ends 401&Thames Walter F contr 440053/'--FBruerermouagnhsIdAasaMBrs 440097/*-,MWiidlsdolenbrCooakrls T Wm H 411-ORuff D Preston 413*Blair Alex jr 414i'Armstrong Hugh G 441198 MLoccCkoliwnenThAoslbeErt J 420AParrish Geo H 421&Gladin Ivy D 422*Babb Alton K 429 Gregory Leonard G Maxwell Oscar N 435AParham John H 443398- White Jas B Andrews Sallie R Mrs 440442*Alexander Colister L 445AWilder John H 451*Tarver Gus A 444455667560//-/--A-''KRCPoeaoulypllayellaTBnBdreBysaseAinrelttpichLeL. Mrs F 466 Hartley Leon G 467ADuckworth Jesse M 468AWiggins Wm M 469*Donnan Homer E 473AAsbell Jas B 475ACOX Jas M 477AHolloway M Tommie Mrs Montpelier av intersects 501 Davis Carey L 502 Radney Wiley R DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT C A 444 Where To Buy? Consult the Classified Business Lists In This Directory J. GUY JACKSON, General Agent GUARANTEE MUTUAL LIFE CO. Purely Mutual Legal Reserve Old Line Company--Organized 1901 Third Floor First National Bank Bldg. Telephone 1142 DUNCAN AV--Contd 503 Jones Wm L 504-0-Branan Alvah L 505*Lester Rufus E 507hCarey Ernest L 592-0-Howard Mary Z Mrs 594-0-Dudley Lenora Mrs West End av ends 602'JRodgers Geo T 610 (618) Powell Predk C 61K'Bargeron Wm 613*Kelly Oliver L Rev 615*Abel Lula R 618 (610) Newberry H Grady 620&Long Roy W 621 Vacant 622-OBell Reason H 623 Littleton Chas H 6240.Johnson Robt H DUNLAP (East Macon)--East from 426 (423) Peachtree 1 blk 440 Sharpe Albert (c) 450 Lane Curtis (c) DUNLAP AL--West from 531 Cotton av to Orange 537 Fields John (c) 538 Lewis Henry (c) 555632 DEvuadnlesy LFurralinnke ((cc)) 565 Mosely Alberta (c) Spring intersects 616 Scott Eliz (c) 623 Graham Lou (c) 625 Lamar Annie (c) 653 Vacant 675 Jefferson Lewis (c) 677 Borah Lillie (c) DURE (Unionville)--From Dempsey av north, 1 west of Pio Nono av 101 Byas Eug (c) S utley intersects 302 Cash Geo W (c) 305 Harden Margt (c) 307 Perkins Lee (c) 315 Harden Geo (c) 317 Thomas Sidney (c) 319 Head Wm (c) 321 Harden Henry (c) 323 Phinazee Henry (c) DUVAL (East Macon)--Bet Broad and Washington, 1 north of Green 152 Vacant 155 (122) Holmes Annie (c) 157 (218) Thomas Anna (c) 159 (214) Carter Roscoe (c) 160 (217) Henry Mamie (c) 165 (215) Benford Geo W (c) EAST BOUNDARY (Vineville) -- From Vineville br north at city limits ECHO PLACE (Bellevue) (Changed to Dover) EDGEWOOD AV (Formerly Boundary) --From Division west to limits, 1 south of Elm 105 Bryant Jas (c) 109 Palmer John (c) 110 Brown John (c) 111 Brannon Columbus (c) 1112 Harden Gilbert (c) restr 113 Threats Mose (c) 119 McSears Marie (c) 120 Cobb Chas W gro 121 Isabell Mose (c) 122 Sealey Mattie (c) 123 Thomas Wm (c) 124 Williams Sami (c) 126 Williams Clem (c) Hammond intersects 201ATrawick Claude Coal Co Inc 210-2-Gulf Oil Corp (plant) 230 Butts Nathan J (c) 232 Vinson Mattie (c) 234 Counter Robt (c) 236 Bell Leonard (c) 237 Tolliver Chas (c) soft drinks Elbert intersects 301 Harris Greely (c) Taylor Chas (c) restr 303 Wright Walter (c) 304 New Zion Baptist Church (c) 307 Taylor Chas (c) 308 Willis Thos (c) 309 Colbert Essie (c) 311 Brown Lillie (c) 318 McCluster Shoat (c) 324 Prater Elsie (c) 417 Vacant Broadway intersects 419 Beeland Mary Mrs 421 SHmarirtihs LJaeene Mrs 423 (453) Ryles John M 425 Vacant 440 Buckner Freeman Webb John 448 Boutwell Julian 452 Ogle Chas D 454 Smith Oscar B 456 Britt Lonnie T 458AGroce Spartan T , Third intersects 500AMunn David M 506Spikes Wm I hSpikes Wm F 509ARhodes Johnson J 520-0-Beall Rosa D Mrs 525 Sutton Sidney W 526 Brown Julia K Mrs 553 Vacant 556 Winders J Fredk 557 Vacant 558 Copeland Steph W 559 Hawkins Lucius R gro 560ASimmons Addis F Second intersects sw cor Water Works Reservoir Weir Cynthia Park 6674-Beck Alf F 671ABelote J Harold 667753AHSoimotpesnonClCiffoSradmiR 677 Mathis Chas P First intersects 722 Jordan Robt (c) 724 Chester Idus (c) 730 Miles Jerome (c) 731 Lamar Mattie (c) 773480 JSomhintshonLuMelilnani(ec) (c) 741 Spry Eug (c) 742 Greeley Alex (c) 748 Myers Mollie (c) 750 Williams Pate E (c) 751 Vacant 752 Comer Edw (c) 753 Ross Thos (c) 754 Williams Wm (c) 755 Smith Edw (c) 756 Harris Walter (c) 757 Waller Reuben (c) 767 Middlebrooks Burnett (c) 771 Lightfoot David (c) 773 Williams Thos L (c) 775 Bell Marguerite (c) 776 Raley Eug (c) 780 Vacant Telfair intersects 802AGunnels Louis W gro 804 Brown Chas (c) 805 Vacant 806 Potter Chas (c) 807 Prater Myrtle (c) 808 Adams Frank (C) 809 McCloud Blanche (c) 810 Harper John (c) 812 Hall Clifford (c) 814 Dorsey Willie M (c) 815 Harrington John (c) 816 Smith Jack (c) 818 Sutton Albert jr (c) 820 Lockett Oscar (c) 445 MOTOR PARTS CORP. Part* Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 EDGEWOOD AV--Contd 322 Reid Lloyd (c) 824 Fowler Roosevelt (c) 826 Newman |Saml (c) 828 Vacant 830 Newman Lucius (c) 853 Wimberly W B (c) 855 Jackson Claudia (c) 857 Brown Wm (c) 850 Hart Geo (c) 861 Pennyman Anna (c) 865 Davis Lonnie (c) 867 Bennett Louise (Jca)ckson intersects 901 Evans Wm (c) 905 Hughes Moses (c) 909 Mitchell Wm (c) 913 Griffin Horace (c) 917 Rembert Wm (c) 919 Newman Quintus (c) Alabama intersects 1011 King Lillie (c) 1015 Oliver Lula (c) 1017 Riley Langston (c) 1019 Pullum Wm (c) 1021 Lawrence Floyd (c) 1023 Cutwright David (c) 1025 Williams Aaron CORoss intersects 1154 Pitts Betty A Cc) 1155 Clemmens Wm (c) 1156 Meadows John C gro 1158 Fogarty Drew T 1162-0-sturkie Annie CBolleMgersdrintersects 1202 Barbee Bertha Mrs 1204 EWthooerdiadlgl eGLaedwsoisn CH 1240 Barron Hugh C 1242 Alpha Lambda TCauolleFgreatienrtneirtsyects 1335 Vacant 1353hRagsdale BarCtoamwpuDs Ravevintersects 1354AAnthony R Earle 1355 Durham Ida J Mrs Adams ends 14064Sutton Benj F 1408AStone John P 1409 Bowles Floyd G Scott R Benj 1411 Apartments U'-Spinks Lonnie R 2 Peavy Albert B 3 Hambrick Ludie Mrs 4-O Jackson Joshua R S14t1re2/e-tBacrornontinuWedm M 1413hYates Robt L 1414AFolk Wm E 1415AMoore Goldie M Mrs EDISON (EM)--From the river east 101 (363) Vacant 105 (361) Garland Jas (c) 107 ( 345) Davis John B (c) 110 (360) Smith Minnie (c) 112 (358) Vacant 118 (356) Searcy S JaEckllsioontt i(nct)ersects 207 (307) Vacant 209 (409) Vacant 211 Jaffe L C (c) 217 StJames Baptist Church (c) 218 (118) Vacant 224 (124) Ellis Eliz (c) 226 (126) Johnson MiMnnidiedle(ci)*nte*rse*cts Flanders intersects 469 Vacant 500 Williams Ulysses (c) 501 Evans John (c) 502 (507) Cummings Dorsey (c) 503 Lindsay Mildred (c) 504 (505) Johnson Jos (c) 506 (502) Sexton Boston (c) 508 (504) Forrest Chas (c) 509 Jackson Larkin (c) 511 Stone Andrew (cM) artha intersects 606 (206) Blount Geo (c) 661112 ((221112)) GHroilgtsbMy inCnliaeyto(cn) (c) 613 (211) Lovett Clarence (c) 615 Blount Geo jr (c) EDNA PLACE--From Log Cabin blvd south, 2 west of Carlisle lOlAHardeman Geo W 103*Carr John L 105*Bollinger John W 109 (121) Poole Harold B lmConnell Wm W 112236 HRyalrerisVeCrhnaosn MB 129 Lawson Noel 133 Laney Chas H 136 Spiller Jas A 196-OKent Eric A 197 Tanner Ira T First intersects 203 Jackson Wm R 215ATeasley Oscar A 226 Johnson Clyde P 239 Turner Thos E 244 Tharpe Benj C Walker intersects 251 Carter John J 350 Hall Clyde E rear Mack Nora (c) 355hStillwell Earl F rear Jordan Chas (c) EDsoWuAthRDtoS Pa(rUkneiro,n1vilelea)s--t oFfroBmircMh osley 116 Johnson Cherry (C) EIGHTH--From Central City Park west 2 blocks Walnut intersects AMacon Dublin & Savannah RR Co Heard Bros fertilizerChmerfrrys begins EIGHTH AV (Bellevue)--From Industrial Home rd north to Atlantic av 101 Tucker Edw (c) 103 Vacant 107 Vacant ELBERT (South Macon)--From Hawthorne south beyond limits, continuation of Fifth 161 Davis Fannie B (c) 163 (231) Johnson Mattie (c) 165 (237) Sims Carrie H(ca)zel intersects 301 Smith Mary L (c) 303 Boone Buster (c) 305 Smith Cora L (c) 307 Williams Jas (c) 309 Richardson Maude (c) 333 Wright Edw (c) 335 Vacant 337 Vacant 339 Wilcox Arth (c) Ash intersects 423 Sanford EmmaBr(icg)ht al intersects 431 Williams Sarah (c) 435 Whitaker Annie (c) 441 Young Amos (c) Elm i*nte*rse*cts Edgewood av intersects 501 (502) Calhoun Sim (c) 503 (504) Lee Eddie M (c) 505 (506) Atjsins Jas (c) 507 (508) Leonard John (c) 509 (510) Frazier Lucinda (c) 511 (512) Goalsby Bertha L (c) Waterville r*d b*eg*ins Church la begins 601 (1270) Holt Ruth (c) 603 (1280) Wynn Robt (c) We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. 1. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 446 T. L. W 0 0 D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. 64 ELBERT (South Macon)--Contd 605 (1281) Talley John (c) 607 ( 683) Driver Chas (c) 609 (685) Collier Robt (c) 113 (159) Snipes Mary (c) 204 206 (167) (308) Jackson TEinddwall(ca)v intersects Hamilton Eug J (c) 701 Curtis Nettie (cC) ornecsotrrd intersects 703 (702) King Wm (c) 705 (706) Blasingame Geo (c) 707 Buford Carl (c) 708 Blackshear Edw (c) 709 (708) Vacant 710 Bius Elbert (c) 712 Anderson Eug (c) 713 (711) Cleveland Thos (c) 715 (703) Anderson Joshua (c) 717 (704) Cleveland Sim (c) 719 (705) Pierson Stoke (c) 721 Hicks Thos (c) 800 Edwards Jas E grsoceeie intersects 803 Hutchins Jas (c) 805 Howell Hezekiah (c) 807 Cummings Jas (c) 809 Sappington Edw (c) 811 Williams Chas (c) 812 Coach Minnie (c) 813 Bivins NetTtiheom(cp)son's al intersects 815 Fitzpatrick Ben) (c) 816 Orange Mary (c) 817 Sweetwine Phoebie (c) 818 Calhoun Adeline (c) 820 Henry Geo (c) 822 Page Tressie L (c) 824 Brown Jas (c) 902 Washington KatSe tr(act)ton intersects 903 Love Edw (c) 207 (310) Jones Lillian (c) 208 (306) Russell Rosa (c) 221120 (307) (307) Atlantic Ice & Colbert Annie Coal Co L (c) (br) 216 (353) Lucas Chas (c) gro 301 (421) Baison EmCmamapb(ecl)l intersects 303 (417) Freeman Jas (c) 304 (450) Johnson Wm (c) 305 307 ((441198)) FWreabnbkliWn ilWsomn H(c) 309 (422) Spivey Isaac (c) 311 (420) Hughes Ervin (c) 401 (300) Battle VNileunsasba(uc)m intersects 402 (565) Jones Jas (c) 403 (304) Wilson Linnie (c) 404 (543) Hill Jerry (c) 405 (332) White Ellis (c) 407 (330) Collins Floyd (c) 440098 (541) (328) Larry Evans Carrie Allen (c) (c) 410 Vacant 411 Killians Rebecca (c) 412 (331) Cook Albert C (c) 413 (324) Hunter Wm (c) 414 (222) Williams Ella Oc) 415 (330) Hill Henry (c) 416 (220) Wright Stella (c) 417 (328) Draper Sami (c) 418 (218) Washington John D (c) 421 (520) Hill John (c) 423 (518) Little Hattie (c) 904 Hughes Jas (c) 905 Winn John H (c) ELIZABETH (Western Hts)--Changed to Oakland av Hatfield al intersects 907 Weaver Fredk (c) 909 Thomas Lee (c) 910 Godard Jas (c) ELIZABETH PL (Vineville) -- From Hines Terrace west, 1 north of Vineville av 930 Mims Geo (c) 105 (202)AToole Chas L 932 Howard Martha (c) 934 Smith Beni (c) 936 Walker John (c) 937 Mims Chas (c) 107*McFerrin Jas M 108ARobertson Calvin W 109ACrowley Thos J 110 (200)AWall Leroy 938 Vacant 939 (909) Mims John (c) 111 (193)AHall J Ellsworth jr 113 (195) Smith Morris O 940 (942) Byrd Sami C 941 (909) Epps Glenn A gro 942 (940) Hutton Thos T gro Reid intersects 1011 Calhoun Ellen (c) 1012 Britton Enoch (c) 1013 Goggins Frank (c) 1014 James Walter (c) Elbert la intersects 115 (197) Bernd Laurence J ELKS PLACE (South Macon)--From Prince south to Henrietta, 1 west of Telfair 100 Buckner Jas (c) 102 (524) Miller Valley (c) 104 (171) Granville Bertha (c) 106 McGee Katie (c) 1015 Price Hattie (c) 110 Davis Ethel (c) 1016 (12) Robertson Estelle (c) 112 Calloway Jack (c) 1017 Davis. Sylvia (c) 114 Davis Willie M (c) 1019 Golden Louise (c) 116 Dyer John (c) Henry i*nte*rse*cts 118 (217) Hill Robt (c) 120 (219) Harris Benj L (c) DeBorde intersects 1106 Wood Henry (c) 122 (126) Stevens Freeman (c) 124 (12) Jones John (c) 1108 Dean Lee (c) 126 Raney Romas (c) ELBERT LANE (South Macon)--From 128 Stubbs Wm (c) Hall west to Chappel, 1 south of Reid ELL (South Macon)i--From Broadway 10 Will Ora B (c) av west 17 Riley Oscar (c) 18 Hughley Wm (c) 19 Blount Ella M (c) 106 Horne W Fredk jr 114 Hubbard Emma 117 Stuckey Homer W 21 Clark Ernest (c) 119 Johnson Philip E ELIZABETH (South Macon)--East from Alabama Jo Wing's Hill, 2 south of Edgewood av 1100 (144) McCormick Sami (c) 101 (22) Woods Riley (c) 102 (146) Watson Thos (c) 104 (148) Lamar Clara (c) 106 (150) Turner Geo (c) 107 (155) Brown Cajor (c) 108 (131) Martin Jessie 111 (157) Smith Sarah (c) 121 Bateman Codono V Mrs 128*Ellis Horace M 130 Sellers Claude 132 Brown Bernard 135 Kitchens Lee D Cedar ends 113386AYLaarvbernoduegrh WCmliffHordMrs 140 Keen E Tilman 142 Nelms Claude L 144 Hanley Geo 146AWaldron Millard F 447 PITTS' MORTUARY Phones 146-147 AMBULANCE SERVICE 814 Mulberry HOTEL ELL (South Macon)--Contd 147 McPherson Eug L 115615hVGahcoalnsot n Richd L _ 167 Clance Carol 172 Gray Rollie J Second, i.nt.ersects 219 Rigby Robt 222219*'lBJoannekss JArRthufuAs 231*Bean E Chester 237AMitchell Henry R 239AMitchel Forney D 224460&*JJoenneksinsDaWvimd JJ 250 Gilleland Addie 253&Holloway Chas R 260 Kelly Clifton E 262 Selman Lucius D 226739**NIribcyksFErallnak MErs 274 Rollins T Arth 275hPowell Lannie J 276 Middlebrooks Mary Mrs 277ATamplin Maggie Mrs 278 Raines Lillie Mrs 279 Odom Clifford L White intersects 301 Wagner Oscar B 302 Crawford D McCurdie 304 Watson Wm T 308 Stone Leroy lOOhRankin Robt L 102*Brown A Sidney 104*Pastzor Julius contr ELLIOTT (East Macon) -- From 428 1M02ai(n202n1oMrtheddtoy WFiirlsltie (c) 103 Harris Dora (c) 103% Culp Jos (c) 104 (235) Carswell Sallie (c) 106 (211) Howard Ola (c) 109 (205) Epps Mary (c) 110 (201) Houser Nathan (c) 115 (227) Humphries Sami T (c) 119 (225) Rosier John (c) 123 (212) Welcher Thos (c) 127 (207) Weaver Philip (c) 131 (221) Thomas Hattie (c) 196 Ellison Chas (c) 197 Walker Chas (c) 199 Rouse Della (c) Pear intersects 204 Finley Grady (c) 206 Harris Bertha (c) 208 Rogers Roosevelt (c) 210 (209) Walker John (c) 216 Farrar Alex (c) 219 Turner John H N (c) 221 (219A) Williams John (c) 222 Thomas Paul (c) 224 (223) Bayman Clarence (c) 225 (215) Jones Vinnie (c) 226 Vacant ELL EAST--From 2308 Broadway east 100 Johnson Geo (c) 101 Wiley Asa (c) 102 Franklin Easter (c) 103 Calhoun John C (c) 104 Vacant 105 White Arth (c) 106 Brice Crawford (c) 107 Reid Lucy (c) 108 Lockett Edgar (c) 109 Lane Otis (c) 110 Clayton Lillie M (c) 111 Vinson Lillie B (c) 112 Matterson Clara (c) 113 Jackson Fannie (c) 114 Walker Benj (c) 115 Dean Jordan (c) 116 Thomas Geo (c) Ilf Goodrum Jesse (c) 118 Morgan {Sidney (c) 119 Jackson Everett (c) 120 Stocum Wm (c) 121 Rumph Andrew (c) 122 Collier Jas (c) 227 (217) Johnson Benj (c) 228 (213) Burrell Wm (c) 230 (213%) Patterson Andrew (c) 231 (221) Parnell Homer (c) 233 (124) Kinslow Georgia (c) 234 (214) Nash Wm M (c) 236 (220) Collins Wm (c) 238 (218) Smith Geo (c) 240 Vacant 242 (226) Hall Marie (c) 246 (255) Miller Wise (c) 256 Jones Florence (c) 260 (236) Turner Mary (c) 418 Phelps Lee O (c) 420 Vacant 422 Wilson Delius (c) 442234 B(4a5r1n)esBaMlcoarmy C(ch)arlotte (c) 427 Roberts Mattie (c) 428 (236) Jones John (c) Middle la intersects 431 (425) Winn Jas (c) Middle intersects 500 (113) Wilson Mathew (c) 123 Johnston Maybelle (c) 124 Burley Lumpkin (c) 125 Starke Denny (c) 126 Burns J D (c) 127 Grier Celia (c) 502 (120) Cannady Mollie (c) 504 (116) Vacant , _ 504% (111) Myrick Henry (c) 506 (119) Dunn Emma (c) 512 (110) Culver Carrie (c) 128 Kelly Carlton (c) 129 Grier Jas (c) 130 Griffen Millie (c) 131 Thomas Rusay (c) 513 (114) McBride Archie (c) 514 (112) Chatman Leo (c) 515 (115) Brown Walter (c) 516 (100) King Ira (c) 132 Neill Riley (c) 517 (117) Vacant 133 Davis Leonard (c) 134 Champion Wm (c) 135 Harris Wm (c) 136 Parker Ida (c) 137 Vacant 518 (105) Smith Jane (c) 521 (122) Appling IrviEngdiso(cn) intersgerocts 601 (122) Searcy Wm (c) gro 603 (120) Thomas Mabel (c) 138 Joseph Vester (c) 139 Seabrooks Wm L (c) 140 Vacant 141 Butler Erastus (c) 605 (108) Walker Luther (c) 607 (106) Soloman Chas (c) 609 (102) Cullins Ophelia (c) 611 Hupp Lorine (c) 142; Thomas Norman (c) 144 Simmons Susie M (c) 146 Hill Henrietta (c) ELLIS (South Macon)--Changed to Violet av 148 Green Jos (c) 150 Outler Chuck (Cc)happell intersects 204 Hagen Annie (c) 206 Davis Anna (c) 208 Fowler Jos (c) 210 Davis Cleo (c) ELM--From Harris to limits, 14 south of river ftANational Handle Co handle mfrs 6 Spencer Clifford (c) 10 Vacant 14 Collins Annie (c) Gilmore intersects ELLA (South Macon)--From 3024 Houston av east 100 Maddox Eva (c) 102*Smith Harry M gro 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. 1. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 448 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically EVery City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. IS3 ELM--Contd 104 Tarver Wm (c) 105 Gary Sol (c) 106 Rice Thos (c) 107 Burnham Geo (c) 108 Doly Lena (c) 109 Bryant Mannie (C) 111 Bailey Arcelius (c) 112 Watkins Jas (c) 115 Woodle Alex (c) 119 Ford Alice (c) 120 Phelps Jos Rev (c) 124 Perdue Winnie (c) 152 Mitchell Robt (c) 153 Vacant 157 Callaway Wm (c) 160 Marshall Ira (c) 162 Gordon Chas (c) Hammond intersects 209 Vacant 211 Vacant 217 Lowe Ada (c) Elbert inte*rse*cts C of Ga Ry* c*ros*ses G S of F Ry crosses 314 Williams Jos (c) restr 320 Blackshear Thos (c) 355 Jolley Mary L (c) 357 Williams Dollie (c) 359 Taylor Gertrude (c) 360 Leonard Mattie (c) 361 Fair Geo (c) 364 Johnson Hannah (c) Broadway intersects 409&Hanson Robt R 411 Russell Christopher 415 Vacant 416Garvin Wm F 419 Murphy W Brodes 420 Logue Chas L 452 Lowe John T 454 Mishoe Wiley 457 Thomas Jas 459 Bales Doris 467 Morris John W 469 Channel R Leonard Third intersects 516 Brady M Tilson 520ABolton Geo S 521 Anis Dois 523 Balkcom Ralph J 533 Langston Hugh 554 Spivey Arlie Mrs 555 Mann Wm J 558 Burnett Jas E 560 Bigler Geo L Second intersects 610 Watson Danl 612 Jones Horace L 615 Lee Jas R 618 Brantley Ernest M 619 Vacant 621 Vacant 651 Purser Robt S gro 653 Purser Robt S 654 Hudgins Thos W Chestine Lloyd 655 Smith Benj B 657 Cannon Jack C 659 Hammond Albert L 660*S>immons Thos S contr 661 Josey Clifford 664 Crump Chas 665 Shepherd E B 667 Baldwin Sami IR First intersects 702&Gaskin Henry (c) 706 Cephus Nathaniel S Rev (c) 708 Veal Marcus (c) 771102-OShPhairlplipsHoEruagce G(c)(c) 718 Edwards Mary (c) 720-22 Odom Wm (c) barber 753 Franklin Nellie (c) 755 Mackey Ludessa (c) 757 Ebenezer Baptist Church (c) Telfair intersects 802&Hudson Danl E gro 804 McCrary Eliz Mrs 807 White Jas (c) 809 Cook Henry (c) 810 Byrom Edw (c) 811 Chambers Lillie B (c) 814 Boyer Clifford (c) 816 Frazier Arlena (c) 818 Green Jobie (c) 852 Simmons Mary L Mrs 854 Simpson Jas 858 Carroll Mattie L Mrs 859 Vacant 863 Arnold Geo T 864 Clark Marie 865 Evans Beulah Mrs 866 Dyche Wm L 868 Tomlinson Wade F 869 Kolodner Morris gro Jackson intersects 908&Stallings Henry P 911 Singleton Chas C 914 Bost Fannie Mrs 915 Lewis John E 917 Etheridge Hattie Mrs 920 Schermerhom Mary 949 Bartlett Walter E 952AHerin Walter S 953hRamey Reese L 955 Purser Dollie Mrs 956*Flanders Sami (c) 957 Thompson Harry 964 Thorpe Wm (c) 966 Walker Chas (c) 968 Rogers John (c) Calhoun intersects 1017 Harvey Jas 1018 Jones Sula V Mrs 1020 Behr Eliz Mrs 1021 Vacant 1057 Wilson Geo 1059 Vacant 1063 Stewart Wm T 1064ATucker Prentiss 1066 Pittman John gro -- Ross intersects 1103hBailey Chas E 1112 Cockrell Allen Chancellor Jewett A 1116 Demouy Tarleton 1120 Davis Wm J 1157 Freeney Leroy W 11115598/-CGoobdbfreCyhaHs enWrietta V Mrs 1160 Paul R Carl hPaul Leslie Mrs 116K'Grace Jesse M 1164hNabors Calvin A 1178 Green Clinton D -Green Birdie Mrs College intersects ELeMrs (East Macon)--Changed to FlandELM AL--From C of Ga Ry south to Elm, between First and Second 653 Stinson Lula (c) 655 Simmons John (c) 657 Morris Willie (c) ELM ST LANE--From Elm east along C of Ga Ry to Elm al 635 Cochran Ida M (c) 637 Pulling Norman (c) 641 Henderson Claybom (c) 643 Little Albert (c) 645 Houser Lonnie (c) 647 Walker Cleveland (c) 649 Simmons Mamie (c) 651 Williams Amos (c) EMERALD (East Macon) -- From 396 Flanders to Arlington 104 Maxwell Chas 106 Byrd Oscar 108 Connally Henry 110 Gilder Gordon 449 ROBERT O. THOMAS REALTOR Telephone 1067 EMILY PL--Between Ingleside av and Vista cir, 1 east of Claire pi 143*Hollingsworth C Jefferson 150AMcKay John J jr 155AAnderson R Lanier jr EMORY AV (South Macon)--From Jeff Davis west to Sixth av, 1 south of Plant 101 Pope Bruce G 103 Fox Henry A 104 Meaders J Otis 105 Clements Ollie L 110086 MSaeualdsorDsewJaesy WE 109 Cadle Geo 110 McCrimmon Lester M 114 Batchelor Artis B 118 Rutherford Lena M Mrs 119 Ash Lewis M 121 Churchwell Wm H 122 Weaver Howard O 125 Reed Thos O 160 Coulter Alton P 162 Skipper Benj F EMPIRE AV (Vineville) -- From 320 Third av south, 1 west of Middle 100&Alexander Carolyn (c) 101 Webb Herman (c) 102 Crawford Lillie (c) 103 Harrison Addie (c) 104AAllen Jas (c) 105 Street Jos (c) 110076 TCarosskserRLoseinea (c(c)) 108 Smith Regina (c) 109 Turner Wm (c) ENGLISH (Vineville) -- From 209 Oak Haven av west, 2 south of Vineville av 102 Fincher Arth B 104 Simpson Millard E Rev Clark Robt L 106 Patterson Nezzie M Mrs ABrokenshire Melvin R 108ACBleagrkgerBWHmarrCelson 155 Chandler Alva R leOt-Clark Eug O 165*Jones John A 1IS75O-V'-Hacaragnrtove Wm M 182 Vacant 184AHardin Ernest H 185-C-Dunwody Howard R 118868AASSmmiitthh EMmaumdae JMrMs rs 190 McDonald M Donald 192AMoore Lloyd D 194dWilliams Gay E ABurkett Ira E 195AMidyett Jas C Rev 196AVolk Theo J 199*Torch Aaron EN25T5E4RBPrRoIaSdEwa(ySoeuatsht tMoacWona)lte--rvilFlerormd 100 McCallum Robt 104 Ezell Geo E 105 Vacant 106`AWoodson Leon L 106% Sumlin Warren J 107 Ellis Ivy E 108 Vacant 109 Currie Tillman D 110 Byrd Thos M 111 Pritchett Howard 112 Dyer Thos 113 Vacant 114 Sumner Geo 115 Beasley Drue J 120 Hester Robt L gro ERNEST (Cherokee Hts)i--South from % block north of Napier av, 2 west of Brentwood 75 Willis Edmond (c) 77 White Hattie (c)Gordon intersects lOOABailey Henry (c) 104 Howard Collins (c) 107 Vacant 112 Kendrick AndrNewapiDer a(vc) intersects 211 Chambliss Lula Mrs 224 Kendrick Mamie (c) 226 Kendrick Dollie A (c) 228 Kendrick RichmondBer(rcy) intersects 315 Thomas Beatrice (c) 321 (214) Dudley Robt (c) 325 Jackson Leonard (c) 329 Denton Chas (c) 331 Bailey Frank (c) 333 Gates Duncan (c) 333357*KCeallsleoywaMy aCttliaerk(cL) (c) 341 (101) Jones Wm C (c) 343 (145) Willis Thos (c) ERNEST (Log Cabin Hts)--From Log Cabin way east, 1 north of Log Cabin blvd ERNEST LA--From Inverness to Bartletts la, 1 block north of Gordon 154 McCollumn Burdell (c) 156 Howard Jonah (c) 158 Calhoun Estella (c) EUCLID AV--South from Forsyth rd, 1 east of Resthaven av lOlAKemp Geo H 106ACarter Leonard W 108AEvans Rufus R 110-OMcMillan Walter C EVELENA AV--East from 105 Clay av EVERGREEN LA--From 2900 Houston av west 143 Frazier Joshua W (c) 145 Mack Geo (c) EVERYBODY'S CROSSING -- From Bartlett east to Hillyear av, 1 north of Napier av (See Whitehall) EXBPrRoaEdSwSay WOEldSTU--nFioronmD5e1p5otFifth to 7AAdams Mfg Co clo mfrs FAIRMONT AV (Bellevue)--From Lake west to Grand av, 1 south of C of Ga Ry tracks 102 Booth Early APearce Wm L 104 Ross Jas J 302 Pierce Courtland T 304 Bryant Chas T 305 Modema Nicodemus J 306 Vacant 307 Heath John R 311 Vacant 523 Perry Wm H FAFIlRetVchIEerWtoAVMa(inE,as1t Meaasctono)f --BFalrcoomm 101 (226) Lowther Frank R Plumtree intersects 103 Comer Laura A(pcp) lewood intersects 203 Preston Thos S 207 Davis Walter E Peachtree intersects 351 George Cora Mrs 352 Farmer Amanda Mrs 353 Estes Z K 354 Sapp Lizzie Mrs 356 Johnson Jas D 357AKitchens Albert H 358AWebb Wm B 359 Connell Jesse J 360ACrowe Thos W 361AWhitten Wm P Consult the CLASSIFIED LISTS otthe DIRECTORY If You Would Find What You Wish to Buy 450 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 FARGASON (Vineville) --From Tamar east and west, 1 north of Vinewood av 202 (220) Mason Albert (c) 203 (222) Warren Jas (c) 204 (212) Sargent Virginia (c) 205 (224) Roberson Emma (c) 206 (211) Gonder Alf (c) 208 (210) Tolver Monga J (c) 210 Rouse Hattie (c) 212 James Fannie (c) 214 Culver Chas (c) 216 Pinkston Leo (c) 218 Allen Allen (c) 220 Love Mary (c) 222 Griffin Rofot (c) 223 (329) Avant Amanda, (c) 224 (219) Gonder Robt (c) 225 (130) Jackson Andrew (c) 226 (232) Vaughn ROtat (c) @ 227 (334) Semmons Jas (c) 229 (235) Abrams Sami (c) 230 (234) Lundy Miles L (c) 232 (236) Failing Mary F (c) 234 (238) Watts Lizzie (c) 235 (237) Pennington Willis (c) 236 (244) Avant Annie (c) 237 (243) Jackson Maggie (c) 238 (240) Covner Adam (c) 239 (241) Israel Fred (c) FEB AV--From 716 Holt av east % blk 105 Folsom Carl W 115 McCullough Joel S FIFTH--From river south to Hawthorne 3 east of Second 4ARiverside Ice & Coal Co 18ALunsford Clifford filling sta 19 (17) Night Owl beer 21 Bellizia Frank gro 2'3AMacon Peanut & Storage Co 25AMacon Supply OCcomumiliglele siunptsersects lOO-'Levine Tire & Parts Service 114 Rivers Homer (c) 116 Brown Sylvester (c) 149AGibson Vinegar Wks 150 Mon'crief Chas (Pc)aradise al begins 151 Vacant 151% Vacant 153'-Brown Jug The beer 155AAnderson Oil Co AWilder C Bug gro 156 Snead Walter (c) 157 Marshall Larkin '(c) medicine mfrs 159 Odom 'Candy Co confrs mfrs Odom Jolley J 160 Davis Herman (c) 161AChanin Barnett meats 162 Jones Clarence (c) 163AZimmerman 164 Davis Thos !(Hc)erman confr nw corAPeoples Oil Co filling sta Walnut intersects 202 Vacant 203-05 Handy Geo gro 205% Giles Foster (e) barber 207 Brown Rosa M (c) restr 209 Vacant 211 Crittle Walter (c) auto repr 213 Jordan John (c) shoe repr 215 Smith Sol ((c) barber 217 Pearson Martin (c) shoe Shiner 219 Snipes Wayne (c) barber 223 Holmes Taylor (c) restr 225 Vickers Georgia gro 225% Thompson Callie (c) 227 (303) Stpval Katie '(c) 229 (305) Brooks Adeline ((c) 244*Werden W R & Co whol gros 247 Dennis Mattie (c) 248ABarfield Feed Mills mfrs 249ABoard of Water Comnrs (shop) 250 Vacant Graham's Lot intersects 251 Simmons Stokes T (c) chiropodist 253 Vacant 255 Jones Carrie '(c) 257 Vacant 226652-CCMitycNaWiratLebrr W&orkSsup'(pslhyopC) o 266ADulap Roofing Co Mulberry intersects Wall intersects 355-57'-'Cook's Beer Co brewer agts 359AMacon Beverage 'Distributors whol wines 361AUnited Purchasing Co loans Cherry intersects Terminal Station &Macon Terminal Co ^Railway Express Agency Inc ^Southeastern Express Co Terminal Info Bureau ^Terminal Sta Baggage Room ATerminal Ticket Office Union News Co news dlrs Union News Co restr (Ry M S Terminal Barber Shop AYellow Cab Transportation & Bag- gage Co R1o0o1m- s: 102107108116 Vacant 118AC of (Ga Ry !(chf special agt) 119 Railway Express Agey route agt 120 Sou `Ry System trainmaster Sou Ry System claim agt 122123126 Vacant 127-31 Vacant 201AL & N R R Co coml agt 202203206-OC of Ga Ry div supt 209-11 C of Ga Ry claim agt 212AC of Ga Ry div train mstr 213 Vacant 214AC of Ga Ry chf dispr 215 Vacant 1221167AVCaocfanGta Ry signal dept 218AC of Ga Ry supvr of bridges, bldgs and tracks 220-0-c of Ga Ry record dept 219-23 (Vacant '224AC of Ga Ry tel and teleg dept Street continued 45'lABurney Bros Co whol prod 453AFreeman Dent Sullivan Co whol prod 461-ALiberty Candy Co Inc confrs mfrs 463AKarsten & Densdn Co (whse) Poplar intersects 503ASouthland Coffee Co Inc 513-15AMacon Paper Co Inc Express al ends 555ANational Biscuit Co whol bakers Plum intersects sw corAEmpfre-'Dixie Coal Co 575ASwift's Ice Cream whol AC of Ga Ry frt depot nw corAUnited Food BrokPeinrse iCnoterIsneccts Georgia RR frt depot -- 'Sou Weighing & Insp Bureau Oak and Oglethorpe intersect 900AMacon Milling Co Hawthorne intersects 1052AHouston Coal Co 105*3APower Oil Co Inc (plant) Bay intersects FIFTH (Unionville) -- South from 124# Dempsey av south to Third av 250 Vacant 451 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 FIFTH AV (Bellevue)--From Industrial Home rd north to Atlantic, 1 west of Fourth av 102 Riley Eug (c) 109 Primus Mary '(c) 111 Smith Elmore (c) FIFTH AV (SH)--From Enterprise to Nelson, 5 west of Waterville rd FIFTH AV (South Macon)--From Plant south to First, 1 west of Sixth av 113 >(116) Clark Quincy F0icr)st intersects 115 Lewis Clairence H 117 McCook Clyde F 119 McCook Lula Mrs FIFTH AV (TJnionville)--From Taylor south to Dempsey av, 1 west of Cedar 100 Redding Jas (c) 106 Cummings Jas W (c) 116 Patterson Mack (c) FILFyTnHwoAoVd, (1Vienaesvtilloef)--FForuormthMaovnroe to 1 Goolsby Pearl i(c) 3 Johnson Wm (c) 5 West Ella (c) 7 'Nelson Cleveland (c) 9 Watson Annie (c) 11 Keith Wm (c) 110 Banks Ophelia (e) 112 Colem'an Ella B (c) 114 Veal Mazie (c) 116 Bland Mary Oc) 128 (130) Vacant 130 Gibson Lawrence (c) 132 (142)hDavts Wanza A Dr '(c) 133 Tremble Calvin T (c) Tremble Cleosia (c) clo clnr 134 Ryan Emma (c) 135 StMary's Baptist Church (c) 136 (139) Williams Pink (c) 138 >083) Paul Laura M '(e) 164 Bivins Beatrice (c) 170 Coker John (c) 172 Forsyth Estelle (c) 178 Clark Delia (c) 220191 JJoahmnessonHoIdwaard(c)(c) 213 Glover Maggie (c) 215 'Solomon John (c) 218 Singleton Eula (c) 219 Murphy Albert (c) 220 Brunson Sara (c) 221 Alfriend Foster (c) 222 Randall Fredk (c) 223 Green Ethel (c) 225 Worthy Genie (c) 227 Reed Lillie (c) 228 Vacant 229 Vacant 230 Parker Eug (c) 231 Worthy Lucius (c) 232 'Henry Isaiah (c) 235 Pollock P London (c) 236 Berry Sally (c) 240 Vacant 244 Peters Lizzie (c) 245 Overton Queenie (c) 247 Hanks Lot (c) 249 Brown Ora (c) 225510AMCuarrsrwayellMMatatriye '((cc)) 254 Wesley Sarah (c) 258 Houston Zonnie (c) 263 Stewart Print '(c) 264 Jones Mattie H (c) 303 Bentley John (c) Davis intersects 304&Ziegler Wm (c) 313 Fletcher Virginia (c) 320 Vacant 332214 JMaimmess JCashe'r(rcy) (c) 325 'Sims Edgar (c) 350 Vacant 354-bJolly Henry T (c) FIRST--From river south to limits, 1 west of Second 63 Ellison Wm (c) 65 Jones Thos (c) Qcmulgee intersects lOl&Hendrix Irene 103 Newsome Wm F 105 Vacant 106 Cooper Arth W 107-CHanse Lee A 119 Filsinger Conrad N 121 'Sanders Wm W 122 Roberts Thos M 124 Rooks C'has G New Street la begins 151 Waller Lonnie A 155 Sloan Nora C Mrs re1a57r CDrruigmgbelresyJaJockhnD(c) 164 'Green Fred J 168 Wilburn Jesse L Walnut intersects 202 Dykes John D 203 Simmons Walter B Turner Jas C 206 Smith Martha Mrs '209Parrish Sallie T bdg 210 Branan Carolyn Mrs 215*Pair John E 216217- 220hSolomon Eliz D Mrs furn rms Plant al intersects 252bFinley Lola E Mrs 258hWhitehurst Eugenia J Mrs Mulberry intersects 301 'Goodrich Silvertown Stores tires '332210-MOJaoinnner JBaceknnNett A filling sta AWagner Marie Mrs Brown W Ralph Boardmans al intersects 352353- McArthur P A Mrs physio therapist 354- Holding Commission S57bBeall Trueser V Mrs 36K'Kea Emma Mrs 362-64*Macon Auto Exchange storage 369 Nolan Alvin E 371b-Y M C A Cherry intersects 401-09 Municipal Auditorium 451-53AYoung Bob Used Car Exchange Cotton av intersects 452 Vacant 445544-%OT'UornchiteAd aSropnanmishkt WsuaprplVieesterans Georgia Aerie No 977 FOE 456 Momand Olvine F fish 464-OTrading Post genl mdse 468 Macon Volunteers Armory 470avolunteer Pharmacy Poplar intersects 506-CGa Natl Guard Armory Ga Natl Guard 1st Battalion (Hdqtrs Co) Ga Natl 'Guard 121st Infantry '(Macon Machine Gun Co) 508 Vacant 510 Vacant '512 Wood Thos L plmbr 5'14-bMuecke Rudolph J uphol '516*Stansell Potato Chip & Sandwich Co '!555148&h'RBi'obbberPtsrinLteiinlag Co Mrs boarding 5S'55'57&ODsebLoornaceheOtLtoewOis C 567-SNorris John L '568hWhite Kate Mrs 5576090h-RAoddagirerSserJvoiecel STtation filling sta 600;-'McKenney & Plum intersects Adams filling sta 601 Congregation Sherah Israel Synagogue w? ^ 5-5i0s o S, ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT, EM. gr. YOUR CITY D I R E C T O R Y MIRRORS the Industrial LIFE Of Your CITY O O O O b 452 PRINTING BINDING ARLINGTON HOTEL FREE STORAGE . BMRoOdeArDn WanAdY,RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, RUBBER STAMPS THE BEST WORK CORRECT PRICES Where To Buy? Consult the Classified Business Lists In This Directory FIRST--Contd 605 Williams Valline D 608AClark Leonard D 613 Richards Carson 616AJones Fannie Mrs 619-SHolland Bessie L Mrs 620 Thompson Wm W Higgison Wm R Rowe Edw Tyner Chester G 654-C'McNelis Patk G 655Jones Albert E 658'OCassidy Hannah Mrs 659McCullougih Jas C jr 668ACassidy Cecile Mrs 669C Jones Jas D 702-WGraddy Henry K 706 Andrews Edw C 712 Wilson Jas M 717i'Bedingfield Geo Jackson Malbory P iPadgett Kenny B ^Hembree Marion D 720 Williams Grady D 722-0-Mullenix David H Radio Service Co 723 Allen W Marvin 5-Cherry Wm H 753-0-Pinholster Danl F 0 754ANewton Arth F 776509&SStutebvbesnsAMlbaetrttieJ Maddox Clara Mrs Scott Claude E 771 Tidwell Chas C 820 Sapp Jas W 822 Byrd Walter C Oak intersects Smith's al intersects 852-CGhelverton Hovis M Mrs 859 First Street M E Church 801ASmith G Reid Rev 865-&Burge Wm R 866 Hunt Earl 867Kimball John J 868 Holland Iduma Mrs 870 Collins Jesse D 874 Harvey Hershal H Arch i*nte*rsects Orange intersects 903-5Price S B Free Library 920 Muecke Wm F rear Harris Alto (c) 960 Hall W Lamar 1011 Brown Wm A Oglethorpe intersects 1013 Bibb Mfg Co (club house) Bibb av intersects 1015 Crane John 1017 Brown Patricia Mrs 1029 Evans Wm F 1031 Moore Irvin 1037 Evans Wm E 1039 Payne Geo W 1041 Davis Geo 1043 Turner Roy L Hawthorne intersects 1203 Balls May E (c) 1205 Hudson Rosa (c) 1207 Anderson Azzie L (c) 1209 Williams Emma (c) 1211 Turner Frances (c) 1226 Lowe Collis (c) 1230 Harris Fred (c) 1234 Crofter Edw (c) 1238 Henderson Eva (c) 1302 Thomas Lucretia (cH)azel intersects 1304 Friendship Baptist Church (c) 1309 Fann Tobis (c) 1311 Bell Otis (c) 1313 Reddick Mariah (c) 1314 Taylor Clinton (c) 1315 Davis Lucius (c) 1316 Ingram Thos (c) 1322 Chandler Alice (e) 1324 Smith Jefferson (c) 1326 Milnar Lula (c) 1327 Miller Ollie (c) 1329 Tinsley Wm (c) 1330 Thomas Ethel (c) 1331 Henderson Wm (c) 1333 Tinsley Kimball (c) 1335 Baker Julia (c) 1413 Martin Cora (c) Ash intersects 1414*Merritt B F Coal Co 1524 Person Wm B (c) UIU1 UUCIVXIS 1526 Kelly John (c) 1528 Hill Obie (c) rear Chandler Jesse (c) 1531 Holloway Ollie E Mrs 1535 McCune John M 1537 Cheek Mattie M Mrs 1539 Smallwood Lydia Mrs 1541 Norton Sallie J Mrs 1543 Watson Wm J 1600 Horne Louis EJdg(ce)wood av intersects 1603 Germany Frank (c) 1604 Eason Ardenia (c) 1606 IBerry Thos (c) 1630 Williams Molly (c) Liberty intersects 1632 Dixon Chas (c) 1633 Watson Edwin (c) 1634 Holden Jas (c) 1638 Booker Horace (c) 1640 Waldon Eug (c) 1642 Phillips Eunice (c) FIRST (SM)--From Junction Plant and Alabama west 100 Vacant 102 Morgan Hubert M 104 Lewis Claude M College av imnte*rse*cts 204 Lee John W Third av intersects FIRST EAST (East Macon)--From river north to Broad, 1 west of Clinton 301 (308) Appling Rose '(c) 303 (301) Paterson Levi (c) 307 ( 302) Hall Lou (E 314 McOarr Ella (c) Flanders intersects 401 Woodford Wm (c) 404 White Arth (c) 405 Bathe Markus (c) 406 (407)' Miller Wm (c) 408 Lundy Ida (c) 409 Smith Dora (c) 410 Gilliard Sarah (c) 411 (415) Napier Henry (c) 412 Vacant 414 Tuff Wm (c) 416 Hoskins Peter (c) 417 Vann Harrison W (c) Martha i*nteffrt sects Melrose i*nte*rse*cts Washington intersects 501 Felton Evans (c) 503 Gibbs Gladys (c) 503% Tolbert Chas (c) 509 Thomas Chas (c) 511 Dunn Sol (c) 317 Briscoe Ola (c) 5522355B-BilolwinegrssleEadwRa;(nc)dolph (c) 526 Byrd Emma (c) 531 Brown Jas E (c) FIRST AV (Crumps Park)--From Forsyth rd north to Ridge av lOO-O-Callaway Claude N 104&Langston Henry L 108-iLifsey Trene T Mrs 453 MILURONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 FIRST AV (NH)--Changed to Blackburn 315 ( 333) Fields Edw (c) 317 (341) Humphrey Mary (c) 318 Buckholdt Ernest (c) FIRST AV (SH) -- From Enterprise to Nelson, 1 north of Waterville rd 324 McGowan Aurelia P(ce)can intersects North intersects FIRST AV (Tybee) --Changed to Harris 401 Robinson Wallace (c) 402 Peoples Mary (c) FIRST AV (UnionvUle) -- South from 1062 Montpelier av to Dempsey av 101 Slocum Wm (c) 106 Holliman Arth (c) 105 Hixon Wesley (c) 403 Turner Chas (c) 404 Jones Jessie C (c) 405 Randall Leroy (c) 406 Walker Lily (c) 109 Gibson Wm (c) FIRST AV (W Hts)--See Rock av 111 (110) Thomas Lizzie (c) 120 Hixon Chas B (c) Hogan intersects FITZGERALD AL--From C of Ga Ry west bet Oak and Pine 201 Wynes Wm (c) 203 Nixon Margt (c) 205 Vacant 207 Aaron Casandra (c) 211 Reece Edw (c) 213 Walker Fred (c) 215 Baker Oscar (c) 217 Ellis Howard (c) Plateau intersects 300 '(527) Cornelius Robt (c) 305 (120) Simmons Jas '(c) 306 (121) Bray Chas (Hc)arris intersects 401 (204) Harris Seaborn (c) 405 '(126) Henry Edwin A (C) 408 (227) Stroud Wm THay(clo) r intersects 500 Spring Hill Baptist Church (e) 510 Head Geo (c) 512 McWhorter Henrietta (c) 514 (193) Harris Geo (c) FLLAyMnmINoGreOavD,R2--eFarsotmofHeHaorudstsoonutahvto 98 Bethlehem Primitive Baptist Oh lOOhPritchett Henry T llSARoberts Benj H Villa Crest intersects 119'-Proctor Robt E Pearl intersects 128*Leonard Edw D 129-o-Hutchison Leon A 131 Morrison Jas E 113'345-V5-aHcaamnlitn Jesse W Grenada ter intersects 1^36^hSMccaKrbionrnoeuyghGeJoasHperW 139 Stahle Ray A 140 Miller C Myrick 148 Vacant 207 Kerlin Harvey J 2l0hBames Warren O FIRST AV (V)--Continuation of Jefferson, 1 north of Hardeman av 100 Glover Northern (c) 134 Vacant 113389-M'HceCrnaldlonCaErlrliae ((cc)) 140 Piercey Alex (c) 141 Reeves Albert (c) 142 Goodwin Fannie '(c) Ormond ter intersects 300 (147)hEpting John D 400 Scarborough Herschel V Villa Crest ends 501 'Echols Jas C 506'-'Anderson Geo E 507 Longenecker Hilton M 525-t'Sharpe Grady B 536 (509)hMoore Benj M 143&Hatfield Pelligrine M (c) 145 (112) Brookins Terry (c) 147 Warren's Chapel M E Church (c) 150 Thomas Scott (c) 152hBrown Hattie (c) 173 Battle Mattie (c) Middle intersects FLANDERS (EM)--From C of Ga Ry west to limits Lake City begins 2 Brantley Matthew J 221 (1) Price Hollis Main intersects 215-dWynn Henry (c) 217*Laney Maude (c) 219 Williams Geo (c) 224 Gatson Wm L (c) 226CGlasco Alvin L '(c) 227 Knowlton Ruby (c) 223316/-(S2h3u0f)theCnapOeliivBiaes(sci)e (c) 301 (300) Lowery Obie N 303 (300J-CJohnson Jas 304 (303) JOhnson Jas W 305 ( 304) Knight David 307 (306) White Fannie Mrs Beck Minnie Mrs 314 Dawson Moses A Emerald begins 238 Duhart Anderson (c) 343 Barlow Jas E 239iWilliams Julian (c) 345 Shelton Oliver 244 Leslie Jas (e) *346 Barlow Annie 247hRoss Kate (c) 347 Cameron Chas L 250-OFrayser w Neale Dr (c) Pear intersects 252 Houser Sami (c) 255hBanks Geo W (c) 260hSpivey Wm (c) 264 Jones Jessie W '(c) 268 Plumber Luther (c) 227830 JDoanveiss CJloasreapJhi(nce) (c) 281 West Preston (c) 284 Lockhart Annie (c) 289 Fulmore Virgil G (c) 290 Carswell Mattie (c) 296 Moore Delia (c) 297-CGoins Filmore (c) 299 Parham Alonzo P (c) shoe repr Craft intersects 348 Dowdell Eli (c) 349 Gilreath Edgar 350 Anderson Dock (c) 351 Maddox Claude L 353 EGvaattnise JPoehrnry 355 Carroll Bessie Mrs 357 Gates Otis A (c) 359 Thomas Edw (c) 361 (361%) Williams Chas (c) 364 Holland Thos (c) 365 Solomon Jefferson (c) 366 Wornum Dinah (c) 367 Sanford Jos (c) 368 Vacant 306 Davis Love (c) rear Manuel Rosa (c) 307 Burk Thos (c) 368% Smith Enoch (c) 310 Lee Jessie P (c) 369 Jones Andrew (cl 30 311 Sutton Geo (c) 313 (327) Price Mary (c) 370 Warren Carrie (e) 371 Johnson Steph (c) 454 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES i jJJJ PlyDlOUtH F3L7A3 NLDitEtlRe SCo(lEliMns)--(cC) ontd '375 Washington Geo (c) Clara intersects 422 Hatcher Willie Cc) 424 Thomas Milton (c) 426 Hughes Richd (c) 428 Shrem Ahr 432*Shrem Abr gro Powell intersects * * ie Burnett intersects 436 Cochran Estella (c) 437 Williams Elijah (c) 440 Forney John (c) 443 Williams Henry (c) 446 IStubbs Rubin (c) 603 Purnell Dempsey Cc) 506 Latimer Thos A (c) 507 Powell Ollie (c) 508 Turner Thos (c) 509 Williams Garfield Cc) 510 Smith Mamie (c) 511 Vacant 514 Lindsey Charity (c) 515 Harden Willie M (c) 517 Mitcham Willie (c) 519 Thomas Jos (c) 520 Lindsey Emanuel M Cc) Ash intersects 529 Harris Ulysses G (c) 530*Emilio Carlo gro 531 Lewis Artlh (c) 532 Smith Lula (c) 533 Standley Sar&h (c) 534 Porter Willie (e) 535 Moore Edw 536 Vacant 537 Hogan Paul Cc) 540 Dean Herman Cc) Second intersects 607 Rdckmore Aileen (c) 608 Wright Nettie Cc) 609 Vacant 614 (432) Society Hall (c) 623 (624) Campbell Susie Cc) FLETCHER (EM) -- From Dunlap to Jones ay, 1 south of Plumtree 145 Savage John W (c) FLETCHER (Unionville) -- South from 2R00ocJkonaevs, L1uwcieusst jorf (cM) oore av 203 Vacant 206 Vacant 208 Wilson Lillian (c) FLaOvRsEoNutChE, 2AVwe(sSt Mo)f--SFercoomndPiedmont 110 Barker Geo T 114 Palmer John E 115 Martin Wm M 116 Wilson Frank C 120 Freeney Clara C Mrs FLORIDA AV--From 1306 Vineville av south to C of Ga Ry tracks 102 McAfee Oscar H 110043*UTshionma aCsoLmepsttoenr AH 105 Groover Thos D 10S*Smith J Allen 108*Brown Gwendolyn P Mrs 109*Hood Marshall H lll*Brown W Morris FORD AL--Changed to Fordville la FORD LA--From C of Ga Ry south, 1 east of Pio Nona av 1 Nelson Horace 2 Holder John 3 Sexton Floyd E 4 Paul Jas 5 Edge Jefferson . 6 Davis Fleming FORDVILLE LA--From Turpin south and west, I east of Harris 1 King Geo (c) 2 Burke Jos (c) 4 Carlton Lonnie Cc) 17 Smith Dfllfus (c) 18 (7) Vacant 20 (8) Nelson Douglas (c) 21 (51) Labell Jas (c) 2234 '((1121)) BBealrlroLnulJaoh(nc) (c) 44 Vacant FOREST AV (B)--From Grand av west, 1 south of Brooksdale av 101 Cox Lebum 102 Strong Chas P 103 Hendley Wm T jr Dikes Robt M 104 '(175) Ross J Frank 105 Reese Hester Mrs 106 Watts Jas I 110098 HPeorlkdienrs HReonbrty JN 111 Kennedy E Lewis 112 Wolff Martin 114 Perkins Leola Mrs 115 Britt Wm E 117 Horton W Horace 223 Hubbard Peter J 224 Potter Jas I 233 Driskell Nathaniel FOREST AV (V)--East from 315 Vineville av, 1 north of Ward 50-OHallard Normal School Cc) rea5r2*VCaactlainnt Harwood B 6631*((16062))*M>CoaumntpsbeLllewEidswH(c) 64 (133) Felts Wm Cc) 65 (142) Johnson Rosalie (c) 66 Knight Chas (c) 67 Neal John (c) 68*Brigham Virginia (c) 69 Vacant 70 Asbury Mack (c) 71 Gibson Homer (c) 72 Clemens Ella (c) 73 Wright Jas F (c) 74 Curry Scott C Rev (c) 7765*'(W13h7i)teHJoawsar(dc) Geo (c) 77 Butts John (c) 78 .Killings Keziah (c) 79 Mims Emory '(c) 80 (133) Wheeler Chester A Cc) 82 (133) Streets Leola (c) 83 Smith Edwin G Cc) 84 'Ashley Orpheus K (c) 85 Hands Pearl (c) 86 Henderson Andrew (c) 87 Holloway Porter Cc) 88 Ashley Asa C (c) 89 Lamar Rosa (c) 90 Vacant 91 Henderson Arth (c) 92 Givens Raymond (c) 93 Holmes Pearl (c) 94 Gibbs Burke (c) 96 Runney Lizzie (e) 97*Sturgis Lena (c) 98 Holloman Jim (c) gro 99 (116) Johnson Winnie (c) Douglas av intersects 100 McDow Wyatt (c) 401 Nichols Allen (c) 104*Finney R'ichd A Cc) 105 Davis John (c) 106 Dickerson Alex R (c) 108 Dozier Early L Rev (c) 109 Smith Chas (c) 111 Scott Jas (c) 114 Cook Hattie (c) 120 Lundy Andrew Cc) 125 Braswell Clarence (c) 127 Smith Robt L (c) Third av intersects 455 WILLINGHAM SASH & DOOR CO. Lime - Roofing - Cement - Plaster 457 Third St. Phones 277-278-279 FOREST AV (V) --Contd 204 'Patterson Jesse (c) 205 'Grimes Simon (c) 206 Vacant 207 CLipsey Jos (c) gro 208 Morgan Thos J (c) 210 Shamlin Love (c) 222 Simmons Walter (c) 224 Billins Robt (c) Sycamore intersects 301 Ryle Chas H gro 303 Chaney Morsey (c) 306 Walker Thos B (c) 308 Bivins Maggie (c) 310 Ferguson Janie C (c) 31'2AChaney Wm A 313 Street Edw (e) 314*Thomas Tallulah (c) 315 McBride Howard G (c) 345 Latimer Adolphus (c) 347 Byrd Amos (c) 396 : Sheehan Robt E 39'8AHobb Thos J 400ABronson Horace W 402 Vacant 402% Vacant 403 Butts Lonnie (c) 404AGibson Harriett W Mrs 406 (408)AStivarius Fred W 407 Bell Mamie (c) 408 (406) Vacant 409 Finch Susie (c) 410-CFunderburke Thos L 411 Morris Chas (c) 412 Key Homer H 413 King Lizzie (c) 414AShadborn Morris 415 Davis Emanuel (c) 416ABeach Jas R 417 Kimball Jack 418 Ryals Wm E aWoodruff Harry M 419 (427) Muldowney Alma Mrs 420AMann David G Rev 421AClements Mildred S Mrs 442253/-'(H41a9r)risDeDFaonrle J D Walter 427 Ponder Allen T 431-OBurns Kenmore 433AHersey Warren C 435 Muse Chas J 437AMcCook Danl O FOREST HILL AV--From Forsyth rd at Park northeast 120AJo!hnson Frank H 193' Williams Wm C jr Ridge av intersects 200aWadley Richd B 204ANisbit McDougald The Prado intersects 301AJones Stanley A 311ADavidson Wm E 319AYates J Emory jr 321-31 Appleton Church Home '(Episcopal Orphanage) 330 Griffin Edgar L 40:7&chandler Overlook av Willie M Mrs intersects FORSYTH--From Spring northwest to VineviEe av, continuation of Cotton av Spring and Pine intersect 102 Gresham School. 114 Copeland Jack 126 Lanier High School for Girls Orange intersects 200-OWillingham Grocery Co 201 Williams Watson Dugger Dudley B 202 Vacant 204AAtkins Andrew H baker 206ANorton Wm A 207ASmith Wm G rear Vacapt 210 Vacant 218ASolomon Linton M Solomon Lillian R Mrs 221-'*-NSeteevl eJnoss Carlton E N Jr post No 3 Am Legion rear Boy Scouts of Am Troop No 33 225 Power Oil Co The (hr) filling sta College intersects 305 Weisiger Wm P Johnson Susie R Mrs 307-CThompson Wilbur L Crutchfield Jack E 310A>Geeslin Lois 311 Ryle Jas G Cox Jerry O 313AOriswell Andrew F 33'1l'47AAMShuar,rppheZyimAileiceDHMrs 318ASheridan Chris F' @ 321 Vacant 322AAdams Railey J 324ABtembridge Olin L 325AJones David S Arlington pi i*nte*rse*cts StPaul intersects 440040-&0-NYeawtetsonGVMicotorgriaanMrs 40SABamett Morris 407ABeall. Jas 410AMagee Jas S Progress begins 411ALumpkin Geo B 415AAlexander Wm P AGilman Thos D 416AEtheridge Elma M Mrs 419AYelin Benj 442210AATHoirwsclehr 'AIsratdhorGe 422AHatcher Albert S 426AHanson Jas W 427AWillington Chas L Moore intersects 500 Texas Co The fill sta 501Across John J (c) 503ASavage Edw W (c) 505 Thomas JaS E Cc) 507 Andrews Mary (c) 509 Glover Wm '(c) 510 Sunshine Dairies 511 *Lavender Beulah Mrs confr Kahns al intersects 513 Jones Eva (c) 515 Stone Leola (c) 521 Moore Isaac (c) 523 Dennard Nicie (c) 525 Robertson Jeanie (c) 527 Barnes Bunk '(c) 528 Watts Hattie (c) 529 Jones Susie (c) rear Vacant 531 Gore Calvin (c) 532 Rushing RoBa (c) 533AMdKinney Jos O gro 533% (Griffin Walter (c) 540A'Green Albert E 544ALaing Fred C Frank's al i*nte*rse*cts West Boundary intersects 603 Adams Chas L 604 Murphy Wm F 604% 'Barnes Louie M Carswell W Roger 605 Vacant 606 McKinney Jos O 606% Hatfield Vera Mrs 607ASherrill E Gordon 608APaullin Margt S Mrs 610 Smith Jas T 611ALatham Rotot S Virgin begins '661152ALNegewgesottme CBhraasdfAord 616ARidley Hamilton B Hartley Mary E Mi's 618 M'cAfee Eula P Mrs 619 Alexander Eulalie T Mrs 620 Vacant 622 Vacant 6'23AWarlick Josie V Mrs Linen Service DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information yon are unable to procure elsewhere, call on ns R. L. POLK & CO. DETROIT 456 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 FORSYTH--Contd 625&Smith C Jean 626AJones Bruce C 629ADavis Jesse W 630ALawson Oswell T 631AGrace Ruby J Mrs Blanton Geo W 632AColeman Young R Dr AColeman Thos V Dodd Julia B Mrs 636 '-TWhoroadshruefrf JGoehon SB 637AJaney Geo W Janey Mary F nurse 639 IPellew Sarah AA1friend Malcolm C 643ARoberts Frank 644AWright Harry Curry Jas A 646AHorne Margt J Mrs 647ABaughcum John M 648AHicks Louise N Mrs 650AWoodruff Harry M florist 651A'Irvine Lee 65*3AThomson Vernon L Holleman Cornelius B * 654-AElfe Matilda Mrs Neylans Oscar S 655 'Peebles Harry L 658-0-Riley Jas T 660ACates John G James Ben`j W Virgins la intersects 701 Banks Mattie L nurse ABankS Lula A Mrs 702AFerrill Margt S Mrs 709AOrr Oliver lawyer Cooper Kate O Mrs 771110AVTaicmabnetrlake Joel H 712AKassner Irving E 714AGorton Ann E Mrs 715AHU1 Mattie 716 Chappell Clarence J 720 Lott Gus O 722ARedding Wm C 726AClisby Jos W FORSYTH LANE -- From 411 Forsyth north to Tinsleys la bet Monroe and Arlington pi 140 (264) Coleman Mattie (c) 141 Gibson Fannie (c) 142 (262) Thomas Horace (c) 143 Turk Maria (c) 144 (246) Huntney Mildred (c) 145 Jackson Jas (c) 147 Clinton Jas (c) 151 .(426) Battle Eug (c) 153 Jackson Richd (c) 154 1243) Renfrow Fred (c) 156 (241) Vacant 264 Sutton Leola (c) Progress begins FORSYTH ROAD -- Continuation i Vmeville av from Riley av 2120 Gordon Robt W gro Trevick Wm R barber 2121 Vacant 2122 Gordon Robt W 2123 Vacant 2125 Trevick Wm R 2130Aingleside Oil Co fill sta 2200AClark Memorials Inc monuments 2207 Riley Henry H 2213 (2137)ADavis Jas W 22221154APlerrvsinoen WEmug SG 2216 Gotten Boman C 2218 Cook Sidney J 2220 Millirons Sami W Brookdale intersects 2226ALiberty Service Sta fill sta AHiggison Leila Mrs restr 2300 Vacant rearAjeffreys McEIrath Mfg Co box mfrs 2302ABuck Ice & Coal Co 2311AGood..mg J,as K Oak av intersects 2320AJordan Betty Mrs 22332264AVSahcoaunset Edgar S 2328AHoagland Raymond L contr 2332AYeomans Sami R 23'34AEssig Geo J 2335ABarnwell Mina Mrs AFrance Ernest H 2re3a3r6AMSatrritciknlaJnads AMrth G 2337 Yeager Frank 2340 Vacant 2342 Alley Alex K 2344Aprance Sydney T 2345ADerr Harold A 2346ADismukes Jas C rearAHarrell Everett L 2400AFarres A. ug Wm Rex intersects 2402ATaylor Jemison W 2404ARose Ernest C 224410O6AAMShceNrwaiorodWAm TOr'aywick 2412ADaniel J Walter W 2501ASharpe Lila Mrs Auburn intersects 2502Adark Mae E Mrs AHolt Hamilton 250SHanson A Sydney 2505AJarrett Henry K 2510AHuey Luke M 2514 Oak Art &AGlbieftrmSahroleppTi hinetersects AWalker Claire J Mrs ARussell Henry D 2515 Wilson John E 2516ARichardson Rhea W 2518Apiunkett Robt G 2520ACappell Wm A 2re5a24rAVDaecsasanut WashRinivgetrodnaledr intersects 22661011AVPahc.i.la.l.nrpts Chas HBerkley dr intersects 2612ASChmidt Mildred V Mrs 2700ABlossom Geo L Euclid av intersects 2717AMoore Ernest C 2719AMorgan Bert 2720*Johnston Lillie M Mrs 22772550AIWttiiklsonAnJnaEdLw Mrs 2801Ajones Paul A 2814AZaohary W Clarence 2820 Ga Power Co (sub sta) 2822AShinholser Walter N gro 2,,9,,,,0,,0 V,,acan,t Park intersects 2902APitts Pharmacy 2904ADavis E Clifford gro 2908AHill Wm E ABrown Mabel Mrs nurse 22991156AAPPoeltaerrsoBneaJrasTLhe restr 3006AGarrett EugenePaErkwood intersects 3012AQuickel Albert F Forest Hill av i*nte*rse*cts 3102 B_ass M E ChurRchidg(eSoavuthin)tersects 3201AHephzibah Orphanage 3202ABurke Effie B Mrs - C,,ent. ral of Ga RUynd(eWrpeasslseyinStteartsieocnt)s - Davis Harry filling sta - Huff Wylis (c) - First & Last Chance filling sta - Foster John (c) - Fry Isaiah (c) - Burney Wm (C) - Goggins John (c) - Idle Hour Club - Idle Hour Nurseries greenhouses 457 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS S69 MULBERRY STREET PHONES 946-947 FORLSeYe TMHarRy DC--MCrsontd Morris Paul I filling sta Neal John (c) Odell Arth B Redding Thos (c) Robinson Henry (c) Street Sami (c) Threatt Lucinda (c) AWesleyan College AWesleyan Pharmacy FORT HILL (EM) -- From 628 Main north to Clinton 120ACain Cicero A 121 Bums J Harry 122 Albert Nathan 123 McDonald T Fletcher 124ALiles Jas D @ 125 Cunningham A Eug 126 Vacant 127 IGriffin Lewis H 128 Liles John A T30AWard Jubal B 131 Griffin Henry L 133 SBhroelalcehy JColhaundWe iBllingham intersects 202'iBrown Wm R 203 Johnston Jas R 206ATrawick Wm A 207'--Keefer Missouri MrsStJohns begins 301 Dixon Alvin K 302AHolloway Maurice 330034AWJoonoeds OJohhans C 305APool Wesley S 306AHeyser John F Broad intersects 401AValette Nettie Mrs Couch Robt B 4025F-RuollbeerrtWs JiansfrBedE 404 Brockman Swep O 406 Burns Harry B 412*Jones Robt T 450 Fort Hawkins SWChoolfolk intersects 500 Vacant 501ADurden John R 502ADunden Susie 503 Williams Eula (c) 505 Wells Ossie (c) 506AJohnson Isaac K (c) 507 Dixon David (c) 509AWarren Wm '(c) 511 K512) Bankston Creacy (c) 513 Benford 5'14ASawyer Jas Arth (!(cc)) 514% Sawyer Arth '(c) gro 519 Jordan John (o) 594 Broadus Effers (c) 596 Ursery Julius (c) 598 Burney Claude '(c) Cowan intersects 601 '(600)AJohnson Amy (c) 602 IGriggs Rufus (c) 603 ( 605) Vacant 604 Shropshire Jas L (c) 605 606 R(6u1t3l)edHgeubDbaarvdidE:(dci)nburgh '(c) 607 Hubbard Edinburgh '(c) gro 608 Redding Eliza (c) 610 Fitzhugh Willis M (c) 611 Lowe Wm T (c) 612 Bell David '(c) 614 Odum Jas (c) 616 Hines Geo (c) 631AJackson Wesley (c) 633 Stewart Wm S (c) 635 Bourne Leila '(c) 637 Blount Annie K (c) 639AGebara Chas 641 Gebara Chas gro Hall intersects 717 Smelter Thos (c) 710 Ross Henry (c) 721 Glover Edwin J '(C) 723 Fitzpatrick Seaborn (c) 724 East Macon School (c) 755 Wilburn Geo (c) 757 Butler Mitchell '(c) 759 Billingslea Abr (Mc)itchell intersects 801 Wilson Susie (c) 804 Davis Gussie '(c) 805 (801) Carswell Dessie (c) 805 (802) Wilson Woodrow (c) 806 Singleton Wm (C) 807 808 GMloosvser!EoHlaattMie `(c) (c) 809 Taylor Kine (c) 810 Taylor Polly (c) 811 '(809) Smith Arth (c) 813 (836) Glawson Harry (c) 815 (838) Vinson Ida (c) 817 '(812) Vacant 819 '(844) Brown Mack '(c) 821 (745)APerkins Wm L (c) gro 843 (800)AEpps Fred (c) 900ABurdell Maryland M (c) 901 Dentley Ashley (c) 904 Wood Jackson (c) 905 'Hampton Frank '(c) 921 Jinks Lula (c) 931 Lewis Ray '(c) 971ABynes Henry S (c) 981ALester Robt B Rev '(c) 1000 Cook Hiram '(c) 1016 Harris Neal (c) 1020 Powell Oris (c) 1048 Green John (c) FOSTER'S AL--From 822 Hazel south to Ash 851 Flemming Chas (c) 852 Mathes Camilla (c) 853 '(862) Williams Mildred (c) 854 Smith Emma (c) @ 858 Simmons Estelle (c) 860 Holmes Laura (c) 862 Jackson John (c) 868 Calloway W Henry (c) FOUNTAIN AV (East Macon) -- From Peachtree southeast to Applewood, bet Jones av and Balkcom av 100 Hawthorne Wm H FOURTH--'Changed to Broadway FOURTH (UnionviUe) --From Dempsey av south to Third av, 1 east of Fifth 112 Vacant FOURTH AV (Bellevue)--From Industrial Home rd north, 3 west of American blvd 101 Joiner Pauline (c) 102 Jackson Eug (c) 103 Ransom Mary (c) '104 'Poole Amanda (c) 105 Vacant 106 Hill Perry '(c) 111 Reed Benj (c) Burkner intersects 213 Thompson Wm (c) FOURTH AV (Crumps Park)--See Marshall av (Crumps Park) FOURTH AV (South Macon)--See College FOURTH AV (UnionviUe)--South from May av to Dempsey av 113 Brown John W '(c) 115 Marion Arth '(c) 116 Morris Jas (c) 339 'Watson Jas Rev (c) *341 Williams Oscar (e)_ 343 Bailey Hillman (c) 344 Calhoun Aquilla '(c) 446 Durham John (c) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? 1$ Answered Gy the Classified Business Lists In this Directory 458 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 FOURTH AV (Vineville) -- From 363 Monroe northwest to Ward 1101901 'Davis Jack (e) Pounds Sina (c) 111 Barron Fannie (c) 112 Vinson Walter '(c) 115 King Bryant (c) . 116 Little' Mary '(c) 118 Newkirk Laura (c) 122 Brooks Adams (c) 123AAshley Marshall (c) 126 Clayton Andrew J (c) 130 Allen Irving '(c) 131 132 Butts Ben.) Ferrell Eug- !((cc)) 133 Robinson Cleveland (C) 137 (139) Jemison Wm (c) 139 141 VFraacnaknlti1 n Walter '(c) 142 Wright Sarah (c) 145 Avery 'Green (c) 155 Vacant l56AJohnson Alf (c) 1580'Gilmore Mary A (c) 161 Glover Emma (e) 162 Mims Eli (c) 164 Vacant 167 Carnegie Abetha B (c) 179 Jackson Chas (c) Middle intersects 205 Hampton Henry (c) gro 207 209 CWlialrskonEBlizeassi!(ec) (c) 224 Bell Anna (c) 226 Vacant 227 Ingram Emma (c) 229-0-Savage Wm B (c) 231 Vacant 232 Murphy Lee '(c) 235AGoodwin Badger (c) 236 Laws Robt (c) 240 Johnson Eva (c) 241 Johnson General (c) 243 Vacant 254 Ricks Leila '(c) 255AHollis Johnnie L (c) 256 Johnson Mary '(c) 257AMcDonald Eliza (c) 258 Hamper Jos (c) 259 Vacant 260 Brodie Arth (c) 262 Watkins Henry '(c) 263 White Easter (e) 264 Alexander Wm H (c) 266 Stewart Mary B '(c) 269 Vacant 269% Brick Masons Hall (c) 271 (269) Kendrick Anthony D (c) gro 275 Robinson Robt '(c) 276 Lattimore Essie (c) 278 Goihlston Cleonis (c) Clarke av intersects 30'8-CWalker Jas L Rev (c) 30'8-Q-Harris Danl (c) 314 Parker Walter (c) 320 Alston Wm (c) 322 Vacant 323 Jones Baby R (c) 325 Pinkston Alf '(c) 343 Mobley Otis (c) 347-OBtanley Carrie E (c) Lawrence Beatrice (c) nurse 407 Vacant Lynwood av intersects 436 Swaing Mattie (c) 438 Wright Robt (c) 440 Lamar Pierce L (c) 443 (415) Vacant 455 Fultz Estella (c) 551 White Wm (c) 560 Vacant 607 LT emon Otha (cM) oughon intersects 609 Clark Sophie (c) 610&Johnson Sonnie (c) 611 'Cook Aaron (c) 612 McCoy Jack (c) 613 (614) Willis Lillian (c) 618 Walker Albert (c) 662202 ((661290)) LWawrigsohnt LJoosttie(c)(c) Miller Eug (c) FOURTH AV (Western Heights)--South from 500 block Winship to Dempsey av 600 Anderson Josephine (c) 602 Smith Jas (c) 604 Green Geo (c) 605 Lamar Henry (c) . 606 Lewis John (c) 607 Freeman Oscar (c) 609 Harden Geo 610 Vacant 611 Harris Nehemiah (c) 615 Battle Boskie (c) 617 0626) Evans Annie (C) 618 Brannon Chas B (c) 619 Matthews Isaac (c) 620 Vacant 622 Vacant 625 Jones Elijah (c) 627 Lackey Jos (c) 629 Byrd Addie (c) 631 Goodwin John D (c) 633 Burns Jesse (c) 635 Doyle Andrew (c) 637 Allen Wm J (c) 639 Smith Jos L (c) 664410 SLmauidther FLrailnlike M(c) (c) 642 Steels Hattie (c) 644 Smith Thos (c) 645 Mills Hattie (c) 646 Maynard Amanda (c) 647 (130) Shakespeare Postel (c) 648 Hughley Chas (c) 650 Jones Mack (c) FRANK AL -- From Forsyth east to 1H01ar0d1e)mNaenlson Mary (c) 102 (2) Vacant 103 (3) Gould Eug (c) 104 (4) Pennyman Albert (c) 105 (4) Murphy Jas (c) 106 06) Redding Lena (c) 107 (5) Green Albert (c) 108 (76) Collier Robt (c) 109 (7) Nelson Nancy M (c) 110 (12) Fuller David (c) 112 (11) Townes Alice (c) 113 (9) Booker Eliz (c) Tinsley la intersects 115 (10) Robinson Ada L (c) 117 (13) Richardson Otis (c) 119 (28) Rainey Georgia (c) 120 (213) Grier Whittle (c) 121 (16) Brown Geo (c) 122 (211) Vacant 124 (214) Phillips Clarence (c) 125 (19) Bryant Geo (c) 112297 ((2322)9)MVidacdalenbtrooks Frances (c) 131 (20) Mathis Jas (c) FRANKLIN--From Rose Hill Cemetery to Walnut) 4 west of Second 4485-OBGroeworngiaWPiloliweer(cC) o sub sta 101 Leary Robt '(c)Ocrmesutlrgee intersects 103 Newton Noland (c) 107 Clemons Jefferson H (c) 108 Maund John (c) 110 Ellis Osie (c) l1l1l2&DCliesrmooonns FJreafnfekrsoWn (Hc) (c) gro 117 Morris Frank (c) 118 Haddox Thos (c) 119 Brown Alma (c) 120 Jackson Mamie (c) 151 Washingt, onFrManakrlyin .S(ct) la intersects 159*Standard Market gros Bobo Ralph Disroon al intersects 459 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 FRANKLIN--Contd 252 Little Anderson (c) 256 Collier Edw (c) FRANKLIN (SM) -- From 3032 Houston av east 401 Burden J Hubert 403 Dixon Melinda J Mrs FRANKLIN ST LA--From Franklin to Hill, bet Walnut and Ocmulgee 116 Hutchins Lula (c) 118 Vacant 119 (5) Williams Edw (c) 120 (8) Knight Lillie M (c) 122 (9) Rawls Amanda (c) . 123 (13) Wall Eudell (c) 124 (12) Nixon Robt (c) 125 (15) Taylor Eug (c) 127 (17) Green Mazie (c) 131 Cross Katie (c) FREEMAN (SM) -- From Williams west to Harrell 101 Jones I Brrett 105 Vacant 107 Lee Claude M FRETWELL AL -- From Elm to Edgewood av, I north of Ross 208 Reed Lewis (c) 210 Anderson May B (c) 211 Talley Leola (c) 212 Thomas Lizzie (c) 212% Spencer Ida L (c) 213 Oliver Rebecca (c) 214 Riley Edw (c) 215 Felton Leslie (c) 216 Street Fannie (c) 217 Sanders Lizzie (c) 218 Turner Horace (c) 219 Macon Henry (c) FULTON (East Macon)--East from 809 Clinton to Lexington av, 1 north of Woolfolk 115025/-L'-eHwudissonHaJrevsesye R(ce)v (c) 216Kizzie Hattie (c) 219 Adams Isaac (c) 221 Vacant 224Miles Mary E (c) Northern av intersects 500 Green Geo (c) 501 Spradley Cecil (c) 502 Gtreer Wm (c) '550043-MSGaannsnosn RMobatck(c)(c) 505 Kizzie Anderson M (c) 506 Hannah Ruth (c) 509 Turner Wallace (c) FULTON (South Macon)--From Houston av east to Kemper av, 1 south of Grady lOOA'Sumner John W Sumner GroveMr iWkadotruacvkiinntgersects 220013*DMoabtbhsewSspiJvoehynL 205 Newberry Morris 206 Moulton Thos F 222070&SWteivlleianms sMPaaunul eCloKEweamgpoenrminfrtsersects 308-OCarter J Wm gro 310-12 Vacant 314Art Furniture Mfg Co FULTON AL--South from 552 Hemlock to Arch, bet Second and Third 3 Rogers Hardy (c) 8 Roberts Henry (c) 10 Brown Wm (c) 16 James Oscar (c) 102 (2) Jackson Win (c) 106 (4) Jordan Ollie M (c) 107 (6) Nelson Maggie (c) 108 (5) Austin Danl (c) 109 (7) Wilson Douglas S (c) 110 (6) Perry Jas (c) 111 (69) White Pearl (c) 112 (7) Patterson Annie M (c) 113 (556) Vacant 115 (558) Battle Chas (c) 116 (10) Jenkins Robt (c) 1.17 (555) Miller Georgia (c) 118 Brown Annie (c) 120 (8) Hughes Lizzie (c) 122 (14) Oliver Eva (c) 124 (514) Kitchens Blanche (c) 126 Ellis Gilliann (c) 128 (1) Hardy Delree (c) GAILLARD (V)--North from 314 Roosevelt to Neal 1 Howard Henry (c) 5 Stephens Arth (c) 113 Threatt Ned (c) 1.14 Wisdom Oscar (c) 115 Parker Gertrude (c) 116 Threatt Henry (c) 118 Robinson Tabernacle A M E Church (c) 122 Stroud Teazea (c) GANT (East Macon) -- East from 105 Yates av to Clinton, 1 north of Main 108 Pritchett L Eug 112 Dukes John H GANTT CITY RD (SM)--From Enterprise south beyond limits, 1 east of Broadway 99 (210) Vacant Charles intersects 100 Vacant 102 Coggins Rufus (c) 104 Taylor Jas (c) 106 Grier John (c) 108 Hawkins Jessie (c) 110 Simmons Floyd (c)Crisp intersects 200 Mt Calvary Baptist Church (c) 201 Mallory Betty (c) 202 Henderson Leo (c) 203 Holloway Mattie (c) 204 Brown Anna (c) 205 Tinsley John (c) 206 Vacant 212 (231) Moore Lizzie (c) 257 Giddens Wm (c) 259 Banks Russell (c) 260 Green Hezekiah (c) 261ABentley Borie B (c) 263 Taylor Rosa (c) 300AGreenwood Nelson (c) 302 Galry Alonzo J (c) 315 (267) Howard Mary (c) Rutherford av intersects 401 (313) Carter Carrie (c) 405 (384) Independent Sons & Daughters of Jerusalem (c) 501 (401) Jackson Susie (c) 507 (405) Jordan Jack (c) GANTT PL --From Bright al east, 1 south of Bay 214 Hilboard Nancy (c) 215 Lewis John (c) 216 Comer Irene (c) 218 Johnson Fannie (c) 221 Davis Effie (c) 331120 WMiitlccohxellPeJansny(c()c) 315 Ferry Hodges (c) GARDEN (East Macon) -- From 225 Church west to Clinton 111 Hyatt Hady C 114 Chatman John 115AMorrow Eliz S Mrs 116 (Grimsley Geo T ,117 Lonnineck Bartow 119 Griffin Memior 120 Vacant 121AAllen Hermie O 122 Willis Milledge C 124 Walls Harris Macon Federal Savings & Loan Ass'n Loans on City Heal Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R, L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 460 461 M ACON I Moving -ProPmpat cEffkicieinnt Sgervic-e Crating TRANSFER new and used furniture CO- 408 BROADWAY PHONE 304 GILES (SM)--Contd 450 Evans Nell Mrs Cedar intersects 5011 AVpacaartnmt ents 2 Vacant 3 Vacant 4 Vacant 5 Vacant Street continued . 501 Church of Jesus Christ 502 Braswell Jack J 506 Leaptrot Grady 507 Vacant 551104hHWililllisGeGoeoP W 517 Bower Bishop W 551282*CNaorrtreerd JWulaiallnace P GILMER -- Continuation of Seventh, from 151 Tupelo south to Edgewood av 214 Davis Eug (c) 216 Brown Walter (c) 220 Thomas Geo (c) 222 Ross Fannie (c) 224 Wright John (c) 226 Davis Rosa (c) 230 Vacant . _ ,. 233 Shoemaker Leonard J (c) 235 Vickers Annetta (c) Bay intersects 303 Johnson Ernest (c) 305 Thomas Jas (c) 307 Jackson Lonnie (c) 310 Parker Lillie (c) 312 Nelson Austin (c) 315 Farrer Chas (c) 317 Evans Jas (c) 318 Ward Addie (c) 319 Hall Chattie (c) 320 Robinson Cath (c) 321 Robinson Jack (c) 322 Allen Robt (c) 323 Thotmas Oscar (c) 325 Vacant , 329 Hicks Warren (c) 331 Holmes Orcelia (c) 332 Smith Lelia (c) 333 Duncan Lynwood (c) 333385 UVaSca, nPt W A Homema,k.ing_ Center 339 Johnson Robt L (c) 340 Jackson Lovie (c) 342 Bryant Lula (c) 344 Brooks Obie (c) rHesatzrel intersects 402 Bolden Mack (c) 410 Kendall Rentz (c) 412 Spencer Etta (c) 414 Josey Richd (c) 416 Bowden Millie (c) 418 Ware Walter (c) 421 Scott Henry (c) 437 Brown John (c) 441 Bonner Sallie (c) 442 Rhodes Iverson (c) 443 Kelly Carrie (c) 447 Clayborne Carrie (c) 449 Cooper Lucy (c) 453 Thomas Wm (c) 497 Ballard John (c) 498 Walker Ida (c) 503 Humphries Sarah Ash (c) intersects 505 Williams Wm (c) 507 Vacant , 509 Troutman Jos (c) 511 Walker Chas (c) 513 Vacant 515 Vacant 517 Fair Berry (c) 551291 HWeialltiamGsoldWenm (c()c) 525 Brown Henry (c) 526 Johnston Will (c) 527 Brown Jos (c) 531 Ponder Robt (c) 533 Combs Wm (c) Elm i.ntersects 660021 W(2)ebHstuedrsoDnanJloh(nc) H (c) 603 (3) Causey Jas (c) 604 (4) Nelson Mary (c) 605 Vacant 660076 P(6a)tteWrshointe EEarrnles(tc) (c) 608 Gordon Martha (c) 609 (9) Williams Lucile (c) 610 (10) Banks Robt (c) 611 (11) Dinkins Andrew (c) 612 (12) Ross John (c) 613 (13) Taylor Gertrude (c) 614 (14) Vacant 615 (15) Barr Wm (c) 616 (16) Brown Freeman (c) 617 (17) Grier Mattie (c) 618 (18) Roberts John (c) 619 Vacant 620 (20) Goolsby Ola (c) 621 (21) Vacant 622 (22) Vacant 623 (23) Vacant 624 (24) Howard Danl (c) 625 (25) Vacant 626 (26) Jackson Wm (c) 627 Vacant . ,. 628 (28) Middlebrooks Minnie (c) GLEN (EM)--From 513 Woolfolk east 112 (113) Coates Mary (c) 115 Stewart Mandy (c) 116 Coaston Alf (c) 123ALewis Inez L (c) 125 (124) Gilmore Bishop (c) 112568 B(2a6t)tleReiGdoldOilelie(c()c) 161 (15) Waller Anthony (c) 169 Curry Beulah (c) 322 Goodwin Boyce (c) 416 Clark John H (c) 765 Solomon Theo (c) GLEN COVE DRIVE--Changed to Park GLYNN AV -- From Log Cabin blvd east, 1 north of Habersham av 2 Vacant 6ABayne Chas J 7AMartin Robt M lOA(HO) Miller Jos G 118*Potts Julian 124-tDuPree Doris H Mrs 127 Walker J Clifford 114580 RBianngksCJhaass H GORDON (Cherokee Hts)--From Bartlett's la west, 1 north of Bellevue av 121 Hill Otis (c) 187 Chaney Willie L (c) 118889 CJaocdkesown mFan(cn)ie (c) 192 Vacant 194 Jackson Zadie (c) 301 Jones Dolly (c) 302 Clark Austin (c) 303'ijames Moses S (c) 304 Vacant 306 Parker Chas (c) 354 Vacant GORDON (HH) --Changed to Oglethorpe GORDON (South Macon)--From Third west to Second, 1 east of Edgewood av 115 Mitchell Emima Mrs 116hBurnett Chas M 130*Shinholser W Jesse 131AStokes Otis R 132Daily J Harvey Rev 133hRyles Jas T 135*Horton Geo E GRACE (South Macon)--From Second to Fourth, 3 south of Steele GRACE (VineviUe)--See Ruby YOUR CITY D I R C T O R Y MIRRORS the CIVIC life Of Your CITY 462 YOUR CITY D I R C T O R Y MIRRORS the CIVIC Of Your CITY TAYLOR TRANSFER COMPANY STORAGE SHIPPING PACKING 458 PLUM ST. PHONE 388 GRACE AL--See Army Lot 107 Stinsonville Baptist Church (c) GRavACsoEutAh,V1 (wSeMst)--ofFSroemcon1d11 Piedmont 100 Bowles John R 102 Pilcher T Roger 120 Vacant 109 Bloodworth Lonnie (c) 110 Adams Henry (c) 113 Colbert Jas B (c) 116 (10) Battle Frank (c) 119 Tanner Mary L (c) GRADIE'S ROW (South Macon)--See Reid (South Macon) GRANT AV (Vineville)--From Fourth av north, 1 east of Ward lOOhBeda Etta College (c) GRADY (South Macon) -- From 3506 HofoFuustlotonnav east to Kemper av, 1 north 103 Stripling Jas P 105 G_ ornt,o W,, illie E M. rMs ikado begins 107 Ross Edgar J <-- 109 Ross Jas H 111 Curl Lillian W 112 Ellington Elmore D 111143'0M-GilillelerlanHdugDhempsey @ 111154%WWhiaterhreunrstTeBxuarsdick 116 Harper Leonard A jr 117 (123) Harper Jos R 118 Harrison Jas C 120 Jones Ida A Mrs 121AHamlin R Floyd 122 BNeicreknsJteinFleFmuilntgon J 124 Hightower John W pntr 126 Brown Gordon 128 Halsey Edna W Mrs 130 (126) Hamlin Emma Mrs 102 DBeuddaleyEtRtaobLt ib(cra)ry (c) 103 Church of God (c) ,,2,,0,,0 (129)&Pit,ts HDatotuieglaLs a(vc)intersects 201 Johnson Bertha (c) 201 (191) Vacant 203 (185)hFrederick Emma (c) 204 Dudley Zella (c) 205 Vaughner Millie (c) 206 (232)-2Berry Claiborne B (c) 207 Hartwell Thos (c) 208 Clark Berry (c) 209 (227) Jackson Ethel (c) 210 Rogers Walter S (c) 211 Turner Edith (c) Ple e"ds 212 Jackson Edw (c) 214 Holloman Jas (c) 215 (145) Vacant 216 (159) Black Virginia (c) 217&Parks Ella M (c) 218 (161) Walker Frank (c) 219 (136) Clay Zettler C (c) 222210 ((113643)) RSmeeivthes JGosrady (c) GRA2 HWAiMlli'aSmLs ORTo--mReea(rc)225 Fifth 4 Woodward Mamie (c) 5 Brown Pearlie (c) 6 Johnson Arth (c) 7 Jones Daisy (c) 8 Vacant 9 Brooks Susie M (c) 10 Nealy Wesley (c) 12 Jackson Daisy (c) 222 (165)*Sims Jas (c) 223 (130) Hunt John (c) 224 Vacant 225 (132) Lockett Agnes (c) 226 (125) Nims Hayes (c) 227 Hicks John H (c) 228 (127) Hyman Wm (c) 229'5-Lavender Hubert (c) 223310A(B12u4r)neByurCnreayw-fJourndiu(sc) (c) 13 Mt Pleasant Church (c) 15 Mabley Rachel (c) 16 Martin Leila (c) 18 Stovall Katie (c) Sherman intersects GRANT CHAPEL AL (SM)--From Sec2o24nd(2s2o3u1t)h.V1acnaonrtth of School GRAND AV (B)--From junction of Log Cabin blvd and American blvd north to Ayers rd 1 Arnett Lucius B 2 Carr Laura Mrs 3 Arnett Henry 4 Farr Henry B 5 Vacant Forest av intersects 6-C'Russell Sami C 8 Arnett Sidney O 10 Cranford Arth A 12 Dawson Jas J jr 18 Cook Wm R 19 (298) Watson Hiram A 21 (190) Dover Sidney J Brookdale intersects 100 Sweringen Wm W 101&Ross Eunice M Mrs 102 Franklin Carey G 103 Roland Henry P 104 Lovett Wm F 105 Davis Wm H 106 Bullock Albert J 226 (22291/2) Childs Homer S 227 Peavy Claude Mrs 228 U S Home Making Center 229 Dawson Walter 405 Brooks King (c) 525 Munson Chas (c) 526 Denkins Elijah (c) 527 Akins Otis (c) 528 (6) Wheeler Julia L (c) (5) Cook Phyllis (c) 529 Grier Essy (c) 530 (7) Brown Annie (c) 531 McLendon Ida (c) 53:2 Edwards Lee (c) 533 (415) Brown Essie M (c) 535 Jones T J (c) 537 Akins Wm (c) 538 Wright Florine (c) 539 (512) Scott Annie B (c) 540 (510) Collins John H (c) 542 Nelson Wm (c) GRAYSON (U)--From Mosley south to Parker, 1 east of Edwards' 107 Minter Arnold L 117&Bateman Gilbert C Fail-mount av intersects 201 Allen John A 220035 TGaibyblosr WAmlmeDda Mirs 206 Perry Robin T GREEN--From 261 Madison north 114 Mahogony Jos H Rev (c) 116 Cornelius Henry C (c) 120 Gardner Ella F (c) nurse 122-OFloyd Etta (c) 124 Broomfield Julia (c) 125 Garland Meta (c) 215 (53)Watson HuVbeilrlterCav intersects GRANT AV (Stinsonville)--North from Brooklyn av, 1 east of Main 106 King Jos F (c) 126 Clyde Annie P (c) 128 Walker Levi (c) 130 Tucker Henry (c) 132 Vacant 202 McPherson Viola (c) 204 Hunt Minnie (c) 463 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 GREEN--Contd 206 Idlett Wm (c) 208 Smith Della (c) 209 Leighton Cornelius (c) 210 Sullivan Martha (c) 221112 TCulacrkkerJaLsizz(ice) (c) 213 Bullard Elvira (c) 215 Nesbit Sami (c) 221167AWWimrigbhetrlyJasEdTw ((cc)) 218 Murchison Jesse (c) 219 Waller Danl (c) .220 Jerry Carrie (c) 301 Card Pleasant (c) 302 Cobb Scott (c) 330034 SLeulnlesrfsordOpMhealuiadie(c)(c) 305 Jackson Mary (c) 306 Clark Cleveland (c) 307 Bailey Mattie (c) 45 Vacant , 47 (44) Johnson Gus H (c) 49 (45) Blash Mattie (c) 51 (48) Hayes Ernest (c) 53 (60) Gilbert Geo (c) 55 ( 47) Vacant GRENADA TERRACE--From Houston av east to Flamingo dr, 2 south of lOHle&arWdhitehead John _H_ _ 106AHorne Danl W 109AKitchens Jos T 119AHorne Earl BSan Juan intersects 204AClay J Price 208AGriffin Gladis F '2lOASimmons Jas J 213AByrd Julius FMlamingo dr intersects 340*Cranford Julian E "Macon's Newest" 309 Cooper Isaiah (c) 310 Holt Jos (c) gro 311 Staten Ernest (c) 312 Bostwick Twiggs (c) 313*Lundy Eva (c) 314 Davis Georgia (c) 315 Kitchens Bettie (c) 316 Walker Jessie L (c) 317 Baker Mattie (c) 318 Davis Fannie (c) 319 Davis Walter (c) 332201 BVaatctalent Clifford (c) 322 Famble Gilbert (c) 323 .McCarthy Reddick (c) 324 Ray 'Jas (c) GRENADA TERRACE WEST -- From 3303 Houston av west 111 Smith Claud W 111251&AOKwetecnhsie WWesleLyouPis l23ABa-teman Emmett E 129 Head J Keel 131 Adair Ralph P 133 Jessup Sheperd J 224 Watts Arth B 226 Clark Geo A GRESHAM LANE--From Spring north to Orange, bet Rose Park and Forsyth 626 Danforth Josephine (c) 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 325 Harvey Wm (c) GRIER--Continuation of Ninth 326 Pennymon Chas (c) GUERNSEY LANE--From Elm to Edge- GREEN (Vineville)--From Bell av west, 2 south of Roff Home av 1w54ooMdcaGve,ebeMt oFzierlslte an(cd) Telfair 100 (206) Robinson Louis (c) 102 (208) Hughes Walter (c) 106 (210) Moore Henry 108 (212) Phelps Etta (c) 110 (304) Pleas Albert (c) 112 (220) Franklin John (c) 114 (202) English Dock (c) 116 May Chas (c) 118 (220) Floyd Ethel (c) 156 Jones Fannie (c) 158 White Cath (c) 702 Pollard Carrie (c) 703 Richardson Robt (c) 704 Mathews Mary (c) 705 Hobbs Frances (c) 706 Williams Lula (c) 751 Houston Victoria (c) 752 Hayles Robt (c) ill 119 (112) Sledge Lillie (c) 120 Winbush Frances (c) 122 (224) Howard Maria (c) 124 (226) Johnson Ida G (c) 126 (228) Jones Columbus (c) 128 (230) Myers Jas >(c) GREEN (Paynes Mill)--From Rose av south, 1 east of Davis GUNN'S LA (V)--From 311 Second av east to Third av 1 Bryant Mary (c) 2 Gordon John (c) 3 Morris David (c) 4 Maddox Sims (c) 5 Sessions Julia (c) 6 Cosby Hattie (c) Polk's Bankers Encyclopedia 82-83 Men's Club House 7 Smith Henrietta (c) 86-87 Dyche Lonnie F 88-89 Barton Forest W 90-91 Hullet Geo C 92-93 French Lonnie 94 Parks Milton H 95 Hanner Cliff R 96 Bryant Jodie 97-98 Moyle R Lafayette 99-100 Horton Win D 101 Whitlock Thos C jr 102 Herring W Henry 103 Adams Robt 1104 Tomlinson Ella Mrs 105 Horton Jas 106-07 Wilson Jesse W 108-09 Hutts Jos L 110 Parks Oscar 111 Riley Mamie Mrs GREEN SMITH'S AL--From 374 Monroe north GREEN'S LANE--West from 393 Madison to Monroe. 1 north of Jefferson 39 Lockhart Jas (c) 41 Lewis Isaiah (c) 43 Byrd Mamie (c) 44 Robinson Gus (c) 8 Hill Sarah (c) 9 Sutton Pleasant (c) 10 Walker Arth (c) GUNN'S HILL (SM)--South to limits, east of Fourteenth GUSTIN AV--From Northwest Boundary north to River rd, 1 north of Wise av 2 Broady Arth (c) 14 Hall Ella (c) 16 Holmes John H (c) 18 Jordan Chas (c) 20 Franks John (c) 102 Stephens Leon (c) 104 (105) Glowers Ellis (c) 106 Green Jacob (c) 108 Grant Mary (c) GUSTIN PL (V)--From Holt av to Virginia la, 1 south of Forsyth 1 Vacant 2* Spruce John W 3 Murchison Homer 44Spruce Wesley C 5 Williams Chas A The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York J 1 464 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & CO. Members N. Y. THIRD AT PINE GMC TRUCKS PHONE 5100 Stock Exchange N.ExYc.haCnogteton ChicagToraBdoeard ad AssNoc. iaYte. MCeumrbber* Exchange HABERSHAM AV (Lanier PI) -- From Log Cabin blvd east, 1 south of Glynn av 113*Calhoun Ruby Mrs 115 Harrell Emory S 122 (138) Williams Wm L 124 Harrison Danl J 135*Haddock John H 332297 SJownaens CWomrnel(icu)s (c) 331 Bearden Fanny (c) 333Sinclair Refining Co 334 Rteese Carlton (e) 338 Pryor Otis (c) 342 Mitchell Susie (c) 344 Pryor Sydney (c) Local Stocks and Bonds HALL (EM)--From Clinton east to city limits, 4 north of Broad 346 Walker Jesse (c) 347 Stevenson Luther (c) 349 Woodall Spencer (c) Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds 125 McCoy Sol, (,c)Northern intersects 263 (667) George Peter (c) 264 (664) Crittle Walter (c) 226656 ((666658)) BSmawitlh DEamvimd a(c()c) 267 (663) Duke David (c) 268 (660) Moss Amanda (c) ,,3,,0,,3 (583) KendrickLLexuicnigntdoan i(nct)ersects 4.0..0. (531) Jack, sonLitHtleenrSyho(rct) intersects 401 (735) Hall Annie (c) 402 (150) Green Wtm P (c) 5_0__0 (21) -Ree.l.d.ing ,,EdwCe(nct)er intersects 501 (218) Meriwether Arth L (c) 502 (460) Curtis Ella (c) 503 (19) Grace Eva (c) 35:1 Cleveland Sara (c) 355 Deehart Geo (c) 4,1,o8 oSmith TL.iza (,c) Hazel intersects 420 Finney Major (c) 426 Tolliver Benj (c) 434 Wimberly Hester C (c) 436 Taylor Joshua (c) 438 Byrd Chester (c) 500 V.. acant, Ash intersects 510 Respess Wm (c) 516 Jones Susie (c) 550 Sappington Alberta (c) restr 552 Chambers John (c) 553 Walker Clem Tc) 558 Roberts Polly (c) 566 Perkins Columbia (c) Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 504 (42Q)ABivins Henry C (c) 505 (504) Shy Eula B (c) 506 (15) Ford Frances (c) 507 (307)AFolds Ghas H (c) 550087%(4A5F8o)ldMs aLrsahuarlal P(ca)ralceoenfr(c) 5sn0o9 /(o3n0n9) Mitch, el,l RAitnchneiey a(cl) intersects 510 (456) Vacant 511 (311) Howard Roxie (c) 515 (497) Weinberg Louis gro 6,,0,,,,0 (251) C_ummi.ngsWAonmdarecwk in(tce)rsects 603 (252) Vinson Oscar (c) 660032AGEevoarngsiaL_-Cewarios lin(ca) OgHroElCmo intersects Inc oil marketers 608 Williams Sarah (c) 612 Banks Lonnie (c) 616 Banks Frank C (c) 620 Butts John (c) 604 Stanley Thos (c) 628 Bryant Wm (c) 634 Fowler Boise (c) 638 Johnson Lee (c) 640 Hightower Wm B (c) 642 Hall David A (c) 605 Parker Leila (e) 607 Gray's Chapel A M E Church (c) Clark intersects 609 (241) Reed Hattie (c) 701 B_ ryan JessiEedgLew(oco)d av intersects 702 Lovett Jack (c) 703 Stone John (c) 610&Wimberly Jas H Rev (c) 1661121 W(24a0ts)oWn igJagsins(cJ)ohn (c) 613 (239) Stalworth Mack (c) HAeaMstMtOoN6D53'SFoAuLrt--h From 652 Third av, HANSON (Spilth Macon) -- From 303 614 (411) Dean Richd (c) Blount west to Houston av, 3 south of Who Sells 700 701 ((629240))ACBuelrltisJuLliaawTM son)1*(c!) 703 Middlebrooks Jas (c) 704 (695) Riley Anna (c) 705 (227) Ford Grace (c) junction of Second and Fourth 21 ((335106)) JGaaclkrsyonHaLtotiueis (c()c) 3 (312) Thomas Mary (c) 5t ((331105)) WJenadkeinsLoJnonsieeph(icn)e (c) it? 706 (604) Barnes Kate (c) 707 (136) Billingslea Leonard (c) 708 (605) Collins Polly (c) n7n0n9 mStJrames H__oliness SCmhiuthrchint(ecr)sects 6 (313) Turner Manuel (c) 18 (3H1) WTheobmb asRaJyomhonnd(c)(c) 9 (302) Mitchell Chas (c) 10 (309) Dinkins Jas (c) Is Answered 710 (128) Freeman Ollie (c) 712 (127) Johnson Robt (c) 716 (131) Cornelius Allen (c) 8m 03 iFlarl,ey E_st,el,,l (cM) aynard intersects 804 (440) Reeves Wm S Rev (c) 1112 ((330070)) (TFhryom(WasaltOertha(c)(c) 14 (305) Ross Edna (c) 16 (301)AHubbard Robt A (c) ,,31,,7,, Jordan Robt ESimmons intersects By the 324 Molton Hiram N HALL (SM) -- From Reid south bet 326 Brown Donald P Classified Elbert and Waterville rd 2202 LBeooonnaerdBeRautrbicye (c(c)) 3^2M8 cWCaoitHesouJghWmLucy Mrs 330 Heath Danl M Business Lists In this Directory L HAliMmiMtsO, N4Dea--st oFfroSmeconTdupelo south to 303 Vacant 315 Turner Luke (c) 317 Jackson Bessie (c) 318 Oliver Addie (c) 319 Corbin Nellie (c) 320 Matthews Chas (c) 321 Kizzie Alma (c) 322 Wright Edw (c) 323 Hammond Geo (c) 325 Powell Roy (c) 326 Conner Wim (c) 3320-McBride Bemon G 337-OAvera Emmett C 347*Beekum Geo C 356 Hudson Wm R 410 Cape Geo D Bacon intersect 412 Self Stonewall J HARDEMAN AV -- Continuation of Georgia av, 1 east of Forsyth 110013 AGnladdremwasn CChlaasren(cce) r(ce)strclo clnr 105 Causey Jesse A confr 107AMoore & Boone gros 465 The World's Largest Store Shop at Sears SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. and Save HARDEMAN AV--Contd '110078%-l'OBAoLoenaeptrHotenDrryy CClng Co dry clnrs 111 Vacant 112 Vacant 1lm15VKinareevsihlleSaFmisih gCenol mdse Bray Perry M gro 119ARogers Stores gros 120AFairyland Dairy ice cream mirs 123*Vineville Packing Co meats 124AColeman's Pharmacy Coleman Young R phys 103 Butler Wm (c) 104 Pitts Jubie (c) H05 Boone King (c) 109 Morris Wm (c) 111 Johnson Cecil (c) 123 Vacant 206 McCrary Jas (c) 222983 MShainrtein BRenojsa (c()c) 297 Johnson Chas (c) !5Q7 McNiel Nina (c) 509 (McCrary Leila (c) 549 Haywood Ethel (c) n 128 Atkins Leah M MMrisddle i.ntersects 203AWWilasrorne'ns Hgruobsert E meats HARRIS (UnionviUe) -- From First av east to Fifth av, 1 north of Taylor 105 (355) Rose Jos (c) w re2a0r5*NMixcAonfeeDOanslca(rc)H blgkrsomith 209AGarrett Geo C HARRIS AL--From Third west to Secon1 dC, ableathwaenenHPairnreis an(cd) Oak 212AStri*pling Wm J Virg.in i.nt.ersects 217AWesley Mildred Mrs 2 Thomas Arth (c) 3 Henderson Ray (c) 4 Mapp Susie (c) AHobbs Henry J 236AHouser Walter F 238ASparks Daisy H 5 Collins Mamie (c) 6 Vacant 7 Round Frank (c) 240AHackett Wm W 8 Norwood Ethel (c) 243 Gregory Minis H Dessau pi b. egi.nsc 245AHunnicutt Mary Mrs 9 Lowe Annie L (c) 10 Leonard Geo (c) 11 Perry Albert (c) 247 MacMillan Donald M 12 Johnson Anna (c) 249 Fitzpatrick Jas P 14 Barrow Ben (c) 250 Bethune Roy 15 Patterson Tillman (c) 225545AGMibasssoeny OAblmedaiahA CMrs 16 White Eddie (c) 17 Mitchell Lucius (c) 257lAAHpaarrdtimsoenntsDudley H 2ACamp Erwin L 3darke Jas R 4AWright Maimie C Mrs 19 Simmons Robt (c) 42 Mathews Toisic (c) 6936 VDaucbaenrrty Ophelia (c) 94 Haynes Alf (c) S2tr6e8eAtGcaomnbtirneulledHarriet D M,,rs _ 269AEubanks Mary W Mrs 227701-VABacutatns t David M ir contr 95 May Charity (c) 96 Bristol Lilly B (c) 224402 JRoahynsLon CAn(Cn)a (c> 252 Jones Thos (c) DIRECTORY C'Butts Evelyn Mrs Craft .beg.ins HARRIS LA -- From Turpin north to LIBRARIES SOOATurner T Radford Southern R R, between Hams and 301ABCalkarekr IErmmma eMtt HMrs 311APendleton Sallie P Mrs Division 1108 Robinson Arth (c) 109 Sampson Emma (c) We Have on File in Our 331169&ALHaantecheHr atMtieargMt PMrMs rs 322AWimberly Brown 110 Clarington J C (c) 311 George Wm (c) 312 Vacant DIRECTORY library Robson Mary IW Mrs 339AJones Geo S Pursl,ey i.nt.ersect,s 340AHardeman Lula 341 BWuirlsgohnardMaMry FMrances Mrs 342AAndrew Emma Mrs 346*Mitchell Marion H AShaw M Edw contr 335546AVAadcaamnst Horace D_ 335680APjioghgnlysonWiPghgalyrmgarcoys 32AGu1I Refg Co fill stFaors*yth* en*ds 314 Homes Parrie (c) 316 Vacant 317 Daniels Sarah (c) 350 Tinsley Anna (c) HARRIS ROW -- From Turpin east to Sou Ry . ,. 1 Smith Enoch (c) 2 Vacant 3 Vacant 4 Vacant 5 Singleton Sami (,c)s 6 Howard Adam (c) 7 Adams Lee (c) 8 Bludgin Jas (c) 9 White Geo (c) Copies of the Directories of practically Every City in the UNITED STATES and Canada These are for your convenience if you want information you Vineville av begins 502 Sweetie Julie (c) 504 Burgay Leroy (c) are unable to procure elsewhere HARIRIS (formerly Massee la)i -- From Turpin south, 1 west of Sou Ry HARROLD (SM)--From 242 Jeff Davis call on us 1 Jordan Edw (c) 2 Sapp Florence (c) 3 Vacant 4 Vacant , , , 12 Porter Mozella (c) 41 Finney Sara (c) 43 Brown Kate (c) 98 Babb Chas H 100 Prescott Thos E 110046AMCehracmerbliCsslarOensccaer ML contr 107 Stevens Orion Mrs 109 Jones T Frank R. L. POLK & CO. DETROIT 43 Poole Wm (c) 46 Walker Benj (c) 46 (2) Lamar Neal (c) 47 Clark Jas (c) 48 Kendrich Oscar (c) HARTLEY AV (CP)--From 1919 Vine- ville av north to Ridge av, 1 west ot Park av _ . 103ALatimer Eula FRiMdgres av i_ntersects 100 Cason Mose (c) 100 (2) Penny Andrew (c) 101 Carline Henry (c) 203 Baston Wm M 205 Vacant 466 E2>-nc cUaai K ojm j DZ 85 K O 2 tn3o5. A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 HARTLEY AV (Lynmore) -- From 4041 Houston av west, 1 south of Lee 102 Arnold 'John H jr 104 Hartley H Guy 706 Andrews Gertrude (c) 708 Marshall Thos (c) 710 Hutchins Nettie (c) "IS Corbin Matthew (c) HARVIE--East from Burton, 1 south of Log Cabin blvd 714 Green Arrie (c) 716 Hardrick Sophie (c) 718 Milner Isaiah (c) HATFIELD AL (SM) -- From Chappell east to Elbert, between Stratton and Reid 187 Mallory Jas (c) 189 Fountain Geo (c) 720 Newsome Edw (c) 720 Reddick Frank (c) 723; Wilkes Chas W 725 (Woodard Malvin 726hTyler Martin F restr 731 Mullis Hollis HAWKINS (EM)--From 248 Main north 733 Singleton John 739 Nolan Frank HACWofKGINaSTrAacVk--s, F1roemast RofoyBeartnloetrtth to 741 Shepherd Maggie 749 Bailey Sami A 102 (1-2) Lester Daisy (c) 751 Vacant 103 (211) Holmes IWm (c) 759 Sharpe Harrison 104 (3-4) Josey Wm (c) 761 Ross Ralph 106 (5-6) Lawson Jessie (c) 1107 (219) Harris Mandy (e) 108 (7-8) Collier Lawrence (c) 765 Mote Joda B 777637 MVaocteantRoy L 109 (217) Jackson Chas (c) 775 Smith Thos S 110 (301) Dawson John H (c) 111 (221) Woodford Dodie (c) 112 Fuller Wm (c) 200AHawkins Miles (c) 201 Kendricks Valera (c) 2012 Smith Frank (c) 204 (304) Smith AT (c) 205 (315) Allen Wm (c) 206 (320) Dennis Emma (c) 207 (319) Thomas Lucy (c) 209 (325) Cooper Wm C (c) 211 (329) Middlebrooks Edgar (c) 212 (115) Middlebrooks Sylvester (c) 213 (335) Evans Chas (c) 215 (339) Kelsey Bertha (c) 216 (297) Jones Ida (c) HAZEL--From Division west to Ross, 12 s84ouTthuronferrsivTeremple C M E Church (c) 86 Searcy Henry (c) 89 (109) Samuel Wm (c) 90 Morrell Edmond (c) 91 (107) Lewis Fanny (c) 92 (85) Oilfield Primitive Baptist 93 (16C)huJro-nches (cW) m (c) 94 (100) Colson Lucius (c) 95 (17) Carter Clauide (c) 96 (103) Hall Cicero (c) 97 (18) Tolliver Eug (c) 98 (106) Tolliver Ernest (c) (217 (296) Oartledge Gus C (c) 219 Foster Nellie (c) 1i n0o2-h0t-Joyner ,,W,,m gro Gilmer intersects 104 Ponder Amos jr (c) HAWTHORNE -- From Elbert west to ojufnOctgiolenthoofrpTeelfair and Hazel, 1 south 105 Lockett Milton: (c) 110 Byrd Alex (c) 112 Walker Jones (c) 349 Bunkley R,,o,bt, (c) Fifth intersects 115 Thomas Herbert (c) 135 (141) Wilcox Annie (c) 349% Simmons Mary (c) 137 McCrary Jas (c) 366 (365) Taylor Thos (c) 139 Walker Maxie (c) Broadway intersects 141 (135) Adams Sami (c) 412 Smith Leola (c) 413 Reeves Robt (c) 418 Carswell Henrietta (c) 420 Dudley Lilia (c) rear Vacant 453 Brown Jacob (c) 454 Harris Anna (c) 458 Warren Maudie M (c) 466&Norris David Rev (c) Third intersects 505 Woodall Wm (c) 506 Fulton Baptist Church (c) 507 Ford Bessie M Mrs 509 Harper Louis 511 CHaardwaewllayJeRffichd D Wyatt Festus 515 Rozier Chas F 520 Duncan Ester (c) 522 Smith Jas (c) 524 Taylor Theo (c) 528 Jackson Katie (c) 563 Crawford Carrie Mrs 569 Oxley Mattie Mrs 610 Traw. i,ck Wm L Sjercosnhdoeintreerpsercts 612 Brown Roscoe 616 Vacant 622 Christian Robt C 654 Sylvester Jack V 658 Jordan Ada Mrs 662 Vacant 668 Cater Buford (c) 671 Bibb iMfg Co No 2 Bibb Mfg Co crown plant _ 704 DuF mas Ci hesr ter s M gt ro intersects 159 (163) Smith PMluimltmoners(ca) l intersects 161 (162) Varner John (c) 163 (161) Smith Peter (c) 164 Macedonia Baptist Church (c) 165 Spivey Mary (c) 166 Smith Laura (c) 168 Parker Jesse (c) 170 Zanders Lester (c) 171 Morris Mary (c) 173 Ross Wm (c) 175 Frazier Wm (c) 176 Johnson Willie (c) restr 201 Rentz Edgar (Hc)ammond intersects 203 Freeman Jas (c) 205 Burnett Sadie (c) 208 Bailey Hezekial (c) 209 Copeland Robt 211 Ford John 219 Dell Otha 220 Brown Marshall (c) 221 Jones Jettie (c) CofGaRy* c*ros*ses GS&FR*y c*ros*ses 301 V,, acant Elbert intersects 311 James Mary (c) 313 Wilson Georgia (c) 314 Stroud Mark (c) 319 Lamar (Jack (c) 320 Dillard Bobbie (c) 354 Stovall Enlis (c) 357 Simpson Chas (c) 359 Hood Cleveland (c) 360*Pinkston Gordon (c) 467 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not incorporated BANKING IN ALL ITS BRANCHES 563 WE WRITE MULBERRY ST. INSURAMNACCONE, OGAF. ALL KINDS PHONE 1586 HAZEL--Contd 361 Barnes Aug (c) 363 Jones Ida (c) 364 Walker Robt (c) 369 Williams Sami B(rco)adway i.ntersects 414AAkins Jas (c) 416 Gray Randall, (c) 417 Hunt John (c) 418 Hicks Louise '(c) 419 Curry Alice (c) 442201*SHtaurnktser LMizzairey ((cc)) 452 Jones Albert (c) 453 Renfroe Sula Cc) 455 White Julia (cO 457 Turk Dexter (c) 458 Robinson Henry (c) 460 Jackson Susie (c) 462 Davi's Benj (c) 464 Vacant Thi.rd i.nt.ersects 503 Walker Dock (c) 511 Vacant 513 Jones Benj (c) 520 Caslin Bertha (e) 523 Spraulding Josephine (c) 552478ATMhocrCnatrothnySGmoarlldeoyn (c(c)) soft drinks Ellis Hattie (c) drsmkr 550 Pickett Annie (c) 552 Roundfield Lucy (C) 554 Johnson Obie (c) Second intersects 609 Dawkins Sami (c) 611 Sutton Julia (c) 615 Harbour Wm (c) 618 Carvest Edgar C (c) 619 Woodard Beulah (c) 620 Jordan Chas (c) gro 651 Thomas Carrie (c) 652 Hazel Street School (c) 655 Bell Obid (c) 657 Bell Obie lc) 659 Riley Arth (c) 661 Braswell S T (c) 667 Mitchell Wm (c) 670 Vacant First intersects 702 Parker Zebdee (c) 704 Chance John (c) 706 Hamilton Prank (c) 708 Carter Henry (c) 710 Vacant 712 Brown Wm (c) 714 Howard Geo (c) 716 Vacant 718 Vacant 720 Allen Milly (c) 724 Baker Sally (c) 726 Smith Lula (c) 728 Grant Jos (c) 730 Scott Nathan (c) 732 Jinks Janie (c) 734 Crawford Henry (c) 770 Shinlholster Jas (c) 772*W'ilson Grocery Co Telfair begins 802ATompkins Ida (c) 806 Jackson Joshua R restr 808 Wesley Arth 821 Padgett Benj P 823 Atkins Lise 825 Padgett Zonie 827 Black R Odell 833 Hutchison John H 835 Vacant 837 Lloyd Alva 839 Pruett Geo E 841 Smith Dock 843 Simpson Arth 845 Simpson Jos A 847 Parks Wm A 848 Vacant 849 Pollard Odus P 851 Harden Oscar 852 Allen Jas W gro 853 Vacant 854 Smith Louis (c) 855 Arnett Louis 856 Curtis Albert (c) 853 Pentecostal Holiness Church 860 Purvis Ernest 862 Satterwhite Wm P gro 866 Jones Everett 868bJones Everett gro 870 Vacant 872 Jones Kenneth E beer 872% Lloyd John (c)Jackson intersects 902 Harris Grocery 904 Ross Jerolene (c) 910 Sawyer Wm (c) 914 Holmes John (c) 919 Thomas Geo (c) 920Griggs Maurice (c) 921 Jones Daisy (c) 923 Whitehead Annie Cc) 953 Collins Robt (c) 954 Alexander Amos A (c) 955 Jones Lucy (c) Madison Irene (c) nurse 957 Dudley Maggie (c) 959 Vacant 960 Hawkins Wiley Cc) 961 Adams Thos Cc) 962 Gates Robt 7c) 965 Tarver Port (c) 970 Cook Madora (c) 971 Wimberly Lonnie (c) 972 Vacant 973ASimmons GroceCryalhCooun intersects 1004 Toland Eug W 1005 Kines Lester T 1007 Lyles Stewart 1010 Crawford Reid 1012 Maddox Danl 1013 Jones Wm H 1014 Preston Henry C 1015 Berry Henry P 1016 Couch Nellie Mrs 1017 McCrary Willard L 1019 Tucker Lizzie Mrs 1020 Hicks Cleveland 1021 Darity Freeman A 1022 Reynolds Andrew 1052 Slappv Josh (c) 1053 Maddox Ovid 1056 Davis Estelle (c) 1058 Jones John B (c) 1059 Abel Sidney W 1060 Preston Robt (c) 1064 Allen Nora (c) 1065 Iyey Walter C 1066 McLaughlin Johnnie R (c) 1069 Dixon Osborne P 1070 Billingslee Harry 7cR) oss intersects HAZELHURST--West from 209 Clisby pi, 2 south of Vineville av HEARD (South Macon) -- From 3145 Houston av east to Gantt City rd 101 Smith Wm O 102AGassett Wm O 103 (114) Josey Andrew D 105 Culverhouse B W 106 Malone C Reynolds 107 Wynne Henry M Scott Eula J 108 Sherwood Cason 109 Johnston Jas O Higginson John W 110 Partain Dlennis H 112 (104) Jones R Clements 113AWheeler Egbert S Short intersects 121 Pace Wm D 123 Griffin; BernFiclaemCingo dr intersects 200 (201) Vacant 202 (200) Goodwin Thos J 204 (202) Dixon Jas J 207 Garlington Cecil G 208AByington Oscar F Snow's Laundry and Dry Gleaning Go, Licensed "Sanitone" Gleaner Phone 6000 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 468 AUTHORIZED DEALER A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 HEARD (SM)--Contd 209 Pace Glenn B 211 Bryan J Scott 869-OWoodard Doc W 890-OCuamingham L Ernest 213 Beacham Wm C HENDERSON (Bellevue) --From Indus- 215 Mitchell John P trial Home rd south, 3 west of Ameri - Kimble Edw L can blvd 255 (139) Andrews Chas W Bethel Primitive Baptist Ch (c) 257 Burnes J Chas Brooks Pearl (c) HELEN--North from Montpelier av, 2 Cramer Danl (c) west of Buena Vista dr HENDERSON (South Macon) -- From 1 Vacant Daley's Ditch south to Nelson, 4 west 2 Collins Jas of Waterville rd 116 (800) Harris Wm (c) HEMLOCK (Formerly Oak)--West from Third to Spring, 1 south of Pine 504 Butler Tommie Mrs fum rms 512 Knight Ethel 515 Dean Woodrow W 516 Knight Geo V 552-OBrooks Arth J 553 Wright Wm M 555 Howard Paul A 558 Morris E Helen Mrs 559 Raleigh Leola Mrs 560*Riley Anna L Mrs 563 Moye General W 118 Vacant 120 (706) DavHiesndTeorbseon'(sc)row intersects 200 (701) Edwards HCenorlyqui(tct)intersects 201 (704)AHolmes Fannie (c) 203 (703) Ringwood Jas (c) 204 (705) Harris John (c) 301 (11) Moore EmmaCh(acr)les intersects 400 (307) Hoyt Edw WCRriesvp i(nct)ersects 401 (708) Jones Mazie (c) 616bArnold Carl B Second intersects 618APope Jas M 403 Cleveland Dennis (c) 405 Driskell Allen (c) 407 (210) Williams Pratt (c) Parker Wm M 620-bHamilton Albert R 652 Vacant HENDERSON'S HILL (South Macon) -- 653-bPoulos Geo 655-bSchneider Josephine Mrs 659 Daniel Wm L Tribble Berner 660 Hoge Gertrude Mrs 663 Brantley Wm I 666667-672-bHogg Robt H HENDERSON'S ROW (South Macon) -- East from Daley's Ditch to Henderson, 1 north of Colquitt 301 (306) Glover John (c) 303 Dennis Frank (c) 305 Hines Eula (c) 0 C 333010197 TLBhoroocokmkepsttsoJSensasrZiaeahck(c(c))(c) '-IBsarofwNn aHjeebElmTo 87877777777777777770077766666565255110641211492890712378---8%---0O-O-BO00OO&SC*OSJ`CR1GHFFGM-'MRCoMJMeSHaMaoMJhSarrooaiasnhaarmfeioilananbmcomosanecefnlheaenmemyiedCesNmdomnddnspodmsmosyilreiratasmbtlnnpeanoeireAhbonaolBCsnnKsiagynJaMbinendcldrseJoJnslelakyERsaFeooJMahrtMBAnHMrrRthiouhWreLnHaJheRnEyeeunrnraaeoooaeelrtmrCbarnnwvhBDehTrtlFsyAleLehrriiWsoHttneMhniytnnetarlsaMoMlMEryEoMrJsLLsCGMnMMrrWrCssMsrrFNFssreisrwstininteterrsseecctO 0 sts HH1113111333322221111E10000t000000E000109oB76o855136247N315975510N5n555--e------*SD0bdC**0b(((((B(MeDGbbbH2A223--22-MCDDcHWTWRHWL2a223La2)reohllauaeoe7828r6veoeIaiEmianvincvllreX))))H)lx)rgrlltatlYrikwr--iniokkwiihadosvduianMeWVHTwieenssiAmeesnrdggoFdJaia(JoalsagwelsLnNlyaCCeorWfncClrbeEotrc--aashBalloslWCmRPkidiyhnOanLntfnnCWeFwehauatFfiostomnteorrlRuiaShHdolrCmltosjrrasaleatanHoJdmRinNnHsmCAeTf(CWdaofkEMactEdit2Bsbp)OHte3)iMtiMl9eeoi(rn(mcM(CFec)Caeo)1orvsrla(lmC(Ccevci)gnoe)hsetruioellsydnruisnsoteShsrcejttchtsWe-TmhosJ 808*McDonald Gordon L 810-OSteed Jos N 811 OPHatatrerirssoonn Fred John B jr 8140Ford Mamie L Mrs 815--OOWDoehanks CHarulgh S 818 Broy Seneca M Holland Ora E Mrs Strickland Walter P 820 Peacock J Abr 821-OSteppe Rebecca H Mrs 851-OThompson Jos A 853-OHarris Marvin P 854 Bizzell Henry D 855 Kunad Geo W 886610ORHaatmhemeErlslaChEesMterrs B HENRIETTA (South Macon)--From 603 Telfair west to Division 103 C251) Cody Mary (c) 106 (250) Vacant 202 (210) Vacant Tindall av intersects 205 (212) Hill Thos (c) 208 (211) Fountain Jos F (c) Campbell av intersects 302 (315) Moats Leana (c) 400 (567) Teal WNumssb(acu)m av intersects 402 (565) Cephujs Benj (c) 404 (563) Wright Mary (c) 405 (532) Ramsey Prince (c) 406 (561) Bloom Ira (c) 407 (534) Roberts Glenn (c) 408 '(559) Scarvey Robt (c) 469 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 HENRIETTA (SM)--Contd 409 (536) Taylor Henry F Rev (c) 410 (557) Reid Leah (c) 411 (554) Tinsley John D (c) 413 (543) Stephens Marion) (c) 414 (555) Sanders Fred (c) 415 (542) Walker Annie (c) 416 (553) Stokes Florence (c) 417 (541) Riddley Lula M (c) 418 (556) Stubbs Ira (c) 419 (540) Fry Nottingham (c) 420 (537) Stubb John (c) 422 (538) King Washington (c) 424 (539) Lane John H (c) 426 (513) Hudson Chas E(cl)kton pi ends 501 Church of Christ (c) 502 (601) Williams Mabel (c) 504 (603) Hicks Jas (c) 508 (605) Tharpe Horace (c) HENRY (Lynmore) -- East from 3044 Houston av to Gantt City rd, 1 north of Heard av 170 Morrison Memorial M E Church 195 (207) Haralson Jas V 198dHeard Jacob F Short intersects 202 Fuller Wm M 204 Embry John H 205 (185) Henry Thos B 206 Moore Sami E 207 K195) RachelsFlapmieimngmoiedrMinrstersects 208ABelote Jas H 209*DeFore Wilson E 210ACollins Clarence G 211 Lindsey P C 212 Meek Annie Mrs 213 Leverett Walter B HENRY (South Macon)--East from 22 Hall. 2 south of Reid 1_(22) Ross Leila (c) 2 (22) Wilson Lillie (c) 6 (21) Carter Eliz (c) 8 (11) Blash Veal (cE) lbert intersects 100 (5) Winn Julia (c) 101 (209) Salem Baptist Church (c) 103 (207) Solomon Mamie L (c) 104 (4) Flournoy Hannah (c) 108 (204) Gary Maggie (c) 108 (206) Royal Morris (c) 110 (208) Jones Geo (c) 112 (122)*Goodson Mollie HICKS AL -- From 600 Montpelier av south 101 103 Boston Perkins MCharatsha!(c)(c) 111 Perkins Roberta (c) 113 Thomas Affine (c) 114 Quaintance Geo (c) 115 Douglas Wm (c) 116 Williams Mabel (c) 117 Lawrence Mamie L (c) 118 ILoman Garfield (c) 119 Taylor Cherry (c) HIGH--From New southwest and west to Orange, 1 south of Washington av 120*Sheridan John V 121ABoone Jos P Rev 126&Hoge Julia 127 Hurley Madge Orr Sami L jr ABennett Ollie 130*Hammett John R ANurses' Official Register APhysicians' Register 131AMcDonald Mason B ABaxley John R 132AAdams Chas S AThompson Richd G 140ADavis Florine B Mrs Plum ends 141APalmer Sami B Dr 142 Vacant 144 Lane Anna B Mrs 147AChapman Lewis P AFavors John G Wilson Estelle R Mrs rear Sherman Benj (c) 152AMobley Annie Mrs 158 Hines Maud E 162 Rivers Mark E Kight Little J 164AWade Audrey 168ARRaannkkiinn JCelsasreenAce M Buford Clyde 172ACason Claude S Spring intersects 201 StJoseph School 202ADamour Laura S lMrs 203AStapler Irene Mrs rear Lathrem Jas (c) 206ACain Carl G 212AWeaver John N 213AWalker B Sanders 218AKingman Robt H 219AHarmon Jas A Rev re2a20rAEWvailnlisamCshaEslla(c)M 225APrice Mary L Mrs 226AWilliams J Harper 231AHall J Ellsworth Hall John I Dr 232 Marshall Apts Apartments: lAElkins Paul T 2ABaker Azro C Rev 3AOrme Richd P 4AEdwards John C Street continued 234AWorsham Addison T ATownsend Carter E 235ABireh Leila 236ADevlin Andrew F 247ADMevolrignanSaOrlainh Nnurse Kite' Albert 257ATaylor Annie B Mrs Vinson T Oscar 261 Vacant 263 First Christian Church Sunday School 265 First Christian Church HIGHLAND AV -- From 910 Orange southwest to Oglethorpe 120AStrickland Sol P 123AWilson Louis B 124AWalden Chas G 126AYeomans Chas L 127 Speir Louis E 128ACheatham Sydney 129AMyers Minnie B Mrs 113320AJoBnraekse RJoasbt LC 134 Nickles Henry H 135AGreene Mamie I Mrs 136 Shadburn John D 139ABanks Geo T 140AGregory Guy T AStevens W Hardy 141 Vacant 150AReeves John B HILGoHgLCAaNbiDn AdrVso(Luothg, C1awbienstHotfs)T--hFomroams 100 Blount Lennie Mrs l1O02lAVGarcuabnbts Jas B 103 Vacant 104 Dame Sami J 106Affitson Wm R 108 Harris Chas O 114 Bartlett John W 118 Sapp Hiram H 120 (55)ARitchie Milton L 121 Harrell Eason H 203 Connell Ernest S HIGHLAND AV (North Highland) -- From 901 Boulevard north lOOATyner Wm E YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Life Of Your CITY 470 o V o z 2 ,, d QQ <3 CO z a o V MORE GOODS --ARE-- BOUGHT --AND-- SOLD THROUGH THE Classified Business Directory than by Any Other Medium on Earth fj| YATES MOTOR CO. DeSoto 707 THIRD ST. HIGHLAND AV (North Highland) -- Contd 101 Whitt Fred H 102 Stevenson Theo 110 Vacant HIGHTOWER (South Macon) -- From 2835 Houston rd west 100 (101) Shepherd Chas 198 Etheridge Edw C 2,,0,,2,, Etheredge J Oscar Pryor intersects 204 Barker Bettie Mrs 208 Dyer Ernest 300 (301) Walker Wm H 302 (303)ASherling Emmett L 304 Vacant 311-GSherling Jas E HInLuLt,--5 Fwreosmt oOf cSmecuolngdee south to Wal110 Carswell John (c) 118 Swain Wm (c) 120 Dinkins Maude (c) 122 Williams Sarah 3 (c) 145 Stinson Edw (c) 147 Simmons Sarah (c) 149 White Geo (c) 151 Warren Otis (c) 152 Bailey Rebecca (c) 153 Scott >Jas E (c) 154 Scott Rosa (c) 155 Taylor Jos (c) 156 Broughton Irene (c) 157 Rouse Henry (c) 158 Scott Robt (c) 159 Cummings Chas (c) HILL (Log Cabin Hts)--From 619 Log Cabin blvd, 1 east of Edna pi lOOAScruggs Horace V lOlAHornbuekle Aymer P HILL AL--From Hill to Orange, 1 north of Walnut 252 Vaughn John (c) 258 Johnson Inez (c). HILL CREST AV (CH)--From Pio None av west, 3 south of CofGaRy 1lO02lhAHGaollldgCarhaBs eHnj M 103*Bynum Joel C 104AKnight Lester H 1, 05*ARMeaicckheJret anOnpehtetleiaMArs Mrs 110067O-aScciahrokfieAldugCuasrtul sHH 1ll0K9'A-HDeennricykeHoCrlaacreence' H 120AMuecke Henry G Courtland av intersects 200 Williams Harry G 201ARichardson Fredk H n2n0^4AA5Cical,^dawre1lfl 0^C,l.iffoarrdy H H mus tchr 205ACox Edw L 206*Arden Morgan R 2084'Greene Ira D 212 (220) AMaddox S Fleetwood ACribb Llewellyn S Mrs 214 (290) AHarrold Edw B 255AMarshall Hyman 265AWalton Walter F 275AMoWaters Chas L jr 300 302 ((330140))AAKBraarfrtetthES liz V H M"rs 303ABloch Chas J 304 (316)ADowell Kane' M Mrs 305AGoldman Benj 306 (320)Astanton Dellie M Mrs 307 VHaalceanRt oy 308 Vacant 310 (328)ANapier Viola R Mrs 314 (334)AKaplan Micihl M 320 (368)AMiller Cecil R jr ARobertson Minnie PHONES ! 11444456 Plymouth 332297Ai(D37ra7k)eAPAairncehi"eGuAy E 331 (393)AReid H Merton 333 (395)AColeman Cornelia 400AWilson D LeConrescent av intersects 401AWilliams Roy G 403AHaVe's Chas G 404AWilliams Paul H 405ACausey Tillie Mrs 407ACranford Lois 409ABoone J Buford 410ADavis Wm V 411ABollinger Robt A 5s1i6r t(A48Q8o)\ SwtevensInRveorsnceoses a(cv) intersects 524 (497) Howard Georgia (c) 528 (498) Mason Aug (c) Bartlett's la inte*rse*cts Ernest intersects HILL CREST RD--Continuation of Hill Crest av 103 Turner Allison F 115ATrawick Benton J HILL PARK AV--From 364 Spring west to Bond, 4 south of river 1 Whittle School 7ABush Thos J 9 Smallwood Lula Mrs 11 Vacant 2177AAMpaiulllerBLenajwrCence M HILLIARD (EM) (EM)- -Continuation of Hill HTWrdRD AL~From 819 Fourth to 842 Mio7l ARimchosardLsiozznie Ja(cs) (c) gig McCullough Clara (0) 218 Fraley Mollie' (c) 220 Johnson Chas (c) H5^C0c7np-As^StEh?aarvpAtGtousMtwsiPoen)itMp--erlsi.eSrouth from Hill 2'Lumpkin Jas Q fl^Sioodwra-th Luther U 524AFoster Clhas W 525AMcLain Wm D 553376AAHc9illlquRitotbtFrAank W 548AGrady Lester W 549AOdom Julian R SSOABullard Evans E 561ACollier Carrie 572AAddison: Oliver L 573AMichael Moses A 557764ALHuibreshl BJoesnjM 585ANutting Leila Mrs 597AMinton Mack B Napier av intersects (HSADurham Egbert B 649ABarnes Moses 660AHolbrook Robt L 661ABaird J Elliott ADurham Elbert B 673AWalker D Albert 684AWilson Wm P 685AGilbert Thos 696i'Barton David W 697AJefferson Richd G Beech av intersects 771132A,ARCSlztoezwwealalrrttMJHoahraynrryMPrCs nurse 736AHillman Robt H lumber 748Aingle Robt B 749AMainor Jas T 760AWest Norman V 761AUaniel Jos W 772AHertwig Chas C 773AGray Wm E 784 Paulk Horace M 471 WILLINGHAM SASH & DOOR CO. Lime - Roofing -- Cement - Plaster 457 Third St. Phones 277-278-279 HILLYER AV (CP)--Contd 785*Jackson J Guy 779967**RFaarinreens TJorohyn MJ Date intersects HOGAN'S AL--From Pio Nono av west, I south of Cherokee av HOGE (Unionville) --From First av east to Third av, 1 south of Morgan *1 4 812*Walthall Wm W 813*Markert F Earle HOtoLMStESStaAniVsla(uVs)--CFolrloemgectioty CliomfGitsaRwyest 825*Moore Alva E 102 Carver Archie S 836*Shipp Percy G 837*Owen Logan E 848*Walton E Bruce 121 Smith Ola (c) 123 Price Lula (c) 125 (2) Feagin Willie (c) 849*Asbell Edw B 127 Crawley Benj (c) 88o6O1**MSkaiprsphearllJaWs SLeon 872*Brown Mary I Mrs Thackston Jas A 873*Souther Geo L 133 White David (c) 135 Grier Annie L (c) 201 Deveraux John tc) 203 Jones Wm (c) 205 Collins Jos (c) H 883854-*-WBliallcikswJeallcoWb mT G 896 -'Kennedy Roy CLherry av intersects 207 Lewis Mary (c) 211 Searcy Blanche (c) 213 Taylor Jas (c) 897*AShurst Paul L HOLT -- From Orange southwest to Maple, 4 west of First HInNoErtSh TtoERAn(oVla)--, 4Frwoemst9o3f4 RVoingeevrsillaevav 114*Collins Robt E 118 Vacant 106*Domingos Isaac L 109*Lane V McKibben 110 (!108)*Watson Vera V Mrs 114*Jelks Mary S Mrs 115 Burghard Louise E Mrs 116*Clay J Emory 120*Bowen Robt A jr 121*Spratling J Hook 124*Woolvin Robt B 127*Owens Jas D 128*Jones Baxter 131*Wages John T 132*McKay Albert 133*Reynolds Gladys M Mrs 119 Wood O P 121 Rachels Alva C Rachels lone nurse 122 Kimble John C 123 Stiles Jos E 124 Pace Florence Mrs 126*Elliott Mattie Mrs 127*Chapman Lester H 128 Riley Danl 132*Murphy Mary 138*Smith Vivian S 144*Joiner Florence 150*Poole Jos B 156 Vacant 113356*(W15h7i)t*eLMowielleFr raGncis J HOLT AV--(Changed to Holt la) 139*Slocumb W Clifford 114402*EPvaatntosn RMobatryET Mrs 143*Stejvart Wm E 144*Eovelace Ralph A 145*Burden Eug B Boulevard begins HORLyTtoAMVon(tNpealpieierravH, t1s)w--eFstroomf DCunocfGana av 51 Vinson Annie Mrs 52 McCorkle Emma Mrs 53 Anderson Robt L 54 Johnson Wiley M Mrs 201*Evans Rufus W 203 Howard Jos O 204 Bagwell Wm H 205 Fulghum J Walter 207*Barnes Dewey D 208*Cobb Wallis G 209*Long Wiley C 221114*-WTairlplilaemysJoEhdnw FT 215*McCord Chas R jr 216*Holliday Peter O 221198**SHaaunnddeTrshoDs OMijtrchell 55 Wainwright Ethel 56 Moore Thos 57 Cranford Isaac 58 Jones Raleigh 59 Martin Anthia Mrs 60 Evans Maude Mrs 61 Cannon Henry 62 Anderon Jas 100*Kinnett-Odom Co (br) coal yd 101 (50) Hale Irene R Mrs 103 (49) Glass Barney L 105 (48) Black Chester B 107 (47) Cowart June Mrs 220*McCord Chas R 221 Vacant 109 (46) Smith Walter EKinnett begins 222*Watts Wayland M 110 (5) Carpenter Minnie Mrs McDonald intersects 301*Wheeler Geraldine D Mrs 302*Neighbors Jos B 303*Pate John G *Key Tandy E 304*Moore Chas R 305*Lister Gilbert H 308*McEachern Lloyd F 308*Smith J LeConte 310*Hedgepath Jeanette Mrs 333*Chappell Isaac H 345*Williams Ruth Mrs 347*Andrews 348*Hughes [JCasheWsley B 349*Williams J Percy 350*Clark Gilliam 351*Hawkins Ralph W 353*Parker John B 405*Skinner John V 111 145) Monfee Andrew J 113 (44) Mayo Benj T 114 (7) Moore Chas W 115 (13) Collins Adolph D 117 (42) Dennis Bloomer R 118 ((9) Wilson Wm T 119 (41) Hanes Sami R 121 (40) Sexton Jas A 122 (13) Bethune Carrie Mrs 123 (39) Carmichael Sarah Mrs 124 (14) DeFore Florzell 125 (38) Mills John 126 (15) Collins Jas T 127 (37) Glass Wm 128 (16) Addleton Lee Mrs 129 (36) Whitehead W Jackson 131 (35) Glass Raymond C 133 (34) NoblDesanOnescnabrerg av intersects Ifbi;: I 4' 1 407*Miller C Ross 135 (34) Wainwright Raymond R 410*Davison Addie V Mrs 200 (56)*Goins Robt W gro 414*Roberts Cecil H 201 (32) Stevens Russell L jr 415*Turpin Wm C jr 202 (95) Allen P Frank barber 472 LOANS ARRANGED FINANCE SERVICE OF MACON on EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING Furniture Automobiles Endorsed Note TELEPHONE 366 Single Signature fcs4 EZj co 44) k css >> I!2^03LT(3ov 1) Cr* Xow 1 E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES ' and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 476 EDWIN S. DAVIS, District Agent Where To Buy? Consult the Classified Lists Directory JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 JOHNSON AV (HH)--From 127 Lawton av to Montpelier av, 1 west of Linden av 300*Sears Homer L 301-0-Walthall Edw L 3095Matthews Jas W 312&Wood Raburn M 3155Hancock John M 3135Bronson Dell B Mrs 3195Holmes Oliver W 3205Graham John W 221 Nelson John H (c) 226 Burdell Ulysses S (c) 222298 CMlielveselaLnudkeMi(nc)nie (c) 2305Pugh Amanda (c) 232 Finney Lillian (c) 233 Vacant 234 Smith Clifton W (c) 237 Lawson Viola Ic) 243 Charleston Equilia C (c) nurse 322-Q-Wade Chas B JONES AV (East Macon)--From Flet- 3235 Baldwin Chas L cher west to Main, 1 north of Hydrolia Coleman intersects 107 Wood Elmore 419*Kappa Sigma Fraternity 115 Allen Wm L 4205Ray Sami T 119 Ryle Jos J 421-O.Burnett Chester rear East Macon Cement Works 422 Castellow Meta W Mrs 120 Cordle John A i 423-b-Belmont Oscar B 424 Slocumb Hattie L Mrs 2105Schell Sidney PAeachtree intersects 425 Vacant 2195Giddens Isbon A 426 Holmes Anna T Mrs 2205Barfield Ernest A 426% Benton Henry P 429 George Durward F 2232015DMeaanttheSwamJiohAn A 4433315&-MKoitmchaennds HJoehnnry HG Knight John H jr 2405Wood Obie L Montpelier av intersects 5n&Melton Wm R 3025Martin Wm A Myrtle intersects 51185-McElmurray Jeffie C 304 Merritt Wm W 5195/Dugger Jas G 306 Brantley Lucile Mrs 520 Hewatt Clarence J 308 Beck Jasper N '5i21-5Rankin Issie West End av intersects 612 Parker Clhas L JONES PLACE (EM) ris east to Short From 227 Nor- 614 Vacant 615-'-Kirkpatrick Frank M 6165-Bishop Jas P 617 619 ''((6e1il3K)5'-RM0agnesrfsielCd arJlohDn JONES STREET LANE--From Orange west to Madison, bet Jones and Rose Hill Cemetery 101 (476) Vacant 103 (476) Vacant JOHNSON LANE--From Chappell east, between Whitehead and Ell 105 (474) Vacant 107 (473) Vacant 113 (161) Height Bennie (c) JOHNSON'S AL--From 520 Elm south 115 (151) Thomas Wm (c) to Edgewood av 118 (129) Vacant 100 Bolton Annie Mrs gro 120 (123) Fitzpatrick Pauline (c) 102 Williams Jesse J (c) 103 (558) Nottingham Jas (c) 104 (248) Lewis Arth (c) 105 (244) Vacant 106 (621) Francis John (c) H07 (1820) Bivins Josephine (c) 108 ( 501) Nealy Jbs (c) 109 McClennan Wm (c) 201 (213) Folds JanieCo(lcle)ge intersects 203 (131) Vacant 205 (128) Chandler Sol (c) 207 (129) /Vacant 209 (109) Vacant 211 (108) Vacant 213 (108) Vacant 110 Amos Jennie (c) 110 (452) Jones Mattie B (c) 111 (453) Roberts Channie 112 (1534) King Sami (c) 113 (451) Daniels Annie (c) 1114 (5(15) Gary Annie (c) 116 (521) Sallett Ivory (c) 118 (1540) Zeigler Danl (c) JORDAN (East Macon)--East from 125 Norris to Short, 1 south of Broad 101 (4) Vacant 104 (5) Ponder Alonzo (c) 105 (6) Bonner Visia (c) 108 (7) Curry Walter (c) 109 (8) Rice Eug (c) 113 (9) Smith Felix (c) JONES--From Orange west to limits, 1 117 (109) Vacant south of Rose Hill Cemetery 125 Holmes Edw (c) 1115Vissher Janie (c) 126 Whidby Thos (c) 1135Brown Janie (c) 115 Walker Jas E (c) 117 Green Patsy (c) 120 Washington Annie (c) 123 Easley Byrdell (c) 124 Howard David (c) 1126 Vacant 128 Thomas Carrie (c) 1295Smith (Robt L (c) 130 Smith Mattie (c) 132 Davis Hattie (c) 1133 Brown Jos (c) 139 Fagans Irene (c) 140 Lester Daisy (c) 143 Tabor Hugh L gro College intersects 207 Vacant 212 Fy-e Wm (c) JOtRoDGArNa'nSt ACLha(pSeMl )a--l FbreotmWSiellcioamnds waensdt Ellis 2181 White Isaac (c) 219 Pounds Georgia (c) 220 McCarty Clarence (c) 221 Coplan Essie (c) 222 Walker Brady (c) 223 Jordon Bacie (c) 224 Goodwin Sami (c) 225 Lewis Jas (c) 226 Riley Wise S (c) 228 James Annie (c) 230 Rushin Ella (c) 234 Hudson John H (c) 236 Jordan St Baptist Church 238 Stadium Eug (c) 213 Thomas Wm (c) 214 Foggy Ray (c) 2155-Goddard Candus (c) 218 Dean Geo (c) JOSEY AV--From 3205 Houston av west 1 blk of Myrtle (SM) 110 (3308)5Hammack Henry W dairy 220 Davis A Minzer (c) JUDGE (EM)--Changed to Jordan 477 5VGf MOTOR PARTS CORP. Complete Part* Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 KAHN'S AL--North from 511 Forsyth to Georgia av, 1 west of Monroe 100 (20) Rivers LeRoy (c) 101 (534) Trimble Elijah (c) 103 (19) Brown Etlhel (c) 105 (21) Vacant 107 (120) Thompson Mahalia (c) 109 (122) Gilbert Lula (c) 111 (239) Jones J O ](c) 112 (127) Vacant 113 (232) Watts Thos (c) 114 (123) Johnson Hanna (c) 116 (237) Vacant 118 (137) Jones Mattie (c) 120 (133) Dillard Lela (c) 122 (134) Bell Susie (c) KEMPER AV--From Richmond south to Fulton, 1 east of Mikado av 110020 SBtaekveernsEvLaewDis MMrs 105 Vacant 108 Wagner Wm M dairy 110 Hopper Chas P Grady i.ntersects 206 Harris Jas T 207 Lindsey John L 208 Russell Wm H 213 Hoover Kate Mrs fViMiddle Ga Lbr Co KENESAW AL--From 521 Fourth east to Third Brant Motors (side entrance) 132-0-Stephenson Edw L ( 138 Anderson Robt C 140 Justeen Doreen Rev 142 Garner Wm M 144 Raley Danl W 145 Assembly of God School ends 214 Bloodworth Minnie L 219 Wilburn Jos P 221 Cone Andrew J 222 Jackson Sylvester L 22)4 Walker W Ernest 225 Lockhart I Alice Mrs 228 Loveless Wm L LAKE (Adams Mill, Bellevue) -- From Brookdale av north, 1 east of Melrose 39 Seagraves Dewitt 40 Hammon Sami C 41 Toney Irvin J 42 Lee Jas O 4434 HGirlilmeJoss MOerritt C c4o5r BPiogrgulmy WJuilgigulsy CStojrres (br) Fairmont av begins 200 Simmons Phil (c) 305-07 Owens Walter (c) 320 Land Geo T 321 Copeland Judge W 323 Foster Troy T 476 Thomas Fannie (c) KENMORE PLACE -- North from 1607 1V03i/n-'eHvuilgleheasv,Jo1hnweHst of Carolina av lOo -Barnes Jas B LACKliEntoCnI,TY1 s(oEuMth) --of FMroaimn Flanders to 4 Branch Olin 5 (6) Graham Geo W 107*Stone Ernest P 6 (5) Johnson Chas KENNINGTON PLACE--Bet Main and Emerald, 1 north of Flanders 110 Giraden Geo W 112 Collins Sidney 7 Vacant 8 Allen Floride 9 (10) McGahee Lonnie J 10 (9) Griffin Rosa Mrs Deibose John H KEY (Unionville) -- From Dempsey av south, 1 north of Park 98 Edwards Berry (c) 100 Cliett Wm C (Sc)app av intersects 106 Burleigh Peter S (c) 109 Burleigh Robt (c) 115 Mt Lebanon Baptist Church (c) 119 Wilder Albert (c) 120 Denton Albert (c) 121 Wilder Wm (c) 175 Denson Ada (c) 11 Taylor Omer L 12 Vacant 13 (14) Gordon L V 14 (13) Byrd Wm E rear Boy Scouts of America Troop No 14 15 Dixon A Elmon 16 Garrett Lucy Mrs 17 (18) Byrd John M 1198 G(1r7a)hBamranDtleayvidRoLbt L 20 (21) Wood Lois 22 (21) Hood Robt A 23 Batchelor Chas M KINNETT (Vineville) -- East from 110 25 Sharpe Harrison S (5) Holt av 1 Scarborough Chias J 3 (2) Johnson Wm J 5 i(3) Vacant 7 (4) Blair Lester L LAMAR (V) -- North form 400 Vineville av, 1 west of Forest av HOlALeverette John A AKing J Franklin 102-0-Coleman Nathaniel P KITCHENS (Continuation of Short) -- From 1 east Norris Mitchell north to bey city limits 100 Hunt Buster (c) 110 Smith Enoch (c) 112 Neal Jesse (c) 116 Green Mark (c) 202 (100) Davis Chaney (c) 204 Whipples Leila (c) 206 Whipples Chas (c) 208 Williams Anna (c) 102% Vacant 103 Vacant 104AQuin Hugh W lOSABarker Barney B 106AJohnstone Walter T 107AWillis Geo A 108AKendrick Mary W Mrs 109-0-Burts Milton E llOACureton Chas H lllARees Albert W Rev 112AMaddox Edw L 112%AEdwards John E KNOTT (South Macon) -- From Jeff l!13ABaker Prank P Davis south to Ell 114 Bowles Sami P 120 Hollingsworth Prank D 121 Hambrick Paul C 123 Britt Jeremiah M 112256 SJennokwinsRoLyutGher A 127-'-Willis Gordon P 128 Johnson Bonnie D Mrs 129-0-Shepard Chas D 131 Newell Maude Mrs 111156*MZiimmsmeArmbnaenr ELarl 117 Irwin Jas D 118 Corbin Jas B 119AButler Gibson L 120AAndrews Wm H 122&Brooks John B 123 Jackson Jas O 124 Pritchett Claudius T We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 I Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 478 T. L. W 0 0 D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st TEL. 529 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere cali on us R. L. POLK & CO. DETROIT WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety 310-12 First National Bank Bldg. Tel. ( LAMONT AV (Log Cabin Hts) -- From Log Cabin blvd south, 1 west of Carlisle av 103ACargill Edw S 1104 Manor Roy C 138jAHadien Joel A Haden Thos W 139 Fulwood Hilliard W 141 Taylor W Harry 152 Brown Chas G 153-0-Askiew Milton D 164AThomas Luther M 165*Durham C Jos 413 Dean Wm H 414 Davis Daisy (c) 410 Grenon Alida Mrs 420 Champion Cora (c) 421 Glover Frazier O AVUllUUipil pi UCClilS 422 424 Waller Harris Lizzie Julia (c()c) 426 Hunnicutt Sarah (c) 428 Williams Susie (c) 432 Duncan Riley (c) 436 Stewart Lizzie (c) 442 Patterson John T LANG AV (Ingleside)--Changed to Os- Vine intersects borne pi LAWTON AV (Bellevue)--From Indus- LANIER PL--East side Log Cabin blvd bet Glynn av and Habersham trial Home rd south to Rockledge av, 4 west of American blvd 177 Austin Frank (c) LATTA PL--(See New) Austin Wm (c) Wesley Josie .(c) LAUREL AV (North Highlands)--From North west to Boulevard llCOBKhSTcahpopoannmJaak.ser EBurton H 105 Vacant 106hHuhn Henry R llOhShephard Madye R Mrs 112 Baggarly Alvah 116 Vacant :l21ABraneh Oetavus C 125ABankston Robt E Gordon Ella (c) 404 OLowweensNWimmrodL (c(c)) LAWTON LANE (V)--From 138 Second av to First av 118 Watkins David (c) 120 Lakeley Ida B (c) 1201% Shivers Anna (c) 134 Warren Cecil t(c) 135 Nesbitt Willie M (c) 126Hays Chas G 137&Prederick Dewitt T 1421'Malone Carrie Mrs LEAF (East Macon) -- South from 827 Main to Fletcher, 1 west of Short 143*Smith J F 145k'Lamb John R 149*Pickett Ohas 157AKelly Wm F 159 Joiner Bennett 168*Heard J Milton 169-SMiddlebrooks Leola B Mrs 170 Burney Louis P 177ATidwell Chas C 181hWilliams Ohas H 182'-Richter Geo L 185AMaple Orlie E lae'-Marshall Allen W i1l8887/-*lSBnaipthease Robt F Reuben W 193-'-'Barker Geo M 194AKeiser John M. 196AWaite Kath C 197 Holseinbeck Frank D 199AHall Wm R LEE (East Macon) -- From 258 Church west to Broad 105 Hair John 106 Kitdhens Jas E 107 Hudson Geo 111 Griffin Jas A 112*Collins Chas L 115 Lightfoot Henry 116AWooten Jas H 1117 Murner Amos 119 Ryles Geo 115564 BJoonweesn FJreewdkel N Center intersects 201 Cofer Harvey (c) 210 Glawson Geo (c) 21 Redging Bertha (c) 220 Whitby Finney (c) 224 Lamb Mollie (c) 226 (225) Stanford Wm H (c) LAWTON AV--From 341 Adams west 9910-*0H.CahresahthbaamrgerIolCalaMrenrsceH 9945-00P'SoaeunAdenrnsieWCaltMer rsD Linden av intersects 102 (lOl)AFoster Mary J Mrs 103 Pi Kappa Alpha Fraternity lOSADent Iola Mrs 1080'Armstrong Jas W 112 Jordan Rosa 115-OGilbert Irma LEE (South Macon) -- West from 4001 Houston rd, 1 north of Hartley 101-AArnold John H 104 Castelaw Elwin lOSAGibson Geo G 110 Gibson Oliver C 111 Griggs Jesse T 124AYoung Zack B 126 Adams Lev B 200*Hill Robt R 201 Dorman Earlie Wammock Sami A 117 Simpson Annie L 120-0'Brown Wm M 121AArmstrong Victor E 123AButler Thos J 1240Norwood Geo 125 Clark Henry DM1 126 Grayson Annie M Mrs 127 McCrary Felton D LENOX LANE--Frrom 103 Telfair south 1 Jbsey Lake (c) 3 Thomas Andrew (c) Brook Mary (c) 5 Vacant 7 Jones Cooper (c) 9 Chapman Jennie (c) 11 Carter Thos (c) Betty's Beauty Shop 129ABliss Oliver R 219 Vacant Johnson av intersects 221 Dohn Adolph 222-ALeonard Howard N 225AMiller Wm E 227AMoore Minnie Mrs Carling av i*nte*rse*cts Duncan av intersects LEwXeIsNt GtoTOlimNit(sEM) -- From 560 Broad 119 Warner Lee (c) 121 Lester Rosa L (c) Astor intersects 123 Pitts Ross (c) 210 (300) Wiley WmWo(ocl)folk intersects 219 Finney Chas (c) 228 Collier Chaney (c) Lexington la begins 479 PITTS' MORTUARY Phones 146-147 AMBULANCE SERVICE 814 Mulberry HOTEL LEXINGTON (EM)--Contd 319 (721) Vacant 320 (720) Jackson Clifford (c) 326ARoberson Wm '(c) 390 (102) Hutchins DaisHy al(lc)intersects 404 (104) Stanford Maggie (c) SOlhWilliams Henry (c) 506 (192) Washington Annie (c) LIBERTY (South Macon) -- From 1630 First west to Telfair 420-OBrinson Wesley (c) 421 Jackson McKinley (c) 422*Lewis Maggie (c) 426Sparks Jas (c) 427Allen Eva (c) 435 McCrary John (c) 440 George Amelia (c) midwife 444 Hamlin Jas (c) 464 Murray Lewis (c) LIBERTY (Unionville)--North from Anthony rd, 1 west of Rock av LINCOLN AV (SM)--From White west, 1 south of Long LINCOLN AV (V) -- From 117 Douglas av north to Sherman av, 1 west of Ward 137 Durham IRufus (c) 138 (208) Stuckey Willie (c) 145 Washington Booker T (c) 147 Stewart Richd C (c) 149 Thomas Plhoebe (c) 149 (2) Jones Philip (c) 150 Primus Isaac (c) 151 Boynton Lucy (c) 152 Miller Robt (c) 15'3AGrady Wm S (c) 154 Reaves Madie (c) 156 Frazier Mark F (c) 156 Jackson Dosh J (c) 157 Butts Wm (c) 159 James Henry (c) @ 160 Grady Robt B (c) 162AThomas Edgar (c) 173 Matthews Ernest (c) 173% Kelley Gertrude (c) 174 Nims Otis (c) 175 Gilmore Annie (c) 177 Truett Jos (c) 178 Felts Lucille (c) 180 Williams Roosevelt (c) 190 Robinson Henry (c) 191 West Reno (c) 195 Sparks Wm S (c) 200 Lavender Leonard L (c) 202 (198) Crowder Theo (c) 205 Johnson Edgar (c) 209 Phillips Joshua (c) 210 Thomas J Walter (c) 307 Benn Harry (c) LINDEN AV (Formerly Boundary av) -- From C of Ga Ry south, 3 east of Duncan av 104 Vacant 105 Vacant 106 Vacant 108 Vacant 109 Williams Chas (c) 110 Brown Ludie (c) 111 Washington Mary (c) 113 Tucker Aretha (c) 115 Mitchell Wm (Cc)hestnut intersects 201 Paris Cleo E gro 205 Vacant 211 Washington Margt (c) 217 Bell John (c) 219 Denerson Emmitt (c) 221 McGuire Minnie (c) 227 Taylor MinnDiean(nce)nberg av begins 301 Vacant 305&Moore EulaliaOglethorpe intersects 308'- Crawford Jas B . 312S!Etheridge J Olein Rembert av begins 316 Linden Apartments Apartments: (A) Thompson Chas E KB) Maxwell Bertram jr (C) Diamond Carl (D) Lucas Linda E Mrs Street continued 322&Schell Anna B Mrs 326 Middleton Edw L Lawton av intersects 514*Ruark Wm H 515AHollomon Clinton Martin Ralph L 519-0-Hertwig Herman 520 Wellons Colin E 523AHerrington John T 55(2267-QDFairttbsy JoHhanrryC H 534 Walton Hattie Mrs Coleman av intersects 601-03*Tatnall Square Drug Store 605i&Tatnall Square Dry Cleaning Co 607 Tatnall Square Barber Shop 609 Vacant 617-19*Macon Butter Co Montpelier av begins 625 Vacant 626-OMeadows John C LIVINGSTON AV--North from 550 Log Cabin blvd % block LODI (EM)--From Clinton east to Hydrolia, 1 south of Main LOG CABIN BLVD--From end of Napier av west to Bellevue Crescent intersects 120 Sewell Mack N 122 Huthnance Annie D Mrs 124 Newby Lytle R plmbr 126-O.Brown Carrie Mrs 307 (193) Mize Walton E 309 (197) Brooks Paul W Macon av intersects 442232/-BDauurmdegnarWtnemr Cihas O F 424ADozier Eug R Burton av intersects 510 Lawson Henry B 512 Aiken J C 5144'Tanner Wyander H 515516SISAWilson Sally B Mrs 522AToole Frank L 524hWillis Harry 525 Vacant 526*Willis Annie 527 Vacant 528ABishop Robt E 630*Sowell Leon V 532AGattis John P 534 Meeks Beulah L Mrs 536 Livingston Wm 538*Brown Pope M 542*Spiller Jas E 544 Reeves Herman M 554486/A-'KWimarersen Thos Albert N R 550AParkjer ThoLsivingston av intersects cor Stephens Pearl School Log Cabin way intersects eOU'Odom John A /603&Silvius Chas T @ 607 Knight Sami Lamont intersects 661009' AHSilhlroJposshirBe John T 611 Bell Clinton B 612AClark Hill E 6113 Nottage David A 614AAUen Joel C 615 (719)&Nolan Mark A 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar, and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York O S 480 WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 u c H (3 u s o U Hcn usj3Oo>adS wUN5 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT LOG CABIN BLVD--Contd 617 (1753)ASlappey Mary Mrs 619-AClar,k O,,verton P Hill intersects 662210AWHialdtcehrerEdRgoabrt BP 703 Vacant Edna pi intersects 705 (1797) Morris W H beer 707 (1799) Green Lewellyn D gro ,,801 (1801) Meeks ClifforTdhoMmasgrboegins 805 (1800) AOzburn Edw gro Log Cabin dr i*nte*rse*cts 322 (423) Aiken Ira P 442117 ((4412'28)) ATEuicsnkeerr FJorehdnkJaWmL es intersects rear Threatt Edgar (c) 431 (430) Cooper Onan G 432 Holloway Gustave J 439 Grier Geo G 442 Grover Sallie (c) 444 Vacant 450 Vacant 454 (509) Vacant 456 (455) Franks Miller (c) 446518 'J03o(5i1n7e) rWDooalv-ifdork(cL) ee (c) 9.0..a (.1..9.1.9.)A,XNT om.sRoCbhinassonBrd intersects 907 Wright Geo S heating contr 909 (1923) Goodrich Predk W 910 D_ aniel BlufHoridll CNrest rd intersects 912 Bozeman QhaHs abLersham intersects 914 (917)AOdom Norman H 919 (1985) Brentley Jas A 921 (1989)AGiles John B 923 (1991) Goggans Nonie B 925 (1993)AOzburn Harwell C 1015 Mc,,Dani.el Wm DPebgProark intersects Wilson Marvin p Industrial Home rd intersects H11O03I '((21001935))AJaJarrrreetttt WAratlhter(c)(c) 1109-iAbram Mamie (Bc)erkner intersects 462 Vacant 465 Jarrel John A (c) 466 (465) Wade Willie (c) 467 Farrar Cora (c) 468 Dixon Jimmie L (c) 470 Banks Anna (c) 472 Wright Marshal (c) 475 Taylor Quincy (c) 476 Moseley Gus (c) 478 Hopkins Julia (c) 479 McCrary Duckworth (c) 480 Jenkins Lon (c) 483 Chatman Henry D (c) 490 Salem Wm (c) 492 Vacant 502 Vacant 504 Jones Bertha (c) rear Washington Geo (c) 507 McCarty Emory A LOG CABIN HEIGHTS--2^ miles west LOG CABIN DRIVE--From Log Cabin of city limits and Bellevue car line blvd west to Columbus rd 102 Meeks Clifford M 103--'-Manning Bruce E 110074/A-'SMlaiddedleGbrloaodkyss H Harris Mrs 108-0-Tucker Roy A 109 (107)Mathewts John N LOG CABIN WAY -- From Log Cabin blvd north, 1 west of Livingston av 101 Amerson Frank 103 Land Ernest M Davis Lucile 105 West Walter G 110 Hamby Quillian P LONG (SM) -- From 2455 Second west 112-0-Nobles Jas D to White, 1 south of Ell 114ASlocum G Leycester 137 McKinney Wm M (c) 1116-OMcCollum Howard P 823 Howard Clifford (c) 119-OGriffin John H 342 Hicks Charlotte (c) 121-OMcCaleb Dee 344 Vacant 123APinkerton Mattie Mrs @ 346 Vacant 124 (112) Vacant 348 Vacant 125-OSwaim Carlos R 350 Vacant 128 (120) Davenport Ralph J 1242 Hill Mary (c) 130 Ross Robt W 132 Vestal Jack 136-OABEanigleliyshMFirnendike OD M rs 138 Hewatt Claude A 144 (192) Log Cabin Presbyterian Ch LONG LANE--North from 109 Rock Hill la, bet Orchard and Green 101 (222) Crumley Rebecca (c) 103 (224) Vacant 107 (121) Mitchell Minerva (c) Highland intersects Hudson intersects 200 Balkom Elisha J 201 Vacant 2020-Goforth Wm M 203 (204) Coppock Jas P 205 Whiting Geo 206 Turner Lucile Mrs Ross Max M 207 (206) Goodrich Richd C 209 (208) Craps Wm M 211 (210)*Slappey Robt C 212 (215)-O-Pinkerton Robt A 108 (106) Stephens Susie (c) 109 (104) Vacant 110 (106) Stewart Rosie (c) 111 (103) Lamar Jas jr !(c) 113 (100) Rivers Geo (e) 115 (98) Jtohnson Mitchell (c) 125 (77) Vacant 127 (79) Vacant 129 (8) Vacant 137 (83) Hendrix John (c) 139 (85) Vacant 21:5 (214) ^Horton Geo R 217 (216)bSargent Wm H 219 (218)Smith Leonard L 221 (220)ALyon Wm J Speer Otis V 223 (222) Noblitt David J 225 (224) AAderholdt Ernest M James intersects 302 (319) Getson Carrie Mrs 304 (317)AGetson Carrie Mrs gro 307 (308) Brown Hartridge B 308 (349) Kitchens Andrew C 311 (310)ASanders Elmer C 312 (363) Bryan Burl F 3181 ADurr Ralph N LONG ST LA (SM)--From Long south and west to White 101 Collins Savannah (c) 112 Hodges M B (c) 116 Vacant 209 Vacant 223 Fountain Chas (c) 222258 VivaycaDntennis (c) 378 Walker Carlton (c) 434 (224) Wright Ella (c) 489 Barnes Bennett (c) 505 Anderson Jas (c) 507 Walker Jas (c) 645 Sanford Carlie (c) 481 ROBERT O. THOMAS 569 Vz Cherry St. REALTOR Telephone 1067 LUNDY RD -- A continuation of Forest Hill av LYNMORE -- A Subdivision south of South Macon, bounded by Houston and Gantt City rd LYNMORE AV--From 3400 Houston av east to Gantt City rd, 5 south of Heard 100 Cornelius C Wm (c) San Juan intersects 220021&AKKjienmg pJeor sMAarvin E 207*Madden Darrel 216 Durden John L fish Durden Henry W fish 220AHayes Geo W 224hPlunket ClarFelnacmeinGgo dr intersects 306hEllis Wm S LYNMORE ESTATES--3 miles south of city east of C of Ga Ry nr Lynmore pl LYNN AV (V)--Changed to Stonewall Pl LYNWOOD AV (Vineville) -- From 347 Fourth av northeast 106 Reddick Joshua (c) * 108 Brown John (c) 111 Reese Lizzie (c) 113 Gonder Wm (c) 117 Perry John (c) 118 Gilbert Mildred (c) 120 Thomas Jesse (c) 112212 CHloywdeardJaHs ay(cn)es (c) 125 Brown Jos (c) 129 (119) Pullens Wm (c) 150 Cooper Nathaniel (c) 152 Phoenix Chas (c) 154 Clowers Ernest (c) 158 Hooks Wm (c) 163 Barton Cossie B (c) 164 Donaldson Annie (c) nurse 165 (149) Vacant 170 Lawrence Henry (c) 201 Harris Julia (c) 203 Turner Wm (c) 204 Dago Elnora (c) 205 Evans Crawford (c) 208 Jackson Anna (c) 209 Plezz Jas (c) 211 Wood Wm (c) 216 Robinson May (c) 221 Tremble Lillie W (c) 222 Lowery Filbert (c) 223 (220) Guyton Wm (c) 224 Pitts Eug (c) 225 Vacant 238 Price Mary (c) 230 Vacant 232 Haddock Wesley (c) 236 Smith Love (c) Lynwood Cemetery (c) MACON AV -- From Log Cabin blvd south, 1 east of Burton av 1700-Welch Jas T 220^-Hunt John A MACON AV (East Macon) -- From 320 Bowman east, 1 north of Hall 20 (155) Vacant 22 Gibson Addie (c) 23' Vacant 26 (205) Gross Henry (c) 30 Goodman J Wright (c) 34 Bryant Alice (c) 38 Vacant MADDEN AV--From 616 Montpelier av south to Jasamine 102AKendall John B 104*Ruffner Harry lOodShephard Jas G HO&oSBragg Palmer E l(W'-Bunn Wm M 108*Mallard Wm D 109&Stewart Robt A @ 110-Deavours Wm A lllhNewberry Paul H 112-bSmith. C Fred 114*Thames Wilbur M 115*Davis Ada Mrs Heame John M 117-QGraham Edwin A 119 Bailey Sarah Mrs 12lAColey Perry N 123*Cork Chas M 130 Woodward Mary E Mrs MADISON--From Rose Hill Cemetery south to Georgia av, 8 west of Second Oak Ridge Cemetery Wolfif Wm Cemetery 152 Ross Mary (c) 154 Vacant 155 Vacant 15 Vacant 160 Andrews Lily M (c) ne cor*Riverside CemetJeorynes intersects Gustin av begins 204 Williams Marinda (c) 205^Parker Hugh W (c) 220067L-HittalrerinAgtlobnertJo(hcn) W (c) 209 Lowe Dave L (c) 211 212 LRoeuevdeesr1 Leonora Wm (c) (c) 213 Ray Haywood (c) 214 Flournoy Benj (c) 215 Persley Thos K (c) 217 Cornelius Tillman (c) 222 Brown Carrie (c) 224 Stevens Chas (c) 226 Willis Clarence (c) 228 Allen Wesley (c) 230 West Mary (c) 247*Ga Academy for the Blind (c) 254 Hargrove Wm (c) 256 Gorman Emmett (c) 258 Gilbert Jerry (c) 260 Little Clarence (c) 261 Coffee Andrew J gro 262 Brown Mary (c) Green begins 263 Jackson Leila (c) 264 Jackson Nehemiah (c) 266 Anderson Ira (c) 269 Ragin Marie (c) nurse 270 King Jas (c) 272 Tharpe Chas (c) 274 Dumas Lillian (c) 275 Davis Wm (c) meats 276 Brown Elvira (c) 278 Vacant 280 Maddox Mary (c) 282 Rivers Clara (c)Woodley intersects 302 Hobbs Bertha (c) 304 Williams Rebecca (c) 305 Kendridh C Lee (c) 30 Threatt Annie (c) 307 StMark's A M E Church (c) 308 Mason Jos (c) 309hEverett Nash M (c) gro 310 Woodard Mildred (c) 312 Falk Ada (c) 313 Smith Julius (c) 315 Williams Jacob (c) 316 Gilham Carrie (c) 317 Glover Josephine (c) 318 Edison Cordelia (c) 320 Riley Willie M (c) 325 Johnson Hannah (c) 332298/-JGacaknstot nRoHseanlirey (c) E (c) 3'30 Davis Etoy (c) 332 Harvey Annie (c) 334 Banks Milton (c) 335 Woolfolk Grace (e) 337 Timothy John (c) gro 338 Hill Geo (c) Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 482 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 HU1' MADISON--Contd 340 Curtis Bessie (c) 341 Naples Mamie (c) 342 Rozier Anna (c) 344 Mooney Jas A (c) 335426 TMhcoKminanseyEsDsieanlCc)(c) 354 Fields Annie (c) 222220*ECllaisnonnoinanMAilndnreedx MThres ARaley John S Stubbs Jack E Maean Edgar B Myddleton Jas P College intersects 335565 BMecdCnleeyrryRuRtehmu(cs) (c) 35T Wilbur Mary (c) 336518 HAaorronne WWimllieHM(c)(c) MAGNOLIA LA--From 480 Orange to 1i0n1teArsrelicnteionMaomf iCe he(cr)ry at Nisbet pi 103 (9) Walker Frank (c) 104 (304) Adkins Lula (c) 367AJackson John W (c) 105 (11) Mabry Paul (c) 371 Colbert Jobie (c) 375 Holmes Taylor (c) 106 (301) Jackson Lela M (c) 107 (5) Vacant 377&Wilcox Calvin I (c) 380 Davis Danl (c) 382 Vacant 110098(V11a2c)aHntall Louise (c) 110 (113) Jones Eliz (c) 383 White Grace M (c) 385 Sanders Jas (c) 389 Muse Robt (c) 393*Harvey Geo (c) 111 Vacant 112 (555) Davis Chas (c) 113 Vacant 114 (557) Johnson Lucille (c) Second av intersects 115 Vacant 405 Redd Lula (c) restr 411 Moore Burney (c) 111176 I(T5'S5/>9q)rvSp mith Mary (c) 413 Rutherford Herbert M (c) 118 (554) Sweeney Mattie (c) 428 Pitts Alberta (c) 430 McCormick Mary (c) 119 (24) Curry Lizzie (c) 121 (25) Lorance Katie (c) 433 Baul Ollie (c) 435 Williams Horace (c) 123 (202) Lockett Leonard (c) 125 (204) Mitchell Frances (c) 437 Easton Sidney E (c) 127 (206) Smith Amelia (c) 444319'-'IKnegartaimng Sami Eliz (c) (c) 129 (205) Cain Lillian (c) 131 Vacant Jefferson intersects 133 McCrary Lillie M (c) 137 Morris Adeline (c) MAGEE AV (South Macon)--Changed to San Juan av MAIN (East Macon) -- Principal thoroughfare east from river MAGNOLIA--From junction of Spring 130 Watts Radie Mrs and Cherry west to College, 7 south to river 200 Morris Geo W soWft adterriniknstersects :104&Wells Alice Mrs 108*Borde Alice Mrs llOAjeter MJattie Mirs 114*-Cosby Essie I Mrs 116*Johnson Paul 204 (203) Lloyd Geo 206 Kitchens Dorothy Mrs 214 Binns Taswell S 224 Woods Robt L 235-65ABibb Mfg Co (Plant No 1) 120*Barfield Beulah Mrs 121*Gewin Christopher C 122*Williams Lester E 123*Stanley Louise Mrs 125*Brooks Mary Mrs 127*Urquhart Jas L 130*Lane Harvey T 134*Jarratt W Devereaux 137*Babb Alice K Mrs 24. 4A,, W U Teleg Co (br) Elm ends 246 Thompson Budrow (c) barber 248 Harris Andrew L 348% Woodall Jas D 252 (234) AElder WillisEGlliotgtrointersects 254 (236) Bibb Shoe Shop shoe reprs 256AKelly Arth J cotton buyer Bailey Jos B Pearce intersects AJones Ella Mrs^ 262Apostal Teleg-Cable Co (br) Cullens LeRoy- 264 Ward John W 140*Fagan Beulah W Mrs 266 Stewart Jas T restr 142ASudd(ath Roy V 266aAThomas Wm H (c) phys 114443*HCoalrltienrgsSwaomrtih LAllen L 146*McCarthy Jos H 149*Bailey T Merritt 153*Hanks Lester F Rev 268ATravich Candy Co 268% Hathaway Wm H restr 270 Sucurella Josephine Mrs Beck Ella N MCrs 280 Johns Bartow Hanks Mary K Mrs drsmkr rear Wornum Henry (c) 156*Baker Effie H Mrs 280 (2)AGlawson Service Station filling in 157*Heptinstall Ruby Mrs 161*Hays Carl H 162*Saye Florence A Mrs 116665**JMoncWesillWiamms JEllen E Mrs 167*Smith Lavosier V Thames Leila Mrs 171-0-Stocks Peter C 172*Berner Clifford N 175*McKellar Idus E 178 Bailey Geo W 181*Rodgers Alfonzo T 18o*Almand Grover C 186*Popper Steve gifts 189*Hose Leila B Mrs 190*Moseley Harry M 193*Ru.ssell Alice Mrs 198*Stubbs Ora Mrs 216*Reyno,ld,s Nellie MOramngues itnctherrsects sta Flanders intersects 301AKite Jesse 302AGruhn Wm J gro 30i3*-Ryle J Thos 304 Vacant `306-08ADixle Roll & Cot Co Inc textile 311 ShsauwpplViesJack 312 Brewer Wm J barber 312% Rice Wm J restr 316ASam's Market meats Vullo Sami 317Apittman Guy W 318AFiorida Fish & Oyster Co 318% Stefano Luke 320ABirdsey Flour Mills (br) gros 324AWilsons (br) gros 326AHamlin W Edw gro and meats 329 Bibb Mfg Co (whse) 483 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 MAIN (EM) --Contd 333333206--OODRMimocgCeerrasSrytSotrDoereeWdseipt(tttorD)strougrgreosCo Inc 338-Q-Kennington's Market gros AKennington Godfrey A meats 333480%-0-B(Valakccaomnt's PharmCaclyinton m. tersects 400-04AWofford Oil Co (tor) filling sta 403 Arnold Danl S 405 Vacant ,,. . . . 40'S Walker Alice V Mirs 2d hd clo 40i Washington Memorial Library (tor) 410 Fort Hawkins Lodge F&AM 411 Woodall Nettie ScMhresll av intersects 426 Harrison O Homer barber re4a28r ASBlayprdpyIdLaorMettaMr(sc) Morgan Jas OSchell av mtersects 431/--Tank Car ServiceHSytdartoiolina fiinltleinrgsescttas 503 Anderson Sue Mrs 5S0l9SbBSetlrliipzliiangAnEgmeloory GRarden intersects 521 Thomas Barney M 55il*Vaughn JCasuttRers Green intersects 563AHolston Alice A Mrs 559 Tyson LeRoy 600 Chapman Wm F Union av begins 601 Pruett Elijah L 602&Taylor Marcus TCutter's al begins (604 Massey John P 605 McConnell Thos H 606ALiles Wm C 607AChurchill John R gro 607% Strickland Braxton B Jones intersects 608 Campbell John 612 Roberts Wm F 881280 GHoaltltiise JBacarkney 822 McKinney Henry H 823 Burns Robt B 825 Myers Paul 826 Blount Geo W 827-Cannon W Edw 828 Poppell Jack E jrNogrrrois intersects 835 Estes 'Emyal E 837 Purvis Rube 839 Vacant 843 Vacant 900 Hester Robt L Short intersects 1000 GOOD Vacant 1002 Vacant 1004 Anderson Alice (c) 1006 (1010) Hall Winkfield F (c) gro 1008 (1006) Turner Sallie (c) 1010 (1108) Vacant 1012 Seabrook Jerry (c) 1014 Gray Jas S (c) 1016 Dudley Geo L (c) auto repr 1018 Calhoun Richmond (c) .1020 Brown Wm E (c) 1022 Ponder Pink (c) 1024AAaron John (c) 1024% Fluellen Obie (c) gro Broad intersects 1106'iHammock Bonnie Mrs gro 1108 Turner John W 1110 Wood Roger L 1128 Edwards Chas L MAIN (Stinsonville) -- Main thorough- fare beginning % blk north of end of Auburn av and running west through the settlement 103 Brooks J A School (c) 105 Brooks Emmett (c) 107 Robertson Roosevelt (c) 109 Ray Florence (c) 111 Barns Roberta (c) 113 Gaston Eliza (c) 116 Stinsonville A M E Church (c) 614 Andrews Gussie L 618 Johnson DeWitt 620 [Holt Ora Mrs MALLOY'S AL--From 420 Ash to Elm 5 Tanner Isaac (c) 7 Battle Leonard (c) 623*Ford Jas W jr 8 Vacant 624*Day Mattie L Mrs 9 Taylor Arlie (c) 625 Melton Walter M 627 Massev Irvin B 628-Brooks Wm B 629 Kirkley Harry F*ort H*ill be*gins 10 Vacant 11 (130) Burnett Mamie (c) 12 Gibson Rachel (c) 13 (131) Brown Emmett (c) 15 (8) Sparks Ida (c) 17 (135) White Wm (c) Balkcom begins 18 (11) Little Nettie (c) 770013*'iCToiduwchell &HeWnroyodiaSll eras rear Vacant 22 ( 26) Vacant 704ASchaefer Minnie Mrs 708*Cranford W Lafayette 23 Leonard Pauline (c) 24 (23) Garling Benj (c) 709AAmerson Warren R 26 Vacant LMyalesssenWgamle SWm A 28 (121%) Davis Henry (c) 711 Kitchens John T MANCHESTER OTIS (V)--Changed to 712Williamson Thos H Atlantic Mill Qtrs 713 McCullough HOul'eNtetal's al mtersects MAPLE -- From Oglethorpe northwest 716 Sutherland Robt A 717&Mo.rgan Georgia W Mrs 721*Couch F JeromFeairview intersects 772242tAoWCoowoadnallWHmenMry MFaynard intersects 801 Quarterman Jas N 803 Liles Wm C gro 804AEvers Roderick C 805 Jabo Thos 880079-SMmoarlrliwsoonodJoThhnosGL gro SllAParker Laurie L Morrison John G 813 Smith Gatsy R Mrs 815 Campbell Wm X H Hoffman F Ridhd 816 Cannon W Edw gro and west to Ross, 1 south of Orange Highland av ends 117 Vacant *,Latt*a pi *ends Oglethorpe intersects 119 Josey Wm T 153 Mills Thos W gro Cole intersects 2020Ryals Andrew J 204*Beall Henry W 252 Bailey Wesley G 258-bGunn Henry E 26U'Thomason Jas V 266 Herndon A Bradley 267 Vacant 268 Four Point Grocery 269 Tindall W Shelby Weems Jas C YOUR CITY D I R E C T O R Y mirrors the Industrial LIFE Of Your CITY 484 PRINTING ARLINGTON HOTEL BINDING FRFF I STORAGE | BMRoOdeArnDWaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep** THOMAS O. MOSELEY, Prop. RUBBER STAMPS THE BEST WORK CORRECT PRICES MAPLE--Contd 270i*GDoreleesn Mittie Mrs Audrey Mrs Par*k pi *inter*sects 317 Vacant Calhoun intersects 318 Worthey Robt (c) 319 Sanders Lucy (c) 320 King Lulu (c) 322 Hogan Anna (c) 325 Edward Robt (c) 326 Griffin John (c) 336 Brown Sarah (c) 337 McGee Ellen (c) 338 Harris Clinton (c) 339 Vacant 341 Stokes Jean (c) 354 Hudson Curtis (c) 357 Brogsdale Chas (c) 363 White John (c) 366 Vacant 370 Vacant 201 (7) Ringwood Lucius (c) 4a0m1 Millirons Mars,hal,l C(cri)s intersects 403 Mason Lillie B (c) 405 Dobbins Dock H (c) 407 Jones Mary (c) M--ASJO^oNmICBHouOlMevEarRd Dno(rNthowrtehstHighland) 225 Duffey Robt G 254*Ingham Ralph E 228815&HPuamttopnhriTes ERmuotrhy Mlrs 229817APReotbteayrtsS WAmugGustus 291% Vacant S3O56BAKSnipiagirhksts WEialrlilse BMrs 358 Deschauser Geo (c) ' Masonic Home of Georgia MASSEY -- From Fourteenth west to Seventh, 1 south of Pine Where To Buy? Consult the Classified Business Lists In This Directory MARION AV (Lynmore Estate)--South from Melvin pi to Carman, 1 east of Worsham 369 Durden Danl B 4044'Howel] Hubert D 405 Smith Eric D Kirkwood Henman L MARION PL (Western Heights)--From 412 Montpelier av south 9*Wright Jas I MAY--From Pio Nono av east, 1 north of Richard 105 Dubose M:aihew (c) 106 Webb Julius (c) 107 Ross Elijah E (c) 108 Coleman Alice (c) 109 Pitts Annie (c) 110 Powell Ella (c) 111 Hughes Lucius (c) 112 Matthews Carrie (c) 114 Davis Wm ir (c) 14&Hurst John P 115 Davis Lizzie (c) 16i'Smith Mary Mrs 116 Briscoe Thos (c) 17ARett Louis E 117 Higgins Clarence (c) 20&Branon Edw W 119 Cullen Oscar (c) 2325&AWRyritghfehrt JFenMleiylton 33*Culverhouse Geo W 40AMilliron Albert J 41-0 Daniel Emory A 4494-ACA-EsdkgeewDNanelwtMon G 56 Chew W Hubert 5T-?McGriff Leon G M1Ap00eYliHeAarVwsko(iuUntsnhioHnevnilrleie)ttaFr(ocm) 922 Mont101 Callaway Handy C (c) 102 Harpe Lewis (c) 104 Harvey Malissa (c) 105 Waller Nelson (c) 106 Wright Edw (c) 108 Wisdom Milton (c) MARSHALL AV (Crumps Park)--From 2015 Vineville av north to Ridge av, 2 west of Park av 101 Brown Leon D 102 Johnson ArtJh M 103 Carlisle Alek O 104 Johnson Jos E 109 Parker Jas (c) 110 Davis Hollis (c) 111121 C(1a1l0h)ouVnacIasnatac (c) 114 Rutland Geo (c) 115 Smith lEliz (c) 156 (157) Ryan Mary (c) 157 Battle Robt (c) MARTHA (E Macon)--From 120 Powell west, 1 north of Yates av 449 (452) Card Floyd (c) 451 Blunt Mary L (c) 453 (450) Barber Julia (c) E Second intersects 501-03 Clowers Randall D (c) gro 159 Myers John (c) 161 Watson Irene (c) 163 (162) Gibson Oscar (c) 164 (604) Davis Ellis (c) 165 Johnson Wm (c) 167 Harden Geo (c) 169 Blackshear Julia (c) Edison intersects 504 Gay Essie M (c) 505 (504) Williams Wm (c) 550076 BBrroowwnn LLiizzzziiee ((cc)) 50 lEVans Gussie B (c) 509 Brown Minnie (c) 510 '(457) IBlnberley Isabelle (c) 511 (512) Pearson Frank (c) MMAYaNinARnoDrth(Eatost lMimaictosn) -- From 724 103 Vaughn Chas 105 Woodall Ashby T 132 (133)Byrd Robt T 134 (131) Booth Newton I 136 (131) Johnson Rufus 217 (218) Glover WLiilllliiengRhamMrisntersects 513 (514) Stevenson Wm (c) 218 (217) Hall Talmage W 516 (517) Vacant 219 (220) Shepard Wm A MARY--Changed to College dr 220 Hill Tom 221 (222) ^Atwell Jas W MARY (Artope Hts) -- Southwest from 236 S CoUege 171-QFuss Leroy 225 (51) Patterson Jos A 229 P(5e2t)ti'giLreewslieJoHhonmeFr L 231 (53) Sanders Geo T MASON (South Macon)--From Colquitt south, 5 west of Waterville rd, formerly Fifth av 102' Foster Beni (c) 103 (110) Slocumb Susie (c) Charles intersects 256 (56)i'Mixon Beni F 400 (403) Curtis Huigh B(rco)ad intersects 401 (342) Hunt John (c) 402 (504) Benford Thos L (c) 403 (344) Sharpe Henry J (c) 404 (506) Carswell Jos (c) 485 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 MAY AV (U)--Contd 405 Cook Bernice (c) 406 (508) Pitts Andrew - J Cc) 407 (348) Hunt Wm H (c) 440098 H(5o1d0g) eVs aDcaanvtid (c) I4411H0 i((536122)) DSmurihthamSoJlun(ico)r R (C) 412 (514) Glover Alex (c) 413 Ricks SalUe B (c) 414 (516) Reid Isaac (c) 416 (356) Jackson Sami (c) 410 Wimberly Alex Rev (C) 417 Pleasant Grove BaCpotiwstanChinutrecrhsec(ct)s 501 Earley Sallie (c) _ 502 (520) McCall Robt B (C) 503 (507) Mitchell Estelle (c) 504 (555) Hill John (c) 505 Battle Carrie (c) 506 (524) Hill Estella (c) 507 (509) Woodall Annie (c) 508 (526) Bryant Wm T 509 (519) Thornton Lizzie (c) 510 (530) Fuller John H (c) 511 (527) Ridley Nathan R Rev (c) 512 Tinsley Mattie (c) 515 (529) Harper Ellen (c) 516 (537) Freeman Wm (c) 517 (531) Haddock Rachel (c) 519 (535) Butler Ella (c) Hall intersects 611 Wright Mattie (c) 614 (540) Smith Jas (c) 615 Harper Elian (c) 616 Green Sim (c) 618 Sweeney Fannie (c) 619 Evans Robt (c) 622 Clowers Mack C (c) Mitchell intersects 702 (701) McMullin Jos (c) 707 (800) Benford Thos L (c) 708 (588) Davis Warren (c) 709 (800) Virgil Wm (c) 710 (75) Smith Ebb (c) 712 (577) Sharp Ed (c) 714 Robertson Leola (c) Taylor intersects 800 Turner Eva (c) 801 810) DeShazor Wm (c) 804 Fultz Bernard (c) 806 Richardson Squire (c) 809 (801) Eason Reynolds (c) 813 (875) Bowman Wm (c) 815 Childs H Walter (c) 820 Vacant 825 Vacant 882 Glawson Jesse (c) 884 Cranford Edw (c) Williams intersects 901 (950) Open Air School (c) 911 (884) Ford Clisby (c) McBURNEY AV -- One mile north of Clayton east and west to Cutter (V) McCLAIN LA--West from 726 Pine to Oak bet New and First 210 Vacant 228 Barnes Eva (c) 321 Walker Anderson (c) McKAY'S AL--Frrom 520 Ash south to 523 Elm 125 Smith John (c) 127 Davis Thos (c) 129 Moselle Rosie (c) 131 Young Jas (c) 133 Vacant McKENNA AL--From 819 Fourth west to Third MELROSE (Bellevue)--From C of Ga Ry south to Bellevue rd, 1 east of American blvd 3 Ford Clifford 4 Evans Clifford W 5 Gandy Israel G 6 Freeman Gordon J 7 Lewallyn Clyde V 8 Barum Julius C 10 Oliver Clarence P 25Wilder Eldred 28 George Clifford C 30 Surrett Mattie Mrs 31-34 Drake Wm J 35-37% Vacant 38 (112) Mann Jos W 39 NeSmith Evelyn Mrs 40 Fitzgerald Thos W 421 IScihrimishire Georgia Mrs 44 Wilder Grover C 100 Pritchett Walter H 102 Pierce LewisFabiarmrboenrt av intersects 200 Pendley Waymon D 217 Askew Bradley S 3070-Hendley Jos C 308 Walden Wiley W 309 Sims Mary F Mrs 312 Durden Benj W 315 Land Robt 317 Moore John 319 Sisk Olie C 321 Dennis Henry P MELROSE (East Macon)--From junction of First and Washington north 385 Martin Claudie (c) 386 Kizzie Rufus (c) 387 Davis Sami (c) 386 (381) Wiggins Wade (c) 390 (380) Morris Hattie Cc) 392 (378) Williams Gertrude (c) 394 (376) Wilburn AdaBr(oca) d intersects 412 (265) Miles Moses J (c) 415 (260) Williams Frank (c) MELVIN PL (Lynmore Estates) -- West from Marion av to Trammell Britt Norman MERCER (Bellevue) -- From American blvd south to Atlantic av, 1 east of Grand av 202: Anderson John H 302-0-Marshall iHenry C dairy 323 Vacant 325 Jones Lawrence J MERCER TER--From 517 Adams west 98-OSmalley Welcome T 1000-Condon Wm F 102 Sears Henry N McDonald AV (Vineville)--North from Rogers av to Buford pi nr Clayton 106 Sharpe Jas P 108 Renfroe Arth J McGEE (CP) -- Northwest from 2015 Vineville av to Ridge 103 Lee Walter A 105*C'rambes Peter S 107 Jobson Arth B McGRATH (South Macon)--From Edgewood av south to Bright, 1 west of Second MERRITT AV (Ingleside)--From Ridge av north, 1 west of Riverdale dr 1220Jenkins Elbert 11224600-BHealrllinLer EHmamroeltdt 1280Rehfeld Frank W 129 Simmons Jas M 131 Fisher Guy L MInDeDttLEeas(tEast Macon)--From 316 Bur437 Ingram Gath (c) 439 (448) Patterson Leila (c) Middle la intersects SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. < 220 Georgia Casualty Bldg. Phone 3368 U) fD ? m <2< 3to IEL'fXfV* 5- ** P S? 3 I 486 YATES MOTOR CO. 707 THIRD ST. PHONES (11444465 MIDDLE (EM)--Contd 441 Vacant 445 (505) Bowen Wm (c) 447 (707) Baldwin Cornelia (c) '520 Jordan Luther (c) 522 (500) Hollis PrimrEosdeiso(nc)intersects 525 Vinson Anna (c) 342 Mims Danl (c) 344 Stephens Arth (c) restr 349 Daniels Simon (e) 375 Smith Wm (c) 379 Vacant 381 Hollomon Mabelle (c) 383 Grant Geo (c) 526 (509) Kelly BeUlaih (c) 5522f7li ((552276)) FVliangsonAlmClaiff(ocr)d 531 (529) Glover Benj (c) 534 Nelson Loubertha (c) MlIiDoDt LnoErtLhAto (MEaisdtdleM, a1coena)s--t oFfroEmdisEoln113 Easley Chas (c) 120 (402) Thomas Alex (c) 536 Brown Annie M (c) MIKADO AV--From Grady south, 1 east ,,,,1,,0 Mills Willie (c)E Second intersects 621 Butts Danl (c) 621% (622) Bullet Lillie (c) of Houston av (Mikado Place) 200ADix Lee A 203 Denson Leila 204 Harper Aaron D 623 Vacant ^Harper Nora Mrs nurse E Academy intersects 205-CLyon Mamie M Mrs MIDDLE (Vineville)--From 123 Hardeman av north 108 Taylor Robt (c) blksmith 110 Maynard Alice (c) drsmkr 112 Vacant 114 Brown Geo (c) 115 Vacant 117 Vacant 119 Coleman Andrew F (c) 121 Jackson Cornelius (c) 123 Ivey Edw (c) restr 131 Mitchell Lucius (c) 135 Donaldson Jesse (c) 136 'Carswell Mattie (c) 140 (141) Spivey Henry (c) 143 Culpepper Mary (c) 145 Hope Edw (c) 146 Wynn Rufus (c) 148 Williams Ida M (c)' 150 Sanford Lee (c) 152 (154) Ridley Addie (c) rear Vacant 153 White Mary L (c) 154 (152) Napier Comer (c) 155 McCombs Virginia (c) 156' Williams Pearl (c) 115598hRDoesms pBseryosJo(hc)n gTros(c) Dawson Josephine (c) dirsmkr 208 Woods Wm N 209 Boland Jas W 210 Mikado Baptist Church 211*Evans Jos H 300 Davis F,,red, Fulton intersects 301 Shinholser J Graniss Bittick Wm R ir 330043-0D)HonuatchhoinogsJoVsirgii R 305 Grace Chas B 307 Rogers Walt H 308 Tharpe Lee H 309 Voellinger Willis E 311hGnant Wm R 4. 06 Yeoumans Obie B Troup ends 4410126*BHlaunfdfeirGs eLrteroudeD P Mrs 414 Johnston W Fleming 415 Bankston Geo D 441186&GDoarvdios nLoFnanltioenJ 420*Durden Leon F 4244'Durden Alsey F 425 Clarke Harry H 501 HTIunnicutt J FrankDavis intersects 504 Campbell Harvey L 505 Ennis Clifford L First av intersects oO&OMills Junius P 206 Vacant 509 Stokes Zoira Mrs 208 Holmes Maria (c) 209 McCoy Simon (c) 601 Co1leman rTmh.os M,, Burke intersects 210 Starr Hattie (c) 602 Dorough Augustus B Rev 211 Buckles Mattie (c) 603 Brewer J R 212 (216) Walker Cornelia (c) 605 Broome Ailleen Mrs 214 Peterson Frank (c) 20 (520) Vacant 215 Spivey Claude (c) 222251-QGMlecnWn hWortaerlteErdw(c) (c) 233 Campbell John (c) 235 Vacant -7m0o2AiT'HT arrel,,l S,,and,y CBhath' am intersects 704 Hughens Wm J 706 Ozburn J Lee 711 Griggers Robt A 235a Walker Daisy G (c) nuirse 235% U S Works Progress Administra- tion Sewing Dept 237 Mays John (c) 238 Morris Ida B (c) 240 Noble Leila (c) 2424-Benton Lois (c) 801 Nort, on ClevelandToombs intersects 803 Keth Oarl A 805-0-McCowen Richd B 807 809 LBalowordewncoerthHoHmeOr tis; 811 Harper Claude E 254 Finsley Jos (c) 255 Hooks Wm (c) 256 Hill Lela W Cc) 1 257 Whipple Jas (c) Second 300 Davis Alex (c) 309 Johnson Rosa (c) 310 MoEvoy Wm (c) 315 Kendrick Chas L (c) 316 Vacant 319332201- Johnson Lucius (c) 325 Ephraim Sophie (c) 333 Gibson Ella (c) 336 Pate Jos (c) 338 Walker Viola (c) 340 George Edgar (c) MILL--From Lawton av north, of Holt av av intersects 21 ((7765)) GGrreeeennwwaayy LRooibst UL 3 (74) Copeland Jas F 4 i(77)Foxworth John E 5 (73) DeFore Gaston P E 6 (78) King Jas R 7 (72) Graham Henry A C i 1098 (((877019)))CWSWCoealaiallrlik'ltnrieebasrramrTDysChahoROnasslatilsp(B(chc)T) J 11 (70) Morgan Wm K 12 (81) Griffis Jas F 13 (69) Williams Alice Mrs 14 (82) Adams Silas W! 15 (68) Williams Oscar 16 (83) Long Carroll E 1 west 487 WILLINGHAM SASH & DOOR CO. Lime - Roofing Cement -- Plaster 457 Third St. Phones 277-278-279 3 MILL--Contd 17 (67) Amerson Roy T 18 (84) Land Green B 19 (66) Jones Wm E 20 (85) Broome Lester 21 (65) Godfrey D Luke 22 (86) King Jas M 23 (64) Dykes Julia Mrs 24 (87) Stephens Geo C 25 (63) . Creamer Eldora 26 ( 88) Dennis Maggie L Mrs 28 089) Bartlett Chas 30 (90) Bragg Joel R mill (East Macon)--Changed to Middle MILL AV--From 3601 Houston av west 101 Wheeler John R _ 102 Willingham Miaytaell Mrs 103 Horne Jos G 104 West Emory 105 Wade Walter !H 106 Hunnicutt Wm S 107 (111) Jones Allen L 109 (215)AGill Clark D rear Vacant ilOAPickering Geo A 111210*AVrnaloelndtinJeohRnobTt L 112246*(L1e3s2te)*r PJaattsersWon Archie O 150 Martin Wm N MILLEDGEVILLE RD (East Macon) -- Continuation of E Main 1132 Tidwell Annie T Mrs 1136 MalcoSlmulpEhurnr eSstprMings rd intersects 1137 Vacant 1138*Bell Wm 11113491*BRaokoekrs JCahsasgrTo 1142 Mixon Ellis T 1143&Dean R Walter 1144A*.MBaakretirn jaWsmA filling sta 11114445a*CBoaxkeJrohCnlarTence E ' 1146*Ard Tully C 1148ALog Cabin Service Station 1148a''-Robles Chas 11114498*-(C2o)x*SMumarmveinrs RChas E ABaker Jas O 1150AStripling Robt G (2)Astripling Robt G Jr 1152AMartin Ira L 1154 Baldwin Mamie Mrs 1155ASteed Jas 1155 (2) Massey Geo 1156AKitchens John C filling sta 1157 Odom Anderson E 1161 Herndon John A blksmith rear Dean Sami 1163 Reeves Chester R filling sta 1165 Vacant 1190AKitchens Jas W gro 1194AWilson May C Mrs MINDON (Napier Hts)--From First av west to Pio Nono av MaITloCnHgEcLitLy l(iEmaistts Mtoacwoens)t--siFdreomof RCeleinseton rd 3 Cleveland Mary (c) 5 McDuffie Marie (c) Center intersects 108 Locket Mary (c) 110 (109) Hill Viola (c) 111 Person Ulysses (c) 112 Wilson Otis Cc) 135 Haynes Alex (cC) hestney intersects 202 Hunter Wm (c) 204 Harris Edw (c) 206 Rockmore Geo jr (c) 240 Solomon Lula (c) 242 (243) Tyrus Andrew H (c) 244 (246) StallworthWCoamesaacrk (icn)tersects 353 (352) Murphy Mary L (c) 402 ( 401) Pitts Wm (c) 404 (403) Card Andrew (c) 406 (405) Vacant 408 (407) Jones AMnniticeheBll lCac)i.ntersects 442 Pound David (c) 452 (25) Farrer Gussie (c) 453 (442) Miller Press M (c) 456 (455) Roberts Nome (c) 498 (28)ALowe RandaFlolrtCcH) ill ignrteorsects 502 (152) Vacant Smith i. ntersects 541 (141) Vacant 543 Vacant 545 Davis Mary L (c) 547 (144) Glover MMamaiyena(rcd) intersects 602 Wright Frank (c) 606 Smith John L (c) ^^ ^ 608 Stephens Jas L (c) MITCHELL AL--From 420 Elm to Edge- wood av bet Broadway and Third 401 J(4e1n5k)inWs inJgafnieeld(cF) rank (c) 402 Tolbert Fletcher Cc) 403 Bryant Lula (c) 404 Proctor Leola Cc) 406 Brown Lessie Cc) 408 Perkins Frances (c) 410 (402) Stancil Arch (c) 412 Griggs Lizzie (c) 414 Logan Gus (c) MITCHELL LA (East Macon) -- From Mitchell beyond limits, V-i b*k west of Fort Hill 1 Jordon Essie (c) 2 Vacant 3 Jones Edw (c) 4 Vacant MITCHELL LA (VineviUe) -- From 580 Clayton south 1 blk 11131 MoOowian Henry (c) 218 Wright Carrie (c) 220 Davis Emma (c) 231 Howard Wm (c) MOCCASIN SLIDE -- From Fifth to Sixth, bey Walnut and Ocmulgee 111140 VPiaecrcaent Martin (c) 115 Vacant 116 Brown Sara (c) 131 Dezuim Roosevelt (c) 133 Curtis Rebecca (c) * 134 Thomas Flossie (c) MONROE--From Woodcliff south to C of 307 Ga Ry, 2 Stafford north Benj (oc)f1 Madison 309 Stokes Jas (c) 311 Venable Pearl (c) Fifth i.nt,ersec,ts 312 (322) McIntosh Louis (c) 314 (320) Whitfield Emma (c) 316 (318) (Hudson Jolhn Cc) 318 Olio) Gilmore Lillie cc) 320 (314) Flournoy Wm (c) 322 (312) Mullen Ellen Cc) 324 Fulton Mary (c) 325AMat'his Wm L (c) gro 326 Henderson J B Cc) 3'2!7 Wilson Evia M (c) 328 Smith Sarah (e) 329AModemistic Shoe Repair Shop (c) 332 Ivy Heniry Cc) 333 Holliman Annie Cc) 334 Mathis Chas (c) confr 335 Watson Sarah (c) 336 Mathis Frank (c) restr 337 Winners Eldw (c) ?! u and Linen Service DISCOUNT CASH AND CARRY Cleaners Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information yon are unable to procure elsewhere, call on vs R. L. POLK & CO. DETROIT 488 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 til1! MONROE--Contd 339 Holt Silas (c) 341 Kinchen Fannie (c) 348 (333) Hill ViSoltaew(acr)t'sreasltrintersects 352 Hill Viola (c) 354 Jackson Lizzie (c) 356 Bailey Sarah (c) ' 582 Boddie Frances (c) 586 West Gussie (c) 615d)Henry Isaac J (Fco) rsyth intersects 618 McCary Donald M (c) 624 Bryant Green (c) 626 Stinson Wm (c) 630 Bell Mamie (c) Fourth av begins 363-C-Mathis Wm L (c) 367&Comer Ellis (c) MONROE (Unionville) -- North and south from Anthony rd, 1 e of Pio 368*G'riswold Florine (c) Nono av 369 Harris Zebb (c) 50 Williams Chas (c) 370 Lawson Wm (c) 51 Bivins Jessie (c) 337721&MLoidvdeleCbrloeookpsatrMiaar(ice) (c) 374 Forbes Ella A (c) 55 Minton Zudie Mrs 114 Everett LukeAn(cth)ony rd intersects 377APiercy Sophia . E (c) 115 Barnes Missouri rear Parrell Mamie (c) 378 (384) Spencer Lida (c) 379 Brooks Ida (c) 380*Walker Mary L (c) 383 'Elliott Mattie C (c) 385 Lyles Wm S gro 387 Jones Carlton (c) Second av intersects MONROE HILL (V)--West side Gustin av, 114 miles north of Linden av 101 Jordan Hamp (c) 103 Jordan Jake (c) 105 Vacant 323 Vacant 388 Briggs Valley (c) 403 Hicks Robt (c) 407 Miller Mary M (c) 408 Shivers Lula (c) 410 Perkins Emma (c) 412 Vacant 413 Nelson Robt (c) 414 Dobbs Letha (c) 415 Cleveland David (c) 416 Vacant 441187-0S-KteywlesarJtaMs aGud(c)(c) 419 Hudson Industrial School (c) 424 Bostic Thos (c) 428 Hutchings Emma K (c) 431 Grimes Wm V gro 432 Miller Lucille (c) 436 Jones Henry (c) 440 First Congregational Church (c) MwOeNsTt,P1EsLoIuEtRh oAfVC--olemFraonmavLinden av 99-QTatnall Square Service Sta 1lO02liEBcuornnoemtty SDerrvyiceCleSatnaers (hr) 103 Burnett Wm D 104 Fuller Jas W 110065 VThaacrapnet Wm H 1110080H-HuodlsloownayWJaAslleCn 111 Great A & P Tea Co 112 Pope Geo R 114 Seventh Day Adventist Church 115 (109)&Drew Thos H 120 CVhaecnaenyt Renee Mrs 122 Rogers Stores gros and meats 453 Brown J,ohn (cJ)efferson intersects 455 Landers Essie (c) 467-MOBeGarrkasidryaleDBenynroien LB 475-0-Graddy Louis F Holmes Mary Mrs Johnso*n av*inter*sects Bell av begins 2004Melton Grocery Co 202Muirray M Virgil 203 Thurston John A 204 King Geo H City Fire D,,epGteorgia av intersects Auto Pump Co No 2 Auto Truck Co No 2 Washington av intersects 505 McCrary Robt (c) 220086*RFoabriknesronWTmhoLs W 208 VaAiFil'singer Harry E 255 Henry Jas F Carling av intersects 301AKing Henry L 509 Spivey Milton (c) 314 Vacant rear Hooks Fannie (c) 316 Vacant 515-dRogers Robt R (c) 319 Arnold Monroe 518 Curtis Anna (c) 320 Abel Ice Co 5191 Webb Emily J (c) @ 321 Hardaway Richd G 520 Gilbert Mary (c) 522Smith Relliford S Dr (c) 399 (411)-0Durden w DMunocragnanintersects 523*Hutchings Frank J 524-0-Thomas Robt T jr (c! ) 400*Bells Pharmacy 401 Maddox J Atticus 528 Johnson Jos E (c) 402- 530AWilliams Joshua S Dr (c) 531 Reid Robt W (c) 440043- (410)&Donnan Ernest A 533 Watson Thos J (c) 539 Brown Clara (c) . 440065&_(K4i1n2le)dyRWainmes CWm G 543 Stokes Jas (c) Marion pi intersects 532 Mitchell JosephTiinnesle(yc)la intersects 555 Pruden Nona (c) 553^Evans John H Rev (c) 559 McKinley Ida (c) 561 Clay Berry Rev (c) 562-O.Lain Parte L (c) 563 Evans Ada (c) 565 Hamilton Della (c) 567 Vacant 568 Chapman Lizzie (c) 569 Smith Eldora (c) 571 Wilson Nancy (c) 573 Fluellen Lillie (c) 575-QMcNair Elisha B Rev (C) 578 Colson Georgia (c) 408 410 ((4411!46))--00--CToolme liJnosohnn. W Wm T 412 Johnson Ernestine Mrs Johnson Ernestine Mrs gro 415 Cox Otiho B 416 Williams Thelma MOrsa.kland begins 417*Stapleton Harvey P 419dMcCommon Sa'rah R Mrs 420- 421- Elizabeth begins 501-dGober Service Station 505 Vacant Virginia av begins 515AMiller A L High School 489 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 MONTPELIER AV--Contd 516*AHlil-eLno IrGaroOcery 520 Church of the Nazarene 552268AiACmheanseoyn JGoehon RJ Hicks la begins SOfrO-Meaders Purlonia Mrs 604 Irby Wm O SOShHarris Oscar L i 606 'Wilder Mary P Mrs 607ATidwell Romer T 608ABeck John I Ninadel dr begins 610hFoster Emmett L 612 Owen C Robt Leavitt Bessie Mrs 614 Newson Henry N 61t8hMoseley Guy L Madden av begins 708*Stanley David W 711-0-Almand Aubra A 713-hWest John E 771156hiBMucrCclhurePrHanilktonN B 724*Abel Alma R Mrs @ 732 Green John A 739*Balkcom Albert P 774410*VAaacraonnt Thos W 748AAaron Ralph S 749*Odom Athol E 7195 Fhibnon Marvin P 776547-hBOradodmleyWJmos WD jr 765 Rittenberry Lizzie Kimbrew Emmett V 772*Abel Ida Mrs 780 Yates Elmer E 778889**VRooglkeernss SHtoernersy gWros garnod meats Godfree Mollie Mrs Pio Nono av intersects 800*Durr's Creamery 801*Cherokee Pharmacy 802*Birdsey Flour Mills (hr) gros 803 Ross Dallas L barber 805*Raines T M Gro Co Inc 806-0-Keppler Louis shoe repr 881009*VYaacteasntZonnie D 811 Patterson Annie Mrs 815 Cravey Lillian Mrs 881260 BCahJampemttanFePrdhiinliapndRP(c()c) blksmith 821 Long Bennett A Rev 822 Battle Chas B (c) 824 Helton Eloise Mrs 825 Briscoe Mary (c) 826 Helton Eloise Mrs gro Courtland av intersects 327 Morris Marie (c) 829 Slocum Jewell (c) 908 Slocum Curtis (c) 910 Willis Jos (c) 920 Rice Winnie K (c) 922 Davis Jas G (c) Mays av intersects 924 Vacant 925 Vacant 926 Brown Wm N 930 (870) Callaway Henry (c) 931 Sanders Abram (c) 933 Vacant 935 Maxwell Chas (c) 940*Hodges Robt D gro 941 Calhoun Edw 944 Turner Jos (c) gro 947*Cox Thos E 948*Klein Louise Mrs 950 (892)-^Reynolds Susie gro Thir*d av *inter*sects Second av intersects 952 Bryant Laura (c) 954 Read Monroe G 970~-Young Clarence T gro Barfield Lester L 974 Callhoun Ernest Rev (c) 975 Vacant 976 Riley Nonie gro 977 Hutto John B 978 Riley Nonie 980 (935) Carswell Vera I gro 982 (937) Estes Geo P uphol 982 (939) Goodwin Jackson T (c) gro 984 >01003) Stone Sami (c) 9S Ruislsell Jias Oc) 1001 Riley Vincent 1002 (1007) Chapman Eug (c) First av intersects 1009 Johnson John C 1010 (926) Morgan Cain (c) Comer Danl (c) 1011 Thorpe Cicero 1015 Vacant 10117 Clay Chas H 1025 (933) Webb Ada L (c) 1027 Jackson Carrie (c) 1028 (928) Mace Wm A (c) 1029 Nelson Henry 1031 Hill John (c) 1033 Barfield Chas W 1035 Edwards Eug (c) 1038 Chapman Leonard (c) 1039 Gates Cleo Oc) 1050 Taylor Sami L 1100 Sims Jas Oc) restr 1102 Sims Oliver (c) 1106 Furman Thos (c) 1107 Melton Durwood B 1108 Grfeen Chas A gro 1116 Slocum Wesley (c) 1122 Jackson Richd (c) 1126 Gates Thos (c) gro 1129 Causey Steph B filling sta 1130 Calhoun Ela'rly (c) 1132 Vacant 1133 01793) hKnight Jas H gro 1135 Berkner Jos H 1201*Young Harry L 1205 McPherson Andrew J 1220*Dixon Thos T 1224*Moulton Leonard D 1249 Owens Lawson H 1250*Perry Thos M @ >1112217805*IMMoasylana(rHd enWrym HM 1300 Smith John E EiOllbAlexan'de'r Ethel L MOORE--From Fourteenth west to Sev- enth, 2 south of Pine MOJuOaRnEav(SeaosutthtoMGaacnotnt)C--ity Frdr,om1 soSuathn o6f *GLyonomdwoionreWamv R MOORE AL--West from 423 New to Spring and north from 103 Washington to Cherry 21 WReiylsnoonldsLuIcsialeac (c()c) 8 Blash Sami (e) 9 (1): Battle Gussie M (c) 11 Cochran Walter L (c) 13 (3) Fitzpatrick Annie (c) 15 (4) Stevens John (c) 17 (5) Ransom Wm (c) 21 Gibson Geo (c) 24 Gibson Isaac (cj 143 Davis Emma (c) 150 Davis Amanda (c) 151 Thomas Temple (c) 152 Brown Ethel M (c) 153 Phillips Carrie (c) 172 Gorman Carson (c) 770 Denmark John (c) 772 Walker Fanny (c) 773 Hammond Leola (c) M1OOsoRuEthAoVf--DWemesptsefyroamv 118 Rock av, 500 Roundtree Bessie (c) 501 Cuyler Rebecca (c) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 490 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 MOORE AV--Contd 503 Shelley 'Sampson (c) 505 Mathis Mary L, (c) MOSpOrRinEg LANE--West from 115 New to 202 (72) Vacant 204 (545) Vacant 206 (553) Harris Matilda (c) 206 (543) Vacant 207 (545) Vacant 209 (116) Brown Pauline (c) 210 (555) Williams Wm (c) 211 (115) Robertson Wesley (c) 215 (558) Wilder Albr (c) 216 (556) Jackson Irene (c) 217 (857) Johnson Dora (c) 219 (820) Harris Rosie (c) 222 (559) Rozier Andrew (c) 222234 ((258557)) HAvuetclihniengBsapMtiasrtthCahu(crc)h (c) 226- (101) Cochrane Abr (c) 226 (175) Hightower Josephine (c) 228 (174) Minnefield Minnie (c) 229 (113) Huff Marshall (c) 230 (122) Graham Sarah (c) 231 (112) Vacant 233 (111) Graham Edw (c) 234 (223) McCrary Smith (c) 235 (110) Alexander Winnie (c) 236 (221) Vacant 237 (121) Jackson Martha (c) 239 (131) Thorpe Sarah (c) 241 i(2(2(6) Glover Gussie (c) 243 (226%) Goodman Jos (c) MORGAN (Unionville)--From First av east to Third av, 1 north of Hoge 100' Hightower Griffin (c) 101 Williams Emmett (c) 104 Hart Hattie (c) Second av intersects MORGAN AV (Western Hts) -- From 271 Oakland av west 221 White Jos C (c) 227 Taylor Edw (c) 233 Davis Perry (c) 239 Williams Maggie (c) 243 Dorsey Otis (c) 249 Sanders Jas (c) 287 Kell Roy T 291 Mullis Newton M ss Mercer Stadium 304 Cheever Wm H Oakland av ends 313 Thames Thos J Roberts Waldron E 317 Chiles Benj F 388 Barfield Ellis H 397 Hardeman John W 398 Heath Ira C 430 (69 King Crawford (c) MORRIS -- From Industrial Home rd south, 2 west of American blvd 101 Anderson Geo R (c) gro 103 Anderson Geo R (c) 111 Howard Walter (c) 113 Maddox Nathan (c) 114 Smith Mary (c) 120 Howard Louise (c) MHOiRllRIeSast(East Macon) -- From Fort MOSLEY (Unionville)--From Fifth west to Key, 1 north of Poplar 129 Jones Eliz (c) 29'5 Carter Leah (c) MOUGHON (Vineville)--North from 476 Third av 105 Rushin Wm (c) 100 Holland Beulah (c) 109 Byas Marie (c) 112224-OV.paicttasntWalter (c) 126 Bradford Lucinda (c) 127 Wimberly Wm (c) 130 Vacant 113324 J(1o2h8n)soWnillBiaemmsonEb(ecn)ezer (c) 201 Vacant Fourth av intersects 203 Walker Henry (c) 210 Bailey Jacob B (c) 211 Cobb Wm (c) 220 Duval Jos (c) 221 Martin Annie (c) 223 Vacant 224 Vacant 225 Dennis Eveirett D (c) 227 Battle Lucy (c) 228 Proctor Lizzie (c) 229 Gibbs Horace (c) 231APitts John (c) 232 Walker Robt (c) 253 Green Harrison (c) MSUpLrBinEgR, R1Yno--rthWoefst Cfhreormry Eighth to sw cor Willingham Sash & Door Co se cor-C'(Cwrlohpsep)er R C Co farm machy 100-i'Na.t.l P.ecan ,,MarkSeetvinegnthAsinsntersects 1.^01MHiudddsloen GVaicPtoerciaan (Gc)rowers Assn 105 Vickers Lillie M (c) 107 Hogan David (c) 108 Flowers John E confr 109 Cooper Almeda (c) 111 Hopkins Katie (c) Gas House la intersects 113 Martin Carrie (c) 115 Macon Gas Co (plant office) S*ixth *inter*sects C of *Ga R*y crosses 3,, 0,,1*Gulf Oil Carp filliFnigfthstaintersects 305 Swift Wm O soft drinks 331017-B09loAoSdcwhaolrlthPaFirnatncCeos Irnecstr 313 Vacant 315-0/Hotel Macon 321-ODure & Beeks Co ins -ODure Leon S Co investments Realty Investment Co ' -0-Hotel Macon Co Nevarro Apts CO rental Broadway intersects 400-02 Vacant 402% Lodge No 1 Knights off America 403-05*Stroberg Body & Fender Wks Swann L Frank auto repr 404 Miraglia Edw gro 404% Deep Sami 4064'Mulberry Wine Shop 407 Vacant 408-10AHuhn C & Son hdw 409ACassidy's Garage auto repirs 414 Vacant 414% Davis Walter E watch repr 441165-O19g0bCu'rhnapmRoanb'ts EGasroafgte drinks 418 -200-Mulberry Market gros 422 Vacant Alley intersects 4465122%A(RoM!g,ae!rrtsinStLoirlelsie gMrorss 456AGreat A & P Tea Co The gros 456% Vacant 458APiggly Wiggly Stores gros 460 Peacock Allie Mrs462-64 Birdsey Flour Mills (br) 466 Osborne Otto O beer 466% Bunch John E 470ASpiller's Restaurant Federal Building Post Office U S Agrl Extension Co Home Dem Agt U S Agrl Extension Bibb Co Agt Army Recruiting Office 491 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Macon Federal MULBERRY--Contd Federal Bldg--Contd U S Commissioner U S Dist Atty U S District Court AU S District Court Clerk U S Resettlement Admin (office) U S Home Owners Loan Corp U S Farm Credit Admin U S Internal Revenue Service U S Internal Revenue Auditing Dept U S Income Tax Office U S Marshal U S Navy Recruiting Station U S Organized Reserve (Army) U S Post Office Inspr U S Probation Officer U S Referee in Bankruptcy U S Weather Bureau Third intersects 501-09AStewart Oil Co filling sta 502*Jacob's Pharmacy 504ADavis F Clark phys Rex Optical Co Head Geo W ins Adams Realty Co 506ABruce Terminix Co bug extermi- nators ASmith L C & Corona Typewriter Agcy 508*Hatcher & McCrary Inc ins Hatcher Turpin & Hogan Inc ins and real est ^Georgia Underwriters Inc ACo-Ciperative Fire Ins Co of the State of Ga SlOAHotel Fickling SlilABrown Sign Co 512 Vacant 514-iDavis Ethel B Beauty Shop Moseley Thos A 516-22 Georgia Casualty Building Rooms: lOlADessau Realty & Ins Co ilOdAOhandler Sami S Ins Agcy !110034-G06rAegRoermyinJgutoannitRa anMdrs restr Inc office supplies 109-10AAmerican Optical Co lll'lAGeorgia Motor Finance Co 201AStrickland E H & Co ins 203ADavis Ins Agcy 204-05i'-Holmes John R phys 206-07AKansas City Life Ins Co 208ADick Thornton A chiropractor 209 Vacant 210ASchofield Ins Agcy -0-Lewis Julian S ins 211-13 Vacant 2150-Grice & Grice lawyers Casson R Habenicht lawyer 218-191 Macon Community Chest 220 Macon Trading & Inv Co 301-06 Prudential Ins Co of Am 301-03AMoore Johnson & Thomas law- yers 307-08OConaway Paul M lawyer 3080-Sanders Wm H lawyer Macon Circus Equipment Co Inc Rogers Show Co Inc 310-13ACotton States Pert Co 314-15 Christian Science Reading Rooml 316-170'-Macon Credit Bureau 318-19 Vacant 3200-Bell Hallie B lawyer 401-04-0-Park & Strozier lawyers 4050-Courts & Co brokers 4060-Warlich & Co cotton brokers Levie Otis H cotton broker 407--'-'0S8c-a0r-Bboalrdowuignh Cecil A lawyer Richd F lawyer 409-1O1P1 lOuNnkotettitngR'hioabmt G & lawyer Nottingham O-Alacwkeyremrasn Chas lawyer OAtkinson Mallory C lawyer 412-13 Ga Natl Guard 121st Inf Hdqtrs 4411450VFaocwalnert Benj J lawyer 4170Fountain Jas A phys 418-20OAldrich Fred N phys Kipg Jas L phys 501-020-DeFore & Estes lawyers OAidams V Jas lawyer County Attorney 503OGleason Ovilla M dentist 504-09-OMet Life Ins Co 510OMiller John N phys 511-13 Vacant 514 Vacant 515-noMiller & Lowrey lawyers 518 Vacant 519- 520- 601ocork & Cork lawyers 603 Vacant 604OPopper Jos W lawyer 605-OLewis Logan & Co investments 606ORespess E Roy dentist 607 Vacant 60OJenkins Wm A dentist 609-llASiegel Alvin E phys 612 Vacant 6130-New England Mutual Life Ins Co ABeall Olin P ins 614-18AHall & Bloch lawyers ONapier J Hamilton lawyer 661290-AdOHodlolmChRaesaHltyla&wyIenrs Co 701-03AChilds Wyatt B orthodontist 704-08ANatl Life & Accident Ins Co of Nashville Tenn 709ABoswell W Chas phys 710-ll-18-19-20AAnderson Jas C phys ARawls Lewis L phys ^Williams W Augustus phys 712AO'Neal B P jr & Co inv 714*Vacant 715ASuarez Raymond phys ASwilling Evelyn phys 716-17 Vacant 801-02ASelden John A phys 803*Boone Toof A dentist -C'-Heard J Milton jr dentist 804-07-0-Adams Irby H phys ANewton Ralph G phys AKemp Paul S phys 808-09*Southwestern R R Co 810APorch Leon D phys 811-12 Vacant 813 Vacant 817- 818- AWasden Chas N phys Aphillips A Maynard phys 901 Aware Ford phys 904-05ARichardson Rhea W phys 906AFelder Thos S lawyer 908AStukes Jos 909ASnelling J PTalmdeenr.tisCt1 S pract 910-llAMcKay John J ins 912-l9AHarris-Harris-Russell & Weaver 920AMlauwrpyheyrsRobt H dentist lOOlAFire Co's Adjustment Bureau Inc ins 1002AValentine E Henry dentist 1005AGates Paul G dentist 1006-20AJones Johnston Russell & Sparks lawyers Jones Robt B lawyer Oliver Carl S lawyer Benton Edw L lawyer Street continued 551177%KeTllurAnlaegxe shForeanrkepr 519Agpivey Harry A (c) tailor Jung Frank lndry 19% Jung Flrank 521AHainline John L wallpaper 523AOscars Place beer 525AHotel Lanier AHotel Lanier News Stand Hotel Lanier Cafe Sparks Specialty Co vending machs Savings & Loan Ass'ii Loans on City Heal Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York O O 492 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 MULBERRY--Contd 547AKuhn Mfg Co The janitor supplies &52AtAmetriran Printing Co 554*Lyles Benj F restr 554% AJohnson Clebie Mrs music tchr Jones Lucille Mrs music tchr 556-0-Dennis & Dennis archts AMacon Dental Depot dental sups AHolmes Wm B dentist 557*Davis J LaFayette real est AUnderwood Elliott Fisher Co type- writers 558*Palace Barber Shop ABishop John T clo clnr 559*Pittman M C Roofing Co AEves Electric Co 559%ABlossom Geo L mfrs agt 560-62AMcClure Office Equipment Co ALyon Harris & Brooks printers 561ASouthern Paint & Varnish Co 563*Hardeman G G Co real est 556643%VAacLaenttter Shop The 565AWilliams Luther & Son private bank and ins 565%-67AG A B School of Commerce R5o6o6mWs: ashington Building l--A'-HSaannd'ceorcsk WJmohnL Mloanlaslwyer 2AChurchwell Daisy L lawyer AGillon O Grady lawyer 3-4ALewis Arth lawyer ADaly Augustin D lawyer McCreary John J lawyer 5 McCowen Richd B lawyer 6 Vacant 7 Vacant 8AMcClellan Wm A jr lawyer AWest Wm M lawyer AiRjaimey David R lawyer SAFausett J Albert jr lawyer AHirsch Emile lawyer 10 Vacant 11 Vacant 12 Grace Walter J lawyer 13 Vacant 14 Jacobs Thos A jr lawyer 15 Vacant 29 V&csnt 3d flAKaigler's Business College Street continued 568AGenone's Barber & Beauty Shop Associated Master Barbers Chapter No 284 569AHolt A T Co real est Alrby Bros Inc plmbrs McCreary Julia ins 571AAtlantic Refg Co oils Sloan Kyle Service Sta filling sta 572AAndrews Magruder locksmith Kitchen's Kitchen restr 574AChapman's Pharmacy Second intersects Court House (For occupants see 2d nw cor Mul- berry) 610ACrockett Roy W loans Newton Arth F broker 610-20 Salvation Army Building 612 Salvation Army Young Peoples 613 VaCchaanpt el 614 Salvation Army Red Shield Lodge 615 Vacant 616ASalvation Army The Women's Emergency Lodge 17 -Grand Building The Grand Theatre Rooms: 201 Vacant 202 Vacant 203-05AChapman HD&Co whol Ibr AReid H M & Co whol lbr 206ALamar Walter D office 207ACommercial Casualty Ins Co 208AJoanis Wm C dentist 210-12ANew York Life Insurance Co 213-14 Vacant 320115AVDaocvaentWm B phys 302 Vacant 303 Jackson Wm R office 304-05 Vacant 330096--1008AAPperongnreMssiuvteuaLl ifLeifIensInCs oCo 311-12ADaly Jos K acct Ainterstate Bond Co finance 313 Vacant 315 Vacant 316ABowlby Noble E lawyer 401 Vacant 402 Vacant 403ARubin Sami N phys 4O4-06AAm Natl Life Inis Co 406-07 Vacant 408 Vacant 409A-1E2qPuietnabdlleetoLnifWe mAsEsuirnasnce Society of U S 413-16AHall Thos H phys 501 Vacant 502APeninsular Life Ins Co 503 Vacant 504-06ACarolina Life Ins Co 508-10ALife Ins Co of Va 511-12AWallace & Wallace lawyers 513 Macon Academy Music Co AOffice of Building 514 Vacant 601 Vacant 602AHays Russell M ins 660036-A0C5AhaMriosrgoafn M&acMonorgcaonrseItnss Agcy 607A(League Ellamae E Mrs arait 608-10Ainterstate Life & Accident Co 611-13ASchuster M Richd dentist 614ABGarriknlaelydsRAicrhcdh Dpurlacwh yaegrt 7Stthrefelt Vcoacnatinntued ,, 618 Salvation Army Red Shield Lodge dining room 619AJones Malcolm D jr radios 620 Salvation Army Citadel) 652 Havnaer Clarence E 654ASmith's Battery & Electric Co AWhite Guy M radios whol 665608 FViarcsat nPt resbyterian Church 663AHotel Arcadia Mahone Wm P 667-73AFirestone Auto Supply & Serv- ice Stores First intersects 701-51 Mulberry Street M E Church 710AMasonic Temple Masivic Club Zerbal Lodge of Perfection WFeir&MAarMshall A Lodge No 448,, Weir Chapter No 1 Order of De- Molay Kadmiel Chapter No 6 Knights Rose Crox Mabel Lodge No 255 F & A M Wolit'hin Lodge No 390 F & A M. Elberta Chapter No 215 O E S (Macon Consistory A & A S R of F M ,, Macon Grotto M O V P of E R Weir Marshall A council Knights Kadosh 716 Thigpen Budge C Harper Eunice music tchr Vigal Eliz coml artist 718AGans Floy B Mrs 720AMullis A Lamar 722 Carey Aurie nurse ABeard Carl L ,753AWood Thos J 775576AAHFlaelml iVngirgWiemMPrs 759AChambless Christopher E 761 Edwards Felton B 765ADuBose Jas H 768AKing J McDuffie 769 IBranan Jos J 493 MACON Moving Packing - Crating Prompt Efficient Service TRANSFER NEW AND USED FURNITURE OOa 408 BROADWAY PHONE 304 M7UMLBoE'bRleRyY--WOaolntetdr E ^ intersects 801&Grand Lodge Bldg F & A M Grand Council of Ga R & S M Grand Lodge of Ga F & A M Grand Chapter RAM 880024A*MBiegrbcverFEedliwx B A8p10arBtmloecnkts:Apartments l&Block Alex 23&JoHredrmananJoEhmnmRa M Mrs 4 Torch Isadore 5 Woodard Lyman B 6 Marsden Ethel 7 Cagle Guy N Str8eePt ercroyntNineulledL 881174A-oWpiattlslacMe oRrotubatryE Beebe Eliz drsmkr 821 Barnes Avey Mrs 854ABurke Wm B Rev A8p5a5rtKmaetnhtesr:ine Court Apartments lOO&Slade Jos W 101 Taylor Edw F 102 Powell Mary A nurse Norris Ethel nurse 110034 HVaarcdainet Pauline 105 Felmet Jas B ir 110067*RSeaimllpyleHNenelrlietta G .Mrs 200 McKay Henry M jtf 220012 VAsahclaenyt Wm , ,, 203 Wilkinson Frank L 204 Ross Arth W 205 Alsup Chas B 207 Moore Robt 300 Wachstein Lenora Mrs 301 Hall John K 330023*BDausnsawIraeyneRLalpMhrsT 340050-0F-rKiuehdr HEadtittihe MKrsMrs 401 Daniel Tillie K 402 Vacant 403 Rickenbecker Thelma 404 Rubin Sami N . 440057 VHailclanGteo W S3tr5e6eitRocboenrtsinounedKath M Mrs @_ S0Wasdin Jessie C A8p6a4rtTmeerrnatcse: Apartments 1IBAAECllliifottotnRRuosssceolle HV 1C-E Taylor Fannie Mrs IF Snider Jas H 2A Rawls Lekis L 2B Kelly Jas H 2C Jackson Albert 2D Thornton Wm D 2E Vacant 2F Vacant 2G Kolodner Morris 3A Jones Wm H 3B Voight Andrew W 3C Cherry W Comer 3D McGehee Jas T III 3E Brooks Gordon V 3F Fleming John C 43AGEWthhritiedgGeeoRFobt A 4B Williams Jas B 4C Funkenstien Flora Mrs 4D Mitchell Nan 44EF'-VCaocnannetr Wm M 4G Ethridge Robt A 5A Scarborough Ernest L 5B Senft Henry P 5C Tabor Ruth 5D Waters Phillip H 5E Vacant 5F Vacant 5G Lloyd Herbert C S8t6re5e- tTucronnetrinJuaesd , , .. 866- 867- 886689*VCaacldawntell Lewis J Hancock Alf J 869% Webb Jesse T 871 BMeanrntienttJEOlosiscearR Mrs Prator Wm M 875-0-Starr John H 877-OEskew Frank R 8790-King A Rawson MULBERRY LA--From Sixth to Sev- enth bet Mulberry and Walnut 20 Johns Wm (c) 22 (19) McCarthy Alene (c) 24 (18) Cullins Leila (c) 26 (17) Harris Lilly (c) 28 (16) Felter Mary (c) 30 (15) Rice Gertrude (c) MURRAY AL--From Third to Broadway south bet Pine and Oak 1 Harris Willie (c) 3 Armond May (c) 4 Pitts Lee (c) 5 Wright Emma (c) 6 Pitts Sonny (c) 7 (6) C'olbert Peavy (c) 8 Solomon Villa M (c) 9 Vacant 12 Jones Sami (c) 16 Wilson Rosa (c) 18 Springs Boyce (c) 80 Macon Three Centa Bottling Co 724 Morgan Lula B (c) 785890 DHaonseieylsCaLrurilae B(c) (c) 1230 Bloom Philip (c) MUTUAL AV (VineviUe) -- From Forest av west, 2 north of Douglas av 100 Davis Hattie (c) 101 Felter John (c) 102 Johnson Morris (c) 106 Redding Elijah (c) 110079-S0-uTlhlirveaatnt CBleanrkj ((cc)) 111 Fambro Dinah (cP)enn av intersects 133 Howard Robt (c) 220001AVDaocuagnltass Vinson B (,c) _ 203 Howard Roberta 204 Vacant 205 Fowler Pierce (c) 207 Reed Ruffin (c) 209 Felts Wm (c) 210 Meadows Wm M (c) 211 Patrick Robt G (c) 212 Galloway Horace (c) 214 Irvin Wm (c) 215*;Lockett Arth (c) 216 Howard Martha (c) 217 Lamar Sami (c) 218 Patrick Henrietta (c) 218a Mabry Julia (c) 219-0-Smith Fletcher C (c) 220 McNair Georgia (c) 222 Hill Zachariah (c) 223 Evans Nathaniel (c) 225 Williams Henry (c) 226 Hardin Wm (c) 227 Foster Claude (c) 228 Howard John 230 Davis Eva (c) 231 Walker Jos (c) MYBaRlTkcLoEm (aEvastto MHaycdorno)lia--, 1 Fsrooumth 10o5f Main 105 (ID Harden Herman 108 (5) Lawless John I YOUR CITY D I R P C T O R Y MIRRORS the CIVIC Of Your CITY 0 0 494 D. H. Adams TAYLOR STORAGE SHIPPING Motor TRANSFER COMPANY 458 PLUM ST. PACKING PHONE 388 Co. MYRTLE (EM)--Contd 114 (9) Bowden Homer J 115 Potter R Green 119 (7) Chapman Homer J 123 (8) Long J C 517-0-Clark Emory G 518AJohnson Chas W 600AKmney W OscaPratterson intersects SOlAElkins Henry W Studebaker 2,,0,,0,, (101). Vacant Jones av intersects 210 Cooper Bertha Mrs gro 659ARoush Kate M Mrs OSOATlruesdel B Rhett 662ABenson Frank C Willys MYRTLE (South Macon) to W Granada ter Changed 663AHubbel Geo W 664AStripling Pinkney W 666 Vacant Hupmobile Sales NAPIER AV--From Coleman av west to Inverness av and city limits 105ASmith Chas M 110076HCahmaprpiclek MIdaaggEieMHrsMrs 110098^WAillelxiaamndserAnLnoiweeGll MC rs 110 Wilson Carl J 111 Anderson Janie Mrs E Napier av begins 111154AVBaacragnetJ,oh, n A Hugenin av begins 116 Smith Lena 668 Odom Chas A 670 Cherokee Hts M E Church 685-'.'Clark John B 701ABenf,oird CaPrtieor NGonoMalrvs intersects 702AMartin Haidee music tchr 704AHodges Chas T 705ARobles Orryl S 706*Harris David C ir 708*Walker Horace D 710 Tanner Stanley K T71T2lADSaivheisphTehrdosLEouis A 714 Megrath Chas H 122AVandiver Eliza Mrs 124Coe Cora A Mrs 126ALamb Lillian G Mrs 7l5*Meyer Jtas _B_ Courtland intersects 716&Cater Kathleen B Mrs 655-657 Third St. PHONE 2997 128AJohnston Thos A 129ADavis Nell McK Mrs 130-QMartin P Webster 131AJones Ben.i p 134AWilliams Horace G 135 Robinson Robt L Holt av intersects 200 Early Paul K 202AGrimmett Thos W 220064/*-FBeal,sdhinugk Edw Sami B 208 Few Mark C , Courtland av intersects 772900iA'-QShhi?n^hko?leserHH4eignhrtys SBaptist Church 722AButler Danl F ASlo-cumb Airth G 723*Rose Carl P 724*McCowen Mamie Mrs AStewart Arlie 726-C'Estes Jas C 728*Holt Mamie L 730*Gober Randolph W 732AHardison Geo O YOUR CITY D Blackburn av intersects 306 Vacant 307 Naperian The Apartments: 2lARGaoustHinarEry TL 3ABurney Linda M Mrs Stre4eAtMccoLnetninduoendCortez H 311-OBishop F Jos SOOAWood Thos LUyer aV intersecfe s8o0l4A*?Mfladc?kleenbrJ?oJh5sn Louise E H Mrs 806ASchwartz Saul 808 Hanberry Rlchd L Sol?O?irEBlaek;meirnRSteMpahrsJhaRllevR 881121AFSeHtreagvrureisnsosnMLJaoryhKnAayCMrs I R E T O R Y MIRRORS the CIVIC Of Your CITY 312Astevens Robt L 318ATaylor Mattie E Mrs 324 Evans Wm G 3300-Ellis Oscar L 336 WPoaollkeerJaLcekwiWs A 401ADavis Ethel HAenMdlresyav intersects Davis Lemuel nurse 403*Strozier J Searcy 4400540GRaaillelvardRoWmmas PH 406 Cary Mamie Mrs 407AByars Steph M 410&Chapman Carl F 412ASauls Wm C 446114AHPaartdtiellmo aWn mRoAbt W 43-2>Maeon David APatton Henry T AChapple Alf B 465-OChambers Jas J 467*Wagnon Wm C 5cn0.0 M' oore E,,rnest L Birch intersects 50K'Hartness Chas C 550032ALGanolgdsgtaornBMeranbaerldMrs 505 SCahpapffiningtSonamBi eTni P 506AKeen Osee F Dr 507*Morgan Mary E Mrs 511*Birch Ada L Mrs 513 OBdarofmieldShFelromydanTE . 551154&SMnyedrreirtt LBoeusissieN Mrs 516ABlair Madge R Mrs 814 Cowan Richd B Eighth a*v b*eg*ins 901AA.W.. n g,ht M EarlWinton av intersects 9034'Bennor Jos N 905AB(9re25w)erGWillmon JO Grady 906AHiggison John J 907A(D93a5n)ielMForoerde MCecil A 908ANorthington Harry F Rev Holloway Lucius G 909*Baker Eliz Mrs 910ABarnes A Emmett 911Cart Edwin J 912*Austin Hardwell M ASpitz Chas A 914AMcAfee Robt K 918 Pilch,, er's Service BSrteantwfiolloindg bsetgains 920 Vacant 930 Vacant 994420/A-'FBirsahdeyr'sJaDs ruEg gro Store .1.0.0.0-02 H__end, erson-TumCerrescCeont garvos ends Turner Russell llOOOOelA'-DMecnDt oHnaaldrriSsoanmiHH 11001078*VRaocbaenrtts Wm L i1m10o2 Bnati.eman R,,o,bt LBartlett intersects 1104i'Sherwood Emmett L 1I1l11n00o98ACTJ1ao0rh!0sn5w'seolKnl iRtAcolhlseesnniesDEEudoxie 495 S MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 0 455-57 SECOND ST. TEL. 4401 u NAPIER AV--Contd 1113 Watts Robt B 1115 (1114) Grant Otis G 1116 Rasmus Jessie (c) 1117 Reeves Iola Mrs 1123 Hicks Wm (c) 1125 Hodges Mary (c) 1127 Maynard Thos (c) rear Thomas Oscar (c) 1129 (1226) Jones Danl (c) 1131 (1225) Jackson RobEerrnteast(ci)ntersects llStK-'Means Fredk S 11115557-MORcoKssemndanreeWJmohHn C Griggs Walter D 1159 Redmond Jesse H 103 Roberts Saphronia Mrs drsmkr 104 Moore Mary E Mrs 105 Moore Robt L 107 Barker Florrie H 109 DeFore Jas A 111 Ezell Jas H 112 Arrington Wm S 111134AVJaacrarenttt Ch'as K 115 Vacant ^ 117 O'Neal Jos C 119 Leggett Vernon E 121 (159) Clark Sami 116610AADBuonnnnerJeCssleevWeland H 162AGreen Thos B 164 Strong Henry T H L A N D HOTEL 1161 Green Lee R NAPIER AV E--From Junction of Vine and Napier av west to Holt av 501 Rogers Stores gros 503 Vacant 505hScott Minnie G Mrs gro 5017 1(501) AGriner Frentz B 509 (505)dStubbs Ollie C Mrs 511 (507) Amerson Steph H 513 (509)*Miller J Ogbum 518 )(5il'l)-Scabt Robt L 517 (513)*Roney Sami G NEAL AV (Vineviile)--West from For- rest av, 3 north of Douglas av 101 Brown Wm (c) 105 Rogers Sarah (c) 108 Rozier Homer (c) 109 Perkins Lula (c) 111101 MArilmlsstTrohnego (Ecl)la (c) 112 Vacant j^EW -- From river south to Maple, west of First 5 Durham Garfield (c) 52 Johnson Sara (c) 54 Goolsby Wm B (c) 58 MCianhdoyneLeHear(rci)son (c) 62 Watkins Jeff (c) rear Bennett Geo (c) 65 Johnson Lillie B (c) 69 Greer Ernest (c) 73 Cooper Geo (c) 75 Chance Wm (cO) cmulgee i.nt,ersect.s 104AReid Walter T (c) 106&Lovelace Edwin P 110 Johnson Martha (c) 111 Davis GertrudeNe(wc) St la intersects 114 Kine Chas (c) 111251'MlSohoarrep CMleavtteileand(c)(c) "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection S69-571 Broadway Tel. 3047 113 Wright Wm C (c) 114 Ross Sami (c) 122 Thomas SylvesNteerw (cS)t la i.ntersects 115 Lucas Henry W (c) 116 Anderson Mary (c) 118 Collins Roberta (c) midwife 119 Howard Frank J (c) 120 Hughes John W (c) 121 Banks Leila (c) 122 Hughes John W (c) Psehnone irnetperrsects 133 (300) Jones Sami (c) 151 (152) Williams Edw (c) 153 (100) Howard Sami (c) 200 (305) Young Malinda (c) 202 (135) Vacant 206 (200) Williams Thos (c) 208 (218) Davis Hugh (c) 210 (213) Billingslea Seaborn B (c) 223 Atkins Edwin (c) 225 Dixon Irvin (c) 227 Smothers Thos (c) 229 Moore Wm (c) 21301 Chestnut Jos (te) 350 (1) Chambliss Jos (c) NEEL (Unionville) -- From Cedar west, 1 north of Dempsey 101 Ryan Benj (c) 103 Barnett Ferdinand F (c) 111 Vacant Fourth av i.nt.ersects 150 Lewis Bessie V (c) 115563-*OPToohlomJpusloinanWTm A 15l7APool John T 164 Gaines Mattie C Mrs 170*Pickett Chas A Wgroalnut intersects 201 BTwroiwlleny AOlfrlaLndo B 203*JOacdkosmonRoGbetoL C 205Gordon Harry 212*Tyner Thos B 215-OStone Jas G 219-OCranford LSoiunigsleDton's la intersects 220&Kitchens Chas M 251 KJoanleesr ACortrhinnSe Mrs AMason Eliz Mrs AWillis Edw 253&Whitehead Mamie J 254AWard Louis A restr 255-AWeatherford Sami A 257*Gresham Walter G 259 Hale Jesse L 270ARav Edgar L Mulberry intersects Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 Third av intersects 201 Johnson Sami (c) 205 Dillard John (Sc)econd av intersects 215 (255) Collins ChaFsirs(tc)av intersects 306 (6) Vacant 389 Robinson Sallie J (c) 391 (290) Powell Viola (c) 393 Evans Wm (c) 397 Vacant NELSON (South Macon) -- East from 2834 Houston av to Blount lO98OAIvHeilyl PGienok FP 101 Rousseau Edw A 102 Freeny Mamie Mrs 314ABoone Annie M Mrs 318*Etheridge Drew B Mrs bdg 321 Holt Apartments Apartments: 2lA*MHoeletksAlPmaaulMJrs 3 Hummel Albert N 4 Vacant Street continued 322-AHarris Andrew L Parker Sami CSpring la intersects 355AWilson Fletcher C AJohnson Sara W Mrs Edwards J Harvey Cain Robt L O'Neal John G Langford Wm C per volume R. 1. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 496 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. THIRD AT PINE GMC TRUCKS PHONE 5100 Members N. T. Stock Exchange N. Y. Cotton Exchange ChicagoTraBdoeard of AssNoc. iaYte. MCeumrbbers Exchange NEW--Contd 356 Barnes Apartments Apartments: 1 Barnes Ruth Mrs 2*Freeman Roe S 3-'-'Worthington Walter 54*GSamteitsh WIreilnlaerd Local Stocks 6 Wellons Shellie E jr and Bonds 7 Ferguson Wyolene Mrs Stre8e4-tBrcoownntinWuedEug Government Bonds 359 Davis Ola 360ABOr'oNwenal MJoahrvninH Wade Robt Home Owners Loan Corp. and 415 A. par,tment,s Cherry intersects 1 Hickman Alice N 2AAnderson Frank A Fed. Farm Mortgage 3&Roquemore Minnie L Mrs Stre4e-0t-Fcrounitttiincuheerd Lila H Mrs Corp. Bonds 417&Washington Fannie Mrs 4194'Patteshall Steph E 658-AThomas Jos E 6614-Otto Julius H 4L-Caamrrb HDeuyrweollodF P 6694'Burns Wm C 771l44AAsS:caoft?tnnMHemosopriitaall CNouttraagee? HomfC' 7204-Board of Health ^v3soAaMtit-mor F--anni.eCLhapMpresll la intersects nfffWiHiams Robt A 754% 4-Carey Effie Mrs 756-APorter Geo P 756%P4o-rMtecrAErtrhnuerstThCos E 7574'Herndon Chas A 760-ABethea Clarence P 765 GWraietkrsinosn GRoeosa AE Mrs 766 Matthews B Frank ^Gregory Wm C 7714-Whited Sally Mrs Banks A Jack Municipal Bonds Bank Stocks 405 Ga. 4214-Martin Steph D 423 Pierce John E 425-SWhalen Chas E 427-C'Haskin Rosa Mrs 440ANowell Nonie C Mrs 4424B-Gornafvaevs LJoilhian BE Mrs 444 Vacant 814 Toole Robt M HemlCk tatersect 816AGriffin R Lee 8174-Simmons Fred W 882109ABTilalyinlogrsleHaouVsitcotnoriNa Mrs 8214-Callaghan Martin J AHolloway Albert Casualty Bldg. 4484-Watkins Thos M 8524Wilson MrsWhUehead al tatersects Phone 1681 452 Vacant, Park Hotel al intersects 4534-Bailey Andrew C 445564AVTaacyalonrt Hugh N 457*Lane Obie Mrs 4534-Tillery Homer W 4594Hancock John L 460 Collins Willis Mrs 461 Spiller Foy M Mrs Poplar intersects 854ABMesatrloRwaeymEollnad MCrs 855-ADozier Warren C Newton Pearl M Mrs Doke H Lane 885680-4A-HMaaytehsewJsosRHemella Mrs --Patterson Hilda nurse Presley Julia nurse 8624BMocoGkeeer ERuLtehe nurse 552108&AHvuetrchhalnrtgsJaFnuiener(ca)l Home Inc (c) McGee Erith E nurse Glenn Walter 521-Q-Catholic Club House 552AMitchell Melvin C (c) phys 554 Washington Memorial Library (c) (br) 67AWallace Raymond 3694-Fianders Win R 901 Mays Thos L ranffe intersects 555 Vacant 902ADevlin John P j^^Knights of Pythias Building (c) 903 Dodd John S Who Sells 200 Vacant 330040--0062 VHaocllaenyt John C (c) dentist 3d fl Grand Lodge K of P (c) 904ADrew Thos A 990055%TeBrreyll AHlloiemeMr rEs 9900764H-RaeidgdhitngLeAstretrh WF 400AFrayser W Neale (c) phys 908 Binion Roy It? 4011-0(2 Vacant 909 Vacant 4044-Williams Joshua S (c) phys 406-08 Afro American Life Ins Co (c) 9911104M-TuurcrkyerBFelrothreancMe rsMrs 410-20AGuaranty Life Ins Co (c) 912 Vacant 412-144-Davis Wanza A phys 913 Grissom Clement D 417AN C Mutual Life Ins Co (c) 914 Vacant Is 419AWalton DeWitt T (c). dentist 915ACrosby Hemmie K Mrs 421-23 Vacant 916 Maddox John Answered 425 Vacant 4274-Atlanta Life Ins Co (c) 917 Apartments 1 Toole Reba 429 Vacant 2 Doles Betty Mrs By the Street continued 557 Godbee Beulah W Mrs 34ABWuecikrnJearckFrancis L 5584-Macon Telegraph The (br) Street continued Classified 567 Fir(sctoloBraepdtisdtepCt)hunrcehws(pca)per 991198 AVpacaartnmt ents Business Lists In this Plum i*nte*rse*cts 660060AVWachaintet,head, Ed TCiorettoSneravvicientSetrasteicotns 608 Brown Calvin (c) 610 Porter Ernest C clo clnr 6144-Muecke & Sons Co Inc cabtmkrs 618 Polenz Gust umbrella repr Cheatham al intersects 21 RBolalnantodn MNaerllyieMMrsrs 3 Simpson Wm A jr 4 Bright Louise Mrs Street continued 920*Kircus Oscar B 922ACrawford Bertha Mrs NEW (South Macon) Cedar Changed to Birectory 665532-WAGilillilenlgahndamAWugmustAus 654AJoyner J Orvine 656AWard Maude Mrs NEW COLUMBUS ROAD -- Continuation of Log Cabin dr Greene Geo F Rivoli Dairy 497 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save NEW STREET At--East from 114 New 110021 ((111159)) ATnhdormewass WJams (c(c)) 107 (114) Lamar Mattie (c) 109 (121) Vacant 111 (118) Vacant NEW STREET LA--From First west to New, bet Ocmulgee and Walnut 1 (7) Vacant 4 (441) Vacant 5-7 (407) Taylor Emma (c) 6 (442) Williams Louise (c) II (18) Williams Edna M (c) 13 (19) Vacant 15 (20) Vacant 17 (5) Vacant 18 (48) Vacant 19 (545) Vacant 20 (148) Vacant 22 (243) Williams Eula (c) rear Ponder Isabelle (c) 23 (110) Johnson Alberta (c) 118 Vacant NEWBERG (South Macon)--From 3047 Houston 101 (108)--Horne Frank H 103 Collins Jas H 104 McDaniel Chas A 106 Horne Hubert W llOdGray Robt W 111 Plunkett John P 113 Phillips Wm M 115 Hooks Jas B 200ALayton Homer E 201&Holmes Leon M rear Plunkett Ernest L 202 Culberson Lizzie Mrs 220053'-,MStaadndcoilxe J Lamar Doyle T 207*Chapman Walter B 209-Price Jas T 211*Snead Sami J 301 Plunkett Jas L 305 Stokes Chester F 307 Howard Ira C 309 (204) Evans Alvin 311 Brantley J D 320-0-Malcom Otis C 322 Miller Wm V NIAGARA AV--North from 425 Winship 250 Smith Henry G 258 Hendrick Chas C NINADELL AV--Changed to Ninadell dr NINADELL DRIVE--From 608 Montpelier av south to Belmont av 107 Hancock David E 1II0I9JMohenadsoownsWByaartnteyT M 112 Henderson Benj K 114 Smith Jas Q 115*Feagin Owen T 116 Matthews Theo B 111178A*BDoewasdeLneoWDm C 119&Tinker Francis E 120Carswell John M Jasamine intersects 202 Johnson H Lee 205 Burnett Jos 209 Kelly J Otis 2155-Stewart Emmett E 225 Chapman M Elton Rev NINT'-AHm--eFrircoamn COeilntCraol (Cbiutylk Ppalraknt)west NINTH AV--Changed to Brentwood av NINTH AV (Bellevue)--From Iudustrial Home rd north, 1 west of Eighth av NISBET PL--North from end of Cherry 10to6*GMeuolrlginias aHv, L1 west of Spring llOAWilliams Robt L NONA (East Macon) -- West from 228 Lexington 229 Jordan Wm (c) 235 Andrews Russell (c) 242 Lowe Sami (c) NORRIS (East Macon)--From 829 Main north 125*Saxon Jas T Rev (c) 128 (227) McBride Sidney (c) 130 (228) Kelley Aaron (c) 131 (230) Smith Lucy (c) 132 Rice Moses (c) Broad intersects 204 (305) Rogers Arth (c) 207 (307) Collier Jackson C (c) 209' Goodwin Arth (c) 231 Irving Delia (c) midwife 232 Thomas Jas (c) 233 Memorial BaptistWCohluforlckhin(tce)rsects 301 Harrell Wesley (c) 303 Vacant 305 Wilburn Wm (c) 307 Turner Philip (c) 309 Orr Jas (c) 310 Glover Sarah (c) 311 Morris Jas L (c) 313 Lane Wm F 314 Mays Jos (c) 315 Capers Jas (c) 317 Stafford Jos (c) 319 Gary Marie (c) 321 Hill Thos (c) Cowan intersects 503 (127) Stanford Sol (c) 507 Bell Robt (c) 511 (109) Griffin Hardy J 596 (108) Chaney Henry (c) 598 es (110) Fort HHiallncCocekmeJteesMrsyei*tc((hccH-ee1)ll *intersects Taylor intersects 608 Solomon Wm (c) 610 Williams Paul W (c) 852 Lewis Geo (c) NORTH (Vineville)--A contiuation of Pursley from First av to Fourth av, 1 east of Craft 206&Boston Mary L (c) First av intersects 210 O'Neal Mamie (c) 214 Whigham Julius (c) 218 Turner Julius (c) 222 Harden Amos (c) 223 Fulmore Janie (c) 224 (254) Blount John (c) 225 Vacant 226 Young Lizzie (c) 227 Pleasant Robt (c) 229 Collier Ulysses (c) 231 Adams Jas (c) 233 Miller J Nathaniel (c) 253 Scott Roy (c) 257 Bennefield Allen (c) 259 Bowens David (c) 263 Mills Rayfield (c) 271 Daniel Louise (c) Second av intersects 301 Clowers Sarah L (c) gro 302 Harper Theo (c) 303 Mt Temah Primitive Bapt Ch (c) rear Gibson Lawrence H (c) restr 305 Hargrove Senie (c) 307 Sanders Geo (c) 309 Williams Martha (c) 321 Gray Iona (c) 350 Pleasant Hill School (c) 357 Kyles Frank (c) 359 (355) Hunt Nicie (c) 361 (339) Green Ellen (c) 367 Danley Jas (c) DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 498 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 NORTH (V)--Contd 369 Odom Alonzo U (c) 370 (334)AMitchell Marion H gro Third av intersects 414 (428) Miller Anna C (c) 416 (426)AWilson Inez (c) 418 Long Mark (c) 419 Phillips Sallie (c) 420 Cunningham Leola (c) 421 Amos Annie B (c) 422-0-Greene H Vernon Rev (e) 426 Greater Allen Chapel AME Ch (c) 427 Williams'Robt G (c) 435 Adams John (c) NORTH AV (North Highland) -- From Baconfield north to Boulevard Macon Motor Boat Club 99AWofford Oil Co filling sta Baconfield intersects 101-OBlasingame John W 103-O-James T Cleveland 105 Hedeman Lennie Mrs 107-OBowen Jesse J fruits 109-0-Carr & Johns furn 113*Power Oil Co The filling sta 117 Alexander School No 3 Nottingham dr intersects 119&Highland Pharmacy 1210-North Highland Grocery 112264/--bPSeirmdmueonWs VmicRtor L 112381A*BLeaeslsaenttderLRuloabtDLMrs 135ARidley Chas L Boulevard intersects 137hTronce Fred W 145ABurney Ella M Mrs 149-OMarshall Obediah M 170*Odom Boykin B 117712AAMChilalemr beWrsalWlaceRoss 117775AATTyernreilrl RAicrthhd LJ ilTBALoyall Thos D @ 181 (173) Mack Ida (c) 183 (240) Vacant 118854A(5W6e2a)vMer cNNeTarerIrreall (c) 187 Braswell Corinne Laurel av intersects 212hKelly Wm L 213ASandefur J Ewell 21'6ACarter J Holland 217AConrad W Porter 218-0-Vance Oscar F 219*Glendenning Don C 225AWhite Paul C 222276&AYMecaCrtlyellJanTWhoms A 231AHawkins John W Summit intersects 305-0-Arnold Malcolm E 309*Lamon John D 320*Muller Herman Currv pl intersects 321-0-Newbern Lloyd 325-0-Dodd Asa M jr 332298-bEWthiellriiadmgse FWredEk W 333368-'0lC-ShchaemllpiEornneIsstaaRc N 340ABrittain Ralph L 342&Reddy Arzado G 3457-Brown Hardy K NOseRcTtiHon HinIGtHhLeAnNoDrtShe--ast Aparretsiodfenctiitayl just beyond EM NORTH LA--`From 303 North to Empire av 57 Davis Henry <-c) NORTH STREET LA--From 253 North to Craft 101 (437) Jefferson Chas (c) 102 (435) Flewellen Henry J (c) 104 House of Prayer (c) NO25R9TJHaEckRsNon AnVort(hEast Macon)--From 125 Taylor Jos (c) 214 Roberts Hasty (c) 216 Nixon Effie (c) 220 Ford Kelly (c) 226 Wornum Geo (c) 422 Brown Perry L (c) Broad intersects 520 Bingham Lee (c) 522 Solomon Spink (c) NORTHWEST BOUNDARY -- West from 2 Gustin av to Green, I north of Madison 172 Knighton Thos (c) 174 Smith Cleveland (c) 180 Vacant 190 Davis Wm (c) Wise av intersects 200 Russell Ophelia (c) 203 Johnson Wm (c) 208 Thomas Julius (c) 209 Hudson Johnnie (c) 210 Lawson Rufus (c) 211 Holder Thos (c) 212 Price Israel (c) 213 Dixon Zetta (c) 215 Childs Seymore (c) NOTTINGHAM DR (North Highlands! --From North av south to Masonic Home rd 1097Stribling Clara K Mrs lllAManry Wm O 113hParkbr Leonard F 115*Marshall Hialmer D 117 Bearden Albert T 119&Mueller Curt 121ABrown Wm W 123-QMatthews Emory C 125*Glass Albert W 127'-"Berg Leonard 129Wiggins Roy A 131*Burch J W 133hKelly Arth R 137*Jacobowitz Abr E 203&Pitts Fredk D 205-0-Ferrell Robt G 2Q9ABooth Leonard R 215*Barber Claude W 217*Macrz Jos 219&Jelks Albert A 221ABoone A Foy 227*Moffett Kendrick S 223279/-MPoallrekvwHalteWr mGeo E Curry dr intersects 310 Cohn Sidney A 3127-Smith Emory C 330-0-Lee Wm G 421-OCole May S Mrs 4290-Anderson Wm T 430-0-McKenzie Emmett 432 Shirley Hill Club NUSSBAUM (South Macon)--From 830 Edgewood av to Plant, 1 west of Tel- fair 108 (770) Thomas Mary (c) 109 (728) Burney Walker (c) 110 (772) Thurman Wm (c) 111 (726) Neville Ashley (c) 112 (774) Knight Daisy (c) 114 (776) Williams Lillie (c) 116 (778) Danielly Emma (c) 120 (780) Watkins Elliott (c) 122 (782) Parker Henry (c) 123 (730) Vacant 124 (784) Randall Bradley (c) 125 (732) Lucas Chas (c) 126 (780)*Ard Wm F gro 129 (725) Vacant 135 (153) Vacant Prince intersects 137 (157) Sanders Eug (c) 139 (159) Turner John (c) 141 (121) Richardson Chas (c) 142 ( 301) Mitchell R Frank (c) 499 LUTHER WILLIAMS' SON Frederick Ww wWilliamsg-SAolNe KOwInNerG IN ALL ITS BRANPCrivHatEe SBank-Net Incorporated WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY SL -AGON. GA. NUSSBAUM (SM)--Contd _ 143 (203) Dumas ThEolsiza(cb)eth intersects 147 (210)*Holt Fannie (c) 149 (214) Clyde Henry (c) 151 (216) Green Chas (c) 153 (218) Johnson General (c) 155 (408) Jones Warren (c) 157 (313) Sturkey Blandon (c) 159 Newman Mary H(ce)nrietta intersects 164 (400) Little Rock Baptist Ch (c) 165 (317) Walker Frank (c) 167 (319) Toomer Mary (c) 116689 B(1a3r6r)etJtamBeensj E(acr)lie (c) 170 (414) Vacant 174 (415) Hicks Edwin (c) 175 (323) Griswold David (c) 176 (416) Berrv Wm L (c) 181 (325) Thomas Benj (c) 162 (132)ONewberry Columbus M 166 (136) Johnston Chas F Rev 170 (140)O-Brown JoJhansaFmine intersects 190-0-Robertson Willis L 1910Gilbert Frank I 1920Smith Albert C 1970Cheek AldineBLelmont av intersects 201 Brady Estelle Mrs 2050Young Jas S 210OLucree Anthony C 247 King Homer J 2490Harper Hansel L 251 Bartlett Walter L 252 Hooker Ernest O 253 Vacant 255 Shupe L Roy 226687 JPoanyense WRombtELgro 2710Shepard Volley E O344444444444A15251P5556616513167178026Ki--n&-0V--VBHBVMMe-HBaraaaaoFooouc(ncrcodrrwnlpaaaklrogrooneninesnmesctrtttstkoBBAoGEnFCeepgliltsieanfSatzsynttdeiahhesyMrfsarMtrhooBsmrr0 sTo2 ahFTdiirhwfditra,hdy1toiinsnottTeeurertssnheetchcott)sfs-EU0Oi112o22223C0O0M00110t4t4319135M5rOaOMaDBFCcCJUV(nDS2ooreaegouLa0aetnhrxFleer7cGFznlnitwo,)ianoiidnEsCresna1reoesFEreortnGtMsocEERoEarDO--modu-omCCLrtbiemhrloRemlotilesFleaiCoae(ctr(fctothow((Bt)(ccBdrmcRh))ir)SR(voospee(etajcltv)SrrSdFal)eiwieninxnfvtagttt)ehhhynCtiiihino*nnntttteeeear*rrrvsssseeeecc*ccttttotssss O11111A0F000145921Ko----0rOO-sSAyHSmttVirhgoigtuhirds(doIEnnJdgowTlhehnsWeidoAej)rW--O 0 North from 2302 B-Voa4o45555u5512k42g4860e28hr-7HTSnI7HvCAleaaeHramhrurrnraesyrgomosrelhsdnlocOltJenhBlArdCelieslleeMinlcJiPjeMaaarFuMirMeslWrgrssraolTkehrirdla intersects intersects OAK HAVEN AV--From 822 VineviUe av south to C of Ga Ry, 1 west of Callaway 552 Wooten Geo R 556 Rowe Mannie MrsSecond i.ntersects 114-OAlwood Wm 117- E OHa6l1l 4T&hMocsNHeillDNr ola M MArscademy begins 1181190Beeks Walter H '102-OSblomon ISteph 123124- O M0 0 Ed M--MSc66o66uC11l99ro5997rlmaaRMyWmLoineravaEsocertScoderhtBsrneiodMpWebeLhaoamirjAtnMotlerre(ercnj)(rTcaB)hdeaantFrceiinrsgt intersects Delaware intersects 701 Houser Henry (c) 201 Burgess John 203 Smith Mattie O Mrs 2050-Banks Noah S 2060-Cone Edw H 207-OAsbell Edw C 209O'Lewis Bernard M 234 Long Jaspar N Hunt Thos B English i*nte*rse*cts 703 (702) Vacant 705 (704) Little Thos (c) 725 Brown Louis (c) 727 Johnson Jas (c) 729 Burden Oscar (c) 731 Glover Daisy (c) 752 Edmond Oscar W (c) 754 Hall Jas L (c) 756 Newby Jas (c) 758 McCoy LeRoy (c) C of Ga Ry crosses 767 (768) Mitchell Jennie (c) 300-0-Atlantic Cotton Mills OAKLAND AV (Formerly First av) -- South from 417 Montpelier av, 2 west 10o1f C(9a8r)l&inWg heeler Cath Mrs 10 `(100) Wheeietr Jais W 125*Connell Wm G 127 Vacant 131 Taylor Rufus H 133AJones Chas W 133ahBriggs Harry 113357&0-PBaarrkfieerldWAmndRrew J 139 Johnson Lewis C 1520'Dickson Curtis 1540-Freeman John S IS'SAHowell Ortoin D 769 (766) Farrar Homer (c) 771 (770) Bowman MackNe(wc) intersects 803 Johnson Danl (c) 805 Carswell Lula (c) 807 Relliford Rebecca (c) 810 Walls Sami (c) 811 Vacant 812 Goddard Willie M (c) 813 Vacant 814 Gilham Eula (c) 815 Cummings Lizzie (c) 819 Davis Mary L (c) rear Solomon Levi (c) 820 Harris Louis (c) 852 Hicks Thos W (c) 853 'Carswell Jas (c) 854 lOdom Albert (c) 1580'Bailey Thos P 160 (101) Fincher Ira D 855 May Thos (c) 857 Vacant L a q0CO) -roC 2. o xr 5 iwOf-u -! gC 'c ta. XT rt23 3ct- 500 AUTHORIZED DEALER PRINTING BINDING R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 RUBBER STAMPS THE BEST WORK CORRECT PRICES 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York O8C5M8iUJaLcGksEoEn--CCloarnetdnce E (c) exp 859 Folds Mari (c) 861 Nash Lizzie (c) 862 Mercer John T (c) 863 Wheleher Sami (c) 865 Little Wm '(c) 867 Hutchings Danl (c) 869 Sherman Alice (c) ,,901 (,913) Ridley RubinSp(rcin) g intersects 903 (912) /Vacant 905 (911) Vacant 907 (910) Tillman Irene (c) 909 Smith Lilia (c) 911 (908) Johnson Hardy (c) 915 Thomas Sanford (c) 916 Wright Dora (c) 992210 DLiutmtleasJaVsio(lac) (c) 923 (953) PenderOJcomhunlge(ec)la intersects 925 (959) Mattricks Sallie N (c) rear Collins Laura (c) 931 (963) Evans Millie (c) 996522AHcalermrisonNs aSnocly C(c)(c) 964 Melvin Ernest (c) 966ASmith Wm (c) 967 Bonner Wm (c) 968 Puller Thos D (c) 970 Smith Wm L (c) restr 974 Vacant nw cor-AGa Power CoFr'(asnukblisntain) tersects 1011 Stripling Robt G soft drinks 1012 Vacant 1014 Wyche Lela (c) 1016 Johnson John (c) 1018 Chambliss Walter (c) 1020 Hawes Jas (c)_ 1021 Curtis Mamie (c) 11022 Simmons Luther (c) 1024 Ga Power Co (storage) 1051AGa Power Co (garage) 1058 Ricks Jack '(c) 1062 Sullivan Lillie (c) 1064 (1066) Simmons Mamie (c) 1066 McDonald Elnora '(c) 1068 Street Carrie (c) Hill begins 1100 Kitchens Chas M gro 1102ADunn Leon (c) 1106 Calloway John W (c) 1162 Felts Homer (c) 11116664 Latimore Dooley (c) (1130) Little Fannie (c) ---- Rose Hill Cemetery Orange intersects OCMULGEE LA--North from 921 Ocmulgee, 1 west of Spring 105 (921) Holloman Janie (c) 106 (953) Bell Simon (c) 107 (956) Brown Alma (c) 108 (953) Hughes Robt L (c) 110 (954) Dennis Thos (c) 112 (955) Farmer Anna (c) 114 (957) Vacant 1116'(533) Ford Augustus (c) 536 Hall Henry H (c) OGLETHORPE -- From Fifth west to limits, 1 south of Oak 306AKenny C D Co Inc whol coffee and tea AGa Roofing & Supply Co 310 Vacant 325ACentral Bedding Co Macon Mattress Co 4,,14. ,,Freeman HattieBro(ca)dway intersects 416 Batnes Mary '(c) 4j2io-28,A_Ga Market SelrvAicrechSitnatersects 430 Ga State Farmers Market 438AShadburn John D auto tops 440-42ABooth's Cafe 446 Vacant 448 Vacant 500 Vacant Third intersects 512 Leaptrot Ernest 513 Vacant 514 Harris Harvey V 515-19 Williams Fred W 2d hd furn 516 Bartlett Mary L Mrs Mills Wm R 51 McKinney Edw R 520 (522) Byars Geo W 521 Vacant Capitol av intersects 524 (562) Lyles J Rufus Asbell Horace S26AI3felf Lawtrence S 553' Snow John O 555 Carr Mary Mrs 557 Adkins Jos C Robertson Harris H 559 Etheridge Jas W 557600-AWFourldforFd raHnekrmHan O Second intersects 608 Vacant 661152/-LAisnkcehwEFrieolnixI R 616 Vacant 619 Cham'bless Clarence C Chapman's la intersects 623 White Eva L Mrs Mercer Herbert 625 Bailey Sami A restr 630 Snow Berris B 635*Ivey-Turner Ice Cream Co 649 Hogan Sarah (c) 653 Wynes Robt (c) 650 Allen Clara (c) 688 Bibb Mfg Co No 2 Clinic se cor Champion B Jeff filling sta ne cor Bibb Mfg Co No F2irAstudinittoerrisuemcts 772106--2128 PCarorksserGEedowDT 724 Flynn Leon W 72 Younlg Airth C 728 Mueller Guy J 730 Baker Geo 732-34 Bennett jesse G 736-38 Vaughn Wm J 740-42 Tanner Ruth 744 Lamb Harvey 746 Chastain Geo 748 Murray Wm C 750 Fair J Tobias Highland av i*nte*rsects Maple intersects 752 Langford Leroy 754 Etheridge Otis 756 Kinley Chas T 758 Gordon Guy B 760 Sanders Luther 762 Powell Chas M 764 Wood Jas T 770 Couey Eliz B Mrs 902 Hicks Thos J Jackson intersects Delk Bertie F 906 Bateman Sophronia Mrs Bateman Tetrrel M 910 Webster Sarah L Mrs Mills Thos W 915 Smith Jas C Cole ends 916ALinder Ferrill H jr 918 Meadows Milton H Collier Homer 951 (901) Meeks Jos BColgersoal intersects 952 Spillers Clyde E Mrs 954 Jones Kenneth E 957 Mt Olive Baptist Church (c) 959 Brown Clement (c) 962 Mote Wm P 963 Holland Jos (c) 965AEvans Thos W Rev (c) 501 MILLIRONS PLUMBING & HEATING CO. SIGNATURE ONLY Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 SAME DAY OGLETHORPE--Contd 966 Arrington Dudley H 970 Abel Sidney W gxo 970% Early Annie Mrs 971 Brooks Jas D Calhoun i.nt,ersects 100Q McCreary Wm T gro 1004 Vacant 1006 Sires May D Mrs 1009 Adkins .John Cc) 1010 Vegetable Box The gro 1011 Johnson Daisy Cc) 1012 Vacant 10116 Davis Os'dair (c) 1016 Harrell Thos Flanders Lee Wesley Jas Willis Wm J 1017 Hall Ida (c) 1017% (1018) Kane Jos (c) 201 JiackBon Oirdelia (c) 21 Gray Sadie (c) 22 Franklin L A (c) 23 Kendrick Chas (c) 25 Furgison Jas (c) 27 Woodard Jas (c) 206 Britton Hattie (c) 422 Walker Zanie (c) 431 Earl Betty Cc) 4*32 Granville Ezekial (c) 434 Vacant 436 Ivey Henry (c) 438 Taylor Richd (c) 440 Tyler Richd (c) 442 King Wm (c) 446 Adams Rose (c) 502 Thomas Wm (c) 504 McGee Chas (c) 506 Vacant 508 Deese J C (c) 1019 Hogan Roberta, (c) 1020 McLendon Amelia Mrs Elliott Jas D Nelson Emory L OLIVE (East Macon) -- From Clinton east to Hydrolia, 1 south of Main 350ADennis Allen J Macon Pope Mahala Mrs 1021 Robinson Ida M J(acc) kson intersects OLIVER AV (Log Cabin Heights) -- From Hill Crest rd north, 1 east of Log Cabin way Investment 10613 Irving Eural (c) 1056 Vacant lOlADennis John C 107AToole Kath Mrs Co. 11005672 DWaivldidesroLnuLlaon(cD) 1064 Wilder Andrew F 1068 Mullendore Gertrude Mrs 1072 Vacant Ocmulgee intersects 1100 Rogers Pearl Mrs 1105 Hunnicutt Jas T 1106ARogers Pearl Mrs Harrison Horace K 1109 Harvey Jack L OLIVER AV (South Macon)--From 2480 Broadway east to Chappel 71 (130) James Alex (c) 72 Vacant 73 Dean Henry M Cc) 74 Atkins Eliz (c) midwife 75 Evans Eva (c) 76 Butler Hattie (c) 77 (174) Greenwood Fannie (c) 78 (176) Lawson Geo (c) 220 Georgia Casualty Bldg. Phone 3368 Prince Sylvanus 1114ALeverett Cullen C 1116 Chitty Leo F 1120 Sinclair Lena M Mrs 1123 Halls Grocery Shamrock i*nte*rse*cts C of Ga Ry crosses 1157 Lowe Jas E (c) 1158 Andrews Merritt N 1159 Browder Jos (c) 1160 Zemlich Karl V O'NEAL'S AL (East Macon)--From 713 Main south to Peachtree 103 (42) Pauldo Beatrice (c) 104 (43) Bonner Wm (c) 105 (2) Venlper Jesse (c) 107 Mitdhell Horace (c) 109 Gordon Wm (c) 111 (3) Johnson Amelia (c) 11*3 Smith Lizzie (c) 115 (7) (Davis Harry (c) OPERA HOUSE AL--From 253 Second YOUR CITY D I 1162AGardner Murray R 1164AKing Jas R to First 5 King Wm (c) R Wolf Abr 6 Bryant Viola (c) 1166AFioros Gustavus miAHart Alex J (e) College intersects 7 Morris Willie (c) 10 Davis Geo (c) 11 Vacant E 1219APhi Delta Theta Fraternity 12230Jemison Jeannette Mrs 14 Coley Florine Cc) 16 Jones Henry (c) C Tatnall intersects 1309 Oglethorpe Private Infirmary Inc Hall Thos H Rozar A Robt phys Keen Osee F phys 101 West Mary (c) 114 Vacant 115 Shuley Martha (c) 116 Bryant Julia (c) 140 Roberson Osie (c) T O 33 1321AOglethorpe Private Infirmary Th(oNmuprsseosn HMomareg)t 1357-C'Albea Wm L ANeel Roland H 1363*Swain Henry Rev Adams intersects 1401AAlpha Tau Omega Fraternity 1403 Porch Leon D phys 1405-OSteger Frank B 1407AJones J Blount 1409AKeel Wm A 1416AJackson Eloise Mrs Swisher JeSsie E Thomas Lonnie 1418 Paz Alger F 1420AHamilton Noble R 1422Alnnis Raymond L O'HARA LA (South Macon) -- From Edgewood av south bet Third and Broadway ORANGE--From junction of Jones and Ocmulgee south to Cotton av, thence southeast to First 200ABarnes Jas B gro 205 Harris Lewis (c) 207 Branham Percy (c) rear Vacant 211 Norwood Zennie F (c) rear Holmes Inez (c) 217 Smith Daisy (c)Ocmulgee intersects 220 Ingram Jessie '(c) 221 Allen Maggie (c) 222 Johnson Carrie (c) 223 Anderson Nellie (c) 225 McCormack Lillie (c) 226 Brown Randall (c) 227 Samuels Jos (c) 229AHolmes John (c) 230 Smith Pearl (c) 231 Carroll Chas C (c) R Y MIRRORS the SOCIAL Life Of Your CITY 502 YATES MOTOR CO. o u o z 3 *A*l PQ? "2 1 z * o v --ARE-- --AND-- THROUGH THE THAN BY 707 THIRD ST. PHONES ! 11444465 O2R32ANBGutEle--r CNoonrtmd an (c) 234 Powell Roy (c) 236 Johnson Chas (c) 240 Vacant 242 Clark Major '(c) 2524-MeCle,,llanOrWanmge AStrjeretla intersects 255 Johnson Wm F 257 Marchman Robt W 225598-PAeHnubSbaamrdi SBenie M Mrs 480AMcCrary Geo D 4820Ohandler, Cornelius B 4830Alexander Myrtle R Mrs @ 4840Pitts Wm M Nowell Myrtle drsmkr 4860Fowler Thos E 4890Salters Jos W 4940Hamilton Anna Mrs Jones Marianne mus tchr Magnolia i*nterse*cts 260 Butler W Harvard 261 Vacant 22761774--ERdawy aWrdms DHomer J 275AStubbs Peter W 5sr0v6fiOAWwoailiker RoWbtasJhington av intersects Georgia Better Business Assn Inc Davis Studio The art gds 510-ftSeymour Jas E 514 Houser Mary A Mrs 2,,8on0 J_oh nson B^erner R Walnut ends 280% Doke Jos H Griffin Carrie C Mrs 281-0-Brown Oscar E 284ACodington Sarah Mrs 285-ANixon Gena H Mrs 288-0-Davis Aurie S Mrs 297-OShiver Wm H 7-Taylor Bessie nurse 51S7Parrish Julia A Mrs Harrison Erma Mrs nurse 520 CJooilnoenriaCl oArapaMrtmrsenntusrse Apartmentss: lAGiover Eliz V H Mrs muS tchr ACharies Sourie G Mrs mus tchr 4eden Fannie T Mrs 304 Vacant 307-0-Burr Cora Bnd taten,eoto 5-67Chambe:r.s Fredk A-McLean Winship rear Townsend Belle (c) 3130-VonMuller Heinreich -OOGPaadrkdeyr Thos B Maggie Mrs 0-Adams Chas M jr 3177-Hendricks Annie Mrs 318APhillips Garrett L 320-0-Ross Claude F Mrs Jones Claude R Mrs 3210-Wade Jas W 3220DuPriest Hiram H 3500Cork Chas D S 3550Payne Wm S jr 3590McCowen Clarence D ocoggins J Wilbur 360OODMeunrtphQeyuinWtoinllarHd M 3610-Leonard Chas L oJohnson Beni A 3640BIount Fannie 3690Mills John A 3710Dasher John M 3720Ree Danl, I 374 Yates Durwood W 3750Richardson Buirt P @ 3760Turpin Wm C 3780Glover Oza C 3790iSwint Columbus R owniiams Perry B 3800Pope Marvin 385-0(Daley Jas J 3890Goepp Rudolph McCarren Helen G Mrs mus tchr 393-OPiowers Albert T 4560-Oliver Annie GHeorgia av intersects 460OStinnett Wm S 4630Holmes Minnie L R Mrs OMayes Clarence A 4640Thar-p Channie B 4650Washburn Charlie G 470ODonovan Wm 471osolomon R Clinton 4477430Ajopradratmn eWntsAllen 2lOHHaayrersisJoAhdnaAM 30Nirenstein Leon 40wright Susie- P Mrs Street continued 475-79 Washington Apartments Apartments:' 1-OPeddy Julian E jr 20Powell Geo H 30Warren Luke R 40Morris Homer M SOClosson Carroll E 6-OSaunders Aubrey D Street continued 533-47 Nevarro Apartments ^ Cn^ 546ACassidy Francis T '548AMurphey J Clay 550AHarrold Chas C Dr 553AWest Vivian 554AGoodall Wm S Jackson Blanche nurse rear Pord_ Wm (c) 559 Laurine Apartments Apartments: lASingleton Mary A 32AVEatchaernetdge Ezekiel Y 4 Vacant SASingleton Louise 6APatterson Inez 7 Vacant 8 Hazelhurst Marie 9 Vacant lOAjones Blake G Street continued 560AMcKay John J 568AAnderson Robt L 503 O5R71A-7N7GpEa--lisCaodnetsd Apartments Apartments: lABrown Jas F jr AScandrett J Russell 2AYoung Danl R. 3 Vacant 4 Vacant 5AConnell Parvie B 6AEnglish Harlow D. W. 7ANewman Wm A8AThornton Thos A . Daisy Park ends 579-87 Forsyth Terrace Apartments Apartments: 1 Vacant 2ASmith Philip JSAMueller Arth. 4t-Lucas Rotat. SATumer Carrie E. Mrs Gresham Richd B. Forsyth intersects 605 Jefferson Apartments Apartments: lADavis Marshall J, 2 Mills Annie Mrs, 3AByington Jas .WStreet continued 613 Jordan Apartments Apartments: l&Roberson Alvin S. 2ADavis Albert J3 Passmore Annie 4 Alley Gewinner Street continued 617AWatson J Lee 621 Etheridge Eugenia Mrs 622AFleetwood Hugh B 628AGiles Alice Mrs 629-0-Ross Thos L 663326A*GSloasptpiney BLeorvniaerdL SMrs pihys AAlfriend Kyle T jr 637&Pearce Marshall H Rose Park intersects 639-45 Mount de Sales Academy Park pi intersects 710 Central Church of Christ 711ABailey Prances D Mrs Wheeler Julia nurse Cox Alton C 719 Sweeney Thos S 720*Winfield Jesse T 727 Taylor Andrew J Spring i*nte*rse*cts Holt intersects SOOAWeisz Jas G mus tchr Giglio Cecelia Mrs mus tchr 804AEubanks Chas E 805AGodwin Hardy C Achanin Barnett 808AGober Hiram A 815 Bush Gordon AKane Mary Mrs 822 Brown Luella 824 Nicholas Peter 825AWhitten Theo J 826ABazemore Walter L Cargile John P 827ABenedetto Aristide A @ Cole begins 852ABoone Geo A 856 Harden John 886620AWStreivgehnts DWomrisOW Mrs Williams Mae Mrs AClements Jas 863ASmith Rupert L Ajoyneir Grady 863%AWade Lilia Mrs 865AGallemore Clara H Mrs Slappey Virginia nurse Beatty Clyde 869 Leggett Mendese L ADurden Robt R 870ACoplan M David New intersects 871 ABCoulllipnegpeprerBMartionnwieAMrs 871 !4 ACarter J Holland jr 873 Adams Laura Mrs ARowell Ernest 87'3 V2 Vacant Latta pi begins 877AAGRoogoedrws inJoJsasWMDr AJenkins Grady L SOOABoswell Wm L 901-07 Highland Apartments The 901AAlexander Robt J Amerson Alwin L 902AHarper Cornelius B 903 Grayson John H 905 Hancock Marvin 906AWhitehead Henry 907AEtheridge Jos A 909AGostin Rosa J Mrs 910 Chapman Wm HHighland av begins 911ARichard H Frank AWfaite Jos M Adams Oscar C 912 Satterfield Marion H 914 Dent Oscar R Crawford P Pringle 931APuller Grant P Price Library Park cor Price S B Free LibrFariyrst intersects ORANGE STREET LA -- From 240 Orange south to Hill bet Ocmulgee and Walnut 124 Collins Josephine (c) 155 Little Pearl (c) 238 Barnett Dock (c) 252 Vaughan John (c) 256 Shetine Wm (c) 258 Johnson Inez (c) ORCHARD AV--From Hudson al north to limits, 1 north of Green 101 (1) Walker Edw D (c) 102 (2) Appling Arabell (c) 103 (14) Huff Lula (c) 104 (4) Jackson Leila (c) drsmkr 105 '(6) Davis Lucile B (c) 106 (6) Mitchell Hattie (c) 107 (7) Spencer Mary (c) 108 (127) Haughabook Squire (c) 109 (9) Smith Jos (c) 110 '(8) Gross Addie (c) 111 (10) Jackson Eug (c) 112 (12) Williams Jos (c) 114 (16) Sherman Aaron (c) 115 (401) Sherman Sandy (c) 116 (49) Harris Napoleon (c) gio 117 (31) Hall Wm (c) 118 '(283) Vacant 119 (118) Wilcox Chas (c) 120 ( 284) Vacant 121 (120) Jackson Walter (c) 123 (122) Patterson Rosa L (c) 124 (449) Rogers Louise (c) 125 (124) Jones Florence (c) '126 (447) Collins Eug (c) 127 (126) Stephens Rufus (c) 128 (129) Vacant 129 (128) Cloud Willie 130 (151) Floyd Homer (c) 131 (150) Abrams Isaac (c) 201 Fambro Leila (c) ORMOND TER--From Houston av east to Flamingo dr, 3 south of Heard lOlAChance Jas F lOOAArnold Albert M llOADriskill Jesse E 118-Chancellor Floyd San Juan intersects 202AWatson Steph B 2C3ACroom Clifford J 204Ajones Grover J 206AAtwater Robt E 212AHenderson Buford A Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 504 505 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 PARKER AV (V)--Contd 11 (12) Scott Howard (c) 12 Vacant 13, Cox Nora (c) 14 Holmes Willie (c) 1165 TThhoamrpaes WEmmmTa '((cc)) 17 (16) Goolsby Jas (c) 18 Murphy Augustus (c) 19 Howard Lula (c) 20 Sanders Ardie '(c) 21 Thorpe Robt E (c) 22 Burch Sampson (c) 23 Horne Louis (c) 24 Tharpe Marie (c) 26 Wimbush Dilly (c) 28 Ward Clara (c) 5512 HBouwffmEalnlaD(acn)l (c) PARKERS LA---From 231 Roff Home av south 1 Jackson Lewis 2 Morgan Jas E 3 Brown Mary Mrs PARKWOOD AV -- From Forsyth rd south to C of Ga Ry llShTumer T Edwin 123 Jackson Fred A 129 Brown Chas F 131 Schilling John B 133*Adams Harry F 142 (107) Darsey S Elliott 148 Miller Jas H 154 Watson Walter C 156 Clay Margt J Mrs PATTERSON (Napier Heights) -- South from Roff Home av to Beech. 1st east of Pio Nono av 107 (233) Foster Wm M 108 Davis Raymond 109 Williams Emma '(c) 190 Causey Dona M Mrs 199 King Wm Rev (c) Roff Home la intersects 201 Hicks Wm (c) 202 Vacant 203 Coven John (c) 205 Willis Fred (c) 207 James Malinda (c) 209 James Jesse (c) 210 (221) Cole Annie (c) 213 Vaughn John (c) 219 Range Chas (c) 220 Ross Richd (c) 222 Holt Harris (c) 225 Hudson Cornelius (c) 227 Fry Mary (c) 229 Thomas Walter P (c) Thomas Mary (c) gro 231 Anderson Robt (c) Randall intersects 301 Butler Ivey '(c) 303 White Louis (c) 304 Randall Harry T C1 (c) 305 Miller Acy (e) 307 Miller Acy (c) confr 310 Patterson Edw (c) 311AMiller Wm B '(c) '312 Shedrick Jerry (c) 314 Davis Henry H Rev (c) 315 Plummer Walter (c) 316 Webb Calvin (c) 317 Street Mary (c) 318 '(320) 'Range Harris (c) 319 Vacant 320 (318) Tennie Carl (c) 321 Stewart Andrew D (c) 344 Vacant '356 Nesby Robt (c) Braswell intersects 439 Richards Manuel (c) 441 Trippe Joshua (c) Napier av intersects 73'6hBarher Howard D 744 Josey Fred H 746*Denson John W 760 Nirenstein Myer Nirenstein Sarah Mrs 772AAtkinson Harry J 779ABaggarly Ernest M 781&Moore Harry L 783 Jackson Jas B '784ASummers Abram 'J 785*Ware Thos M 796*Carver Gail L 797&oiiver Carl S Date av begins 801*Adams Todd L 823AMatson Robt G 845-QEndicott Lucian 847ATurner Julian H PATTERSON LA (VineviUe)--From 805 Third av east PAUL -- East from 714 San Joan av, 1 south of Richmond PAULINE AV (Western Heights) -- Changed to West End av PAYNE AV--Changed to Rose av PAYNE QUARTERS--Two miles north of city at Payne Mills PEACHTREE (East Macon) -- From 200 Hydrola to Third av 101 (100) Adams Wesley E Jones av i*nte*rse*cts Fountain av begins 123 Vacant 125 Adamson Clarence H Hinson J Preston 126 Weaver J CuBrtaislkcom av intersects 203 Brewer Mary O Mrs 205ASmitih Fannie C Mis 206 Adams Merritt A 207 Marsh Geo H 208AMarsh Sallie A Mrs 211 Wilson John E 213 Johnson Clarence E 223 (257) Johnson John D 250 Stevens Chas M 260AFaircloth Nonie M Mrs Fairview av intersects 301 Gill Effie M Mrs 330042AVMaccKanint ney Benj F 306 Slaton Leonard P 307 Foster Cleo Mrs 308 Harrison O Homer 309AReynolds Lucy W Mrs 310&Hobbs Sallie M Mrs 312 Davis Sidney V 313 Chester Hansford D Stripling al intersects 401 Dorsey Alberta (c) 402 Johnson Dimon (c) 407 Daniel Wm (c) 409 Small Pierce (c) 410ATurner Jas (c) 411 Smith Laura (c) 412 Alexander Albert (c) 413 Jackson Peter (c) 414 Daniels Henry (c) 416 Clowers Eudora (c) 419 Gray Wyatt (c) 420 Killum Wm (c) 422 Chappell Sami T (c) 424 Jackson Arth (c) 426 (423) Durham Henrietta (c) PEACOCK (South Macon)--From Gibson av south to Nelson, 1 east of Gantt City rd 100 Roquemore Henry (c) 102 Hunt Willie M '(c) 104 Smith Wm (c) 105 Vacant 107 Dean Lena (c) 109 Jones Edw (c) Colquitt intersects MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists 506 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York PEACOCK (SM)--Contd 201 (162) Hughes Wesley (c) 202 (ISO) Waters Pinky (c) 20'3 (159) Golden Wm (c) shoe repr 205 (100) Munson Walter (c). Charles i*nte*rse*cts 440020 JVoahcnasnotn LeRoy Crisp intersects (c) 111 Taylor Viola (c) 113 Williams Robt (c) 115 Farley Martha (c) 117 Vacant, Roosevelt intersects 121 Gray Fannie (c) 123*Simmons Webster D (c) 300 Hugh. el,y A,, u.bi.eM(uct)ual av intersects 302 Hughes John Jr (c) PEAR (East Macon)--From 348 Flan- 303 Hughes John (c) ders west to Elliott, 1 north of Main 218 Butler Doshia (c) 2,19 Dowdell Earlie (c) 220 Lowry Annie (c) 221 (202) Cannon Rosa (c) 222 Green Seaborn (c) 223 (208) Conner Rosa (c) 224 (717) Glover Geo (c) 225 ( 204) Cornelius Thos (c) 226 (719) Thompson Budrow (c) 227 Wilson Isaac (c) PETERS AL (East Macon) -- From 50t Clinton 430 (431) Durham Fannie (c) 432 Johnson Peter (c) 437 McIntosh Emma (c) 439 Roland Xsadore (c) 441 Whitaker Wm (c) 443 (433) Davenport Otis (c) 444 Cross Wm M (c) 445 Smith Eug (c) 222289 V(7a2c1a) nHt ooks Isaac (c) PHILLIPS (SM)--See Phillips al 231 (270) Vacant PHILLIPS AL (South Macon) -- From PEARCE (East Macon)--From 238 Main north 103 ( 264) Snow Wm L 106 (265) Tinsley Hattie M Mrs 107 ( 266) Matthews J Oscar 108 Carmichael Wm C 110 Kelsey Nora L Mrs 112 Slaughter Jas C Jordan al south 100 Hudson David (c) 156 Duncan Wm (c) 158 Bonner Emma (c) 160 Williams Elijah (c) 161 Duhart Henry L (c) 162 Jones Anna (c) 163 Williams Mattie (c) 114 'Handy Geo 116 Roberson David (c) PHILLIPS LANE (East Macon)--From 255 Church west to Thomas, bet Gar- PEARL (South Macon) -- From Flamingo dr east, 1 south of Heard av llOOHoward J Henry 122 Philman Homer 125*Johnson Albert R 127-0-Griswold J B 1280ghaw Martin A Rev 129 Payton Elisha C den and Lee 115 (122) Chappel Belle (c) 119 (126) Hunt Jacob (c) 123 (6) Glover Carrie (c) 125 (8) Hinton Marion (c) 127 (120) Vacant 129 Jones Lucile '(c) 131 (123) Ross Roxie (c) 133 Ellis Jas (c) PEBBLE (South Macon) -- From 1811 Second west to Telfair 501OSanders Harvey (c) 503-OWoodson Josie M (c) 5060-Edward Wm E (c) 5Q7AWilliams Wm J (c) 603 Vacant Wilder intersects 607 Durham Jas (c) 138 (135) White Letha (c) 140 (134) Middlebrooks Amanda (c) 146 (132) Ellis Robt (c) 148 (212) Ellis Michl (c) 150 (213) Brown Ida (c) Center intersect'* 414 Buck Mary (c) 416 (415) McKay Annie L (c) 418 (282) Binns Georgia (c) 611 Morgan Ella (c) 620 Lewis Jas L (c) 621 Hill Jack (c) 630-ODunn Jos (c) 633 Anderson Benj (c) 640 Richardson Annie (c) PIEDMONT AV (South Macon)--From 2619 Second west lOOhRoyal Jas C lOlABryant Walter F 103*White Roland E 641 Johnson Ben'j (c) 105*Yancey Tossie Mrs 647 Jaickson Jas 648 Vacant 111006-OBEudtlwearrdJsasAlMtonJ 656 Atwell Wm (c) Grace pi intersects- Telfair intersects 111 Story Alf K PECAN AV--South from 324 First av, 1 west of Craft 130 Tolliver Wm J (c) 115-0-Ashton Paul F 118 Lynch Bernice C 119-0-Royal Ralph 1200-McCuen J Vascoe 131 Lucas Viola (c) 1320-Ivory Wm (c) 1122530DTuhrodmenas AJnodhrnewRB 134 Hobbs Lula (e) 135 Mays Lucius (c) 129-OOldham Jos H 130OCarithers Geo W 136 Terry Arth (c) 13`1-OLowe Ellis H 138 Hollman Pinkie (c) 139 Stewart Rosa 140 Gillman Bessie (c) 1320odom Clarence E 1350Small G,,eo C,, Florence intersect# 141 Swain Candis M (c) 136-OBrown Jos H 142 Arline Ellen (c) 144 Lewis Wm (c) 1133870B-Hoayredry BJaoxhtnerBC 145 Brookins Amanda (c) 140 Fletcher David C 147 Cleveland Viola (c) 149 Threatt Mattie (c) 1144210M)DcoKttsinnHoonwaNrodveFlleE PENN (Vineville)--From 343 Douglas av southeast to Forest av, I west of Ruby 143 Vissage Beatrice M Mrs 144 Roquemore Walter 1450Humphries R Sami P DUNLAP-PEELER HARDWARE Cl Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 ts is PIERCE AV (Vineville) -- From 1035 lOVliAneHvuildlesoanv DtoaMnlcDEonald 102 Vineville Baptist Church Sunday School room l1O04S-ACA'JonhdnesrosonnJAHlicaerryMrs fum repr 105AMatthews M Bedford 106ARichardson Willoughby L 556 Lynch Julia F MrSseco--nd intersects 660187AVTaecmapnlte Walter P jr 619AtHolton Henry P 620APierce Emma Mrs 621AMcCowell LiCzzhieeatham al intersects 652ABoone John D 107ASanford Shelton P jr Boone Eliz mus tchr 108AMarshall Wm J 653 Smith Danl A llOABrooks Omar L 112AThomas Minnie G Mrs 114-OVincent Frank T 656ATYoung Pierce A Curry Ella L Mrs Carter Maggie Mrs ALanier Ohas F 657AWellons Jos B llfi*James Wm E 118 Morgan Flemon E D 658 Grant Emma L MrsFirst intersects 120 (149) Bernd Arth 706AGarfield Chas H 122 (153) Asbell J Andrew 123AMcGehee Jas T II 708 Ryles John D TIOAWalke'r Chester C 124* (140) Newsom Clifford C 712 Thigpen Wm G 125ALittle Wm L 714 Miller E Bevie 126 (142) Wall JEBlizraadbeth pi intersects 715AWindman Mamie Mrs 716AStripling Jas H 129*Wall Penelope Mrs 718AFavors G Dana Sales 135*Thomas Robt H 720AMCDaniel Oscar P 137ANewton Jason W 139ARogers J Chas 721 Copptack John G 722 Wester Roscoe Service 14IADickson Mary L MBrosulevard ends 724APrice J Marvin 726AHerrington Horace O 201*Methodist Orphans Home 202*Dubose Winston H 750ABush Henry C Douglas Jos D Used Gars 204ARichardson Mack W Roney Nicholas 206 Mason Wiley A 208AJones Norman S 210ARoberts Herman 212 Brazzeal HenriMetctaDoMnalMd risntersects 300AEthridge Greene B 302*Sullivan V Carl 310 Verner Hudson L 312 Guy Earl M 348ALundy Bright W 350 Davis Stuart C 351 Vacant 352*Miller Thos J Onola av intersects 753AQuave Victor L AAutry Wm H 756 Vacant 757ABurke Mamie Mrs 750ASheffield Nancy Mrs 761ACunningham C Clifford Wheeler Chas A 765ABryant Jas W 767ATaylor Sidney L New intersects SOlAMoseley Wm T 803AStewart C Emma 805AAmold Thos W 807AWilliams Cosby E 620 3d St. Phone 2297 DIRECTORY LIBRARIES PINE -- From South west to Spring, 3 s of Cherry ADiekey W S Clay Mfg Co sewer pipe sw cor South Ry SystSemeve(nsthhoipnst)ersects ns corADixie Cafe & Commissary Schmidt Burt A lawyer nw ccarACentral of Ga RFyift(hshionptesr)sects 354 Cullen Irving (c) 356 Cox John W 362AMacon Neon Sign Co Broadway intersects 809ATravers Thos 809%ABranan Wm T 820AMacon Hospital Ridley Chas L phys 849AMcBrearty John F 853 Tremont Temple Baptist Church (c) 854 Stowers Eddie J 856ADurloo Louise Mrs 859ADouglass Chas H (c) 880ALane Eva Mrs 863 Nisbet Sarah (c) Spring intersects We Have on File In Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED 415ABibb Mattress Co 419ABoland J Bee auto repr 444-48APritchett Claudius P tractor repr Guarrafa Quinto auto repr ASuperior Welding Shop Evans J Cullen auto repr McCallum Hubert B auto repr 447-449AColbert Mfg Co auto reprs 457 Macon Peanut & Storage Co whse 460AEKxicnhnaenygWe BOui&ldiCnog cotton factors ARoosevelt Jas P cotton buyer 470 Carburetor & Electric Service (side ent) Third intersects PINEVIEW AV--From 2839 Houston av west, 1 south of Hightower 700 Vacant 101 (104) Stewart J D Edw 102ADouglas John W 103 Sorrells Geo W 104 (105) Sorrells Wm J 106 107) Jones Troy E 107 Manning Paul W 108 (109) Sorrell Geo B 110 (111) Mercer Webster D I'll (110) Sullivan John A 112 (108) McDonald Vernon E STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. 510 Yates Motor Co (side ent) 511APowex Oil Co The (office) PINK (Western Hts) -- Changed to Belmont av DETROIT 514ABoone John D gro 518AZettler House fum rms Gaston Clinton PINKERTON AL--From Roff Home av south, 1 west of Pio Nono av 519 Myers Ned 102 ( 301) Revell Edgar L 523AWorsham & Sherrill gros 105 (305) Meeks Jas J 550 Johnson Mark confr 108 (303) Wilson Alf 552 Johnson J Howard 110 '(105) Scott Leonard (c) 553 Evans Ernest E auto repr 555ALassetter Nannie E Mrs 112 114 ((110034))1 Raby Holland Fraser Lonnie A J 508 2 <0 J. GUY JACKSON, General Agent 5 co w GUARANTEE MUTUAL LIFE CO. Purely Mutual Legal Reserve Old Line Company--Organized 1901 Third Floor First National Bank Bldg. Telephone 1142 CO o o PINSON (South Macon) --South from 115 120u"WaordViAstarchavie, 1Cwest of Houston av 111222042AAHHBigaehnrkctonoewcrkerJWoGhmneoHAW 905 Wimberly Mamie (c) 906 Arline Jas (c) 907 Moseley David W (c) 909 Stephens Annie (c) V) 2 Q S =z<0 g ra O 2 PIVO.mNevOiNlleOaAvVto(VA)nt--honSyourtdh, f1rowmes1t0o38f Cleveland av 103&Nottingham Warren 104ARobinson Chas W 912 Telfair Peter (c) 913 Hollis Jas H (c) 914 Dinkins Janie L (c) 915 Williams Henry (c) 916 Pippins Jas (c) May begins 105ATurlington Wm T Richard begins 55SS 107-0-Wynn Geo O 109AColbert Carrie 917>Gibson Van (c) 918 Henry Mary (c) llK'Wyche John C 113 Vacant 920 Johnson Lucinda (c) 921 Horton Sol T (c) ?5! o s gg 118Swinson W Edw 129AGa,tes R_osa LEMngrlsish av intersects VineviUe *inte*rse*cts 922 Clyde Rachel (c) 923 White Rufus (c) 924 Bugg Emmett (c) 925 Bentley Herbert (c) 926 Sweet Mary (c) 0-63 = 300 (200)ACohenStManaisxlagursocir intersects 926a Lee Booker T (c) 927 Storey Howard (c) 301 Atlantic Ice & Coal Co br 928 Unionville Cemetery (c) CO s 302 (202) Cohen Max 330043AMMoPorDe PCulmaupdeCoLNo 6 Causey Emory '306 Brown Harry' 308 Bray Edw gro 310 Moore Chas W 312 Gunnell Walter 929 Moseley Milton T 931 Smith Elisha (c) 932 Unionville Baptist Ch (c> 933 Richards Jas (c) 934 Unionville Hall (c) 935 McGee Adolphus (c) 937 Clyatt Andrew (c) 939 Higgins Augustus (c) 1-1 111 312% Causey Annie C Mrs Taylor intersect? to z 314 Wright Wade W 314% Watts John W 941 Waters John (c) 943 Simmons John (c) 316 ( 228) AChambliss Loris C gro 947 Watson Geo (c) 320 Moore S,,ami, C Roy intersects 949 Davis Edw (c) 951 Johhson Jos (c) 321 Vacant 953 Sims Eliz (c) 322 Cox Maggie Mrs 955 Ward Lizzie (c) 324 Hoffman R Henry 328 HAadnamnashonCBlaertetniece.ERMrs 995597 VBaarcnaenst Jeff (c) 960 Combs Fred (c) 330 Clark Emmett E 961 Grower Laura T (c) 332 Glass Edw 962 Cobb Wm (c) Roff Home la intersects 963 Cullens Celia (c) 964 Reid John (c) Patte*rso*n ends 965 Webb MoCullen (c) 966 Horton Marion (c) Where To Buy? Consult the Classified Lists In This Directory 387 Crawford John Suwanee intersects Randolph *inters*ects Hillcrest av intersects 404 Shaw Alice Mrs 410 Braswell Jas A (e) 418 Sheftall Minnie (c) Cherokee av intersects 424&Hardin Geo S gro 424%,Gibson Danl (c) gro 426 Seabrook Clara (c) 428 Edmond Burney (c) Napier av intersects 533 Reese Aaron (c) 541 (435) Zeigler Wm (c) 615 Mitchell Glenn L 664287AWPeabrkberJaCshaRs RHev 650AHardin Geo S 693 WMcilCliaammys WJosaltRer E Beech av intersects 705AHeard John M 708 Bethel CMECh (e) 774 (812).AHartley Dora Mrs 795 Vacant 801 Hunt Jas A Date intersects 813 Harrison John G 882251ARRoabineertss MDietntineisCCMrs 837 Zuber Hinton C 854 Sutton Sidney P 901 Moseley IdaMoBntp(ce)lier av intersects 903 Mayfield Wm (c) 967AJones Jas H (c) 968 Davis Anthony (c) @ 969 Jones John (c) 970 Williams Henry (c) 971 Jones Geo (c) 972 McGee Jos (c) 973 Cody Jettie (c) 974 Leslie Eva (c) 975ATidwell Thos J gro Dempsey intersects 1lO00O1OE-'-v'Tehroemttas AFmuenleiaral(cH) ogmroe (c) 1003 Webb Permelia (c) 1009 Williams C Walter (c) 1013 Whooper Chas (c) Straight begins 1015 McElmurray Amos (c) 1017 Elzie Henry (c) 1019 Waters Oscar (c) 11002297 VGaracyanLt ee (c) Almond begins 1031 Thomas Floyd (c) 1033 Bell Patience (c) 1039 Cochran Mattie (c) 1043 Battle Henry B (c) 1045 Smith Alonzo (c) 1047 Holt Jas (c) 1048 StLuke's A M E Church (c) 1049 Gordon Jas (c) 1050 "White Thos (c) 1051 Jones Emma M (c) 1052 Holt Sami (c) 1065 King Robt (c) 1057 Simmons Reuben (c) 1059 Brown Turner (c) 1060 Davis Cary M (c) Anthony intersects 509 MOTOR PARTS Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 PIO NONO AV (V)--Contd 1075 Kemp Chas (c) 1081 Lockett Fannie (c) 1083 Brown Wildon W gro 1101 Solomon (Edw (c) 1106 Davis Wm (c) 518 Kizzie Thos (c) 520 Wolfork Geo (c) 525 Reeves Frances (c) 526 Josey Cornelius (c) 537 Hudson Carrie (c) 539 Griffin Jane (c) 545 Brown Wm (c) PIO NONO LA--West from 648 Ko Nono 562 Jones Clara (c) av, 1 south of Napier av 503 Ballard Myrtice (c) 505 Harvey Tempie (c) 507 Taylor John (c) 509 Young Mary (c) PLANT ROW--From 229 First to New between Walnut and Mulberry 215 Mosley Matilda (c) 240 (213) Battle Minnie (c) 242 Williams Willie (c) PLANT (South Macon)--From 159 Jeff Davis west to S College, 1 south of Cura 113 Avant Henry J 111157-GtBrlaonckterRoJobst AP gro 119 Brown Fannie Mrs 244 Vacant 246 Kelley Grace (c) 248 Edison Mabel (c) 250 (174) Wright Jas (c) 252 Moss Mazie (c) 253 Vacant 120 Grant Maynard E 121 Saunders Olin L 123 Ash Jas PLATEAU (Unionville) -- From First av east, 1 south of Hoge 124 Vacant 125 Peacock John A 130 Williams Dewey 136 Supple Mary Nu. ssbau. m ends 203*Cranford L Frank 204*Lee Sanford H (c) 209 Coleman Janie (c) 211 Colbert Minnie (c) PLAZA (Stanislaus)--South from Vineville av, 1 east Florida av 110046**EAlnlidserMsoanrtJhaas MCrs 107-CMcManus Leonard W 109'--Yates Chas H 11(K'Black Ernest D 112*Adams Frank E 212 Lee Lewis A (c) 214 Oliver O Lope (c) 215 Rogers Lucius (c) PLUlVl--From Fifth west to New, 6 south of river Fifth i.ntersects 221168 RBirlaenytleEymmJoehtnt ((cc)) Campbe,,ll end.s 220 Dean Edmond (c) 222 Voight York (c) 224 Bell Minnie (c) 226 Hutchings Richd (c) 228 Harris Oscar (c) 230 Sanders Lee (c) 232 Slocum Pearl (c) 234 Dobbins Melissa (c) 244 Williams Ceipher R (cT)indall ends 246 Goodrum Marcus (c) 248-CBell Chas H (c) 254 Vacant 255 Edwards Leola (c) Alabams ends Sixth av begins First begins 301 Mason Geo (c) 302 Wright Henry (cF) ifth av intersects 305 Lane Nicholas (e) _Dai.sy end,s Fifth av begins 308 Hayes Pinkey (c) 310 Reid John (c) 312 Cotton Ossie (c) College dr ends *^SGoautShoeuas&ternFlaDeRmvurCraoge(fr&t dSetpoort-) age Bureau *Sou Ry System (frt depot) *Sou Ry System (police dept) ASou Ry System (div frt and pass agt) 340-AYates & Tabor Co whol gros 352 -Hirsch Jacob whol paper 361-ftSwift & Co whBorloamdweaatys intersects 441282*M0'cNCeoiyll WChaaltserwRood 423*Central City Bag Co 451-53*Am Bakeries Co whol 452*Packer Adv Corp 454*Bibb Body & Fender Works auto reprs 458*Tayior Transfer Co 460-64*Kingman & Burnette live stock 466 Macon Fender & BTohdiryd Sinhtoeprsects 504 Roberts Drew M restr 550163 VMaycearntLeona Mrs 514*Schwartz & Phaul Inc sheet metal wkrs 515*Williams LucUle Mrs 517 Ga Auto Co reprs ^ 314-iMcDonald John W 316 Campbell Chas B gro 319/Bennett Jerry B (c) 321 Hall Lula (c) ,,, ^ 325 (315) Kelly Wm A Rev (c) 551*Aubrey Florence Mrs 553 Sears Roebuck & Co whse 555547-D61o*rLtcehe &RusSsmellith Mule Co seOACapitol Hotel PLANT AL--From 528 Hawthorne south to Hazel 1 Horn Carrie (c) 2 Roberts Eva (c) 3| Vacant 4 Robertson Tommie (c) 5 Vacant 6 Slaughter Austel (c) 8 Mae Ruth (c) 9 Cain Emma (c) 12 Jackson Queenie (c) 12% Mitchell Chas (c) 14 Flowers Albertha (c) 15 Slaughter Robt L (c) 232 Bullock Frances (c) 223342yB2 eSllcoWtt mOla(c)(c) 236 Colbert Lena (c) 601*Hughes John V 660038*VCaucnannitngham Rebecca Mrs 610*Scurry Birdie Mrs 613*Stripling Minnie Mrs 617*Kent Ellen S Mrs 620 Apartments lAAllen Custus A 2 Hicks Claude M 3 Vacant 4 Whitton Harold S6tr5e1e4tBrcuonndtiangueedLuke M 653*Armstrong Robt I 665545*MSomnistheesJaJsesMsie C Mrs 657 Cargile Cecil B We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE CO. 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 510 T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety L. 310-12 First National Bank Bldg. Tel. 64 W 0 0 PLUM--Contd 659 Hardison. Rufus C 660AJSouseitytonAlNbeelrltieDMrs 66;lACone Maggie L Mrs Phillips Otis D 663 Carter Earl B Holton Geo 664*McGinty Thos A McGinty Susie H Mrs boarding First intersects 716 Caldwell Otis L 306 Vacant 315 (87) Goolsby Louanna (c) 317 (47) Maddox Heywood (c) 319 (18) Smith Thos (c) POE (Vineville)--Changed to Forest av POLE (Vineville)--East from 143 Forest av, 1 north ,of Douglas av PONCE DE LEON AV (South Macon) -- West from 3007 Houston rd D Plumbing and Heating The Best Plumbing is Always the Cheapest 512 1st 716% Greene Nonie O Mrs 717 Bennett Harry R 718 Read John B 718% VSacant 726 Whipple Everett Sims Ralph L 721 Vacant 753 Kelly John C Allen Thos M 754 Parker Lelia G Mrs 758*Floyd Ida Sandefur Ada Mrs 764 Shelton Harry J Hobbs Alene 765 Vacant New intersects PLUM (East Macon)--From Stripling al to Balkcotn av bet Applewood and C of Ga Ry 102 Herritage Wm M 104 Waller Clem H 1OoATheiss Conrad A H10W7 AWHeasytsbrWoomk ACrth V 108 Watkins Gordon L 109 Monroe Wm E McClure Robt E llOACollier Albert H 111 Btyrd Francis C 112 Coker Hiron B 113 Ramsey Max E 111154AWMilclWiamillsiamCshaHsenGry C 116 Hamlin Josephine Mrs 117 Crumpton Jas 118 Jones Wm A 112109AAMRoosusntCreheasJaTs R 122 Mason Frank 124 Williams Omer TEL. 529 PLtUo MEMdgEeRw'oSodALav-- From 152 Bay South 102 (302) Howard Annie (c) 104 (112) Evans Mollie (c) 114 (101) Milner Leo (c) 116 (167) Ford Carrie (c) 130 Russell Minnie (c) 126 Arnold Rufus J McMillan Lowren 128 Stewart Leo H 130ALane Richd L 134ASmith Wm A 201AEtheridge Jas O jr 203ACrisp John K 205 Beale Potomac R DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere calf on us R. L. POLK & CO. DETROIT 168 Mack Geo (c) 170 (126) Jones Daisy B (c) 172 (124) Clayton Julia (c) 174 (341) Davis Ellis (c) 176 (160) Walker Henrietta (c) Hazel intersects 220020 ((412033)) LWoaclkkeetr SEuisssieie A(c)(c) 204 (422) Fair Janie (c) 206 (104) Bailey Neal (c) 208 (100) Frazier Emma (c) 210 (712) Lamar Lizzie (c) 212 (121) Boyd Lee (c) 214 (256) Chambers Chaney (c) 216 (123) Watson Arzada (c) 218 (122) Bell Zaliff (c) 330010 ((164652)) SSomloitmhonLoJuaiss ((cc)) 302 (120) Vacant 303 ( 667) Gordon Elsie (c) 304 (164) Gallaway Chas (c) 305 (165) Vacant 306 (515) Vacant 307 (831) Hughes Wesley (c) 309 (506) Adams Rose (c) 311 (504) Johnson Ruby (c) 313 (507) Moss Viola (c) 313 (63) Coley David (c) 314 (66) Blanford Jesse (c) 315 (65) Finney John (c) 316 (66) Smith Stella (c) 317 (65) Wilson Wm (c) 318 (72) Mitchell Anna (c) 319 (616) Williams Lucius (c) Elm intersects 400 (311) Ross Jack (c) 402 (313) Reid John (c) 404 (375) Slocum Wm (c) 406 (381) Mitchell Wm (c) POND (Vineville)--From 400 Ward east 1 block 100 Lockett Arth 103 Alexander Louise (c) 211 Price Rosa (c) 214 Robinson Sami (c) 215 Pate Edw (c) 216 Epps Wm (c) 217 Howard Laura (c) 218 Bowman Albert (c) 219 Pless Norman (c) 220 Bateman Rebecca (c) 221 Duval Robt (c) POPLAR--From Twelfth west to Spring, 1 s^oCuetnhtraolf Cherry Cotton Oil Co (plant) ACotton States Fertilizer Co (plant) Elkan-Stone Tile Mfg Co (plant) General Reduction Co clay prod Dumas Hamlet H restr Dasher J M Lbr Co who! James Lumber Co mill AJames & Kingman Lumber Co who! AMaxwell Bros Inc box mfrs ARiverside Lumber Co ASou Crate & Veneer Co Ninth intersects City Incinerator City St Dept City St Sweeping & Scavenger Dept ACity Stockade ASoutheastem Compress & Whse Co Eighth intersects corABirdsey Flour Mills AMacon Cabinet Works ARoss Co The bldg supplies 408 (379) Lovelace Ralph A lbr Seventh intersects PLUMTREE (East Macon) -- From 103 Fairview east 202 Sanders David 204 Benson Chas L 7SAAmerican Oil Co (bulk plant) 101 Vacant 116ACarling Tile Co 121-41ADuBose J H & Son junk Sixth intersects 511 \:r),>&<{' ? wmm P 'MORTUARY HOTEL Phones 146-147 AMBULANCE SERVICE 814 Mulberry M C POPLAR--Contd 201 Union Carbide Sales Co (storage) Harris Mattie Mrs restr /Washburn Storage Co dBibb Supply Co Tbeerltminignal* ay* en*ds C of Ga RR i*nte*rse*cts M D & S RR i*nte*rse*cts South Ry i*nte*rse*cts Fifth intersects 301-07/Jackson-Wynn Co whol dry gds 311 Karsten & Denson Co (whse) 331356-B4a4r/BneatttemMafng CCoo whhaorlnefsrsuimtsfrs 346/Great Southern Trucking Co 334580-B5l2o/cHheaHrdideBrCoso cotton factors /Anderson Clayton Sc Co cotton 355 Otto Leather GBoroodasdwCaoy i_ntersects 440015-V09a/cCanent tral Tire Co 400 % 1/City Finasce Co loans 408 OMradceornofFeRdaeirlawtaioynCoofndTurcatdoerss Bldg Electrical Workers Union Order of Ry Conductors Macon Div No 123 , Central of Ga Ry Clerks Motion Picture Operators Local No Br5o PROGRESS--Contd 26*Walton Victoria Mrs Lucas Mattie D Mrs 27 Tyson Wm E 31 Otto Julius H 32 Martin Cora E Mrs PROGRESS (South Macon)--Changed to Colquitt PROGRESS (Vineville) -- Changed to Roosevelt PRYOR -- From 198 Hightower south to Pineview av, 1 west of Houston 100 Avery Chas 101 Moseley Myrtle Mrs 102 Jones Edw T FURSLEY (Vineville) -- North from Hardeman av, 1 west of Craft lOO&Davis Richd M 1020Claxk Anderson PUTNAM (South Macon) -- East from 4100 (3984) Houston av, 1 south Thomas 100 Staley Oliver D 103 Mauldin John D 105 Stokes Carlos E . 150-lHud.son Edgar N 321 Defore B B 323AMullis Bobbie L RANDOLPH LANE--From 26 Randolph pi east 14 hlk 75 Roland John D 76 Vacant 77 Vacant 78 Lee Robt E 79 Vacant 80 Vacant _ 81 Newberry Newman E 82 Vacant 83 Vacant RANDOLPH PL--From 421 Lawton av north to Dannenberg av, 1 west of Duncan av 3 Anderson Della Mrs 4 Bartlett Wm T 5 Boyle Mary L Mrs 6 Williams Geo T 7 Durden John D 9 Williams John D 11 Davis John Pelt Wm T 12 Smithey Leo W . 13 (111) lEveridge Lucinda Mrs Evans Albert 14 (86) Johnson Bromer L o 5 U3 "2.? >o -< O Dm g.O PS)2 ** Of >a. " a 3-b H 2 RAILROAD AV (Vineville)--East from 101 (50) Holt av 102 (147) Vacant 105 (218) Roberts Wm (c) 106 (250) Rhynes Mattie 0c) 108 (149) Vacant 110 (150) Greer Annie (c) 112 (145) Jenkins Henry (c) 114 (12) Barrett Noah (c) 111156 ((221554)) BBealtltleJoMhnoll(iec) (c) 117 (531) Vacant 118 (14) Thomas Sami (c) 119 (530) Vacant . 120 (212) Robinson Virginia (c) 121 (722) Jones Sami (c) 122 (227) Lewis Sami (c) 123 (539) Moses Julius (c) 124 (239) Vacant 125 (541) Pierce Ira (c) 126 (240) Kennedy John (c) 127 (543) Johnson JVasirg(icn) la intersects 128 (241) Jackson Annie M (c) 129 Ponder Thos (c) 130 ( 242) Hill Janie M (c) 131 (204) Moss Minnie (c) 132 (245) Wesley Wm (c) 1IS33OA(2C0h2a)mBberyrsanLbNrelClioe I(ncc) 201 (122) Hughes Dudley (c) 203 (310) Winbush Florence (c) 205 (368) Moore Virginia (c) 207 ( 367) Bailey Bertha (c) 209 W(36il6l)inBghivaimns CRoatctohnaelMi(lcl) 401 (209) Williams Robt F RANDALL AL (NH)--From 209 Pio Nono av south 100 (406) Staley Pearce (c) 101 (403) Jackson Lenus (c) 102 Hollingshead Caldons (c) 104 Johnson Laura (c) 106 Lewis Annie (c) 108 (567) Redding Henry (c) 110 Jordan Wm B (c) 118 (442) Rawls Lawson (c) RANDALL AV (East Macon) -- From Church to Broad, 1 north of Lee RANDOLPH (East Macon) -- From 360 Church west to Center 310 Dorsey Mamie L Mrs 312 Atkinson Jethroe L 314 Cribb M Alice Mrs 317 Parkman Annie B Mrs 320 Redd Percy R 15 McAllister Annie M Mrs 16 (85) Singleton Wiley 17 Taylor Henry W 20 ( 84) Vacant 22 ( 82) Blow Lula M Mrs 23 Vacant 24 (74) Carter Jefferson D 26 (73) Vacant 28 (24) Vacant 36 (104) Rodgers Simpson B 38 (102) Rivers Gussie Mrs RANSOME AV (Vineville)--West from 131 Clisby pi, 1 south of Vineville av 106*Head Geo W ray (East Macon)--From MiUedgeviUe rd east, 1 north of Second av REBECCA (South Macon)--See College dr REESE (East Macon) -- From Milledgeville rd north, 1 east of Bowman 102AReese Mary S Mrs 110 Hardy Wm C REID (South Macon) --From Waterville rd west to Broadway, 4 south of Edgewood av 28 Vacant 29 Johnson Wm (c) 30 (27) Brown Jas (c) 32 (26) Vacant 34 (25) Stokes Susie (cH) all intersects 110 Stokes Lizzie (c) 112 Thomas Anna (c) 114 Earl John (c) 116 Bonner Robt (c) Elbert i.ntersects 202 Vacant 207 Hickman Geo R 208 Fulford Foy W 211 Willingham Jos W 212 Vacant 213 Boinest- Maggie Mrs 216 Grant A Edgar 217 Myers Derias 218 Aides Danl W 219 Reddick Alton 220 Collins Eufa Mrs 222 (298) Russell John B 224 (300)Davis Wm J 225 Ellis Thos A 227 Brown Jas S 229 Etheridge A Dean 231 Shelley Geo S Chappell int.ersects oooo E 0M00Ct0O00 4 Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 514 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 REID (SM)--Contd 302 Vacant 304 Hickman Wm C liltJones Abline H 111163tHpaamrislinThHoosuNston V 300 Epps Eliz Mrs 310 Brown Evelyn Mrs 317 Reid Jacob O 322 Horton Barney 324 Couey Mamie Mrs 116%*Coggin Jasper L 1180-Griffin Mangham E 119 Gardner Fredk P 112190%-tB-OerErdywJaradss ERobt E 325 Marshall O Roy 1210-Carter Fredk W REMBERT AV--From 316 Linden av west to Carlins: av 101 Vacant 102-0-Moore Alan A 104-0Allen Lucy B 109OBeggs Wilma Mrs 1140Lee John D 115 Vacant 119 Edings Julian B 123-tBaird John L 126 Lynch Letitia Mrs 127 Smith Asa R 128 Collier Olie O Kemper av intersects 129-ORamsey Wm C San Juan inte*rsects Flamingo rd intersects 122*Wilder Chas J RICHMOND AV--South from Log Cabin 1250MoSwain John L bivd, 1 east of Macon 127 Reynolds LeRoy F 1010 Rekab Lester L 1280ghepard Volley C 129- O RIDGE AV (Vineville)--WReesgtLfsrteormO1t0to7 P Cauthen Caroline nurse Kenmore pi, I north of Vineville av 130131 Gober Prank D 132ASmall Edw T Rev 0 110031-EOzHeullmpKhareteys Floyd H-Hartness Ola M Mrs 196 Ernest Wm H 133 Mosely Martha H Mrs First av intersects 134-C-Holley John J 201-tBlanks Otis L 135 Worsham Alberta B Mrs 2020-jones J Clifton 135% Worsham Clarence J 136 Brock Ben.i R 203OBrown Willis Eug Geo D A jr1 137 Booker Arth P 204-0-Hurst Needham W 138 Norman Jas E 206- 139 Haircloth Bennett R. 207- 140 Vaughn Clayborne 208- RESTHAVEN AV--South from Forsyth rd, 1 west of Euclid av 210211212- REYNOLDS AL -- North from Oak bet First and Second 8 Ford Emma (c) 728 Cooper Lizzie (c) 772 Shoat Thos (c) 773 Turner Thos (c) 774 Murphy Chas (c) 775 Fuller Geo (c) 777 Rogers Carrie (c) Ingleside av intersects 307 Vacant 308 Godwin Mamie Mrs Underhill Dillon 313-OCollins R Milo 314 Vacant Hartley av i*nte*rse*cts Crumps Pk av intersects 778 Dixon Ella (c) 405 Williams Henry M 779 Turner C Thos (c) 407-OCleaveland Robt E 780 Nixon Alex (c) 781 Martin Bertha (c) 782 Smith Ella (c) 409-OHeam Sallie T Mrs Horton Jack B 410'-Fanning Geo W Cfi 784 Lester Wm (c) 786 Harvey Mamie (c) 412*Macon Carrie Mrs 4130Griffith Percy D 1219 Vacant 414-OCotton Harold M 1220 Vacant 416 Clifton Chas M 1221 Vacant 417-OBonner Bessie Mrs rear Reid Lovie (c) RICE--South from Anthony rd, 1 west of White 4180-Quillian Marvin C 420OLove Henry A RICHARD (East Macon)--From Jackson north to Hall McGee intersects 424-OBailey Marvin J 426 DeFore Ardell RICHARD (Unionvillc)--From Pio Nono av east, 3 south of Columbus rd 103 Gregg Sami (e) 104 Colbert Ethel (c) 427 Ingleside Methodist Church (South) 4280Scarbrough Lillie Mrs 429-0-Rodgers T Furlow Riley av intersects 105 Harden Lillie (c) 506 Durden John L 10'6. (127) Higgins Wm (c) 507 Nolan Walter K 107 Hollis Thos Oc) 508 Pittman Clarence G 108 (120) Mitchell Rufus (c) 509 Garvin . Estelle Mrs 109 (197) Jones Lula (c) 510-OThames Joel E 110 (100) Price Geo (c) 511 Cason Geo T 402 Adams Mary (c) 5130-Fincher Robt F 404 Hatfield Lula (c) 517-0-Baskin Wm H jr 409 Dee Alex (c) 519-OCutter Wm H RICHMOND--From 3498 Houston av east to Gantt City rd, 1 north of Grady 100 Miller Leroy 101OHandley Robt D 102 Pierce Nathan A 103AShepard Roger O 540 Birdsong Richd E 542 Adams Geo W 544 Sheridan Leo D 546 Smith Norfolk 548*Jeffreys Edw G 650'iRamsey John W Oak av intersects 110045O4'HEleliroritnt gWWmesIley 109 Gilbert Willis L 651--'Aldrich Fred N 654-0-Ream Donald K 6560-Weatherly Raymond J 515 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 7SS CHERRY TEL. 161 RIDGE AV (V) --'Contd 659Ajohnson JohTnnyrieone blvd intersec.ts 702AWeaver Olin H 772925/A-BLuawtttoRnicOhsdgoLod 724^Wynne Robt F jr 728ADixon Andrew F 731ABonner Robt 732*Dodds Sami D 222234''-G>KaridnairnderStGeveeonAB jr 225-2-Loh Lawrence M 226AJordan Anne W Mrs 227AWatson Wm H 229AGardiner Alf S 222343305--dFdBJuTutOhcawhnn TWDhemunrnstJiosnjFrD 255*Burden H K 736AELlington Jonah R 738*Gordon Chas H 741 Lucas Alice Mrs 743*Teal Dempie B Mrs 774457-OBBlaucllkockWHmerFman 749ARaekley Ernest 751-2-McKay Jas W 753ARussell Raymond D 755AThomas Launey J 775567AVMaccGaneet A B Auburn av int.ersects 800AWilson Robt L RIVOLI DRIVE -- Parallel with Forsyth rd at Wesleyan College AAdams Elton M AAckers Wm D Barnes Donald W ABDuucnkwoSdeylbyKeHnneth W ADunwody W Elliott jr Rivoll Riding Club Stepp F Wade Taylor John W J ATrimble Lee S Wright Harris Belvedere dr intersects 990068AVWacilalunmt s Jas W 910AAcree MauriAcelbeMmarle pi intersects 1102-CSelden John A phys 1106AWing Augustus M 1108-0-Hill Julian B lllOAMacDonell ARlilvenerdMaledr i*nte*rse*cts ROBERTS (Unionville) --East from Pio Nono av, 1 south of Montpelier av 100 (204) Reece Willie (c) 102 King Shannon (c) 104 (101) Edwards Henry (c) 107 Fields Robt D (c) 110 Thurman Beulah (c) 220017 S(1lo04c)umClaMrkamDieock(c)(c) ROOFINGS EVERLOX SHINGLES Merritt av intersects mi&Brown Leon C ROBERTS PL -- North from Ridge to Drury av SHEARLIBDEARNT, EM. gr. 1202 Daniel R G 11220046AWJohhitneshtoenadLGewuiys TM ROABmINerSicOaNn bRlOvdADwe(sBt ellevue) -- From 1208*Batchelo Alonzo N 1212*Hatcher AyerRoTycrest dr intersects 127: Vacant 332 Franklin Thos (c) 334 Gibson John W (c) YOUR 1231 Alexander School No 4 337 Franklin Elmore (c) 1298 Davis Frank A 353 Lundy Wm W (c) 1302-OSmith Chas P 355 Baker Raymond (c) CITY 130SASwain S Alf 358 Robinson Hester (c) 1307ASolley Boyce Roberts pi intersects 359 Dixon Clinton (c) 360 Lindsey Lucius (c) 1401ACrockett Roy W 361 Mosely Wilbert (c) D RILEY AV (Cramps Park) -- From 2111 Vineville av north 110658&MPoawrteinrs WFainllnieie RMidrgse av i.ntersects 362 Wimbush Mabel (c) 364 Carter Dolly (c) 365 Brown Isaac (c) rear Carter Carrie (c) 366 Jackson Moses (c) 367 Burkes Louise (c) I R 170 Ingram Jas K 229 Gaston David (c) 369 Huckaby Thos (c) 371 Jackson Mattie J (c) E 223315AHDaarvriiss ATnhdorsew(c)(c) 237 Dozier Jane (c) 383 Smith Letha (c) 386 Gordon Ella (c) 393 Causey Wm (c) C RITCHEY (East Macon)--From Cowan 400 Mosley Thos (c) 404 Lee Jesse (c) T north to Hall, bet Womack and Center 406 Lewis Emma (c) 115 Vinson Mary L (c) 117 Jones Clifton (c) 119 Singleton John W (c) ROCK AV--From 328 Dempsey av south O three east of Pio Nono av 121 Stallworth Mattie (c) 123 Cornelius John (c) 125 Allen Major (c) 127 Davis Janie (c) 129 Mack John (c) 131 Davis Marylou (c) 133 Maynard Silas (c) 135 Wilson Ned (c) RIVER RD--North from 1035 Clinton rd, 100 Gray Cora A (c) gro 102 Lamar Anderson (c) 106 (342) Robinson Julia (c) 108 Harvey Northern (c) 110 (340) Battle Lucinda (c) 112 Adams Berry (c) 114 (341) Jones Sallie (c) 116 Tabor Harry (c) 118 Jieter Seaton (c) R Y MIRRORS the 1 east .of Masonic Home rd *Clay Jos Clay Alex AHudson Douglas Hollomon Ellis L AKendall Leonard J RIVERDALE DR (Ingleside)--From Forsyth rd north to Overlook av, 1 west of Albemarle pi 205-0-Dempsey Norbert A 206ANewton Chas E jr ROCKHILL LA--North from 211 Green west 102 Brown Blanche (c) 116 Johnson Laura (c) 118 Vacant 119 Ball Nelton (c) 120 Lewis Jas (c) 121 Jones John (c) 121% Griffin Sami (c) 122 Johnson Carrie (c) 123 Woods Cherry (c) Industrial LIFE Of Your CITY 516 PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES Where To Buy? Consult the Classified Business Lists In This Birectory ARLINGTON HOTEL FREE STORAGE BMRoOdeArnDWaAndY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. ROCKHILL LA--Contd 124 Colbert Cosie (c) 125 King Lizzie (c) 126 Rockhill Lane Church (c) 127 Smith Janie (c) 59 (14) Waits Edw 60 (4) Speer Ray W 61 (3) Durden Amos 62 (2) Adams Andrew 63 (1) Meeks Carlos J ROuCatKioLnEDoGf ERoAbVins(oBnellredvue) -- ContinROCK MILL--Changed to Rocky Creek rd ROCKY CREEK RD--From 3611 Hous- ton av west two blks, south of end of car line 101&Farley Fredk 102 Jenkins Marvin W 103 Martin Nannie E Mrs 104 Williams Amos D rear Roquemore Thos (c) 201 Hudson Robt B 202ASwanson Harvey F 203 DKaitvcihsenOslliWe FLee 209AStevens Bascom S 217 Upchurch Andrew L 253hFordham Mary L Mrs 254 Smith Jas O 305 Philmon Thos D 310-ORobinson Wm 401 Stevens Wm A ROFF H031E AV (Vineville)--(Continuation .of Railroad av)--From Duncan av west bey Pio Nono av, 1 south of C of Ga Ry 64 McAber Augustus N 107 Champion Andrew J 110 Goodin Nancy (c) 112 Andrews Nannie (c) 114 Edwards Edw (c) 115 Gilbert Corine (c) 116 Johnson Wm H (e) 117 Guyton John (c) 118 Cotton Rachel (e) 211 Anglin Luther 219 Mallory Baptist Church 229 Mote Enrnon J 231 Clark Chas M gro 232 Evans Wm rear Tucker Howard R 233; Brown Sami F 234 Moltz Lester rear Harris Frank H 236 Harper Myrtice 240 Collins Frank C 242 Bowden Birdie Mrs 244 Foster Wm M 248 Causey Hattie Mrs 286 Ravell Jas E 287 Hardin Ratter Mrs 525838 CVoauccahnt Ruel 554 Underwood Maggie Mrs ROFF HOME LA -- From Roff Home av west to Pio Nono av 110 Vacant 113310 FWoalkiteWs mClarence L 132 Crow Susie Mrs 134 Gibbs Arth 135 Raymond John 136 Shed Clarence 138 Herron Gertrude Mrs 177 Crawford John P 204 Collins Clarence 206 Vacant ROsoFuFthH, O.oMneE ePasLt--oFfroPmattCersoofnGa R R 50 (5) Parker Harry B 51 (6) Benson Wm 52 (7) (Enterkin M Preston 53 (8) Gamer Whiter 54 (9) Moore E Marion 55 (10) Ryles Frank W 56 (11) Phillips Robt 57 (12) Champion Eli T 58 (13) Lester Chester A ROGERS AL--From, 619 First east of Spring ROGERS AV (Vineville) -- From 601 Vineville av north lOOAAsbury Wilkes R 1025GarfieId Leonard H 103 Vincent Ned 104*Stanley Wm K 105-0-Hartness John W 106AMorgan Wayland B window shades Spooner J Earl Edwards Richd 107-oMcCormick Wardlaw L 108*Marques Wm H jr 109-0-Fulghum Matilda Mrs @ 110-y'--'J'-oWneasnamSakFeireldMearry Mrs Harrison L Holmes llL- Turner Edw H ^HScarwukgignss Walter Wheeler M 112- -0-Wheeler Clyde M OSmall Henry M -0-Young David H 113- 114AJordan E Ross -o-Smith Robt W 114%B&uHchuannt anLucAyndMrerws 115-OSmall Ralph B Mrs Studios interior decorators Small Ralph B ll&O-Goolaby R Cullen ln-O-Pittman Henry W 1184Stewart Benj C 119-OMcMillan Eug C 1200-Little Leslie H Little R Douglas 1210Burgess Morris P 122 Bridgers G Herbert 11224300-ELallyifnigeltdonJaSsladMe A 125 Jacks Lee H 1260Sanford Shelton P 1270Jones J Calvin 128 Roughton R Palmer H290johnston Benj B 1300-Cooper Otis O Bennor Jos 1310Whitaker Cecil F Bradshaw C Herschel 1330Buxton John N Highland a*v b*eg*ins 203OGibson John F Clayton begins 205 Vacant 207 Smith Guy L 209OThurman M Merritt 2110Buxton Raiford E 2170Anderson Jas L ROME RD--Changed to Walls al ROOSEVELT (Vineville)--From nr 112 Ruby west to Gailiard, 1 north of Douglas Penn intersects 113 King Guss 114 Vacant 120 Vacant 123 Phillips Maggie (c) 124 King Taylor (c) 130 James Eva (c) 131 Jones Susie (c) 134 Thomas Maude (c) 135 Chaney Manton (c) 1370Walker Winston (c) 138 Dudley Carie (c) 139 Jackson Nora B (c) 517 1 34 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 ROOSEVELT (V)--Contd 140 Walker Winston (c) 203 Chambless Mittie (c) 205 Maddox Jesse E 206 Wynne Eug (c) 207 Wynn Eug (c) 208 Floyd John W (c) 209 Stinson Clarence (c) 210 Tanner Anna (c) 221121 CSmariitthherEslnTarhaos(c()c) 213 Davis Reuben R (c) 214 Vacant 215 Jackson Thos (c) 220 Lawrence Jas (c) 222 Patrick Floyd (c) 225 Kemp Pauline (c) 226&Brooks Jas (c) 227 Brown Lemon T (c) 228 Person David P (c) 229 Lowe Wm (c) 230 Ligon Anna (c) 231 Jones Lucius (c) 233 Vacant 235 Holt Adam (c) 304 Walkter Jos (c) ROSE AV (Payne Mill) -- East from Water to Thomason, 1 south of C of Ga R R .. ,, Payne City Community House ROSE CREST AV (South Macon) -- From Edgewood south, 1 west of Sec- ond . ,,, _ 101 Singleton Naomi (c) 1103 Dowdell Jos (c) 105 Bland Arth (c) 107 Jenkins Selma (c) 109 Wilson Madison (c) 111 Young Israel (c) 113 Duncan Arth L (c) 115 Morgan Curtis (c) ROSE LANE--From 5 Spring northwest, 1 north of Ocmulgee 3 Lockett Marie (c) 5 Thomas Ellen (c) 7 Thomas Henry (c) 9 White Chas (c) ROSE PARK -- Continuation of Oak west from Spring to OSprarningge intersects 114-0-Nix A Elyert Mrs Blanker Allen C 111255*WNehlistoen REodswnaellRRMrs ,, 131-'-'Drake Wm F Sires Ralph 135AWeinstein Max 139*Herring Pearl W Mrs 1143 BMaartthleewtts BMlaenctkoine MI rs 147-OSchall Mary L Mrs Roger Ann nurse ROSE PL--From 637 Orange west lABalkcom Jack AGrotenstein Carl 2AMeGoldrick Jos P 3*Williams Jeff L 4-CEnnis Henry G 53-Nipper Chas A 6AMoore Asa E Little Geo B 73Head Juliette Mrs ACarswell Kenneth N ROSS--From junction of Columbus and Appleton av, south to limits 103 Andrews MerriCttolumbus intersects 106 Sessions Solemlie Mrs 108 Blair Sami M 122 McDowell Louise (c) 130 Holland Mattie (c) 131 Layfleld Oliver D 135 Kimbrew Ada E MMrasple intersects 139 Welder BusterOgWlethorpe intersects 217 Goodyear Kenneth 218 Taylor Arth B 221 Woodward Felix W 222 Avery Roxie E Mrs 226 Walker Henry G 227 Carlos Wm S 232 Crawford Geo W 233 Tucker Claudie 239 Gordon Sami 240 Sapp W R 243 Wolf Meyer College p*i b*eg*ins Hazel intersects 307 Willis Lillie T Mrs Hilbom Bert W 317 Moran Wm C 319 Hamm Jas F 320 Patton Clara Mrs 321 Parker Geo H 324 Odell Kate Mrs 325 Barker Mary E Mrs 334 Vacant 335 Hughes Augustus L 336 Lazenby Lilly Mrs 338 Pettey Lillie Mrs 339 Norris Nell Ash int,ersects 406 Barnes Maggie Mrs 408 Rainey J Wm 413 Hollomon Collie 441169-B-'Henatttoonn DWamnl WM 422AWillis Robt L 423-0-Amerson Nancy Mrs 429 Hudson Eliza Mrs 432 Tnawick John C 433 Childs Thos O 434-0-Truman Dorothy G Mrs 436 Spence Ernest R 437 Harris Lonnie O 438 Stringfeller Jack 440 Pritchett Rachael Mrs Elm intersects 515 Bouyer Rose (c) 518 Daniel Mattie (c) 519 Johnson Fate (c) 5120 Pitts Berry (c) 552221 MAtckGinhseoen CChhaass ((cc)) 524 Green Mittie (c) 526 Harris Thos (c) 528 Jones Adeline (c) Edgewood av intersects 602; Watson Wm (c) 604 Taylor Jas (c) 606 Dupree Luther (c) 608 Mitchell Annie M (c) 609 Waller Inez (c) 610 Ball Chas (c) 611 Barron Wm (c) 612 Hobbs Bessie (c) 614 Vinson Ernest (c) 615 Banks Lorene (c) 616 Hodges Ernest (c) 617 Ellison Reacie (c) 651 Williams Lillie (c) 652 Hall Wm H (c) 653 Ashkenazie Lula Mrs gro I655AAshkenazic Lula Mrs ROSS STREET PL--From Ross east bet Maple and Columbus 1 Waldon Harry (c) 2 Gardner Jack (c) 3 Shedrick Nathaniel (c) 4 Walker Clee (c) 5 Gordon Arth (c) 7 Quarterman Wm (c) 8 Long Maude (c) 9 Sims Lizzie (c) 10 Banks Frank (c) 11 McCrary Henry (c) 112 Lewis Jos (c) SIGNATURE ONLY SAME DAY Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 518 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES (11444465 Plymouth ROYCREST DRIVE--North from Forsyth rd to Drury av 105'Q.jackson Emmett L ROYE (Cherokee Heights)--From Pio 1N08onCoroawvdweerstJ,o1hnnorLth of Suwanee av 110 Wright Jas H 112 Vacant 114 Edge Laura A Mrs 116 Ross Mary Mrs 111186%KiDngickJeorshonn ONannie L Mrs 120 Odom Ira 124 (163) Edwards Robt (c) 126 (165) Mims Adolphus (c) 130 (169) Kinds Elijah (c) .134 L_ ewis Jef.f (c) soBftelldarvinkinstersects 136 (170) Hartry Luke (c) 138 (274) Boone Sylvia (c) Wilson Aggie (c) 140 (223) Askew Wm (c) 142 (224) Blalock Willie (c) 144 (220) Harris Seymour (c) 150 (226) Fountain Asa (c) Hogan Austin (c) 154 (229) Davis Arth L (c) 156 (420) Hudson Sami (c) 168 (300) Thomas Chas (c) 170 (302) Josey Eli (c) 172 (304) English Alberta (c) 174 (243) Brooks Lucy (c)' 176 (238) Summers Alonzo (c) 180 (240) Searcy Hattie (c) , 184 (3:13) Grimm Jas (c) 186 (343) Hill Hattie (c) 200 (400) Marchman Leola (c) 202 (402) Wilder Nathaniel (c) 210 (410) Clarington Alice (c) ROYE LANE--From Roye north to Green 207 Askew Marie (c) 221029 MBruororkasy WSailllliiee ((cc)) RUBY (Vineville) -- North from 339 Douglas av, 1 west of Forest av 100 Vacant 102 Skinner Roosevelt (c) 104 Jackson Andrew (c) 106 Givens Raymond jr (c) 108 Harris Clara (c) 110 Bonner Shelton (c) 112 Davis Robt (c) 303 Hickman Edw H 304 Gurganious Homer A 330065bPPraetsetoGn eoOsTcar 307 Mullis Robt C 308 Mullis Jas B 309 Clark Harry Blount ends 313 Gilman Onnie F Mrs 315hGilman Lizzie A Mrs 400 Banks Lucy (c) gro RYALS AV--South from 106 Ransom av !02ARicketson Jas E ST JAMES AV (South Macon) -- West from 2931 Houston rd lOlABoon Lois 102-0-McCowen Roy M 103 Smith Bewel B 1lO0S5AhPpiaerrroiesh GSoorldoAn I 108 Moore Singleton lC9ACopeland Ernest C ST JOHN (East Macon)--From Church east to Fort Hill, 1 south of Broad 101 Hughes Kittle C Mrs 102 Vacant 103 Martin Domingo S 1104 Giles Jas C 105 Ryles Jos K lOShJones G Dewey 107 Hartsell Willard E 109 Houston W Bernard 201 Manderson Otis ST PAUL--From Forsyth west to C of Ga Ry, 1 west of College lhPranklin Robt C 7 Davis Lonnie (c) 9 Lowery Wallace (c) SAN JUAN AV (South Macon)--From Villa Crest south to Nona dr, 2 west of Houston av 333,,&Brantley HaOrrrymoTndter intersects Villa Esta i*nte*rse*cts Lynmore av i*nte*rse*cts Moore i*nte*rse*cts Richmond i*nte*rse*cts RUTHERFORD AV (South Macon) -- S99'0M.1?cC29a2h8illHoTuisntuosn agvroeast to Blount 101 Jackson Jas E 108AGriffin Berry L 1ll1O2'-hMDecaGlahFeeernaBnedronarDd 114 Moncrief Marion W 116 Radcliff Jas E 112118 CGarmesphbaemll FJoehrdninOand 123 Woodruff Floyd F 125 Batchelor Mary A Mrs 127 Layfield John 129 Foote Ezra L 206 Cone O,,so,lene MrsBaconnuirnsteersects McDermott Sarah Mrs nurse 210'i-Thurmond Jefferson C 279 Gassett Buford 228831AHHamarmmoonntd EAdnwdirnewH J piano tuner 285 Kenyon Solomon 287 Holley Millard H 289 Hawkins Frank 291 Jenkins Thos J 293 Hawkins Jas W 295 Coleman Chas H o3n0r0, Carrol,,l Jos S Simmons intersects 301 Hutto Garfield 302 Vacant 714 Woodall Jas W ^ 720 Davis Jos W 724 Stovall Geo R 8800200W-Sohoerdwaollod,ChLausmbJerFuCltoon intersects SAPP AV (Unionville) --From Park west to Key, 1 south of Dempsey av 100 Evans Cecil (c) 103 Williams Beulah (c) 104 Jackson Emma (c) 107 Williams Qullle (c) 108 Johnson Molly (c) 111 Howard Alex (c) 112 Howard Albert (c) 1113 Vacant 114 Lawrence Sally >> -c mSi 2 Q jJS; Taa3 M-l *JC >- 41-->1 -CMO a % M O S (iC0t3 rbgoOa>o > u fcSi 201 COTTON AVE. LOANS TEL. 6130 SECOND AV (SM)--Contd 203 Pringle Ernest 207 Sammons Thos W 308 Cliett Wm H (c) 310 Dowdell Luther (c) rear-O-Comelius Robt E (c) SEVENTH -- From river southwest to Hawthorne Ocmulgee intersects cor Central City Park Downie Bros Circus MD&SRR dispatchers' office Walnut intersects 21 Hubert Minerva (c) 22 Dennis Rena (c) 23 Harris John (c) 24 Johnson Wm (c) 25-26 Marshall Willie B (c) 27-28 Jenkins Major (c) Mulberry intersects 345 WPA whse 349 Hub Fish & Oyster CO Wall begins 351 Seventh St Baptist Mission (c) 353 (14) Young Docia (c) rear Lewis Rosie (c) 3515 (12) Calhoun Benj (c) 357 (10) Young Wm (c) 359 (2) Hicks Lillie (c) rear Franklin Ada (c) Willingham Sash & Door Co plant Cherry i*nte*rse*cts Poplar intersects ne cor iRaible J R Cooperage Co SEVENTH AV (Bellevue)--From Industrial Home rd north to Atlantic av, 1 west of Sixth av 101 Bryant Georgia (c) 107 Barnes Gussie (c) SHALLOWELL (East Macon) -- From Garden west to Broad, % north of Church SHAMROCK -- South from Monroe to Ash, 1 west of Ross 96 Fielding Rosa (c) 98 Franklin Froney C(co)llege intersects 126 (125) MiHer Delia (c) Columbus i*nte*rse*cts Oglethorpe intersects 216 Holliman Julian C (c) 218 Hester Sophie (c) 220 Little Roy (c) 222 Pope Elder (c) 224 Lanier Otis (c) College pi i*nte*rsects Hazel intersects 313 (319) Vacant 314*Andrews Felton E 315 Vacant 316 Tipton W L 321 Pope Mary Mrs 328 Hartzog Henry 330 Toland Oscar Ash intersects SHAMROCK (Bellevue) -- South from 366 Robinson rd 103 Carter Clara (c) 105 Dixon Clinton (c) SHARL (South Macon) -- Formerly Short, south from Henry to Heard, 1 east of Houston rd 107*Burnett Chas X SHERMAN (Vineville)--From Grant av to Lincoln, 2 north Douglas av 128 Vacant SHIRLEY HILLS--A suburb north of North Highlands just bey city limits SHOALS Af, (East Macon)--West from 448 Clinton to Martha, 1 south of Center 411 Pace Willie (c) 440 (453) Johnson Emma (c) 444 Billingslea Malinda (c) 448 Vacant Shoals la intersects 452 Sherman Willie M (c) 656 Vacant 610 (611) Nelson Wm (c) 612 Gordon Reuben (c) 613 Gordon Willie (c) 614 (613) Vacant 619 Hanks John (c) SHOALS LANE (East Macon) -- West from 448 Shoals al, I south of Clinton 111 Brown Annie (c) 1115 (460) Ross Mary (c) 117 (114) Tillman Adelle (c) SHORT (East Macon)--North from 1000 GOOD Main .1 (4) Raines Cleveland (c) 3 (6) Stephens Wm (c) 5 (6) Vacant 7 Montgomery Leroy (c) 7% Vacant 11 (8) Smith Ella (c) Jordan intersects 13 (8) Vacant 15 17 (9) Vacant (10) Montgomery Alice (c) 19 (11) Smith Ella (c) 21 (12) Redding Wm (c) 100 (113) Dennis Emmett (c) 102 (114) Smith Adeline (c) 104 (216) Stevens Eva (c) 106 (216) Glover Genie (c) 10614 (217) Clowers Ernest (c) 108 (218) Vacant 112 (107) Glover ClaWuodoelfo(cik) intersects 300 Hunt Benj (c) 301 Carter Chas (c) 302 (303) Bostick Mamie (c) 304 (305) Vinson Richd (c) 306 (307) Westley Wm M (c) 307 (328) Patterson Weston (c) 308 (310) Roberts Delia (c) 312 (311) JohnSshoonrt LSeteree(tc)la intersects 314 (326) Clements Sidney (c) 315 (720) Thornton Ethel (c) 316 (315) Wimberly Fredk (c) 318 (317) Vacant 319 (320) Farrow Sami (c) 322 (321) Blackshear Jas (c) 324 (323) Parker ChasCo(wc)an intersects 402 (14) Harkless Chas (c) 403 (23) Waters Thaddeus (c) 405 (411) Moore Thos (c) 406 McCall Pennie (c) 407 (979) Williams Julia (c) SHORT (PM) -- From 136 Comer ter, west to Brigham 74 Rainey John D 75 Whitlock Thos C 76 Gibson Bartow Mrs 77 Jones Virginia Mrs 78-79 Caldwell Cethes F 80-81 House Earl J SHORT (South Macon) -- Changed to Shari SHORT AL (Vineville)--From 115 Lamar west to Culver 482 (102) Clark Leroy (c) 484 Wright Warren (c) 485 Wilson Thos (c) 486 Howard Solomon (c) 487 Threatt Edw (c) 488 Allen Ora (c) 489 Butts Marcenia (c) 525 Moving - Packing - Crating Prompt Efficient Service TRANSFER NEW AND USED FURNITURE CO. 408 BROADWAY PHONE 304 SHORT DANE (East Macon) - Dom Cowan north bet Lexinffton and Center 107 Manley Jas (e) 109 Manson Booker (c) 111110 FBiantntleey MSauzsiiee ((cc)) 112 Warren Cleveland (c) 113 Phelps Ohas (c) ^ 200 NeCwhuJrecrhusa(lce)m Primitive Baptist 456 Vacant 458 Vacant Poplar intersects SIXTH AV (Bellevue)--From Industrial Home rd north to Atlantic av, 1 west of Fifth av ,, . ,. 100 Bellevue A M E Church (c) 107 Rhodes Ed w(c) 108 Fraley Martha (c) 109 Cressville School (c) 112 Pittman Josephine (c) SHORT ST LANE (East Macon)--From 328 Short east to Bowman SIXTH AV (South Macon)--From 248 Plant south to Jeff Davis 2 (4) Ford Edwin(C) 4 (3) Vacant 6 (18) Cooper Viola (e) 8 Vacant ,, _ 9 (11) Mathis Dave (c) 10 (7) Snow Wm (c) 12 Vacant 13 Holton John H (c) 15 Hall Bertha (c) 208 Roberts H Arth 210 Vacant 216 Hayes Geo B 222 Grant Sarah J MrTsenney av ends 331266*FArdadziiseorn CMorialdrCedMVrsMrs 336 Giddens Robt 346 Hooker Raymond F 17 Cobum EBdrowad(cS) treet la i.ntersects 21 (16) Marshall Clara (c) SMITH (East Macon) -- From Jackson north, 1 east of Fort Hill 99 Gallimore Jas W (c) SIAM (East Macon)--From Clinton to Broad, 2 west of Center 556780*WShilellilaemy sCMhaasry(cR) (c) 571 Nelson Eliz (c) 557759 M(5o75o)n RMivaerrcsusM(acr)gt (c) 81 (576) Mitchell John (c) 583 (24) Davis Jas (c) 587 (20) King Frank (c) 100 Williams Ben (c) 102 Shoates Charlie M (c) 103 Davis SIherman (c) 104 (Hammock Patience (c) 106 Hall Roosevelt (c) 108 Vacant 110 Jones Josephine (c) Co*wan *intersects Hall intersects 558991 ((555597)) WWiololidafmorsdonDHawSsoonl ((cc)) SIMMONS (South Macon)--From Hanson south of Rutherford av, 2 east of Houston av 201 Staoleton Jas A pntr 203 Carter Peru R 204 Crawford John J 300 (200) Driskell Bernice (c) 301 (201) Sutton Maggie (c) 303 (202) Gibson Jas (c) 309 (206) Veal Raymond (c) 311 (114) Williams Minerva (c) 321 Riley Anna (c) 324 Wright Gus (c) 401 Thomas Max (c) 500 Boyer Geo gro 205 Hinson Jas W 502 (402) Grant Wm (c) 206 Carroll Joel ACleve,land, i.nt.ersec,ts 524 Vacant Mitche,,ll i.nt,ersects 300 ^306) Greene Wiley I 301 Freeman John B 533 Sutton Mary (c) 634 Ohillious Leonard (c) SIMMONS AV (Bellevue)--From Robinson rd southwest, 1 west of American blvd 101 (456) McCollum Anna (c) 103 (124) Watkins Frances (c) 107 Gordan Alice (c) 108 Thomas Jos (c) 109 Byrd Harry (c) 110 Foster Shell (c) 115 Brantley Benj (c) SINGLETON'S LANE--From 218 Spring 535 Vacant 536 Parker Allen (c) 538 (1144) Ford Phoebe (c) 540 (248) Cloud Pink (c) 546 (446) Green Odessa (c) 547 (447) Smith Carrie (c) '549 Booker Arth (c) 595 (501) Brown Duncan (c) '506 (504) Williams Mack H (c) 597 (503) Driskell Jacob (c) 59 (506) Parker Wm (c) Taylor intersects east to New 105 (597) Wilson Henry (c) 608 (308) Manuel Cora (c) 610 (203) Peacock Paul (c) 107 (599) Brown Valor (c) 109 (500) Watson Louis (c) 111 (553) Vacant SMITH (South Macon)--Changed to De Borde and Henry 112 (850) Wimberly Katie (c) 113 (850) Fitzpatrick Dock (c) 116 (272) Field Benj (c) 118 (270) Nelson John H (c) 112202 ((226640)) TJahcokmsoans LJoehRnoy (c()c) 124 (262) Jeffrey Robt (c) SIXTH--From river south to Hawthorne, 1 east of Fifth Ocmu*.lgee *i.nt.er*sect.s Wa*lnut *inter*s'ects SMITH ALLEY--East from 723 1st to New SMITH ROW--From Oak west to Arch between First and Second 52 McCrae Betty (c) 515 Stubbs Robt (c) 550 Green Alonza (c) 552 Caesar Chas (c) 554 Drain Hattie (c) 558 Williams Lula (c) 559 Wilburn Chanie (c) 560 Sanders Mary L (c) Mulberry intersects 564 Mouzon Mary J (c) cor&Kinnett Odom Co iceWmalflrsintersects 855 Hymes Emanuel (c) SMOLLING AL (South Macon)--From Cherry intersects Long south YOUR CITY MIRRORS the CIVIC Of Your CITY 526 D. H. Adams TAYLOR STORAGE SHIPPING Motor TRANSFER COMPANY 458 PLUM ST. PACKING PHONE 388 Co. SOCIETY--From 903 Cowan north to Cemetery, between Short and Bowman 99 Stevens Mary (c) 100 Blackshear Wm (c) 6 Mills John M 7 Logue Arth H 8 Vacant Street continued Studebaker Willys SOhUouTnH wBeOsUt NDARY--From 543 Cal1 Johnson Wm (c) 2 Renfroe Hattie (c) 3 Brown Henry (c) 4 Boyd. Douglas (c) 9 Haslam Viola (c) 164 Williams Ernest D Becham Oscar L 166 iCoursey Frank A 167 Ard T Edw gro 168 Bruce John H 117609/--OlARmogeerriscaSntoOreils gro Co filling sta 17|lbWhitman's Pharmacy Hupmobile SOUTHERN HEIGHTS--South of city limits and east of Columbus rd 204/-Doles Thos J Walnut intersects 208 Crabtree Guy E SPARKS AL--From 529 Washington av Walters B Frank) west to Forsyth, between Madison and 212 Dunwody Kate Mrs Monroe 215 McKervey Annie 1 Taylor Carrie Cc) 218 Min ter Inez Sales 2 Jackson Mead (c) 3 Mitchell Lizzie (c) Singleton* s la *inter*siects Service 4 Humphrey John C (c) 5 Woodward Thos (c) 76 RVoabcearnston Mamie (c) 316 Hort. on Annie BMuMbresrry intersects 318&Weir Cynthia A Mrs 320 Heidt Richd L 10 CUrry Wm (c) 11 Freeman Fannie (c) 354AWn. g,h.t GertruSdepriCng Mlarsintersects 12 Davis Chas (c) ^Willingham J Paul 655-657 Third St. 15 Watkins Jas (c) 17 Lawrence Alice (c) 18 (755) Willard Mattie (c) 364 Vacant 371AHud, son ClHififIo1rdPaFrk av intersects 19 (425) Rhone Geo (c) Rice Wm J PHONE 2997 SPRING--From river south to Washingt2onwaevstanodf fFroirmstHigh south to Orange, 41 C(7o)lliTehroMmaeslissHaen(rcy) (e) 6 Brown Jas (c) 7 Vacant 8 Bivins Jesse (c) 403 Wairren Chas A Cherry intersects 409*Eyler Bessie Mrs Walls Lena Mrs 413bMad!dux Mamie T Mrs 422 Vacant 446CStuar.t C,,has FMagnolia intersects 451 Smith Alvah R YOUR CITY D ,192 JLoantteismoCrheasEf(fcie) (c) 14 Hunt Obie B (c) 15 Dumas Thos C (c) 16 Boynton Lint (c) 17-GCobb Bertha .(c) 20 Butler Mamie E (c) 23 Wilkerson Liula (c) Willow intersects 452*King Jos F 457hSimmons Olive D Mrs 458 Kitchings Walter A 460 Moseley Wm W 461 Herring Annie Mrs 463 ACvhaanntneCy hFasranEk C 467 Mathis Carl C Griffis Clarence A 54 Hall Wm (c) 469' Jones Henry A I 55hHamilton Eugenia G (c) 56 King Jos (c) 57 Lowe 'Elijah (c) 475 (Harrison Eug T Pringle Robt L 477 Logan Lomie R 58 Wilson Ellen (c) 59 Jordan Esther A (c) Washingto*n av*inter*sects E 61 Dunbar Sarah H '(c) 62 Mathews Henry (c) H* igh *inter*sects C T O R Y MIRRORS ihe CIVIC Life Of Your CITY 6'7 Adkins Jeremiah (c) 68 Turner Wm (c) 70 Perry John C (c) gro 74 Reynolds John (c) 76 Glowers Frances (c) 80*Standard Oil C__o f--ill sta 103 104 105 TSCehlelolmemrosanssAMWiraammSie(Oc)((cccm)) ulgemeuisnttecrhsrects 107i Savage Hattie (c) 108 Monroe C Anna (c) 109 Benns John B (c) 111 Lyles Lula (c) 112 Smith Gussie (c) 113 Bell Annie (c) 114 Baker Hillman (c) 115 Park Lummie (c) 117 Everson Marie (c) 122 Moore Annie A (c) 152 Stewar,t Wm (cM_) oore la intersects 163-165 Spring Srljt DAispraorotnmeanl tisntersects Apartments: 21 DAolbcrtiogrhtChFaesrris L 3 Bernard Wm H 4 Crutchfield Calder B 5 Ard T Edw Plum intersects 612 Hartley Ruth P (c) 615AAustin John W 616 Moore Chas (c) 619 Jackson Floyd 620 McCoy Florence (c) 6,,5,,3,, ,,Reese John EDuRnelvap al intersects 659hPitts Zephyr (c) 663hWilson Zana Mrs 672*Wofford Oil Co filling sta Cotton* av *inter*sects R. 7o0o0m^DNs,, :oipcptoerrs's BPuhialdrimngacy Pine intersects lOlbAtkinson Harold iO phys 2014'Thompson O Richd phys bWalker Duncan D phys 210*Chrisman Wm W phys bHarrold Chas C phys 220bhHSamrirtohldJ TAhollsenjrphpyhsys hMobley Walter E phys 230hWeaver Hudnall G phys Weaver Olin H phys 301-Q-Corn Ernest phys 3100-Newman Wm A phys AAnderson Carl L phys 527 MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 455-57 SECOND ST. TEL. 4401 SPRING--Contd Doctors Bldg--Contd 331250&h-GBPo'aaorsmlhsiebnryskFiRraBmCenpuitlolenJn Wphydsentist phys 330hRichards6n Chas H phys O-Rogers Tlhos E phys aross Thos E jr phys Street continued 771202-'*-M'BMriidoddwdllene GGaa HHoossppintaulrses' J Frank phys home 752-'-'Stroberg Fred R L 754 Roberson Louis B 756 Williams Walter T 776751 SBaouwnddoeirns RGahleoilgsohn L 780AConnolly Michl HLemlock intersects 888000246'"*A-M'-nWcdaGrlekrweergsoWrMaDatsgaornnuldeEr 808-ORobinson Jas M 881102*MWilaltisroonns HCelnifrfyorMd . V 1 (417) Payton Ruby (c) 2 (456) Vacant 3 (419) Rutland Amie (c) 4 (458) Brooks Lula (c) 5 (1318) Vacant 6 (460) Comer John (c) 8 (1331) Jones Jas (c) 10 Vacant 12 (104) McCrary Louise (c) 14 (750) Curtis Wm (c) 16 (752) Cremer Forrest (c ) 18 (420) Pride Mamie (c) 20 ( 422) Jones Feature (c) 22 (1325) Thomas Carrie (c) STEVEN'S AL (South Macon)--From 15 Elbert south STEVENS (South Macon)--From Daley Ditch to Nelson, 3 west of Waterville rd 313 (315) Edge Tony i(c) 315 (312) Bryant Jos (c) gro 31 Smith Alonzo (cC) ol*quitt *i.nt,er*sects SPRING LA--From 324 Spring Cha*rles inter*sects south of Mulberry Crisp intersects 101 (354) Vacant 102 (304) Carson Jag (e) 103 (308) Haddock Henry (c) 104 (300) Wiley Clarence (c) 105 (356) Harvey Cath (c) 400 Warren Fannie (c) 401 (541) Finney David (c) 402 Greer Monroe G (c) 404 (542) Robinson Richd (c) ' 106 (300) Dumas Edw (c) STEVENS SQUARE (South Macon) -- 107 (355) Vinson Dollie (c) West from Stevens to Henderson, 1 111 (355) Harris Mattie (C) north of Colquitt 112 Gordon Rosa B (c) 124 Banks Jas (c) 113 (350) Spivey Alice (c) 114 (7) Crawford Sand (c) STEWART (East Macon)--From May- 116 (6) Stewart Jas (c) nard to Norris, 1 north of Broad 118 (5) Dugins Irvin (c) 23 Jones Augustus T Rev (c) 120 (4) Tyson Ruby (c) 27 Glover Linton (c) 122 (3) Vacant 124 (2) Lewis John (c) . 126 (1) Stephenson Vom (c) STEWART'S AL -- From 341 Madison west to Monroe bet Jefferson and Jones STANISLAUS CIRCLE--From Vinevflle 105 (227) Rouse Ella (c) and Pio Nono avs south to C of Ga K. 107 (226) Jones Leila M (c) 1R20AWalker Duncan D,, ^ 108 (222) O'Neill ECuodlloirnas p(ci) intersects 122Farmer Frampton W Bostic la intersects 202*McGrady Chas W 113 (235) Low lizzie (c) 208AGreenwald Herbert S 116 (230) Ingram Ruth (c) 2llAMaddux Julian R 120 (234) Adams Carrie (c) 212ACline R Tamp 213&Souder Redding C * 122 124 (238) (238) Vacant King Clara M (,c)v 223AMichael Morris 125 (336) Vacant 229ABussey Harlan E 231APopper Harry S 223325AAHnodgearnsonG HPaalusltead J 236*Jones Rudolph W 239hAndrews C Fort 240AWilliams W Augustus STEWART'S LA--South from 130 Appleton to Columbus 1 Vacant 2 Vacant 3 Fuller Jos (c) 4 Sanders J C (c) 248-dHarris Henry . 249*Schofield John S jr 254ABirdsey Angus B STINSONVILLE--i miles west of Court House, north of Forsyth rd STARNES AL--From 520 Hazel south to Ash STONEWALL PL (VinevUle)--From 715 Vineville av north lOShCarswell B Stewart STEELE (South Macon)--From Waterville rd west to Broadway, 2 south of Edgewood ay 114 Vacant 121 Bush Edw 124 Edwards Jasper E 125 Malone Jas C 126 Bassett Geo H 112278AMYHocauGrnraginrrgPathoenrcAyWnnEiTe hLos Mrs 132ARummel Mollie B Mrs 133 Knight Benj' 134 Hammonds John O 136 Barker Sami T STEINS AL--From 420 Hazel south to 421 Ash l1O07S-A0-DLaovyinsd JHoserbTert A 10'9-Binford J Erie lilACarr Geo M 112hTidwell A Walton 111134-CV-aLcawanretnce F Eug ,, 115hGa.lt Robt H 116'hShehee Enorka Mrs 117 Crook Wm B bMiddlbrooks Rollin P llShWilliams Mary S Mrs 119-hAdams Chas N 120 Octter Rudolph 121hMcCrum Robt W 112232/--0,M-MccKGiubibreenDTavhiods LN 124hOampbell Chas H S 0 u T H L A N D HOTEL "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection 569-571 Broadway Tel. 3047 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go, Publishers 431 Howard St. Detroit 354 4th Ave. New York 528 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. THIRD AT PINE GMC T. RUCKS PHONE 5100 iMSteomckberEsxcNh.anTge. N.ExYc.hCanogtteon ChicagTo raBdoeard of AssNoEc. ixaTcteh. aMnCgeuemrbbers Local Stocks and Bonds Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage S1T2O5 NCEuWlpAepLpLerPLCla(rVa)-Contd 112276--^Wilder (Hattie E nurse a & H11lS32JO39A-dSdZH-iLmeCoieugdittttlgtiheecerresVHREJiroodgwwbOitnailnirlaFideDjr GVoarentteAFndreredwWD jr STfrRoAmIGPHioTN(oUnonioavn,vi1lleso)--utEhaosft Danedmwpseesyt 420 (327) Talton Mary (c) 4,30 (329) Powell Love C(ce)dar intersects sw cor Umonville SelSl ec(co)nd intersects 509 (309) Pitts Eliz (c) 512 (304) Dillard Henry (c) 514 (103) Powell Henry (c) 601 P_age Jos (c) Fourth intersects 134h-Stroberg Chas W 114358*MTielrlrierollnsJaRckobt(H H 146AFulton Thos 147'i-Mitchell Jesse A 149 Vacant 153i-Crand'all Mamie Mrs @ Holliman Annie L mus tchr 154AOrr Malcom W 157158162*Middlebrooks Edgar H 603 Dumas Louise (c) 605 (604) Wilder Ruth M (c) 607 Rose Hattie (c) rear Rose Sami (c) First intersects SUMMIT HILL (StinsonviUe) -- A con203 Hilliard ClBarroaok(lcy)n av (S) 204 Vacant 210 Vacant Corp. Bonds Municipal Bonds Bank Stocks STbRerAtTwTOesNt to(SoBurtohadMwaacyo, n)3--Fsoroumth Eol-f Edgewood av 103 Pritchard Mollie Mrs 104 Vacant 110079 OMaorodreell CElyddgearKH 111 (135) Vacant 211 Vacant 215 Ragan Jas (c) 217 Hill Danl (c) 223 Moore Monroe (c) 227 Moore Hometr (c) 222298 LWaecayveWr iLllieeroyD (c(c)) 250 Goodwin Geo (c) 405 Ga. Casualty Bldg. 114 Burnett Wm R 116 Holloway Benj T 121 Dye Robt E S WMlferALRCS litsT CMU HtS)-(See Phone 1681 122 Folds Alice Mrs 124 Roberts John O 125 Sanders Isadora F 126 Vacant 128 Morgan Henry SUTLEY (Unionville) --From Pio Nono av west to Cedar, 1 north of Dempsey 103 Wilkins John (c) 131 Wilson Chas B *ti I 132 Parker Tabitha J Mrs 134 Wells Harry E 142 Flowers Edw D 200 Tm_r-ipp O~scar C Chappell intersects U restV^FrOM Pi Nono av west 384 Kuhn Fredk W *Kuhn Fredk V 390-0-Turlington Walter C ST2R42A0YESRec'oSndALeas(St otuothBMroaacdowna)--y From Inverness intersects 392hp'hillips Jos J 401 Williams Wm V 306 Jones C J (c) 402 (3'98)hBell Hallie B 309 Nash Kath (c) 607 Pasco Pearl M (c) 40S*Gaines F Clark Who 609 Nash John H (c) 658 Green Mary (c) 2434 Hutchings Lucy M (c) SYeCstAMavORwEest(Vineville)--From 205 For113 (121) Rakstraw Susie (c) Sells It? STfrRoImPL8IN15GtoALPea(EchatsrteeMacon)--South 105' Newman Glen (c) 107 (12) Ridley Mattie (c) 109 (678) Carr Dave (c) 111 (11) Sandford Wm (c) 113 Hughes Dora (c) 358 Vacant Peachtree intersects 115 Pingston Asbury (c) 117 Baull Wm (c) 119 (123) Whigham Luther (c) 122 Goode Mattie (c) 123 Davis Fannie (c) 124 Young Mary (c) 128 Lockett Martha (c) 130 Risby Embry (c) 132 (131) Bray Mattie (c) 134 Scott Lela (c) IS Answered By the SULPHUR SPRINGS RD--From Bowman east to Milledgeville rd, 2 north of Hall 143-dThomason Annie M Mrs 145 Dixon Sami L 147 Sanders Thos (c) Davis Walter E Ramsey Jackson K 136 Morris Aggie (c) 137 Pate Elisha (c) 138 Cheatham Oscar ;(e) 140 Green Nesbit (c) 141 Brown Jas (c) 143 Lowe Bigus C (c) 144 Franklin Lonnie (c) 146 (145) Burton Blanche (c) 147 (151) Tasker Benj (c) Classified Business Lists In this S1111111lUO11(N10103M2M150O9--oA--ii&Od-Mr-JWtRRoFJhIaiaryTiccelsnlkheapiensavAaborermeVndyrwssrCyJeA(hFGNsagtEreAsonevoerdtneotsSdhrMreWLeBHttwoeigMuhlTerlsavnadrds)--Ff O rom 1111111111666555544|2004468928 DHFCLISB((n11oahohar44gosvcara76rtdwikmt))easteerenmbntZBetOlJnieuIsbaTlMErtslisteaheVmsnaneWirmeeo(oyA(crcila)lem)l((tiBc(ceca)()e)nc(ct)Cdt)tCiaSnhta(rac(ibcn))l(dicnl)egr Sam S G S Directory llfr&Brown Dempsey S 117*Smith Eug W llSi-CrimmirLS Timothy E TALMAGE (Vineville) --From Cleveland av west, 1 south of Vineville av 121-0-Holland Jas W 12'6-dLittle Willie M TATNALL--From Forsyth south to Elm and southwest to limits * 529 The World's Largest Store Shop at Sears f 73 SEARS, ROEBUCK AND CO. and THIRD ST. MACON, GA. Save O s CD TATNALL--Contd 111 Lawson Annie (c) 113 Irving Sallie M (c) 114 Lewis Martha (c) 116 Conner Frank (c) 117 Dyer CrawfordTaWtna(lcl)la intersects 119-0-S-DtLyeurkeCrHawosfpord(c)W (c) phys 1200-Weaver Willis W Rev (c) 121 (119) Bradley Laura (c) 122 Ellis Lucius (c) 123 (121) Hampton Susie (c) 143 Green Celia (c)Chestnut intersects 202 Williams Rubin E 204 Stanton Clarence H 206 Phillips Alva L 208 Gibson Thos A 217 Echols Dayton D 219 O'Oain Walter L 221 Lett Wm J 222223-SdMcaarrbtionroFuglohrenJaces PA Mrs 229 Mitchell Robt P 230&Sheridan Albert E 232-OCampbell Enoch B 2340-Macey Jos MOglethorpe, Hazel, Ash and Elm intersect TELFAIR--From junction of Hawthorne and Hazel, south to limits 100 Boland Ida (c) 101 Vacant 103 Vacant 105 Carter Wm (c) 115 Alexander C W restr 111271/-Ol-Pgaltetestrrseoent JCalsara(c)(c). 123-dForeman Green J (c) 127 Jordan Rachel (c) 131 Lightfoot Robt (c) 163 Bailey Chas H (c) 165 Carter Lillie M (c) 167 Daniels Walter (c) 169 Reddick Isaiah (c) Ash intersects 201 Glowers Bessie (c) 203 Mims Mary (c) 221157^G-MlocwCelresndBonesBsieerry(c)B Rev (c) 2180-Evans Isom (c) 220hMurray Albert (c) 221-dStevens Wilson (c) 226 White Oihgerreter (c) 222279 FLloecmkienttg DMoacktthe(cw) L (c) 230 Cater Albert (c) 232 Chambliss John (c) 233 Allen Robt (c) 234 English Wm O 8L p_r gg^? I sr* pa. 3 55" o z r s o s i r ep--a * 73 3 TATNALL LA NORTH--From 116 Tat- nall to Adams, bet Chestnut and C of Ga Ry 111 Jackson Chas (c) 113 Evans Wm (c) , , 119 Brown's Chapel Baptist Church (c) 120 Long Laura (c) 122 Curry Carrie (c) 124 Crawford Phoebe (c) 126 Guyton Fred (c) 204 (1) Fields Mack (c) 206 (2) Humphries Josie (c) 208 (4) Howard Allan (c) 210 (650) Griswold Eva (c) 212 (3) Mims Chas (c) 214 (128) Johnson Isaac (c) 215 (264) Miflin Lucius (c) 216 (129) Clyde Alma (c) 217 (252) Vacant TATNALL SQUARE--West of College bet Olgethorpe and Ash 235 Griffin David (c) 236 McElhaney Robt 238 English Hannah ((cc)) Elm intersects 302 Vinson Lilia (c) gro 304 312 Vinson Grimes Lilia (c) Alberta (c) 313 Davis Ida (c) 314 Middlebrooks Laura (c) 315 Roberts Zack (c) 317 Roberts Zack (c) soft drinks 392 Wood India (c) 394 Threatt Bessie (c) 396 Lewis LorenzEodge(wc)ood av intersects 398 Vacant , 420 Barnes Smith (c) 422 Lindsay Lucinda (c) 425 Ingram B S Sch (c) 429 Smith Bessie (c) 431 Collins Wm (c) 436 Starkes Chas (c) 442 Clayton Hal (c) BrigM ends t w oi DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY TAYLOR (East Macon)--East from Fort Hill beyond Norris VSi mbiltkh intersects Prince ends 502 Edwards John W gro Copies of the Directories of Practically Maynard intersects 138 Blunt Annie B B(ca) llard intersects 505 Lansing Maude Mrs 506 Walker Maude Mrs 507 Vacant 510 Vacant Every City in the UNITED 318 (418) Morgan Grant (c) 323 Vacant 325 Brooks John (c) 340 401 403 Fredericks Abr (c) Skinner McCall Ephriam Wm (c) NJ[ or(rci)s intersects 890 Davis Edw (c) 901 Henry Barney (c) TAYLOR (Unionville) --From 1st av east to 5th av, 1 south of Harris 512 Busbee Geo S 513 Burris Emma L Mrs 555233285hHGHoreawryrainrMdg aHJnosahfrivneeldyL F 538 McDaniel J Robt Pebble ends 545 Atwell Mary F Mrs gxo 549 Atwell Geo D 551 Riley Jas (c) 553 Williams Jas (c) 557 Vacant 559 Waits Ruth Mrs Henr.ietta begins STATES and Canada These are for your convenience If you want in* formation you are unable to procure elsewhere call on us R. L. POLK TAYLOR AV (East Macon)--From 30 Hydrola south to Clinton 27 (28) Wade John W 29 Adams Bartow J 31 (30) Jones Wm B 33 (31) Finney Harry 34 (35) Lyles Robt L 3365 M(3o2)slePyooAl rSthhirley 38 Laddener M Lonnie 40 (37) Clark Mackey L 42 (38) Lavender Lon W 44 (39) Smith Milo W 603 Smith Hattie (c) 605 Roquemore Wm (c) 607 Canada Lula (c) 614 Boutwell Clarence E 616 Hester Naomie (c) 661383*LJoovneesGAeaugu(cs)ta Mrs TENNEY AV (South Macon)--From Jeff Davis av west, 2 south of Plant 116Dunn John H 118 Elliott Augustus M 119hEdwards Corliss H & CO. DETROIT 530 2 as U, m W C 02 to qI O WZ r2\ ^ E--( < 2u-szi O 2 tc3ou3 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. TENNEY AV (SM)^Contd 122 Baxley David W 123AJones Claude E 125-d'Clark Lester C 128*Woodell Melyear L 131 Happoldt Chas E 134 Campbell Wm H 138 Wihatley O Floyd 1143190W-Laamltoonn SHaernarhy Cj Mrs 143 Wiggins W Carl 148*HoIling worth P Ernest 150 McGinnis Leonidas TEtoNTlHim--itFs rom Central City Park west cor Oak Bibb Clay Products Co Burton Coy (c) TENTH AV (Bellevue)--North from In1, "10usStrhmellleHyomMeonrdro, e1 w(ce)st of 9th av Tel. 337 331140> 4PMouacloosn GEeleoc rCesotrcontrs 316 Vacant 317-190Jordan L N household appli- ances 331208 JGaorlrdemttanPaPinatwn& SGholapss Co 321 Vacant 350-56shtBoruerd, en ,,Smith & WCoallIninctedrespect ts 353 Soiomon Maitland R office 3,i5,o3%f;GMiltotenli?cbaei'gCeoruM rt usic Shop 3o5r8ohAM?c?M^Uf,imananEs CIcPe aCinrtea&mGSlahsospCo 36(>-64*StjmdarWd oSmtoerne'ss Apparel Inc dept store Standard gds Wholesale Co whol ctrJv 361bMacon Shoe Co TEbRetM5INthALanAdV--6thwest from 214 Walnut 3 Vacant savir s,ore OFenner & Beane brokers Hotel Dempsey Dining Room SOOuzts-Mitohell & Whaley Inc mdse Hotel Dempsey Cigar Stand AKbenrotk&ersHerin food products 70Sawyer Beer Co 90Ruan Sz Co brokers 11 Burke L C whse Hotel Dempsey Barber Shop Civitan Club Kiwanis Club Lions Club HuteiDDeemmppsseeyy TTaavperRnoormestwr ines TDvi$tAcht? south to NMealscoonn,)--1 wFerostmof WDaaleteyr'-s vine rd }00 (101) Dennis Hath (c) 104 (204) Moss Aaron (e) 220040 JZoahcnhseoryn ALluotnhzeor C((coc)l)quitt intersects 302 Oliver Berta (c) Charles intersects 403 GOO) Johnson MaggCierisp(c)intersects 408 Simmons John (c) TEXAS AV--(See DeSota pi) 366-370OCitizens & So uChNeartrlyBinatnekrsTechtes sw cor Newberry J j Co dept store (side entrance) 440042AGBloubmes DBroeosts SShhoopppe Inc 406'C'Day's clo fpSgGrant W T Co dept store 4, MacykrPkurCchleaasninergs Ccolo lcolannrss 413 Vacant lf4iJ1i^6f-?fClL?-Kolemalyabanexoe-rTHTSsathrororiehs cPTlahoientwComo en's clo 4180Amold's Shoe Parlor THARPE -- From Industrial Home rd 419AWilliams Music Co south to Robinson rd, 2 west of American blvd Bacon Wingfield (c) f442o 211%-CSVmaitchanJtasf Ga A rIensctrwomen's furngs Cason Levada (c) Alley intersects Franklin Eddie (c) Lattimore Matilda (c) ffO-S^Green H L Co Inc dept store 4510B-elle Millinery Co Tharpe Pearl >(c) Barfiedds Dress Shop THIRD--From river south to limits, 1 1e01asBt oonfneSrecJoonsd B 104 Coney Omer J 109 Jones Julia M Mrs 110 Sealy Eula Mrs 1111950HAantdtarewwasy MVairrgsihlall P 120AKelley Dan B laiOGarrison Roseoe C 123 Doles Thos J 153 Davis W Frazier ge^McCommon Bros dept store 4455870h-WGaiUy mCglhoamCoSash & Door Co ^Coley Paint ,& Hdw Co 462-TM 70h?pv0annnFenebderg&CSoeeTdheStdoerpet store Dannenberg's Cafeteria 465 Vacant 447619hVGaecoarngtia Seed Store bsmt Stripling Robt G barber 471%-OMurray Printing Co 157 Abel Carrie M Mrs Moreland Paul K 161-0-Lawrence Julia Hodge Wm B 221J01&N,,Duict.tk..inIgdaSaMrahMCrsWMraslnauuttointIenrds-erycts 221165-V19a*cTanylter Bros Garage 218 Nye Odorless Incinerator Co 304% V,,acan,t Mulberry intersects 306OWright Harry seeds 306% Davis Jos fruits Michl R jr dry gds 310Ajones S Co- gros 508 Bankston John ',ePorepsltarr intersects 508% Bankston John E 510 Watson S M Mfg Co harness mfrs 512 Vacant 512% Lee Building 514 Vacant 517-19-OKarsten & Denson Co Inc poul- try supplies 5117% Vacant 51 Vacant 521-230-Brant Motors sftreo?iOf",S?G?!''od?oA?d?i3ayerersacrrRoSroneebrbv*euiccWek mS&toCCreosjrdteilrpievtsessttoocrke 596--9&H'atc2ier A IS Co auto accessories 311 Brass Rail beer 333111332%ABDrVaassawhceearlnltEWleicllisCBo arrabdeirosShop (c) eooochand,,ler S,,ervice SPtaltuimoninfitlelrinsegcts sta 601OW(osrekwsinPgrorgoroemss) Administration 531 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 THIRD--Contd 603 Read John G confr 66017017VLac&anNt Drug Co 661112&VSamcaaUntAnimal Clinic vet hosp 666111346-7-02G-2Sa*paDrRkusandlaMipaotoCtorhreCvCorooleat uCtoosautos 619*Motor Parts Oorp 6217-Bailey Auto Parts 6237Crescent Restr 6655007%-p7eMppoerrriDs-rFBlinonttlCinog cChoemofisMtsacon 651 -537Bearings Supply Co auto parts 652-907Huckabee Auto Co 652%7-Central Cotton Oil Co 655-577Adams D H Motor Co autos 6656995V-Macanannt Jack Biattery Co 689 Jones Wm H used cars 6917Power Oil Co (br) filling sta Pine intersects 701-077Yates Motor Co autos 7027Standard Parts Co auto parts 706*Carburetor & Electric Service Inc 708-127-Cone W L Auto Co used cars 711-157Roberts Prank autos 714 Johnson Ella Mrs 716 Smith Ruth Mrs 7177-Faekard Macon Co 718 Byrd Ida Mrs 7756307F-MreceCmoarmnicFkaDnneieerin(gc)Store (International Harvester Co) agrl implts 765 Dyer Benj H gro 767 Anslev Robt E Ellis Lela Mrs furnOraekprm. te rsecta 802ABrown Weldon W gro 808 Humphrey Janie 812 McElwee Pearl Mrs 816 Smith Hazel 817 Thoimas Adam (c) 818AHillard Susie M Mrs Hillard S M Dray Line 819 Williams Wm (c) 8825117Jo0hetntseornElEedcwtric(cC) o 857 Jones Mattie B (c) 859 Dean Annie (c) 865 Croft John 868 Economy Market (side entrance) 871 Brown J Robt Arch intersects cor CiOtyffiWceeighing and Inspection 900 Wo(wrktasseP) rogress Administration 990013AEOddwoanrdWs mWmWOPfgillaelitunhtgoorpsreteapinrtersects 1005 Jackson Wm W (c) 1021 Kelly Arth (c) 1025 Jackson Hattie (c) 1031 Patterson Edw (c) 1039 Manson DeWiHttaw(cth) orne intersects se cor Turner Tabernacle ABaMy iEntOerhse(cct)s 1200 Willis Mary (c) 1204 Shelly Nellie (c) 1206 Edgefield J6hn (c) 1208 Watson Walter (c) 1214 Atwood Rebecca (c) rear Cargle Mary L (c) 1215 Malone Pearl (c) 1216 Wilford Oscar (c) 1217 Jones Elsie (c) 1218 Jones Eloise (c) rear Bryant Carrie (c) 1219 Kimble Janie (s) 1220 Vacant 1222 Brown Wm Oc) 1225 Bailey Viola (c) 1227 Thomas Zachariah (c) 1229 Baker Mamie (c) 1231 Sawyer Cora B (c) 1232 Vacant 1233 Thomas Archie L H(ca)zel intersects 1301 Dinkins Henry E gro 1304 Carroll Alma M 1305 Lawrence Jas B 1306 Willis Addie Mrs 1308 O'Connor Dollie L Mrs 1310 Hill Alf 1314 Cherry Andrew J 1318 Jones Mary E Mrs 1325 Brown Lonnie 1327 Tidwell J Lester 1328 Stripling John D 1329 Drawhorn Ira J Logue Amanda A Mrs 1330 Avery Felix P 11333312-7V-Tarcuaensdtell Pearl M drsmkr 13337-Gilbert Jas F 13357-Sitton Emmett L Ash intersects 14057Booker Otis H 1411 Turner T Clyde 1414 Turner Hope- S 1419- Warren Reuben 1420 Robinson Walter H 1421 Maye Robt E 1424 Rowell Jas W 1425-0-Carter Prank W 11442279 HSnaorwdy BRauilfiues LE Mrs 1430dPearson Simeon B 1431 Robinson Homer L 1432 Crosby Jas W Elm intersects 15027-Cook Edgar B 15067-Cunningham Celeste 15077Burke A Read 1510 Hall Auigustus M 15147Burke Wm M 1517 Jones Addison D 1519 Barineau Wm L 1520 Wade Jas L 1525 Spiller- Wm H Joiner Ella S Mrs 1528 Huckabee Edgar L 1629 Sanders J Homer 1531 Skipper Jack C 1532 Dewberry, Sallie A Mrs 1533 Hilley Wm 1536 Carson Steph T 1537 Lyons Wm A 115543197SRmicihthardJsasLoBnnie C 15427Cihance Jas E i Edgewood av intersects 1633 Amerson Curtis D 1634 Jordan Sidney J 1686 Harrington Wm T 1667 Shirah Albert V 1670 IHamlin Lovett C 1673 Shipman Oliver S 1674 Harris Wm H Hardy Geo W Gordon intersects 17017Goldwire Hal M 1702 Brooks John L 1706 Smith H Wilburn 17097Muecke Rhinehart E 1710 Jones Robt L 1716 Shine J Wm stove repr 1717 Ryle Chas E 1723 LPeaanrgcfeordCaSrraireahL EMrMs rs 1726 Simmons Jas T 1728-OMize Cl-arence VSiolet av intersects 1777 Whitaker Dollie B Mrs Knight W Clyde 1778 McDaniel Wm 1780 (Simpson Paul C 1782 Jordan Eulia W 1783 Vacant Wood i.nt,ersects 532 AUTHORIZED DEALER PRINTING BINDING R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 RUBBER STAMPS THE BEST WORK CORRECT PRICES BURKE'S 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York THIRD--Contd 1800 Vacant 1801 Hardison Wm 18071 DWuirlldieamn sMTalriothsaJN Mrs 1811 Thulus Marvin T 1812 Davidson Isaac L 1814 Anderson Jas T 1817 Bowers Alice Mrs 1823 Davidson Geo D Giles intersects 1903ASmith Clifford S 11990172 HPeeasrtseornLRoraelnphGE 1913 Vacant 1917 Culpepper Chas D 19:18 Etverson Arth D 1921-OMcDonnell Teresa Mrs 1922 Buckner L Hugh 1974 Elkins G Leon 1975 BJorhonysoZnedGriecok PA 1977 Gore Emmett W 1980 Dingier Geo H 1985 Thornton Robt L 1986 Langley Oscar A 1992 (1987) Wilcoxon John R 1993 Lisenby Jasper M 1998 Isaf Annie Mrs Jenkins intersects 2001 Capps Ethel A Mrs 2007 Caldwell R Prank 2008 Grier Lobie D Mrs 2010 Cromer Martin D 2011-bSteerman Albert D 2017 Jones Chas W 2022 Cromer David 2023 Haynes Henry N 2025 Johnson J Howard 2027 Buckner Earl L 2028 Vacant 2032 Morris Arth M 2080 Garrett Edw M 2084 Johnston Mary L Mrs Moye Cynthia Mrs 2085 Allen Carlos 2090 Vacant 2091 Worsham Wm S 2095 Haynes Addie M Mrs 2097-OGoodin Ida Mrs gro 2098 Thomas John W gro THIRD (SH)--Changed to Stevens THIRD (Unionville)--From 1103 Demp- sey av to Anthony rd 101 (100) Bailey Geo (c) 102 (130) Hill Dennis (c) 103 Fleming Otis (c) 105 IHill Jos (c) 107 (204) Glenn Iona (c) Straight intersects 200 Lightfoot Minnie (c) 201 (200) Wyche Wm A (c) 203 Howard Benj (c) 204 Vacant 205 Hobbs Robt (c) 208 Maynard Angeline (c) 209 (210) Brown Jas (c) THIRD AV (Bellevue)--From Industrial Home rd north, 2 west of American blvd 101 Fraley Malachi (c) 103 Bellevue Baptist Ch (c) Burkner intersects 201 (1) Bowman Nathan D (c) 201 (2) Billings Lillie (c) 203 (1) Lyons Jas (c) 203 (2) Thomas Louise (c) 205 (1) Moseley Jas (c) 205 (2) Reed John (c) 207 (1) Harch Mary (c) 207 (2) McClain John H (c) 217 (524) Jones Eliza (c) THIRD AV (Crumps Park)--See Hartley av (Crumps Park) THIRD AV (North Highlands) -- Changed to Birch THIRD AV (South Macon) -- From DofemPplsaenyt aavndsouSth,Co1llwegeest of junction 101 (370) Weiss Frank E 102 Wilson Gussie R Mrs 105 (372) Hilley Dean A 110087-WOHaurdnniJcouthtnJas C 203APerry Pearl Mrs First intersects 207AOgbum Robt E 221121MMoordgeanna RPoestserE 215 Morgan Cairlos R 1HIRD AV (Unionville)--South from 950 Montpelier av to Dempsey av 101 Thomas Rufus (c) 102 Turner Wm (c) 103 (115) Barnes Jas (c) 104 Young Clarence (c) 106 Baker Edw (c) 108 James Tlios (c) 109 (116) Denton Wm (c) 110 (109) Brown Chas B (c) _111 Benn John B (c) Hoge intersects 113 Curry Andrew (c) 117 Hart Richd (c)' 119 Cummings Thos (c) 121 Causey Wm (c) 123 Hawthorne Mollie (c) 2,,A011 S_eal,s Jas (,c),, ,, Plateau intersects 202 (203) Ross Chas W (c) 203 (204) IHogan Timothy (c) 207 Davis Giles (c) 300 (207) F__razi.er MaryHa(rcr)is intersects 301 (312) King Rillar' (c) 303 (314) Neal Robt (c) 304 Whiting Jerry (c) 309 Boyd Kizzie (c) 359 Miller Sandy (c) Taylor intersects 363 (372) Houseworth David (c) @ 365' (342) Matthews Edw (c) 367 (344) Ricks Emmett (c) 3366981 Brown Perdue Edith (c) Alonzo (c) 370 Gross Sherman (c) Neel intersects 372 Lamar Robt (c) THIRD AV (Vineville)--From 342 Mid- dle to intersection of Culver and High- land 206 Mills Jos (c) 2200971&BSaprinveeys Harry Genie A (c) (c) 2100-Havis Laura (c) . 215 Mills Gordon (c) 217 New Hope Baptist Ch (c) 220 Thomas Pearl (c) 231 Wilson Norwood (c) 232 Jackson Florine (c) 237 Duval Paul jr (c) 239 (236) Grayor Jessie (c) 242 Ray Julia (c) 243 Ashley Webb (c) 246 Lewis Perry (c) 247 Cornelius Walter (c) 256 Wiggins John (c) 226527&HLoowgaanrdMSayrltvhiaa A(c) (c) 263 McCarthy Clarence J (c) 267 Mabry Wm (c) 268 Lockett Mary (c) 269 Bonner Eveiena (c) 272 Hampton Henry (c) 273 Carswell Lindsey (c) 275 Pitts David O (c) Gunn la intersects 308 Carswell Raymond (c) 314 Harden Lucy (c) 316 Oliphant Mamie (c) 533 The World's Largest Store Shop at Sears SEARS, ROEBUCK AND CO. and THIRD ST. MACON, GA. Save THIRD AV (V)--Contd 319 Holloway Clark L (c) 319 % Breedlove Mattie (c) 320 Robinson Belle (c) 321 Bailey John D (c) 332231%CuSlolelorsmoDnalLlaese ((cc)) 324 Lawrence Matilda (c) 325-0-Taylor Rufus L Rev (c) 326 Martin Chas (c) 330 Carey Julia (c) 332 White Monroe (c) 333 Parson Mattie (c) 336-0-George Dazzel C (c) 337 Duval Paul (c) 341 Dennis Alex (c) Ntorth i.nt.ersect. s 411 (410)ABarrow Andrew W (c) 413 (420) Gross Emma (c) 414 (415)&McMath Jas M Rev (c) 441155a(A46M4i)tcPheitltlsMGaeroion(cH) gro 416 (417)AFennell Estelle (c) 718 Johnson Rachel (c) 719 Clemons Lillie (c) ^ 721 Solomon Z Cicero (c) 774320 ((774320))ASWteaplhkeernsBDuratvoind ((cc)) 805AAmmons Jas A (c) 806 Gibbs Erasmus E (c) 807AGriffin Jas (c) 810 Vacant , _ 820 Bailey Robt C (c) 821 Johnson Herschel W (c) 826 Crawford Sol W (c) 829 Vacant , _ 830 (826) Brown Thos (c) 883313AGMidadbirnysIdJaas ((cc)) 852 (854)Alngram Chas D (c) 853 Lyons Eug L (c) 854 (852)&Staneel Jas (c) 855 ( 856) Barrow Jessie (c) 857 (858) Worthy Annie (c) 859 Gordon Sami Dgroouglas av i*nte*rse*cts 417 (450)Davis Lester (c) 419 (468) Garfield Wm (c) Culver i*nte*rse*cts 420 (419) ^Fields Leonard (c) Clayton intersects 421 (472) Mack Mamie (c) 422 (421) Cleveland Ada (c) THIRD ST LANE -- From 1231 Third 423 (474) McCord Polly (c) west to Plant al 424 (423) Gilbert Mariah (c) 1 Robison Edgar (c) 425 (424) Pleasant Hill Cash Market 2 Jones Victoria (c) meats 3 Jackson Cleo (c) 426 (425) Vacant Moughon i.nt.ersect,s 4 Rhodes Josephine (c) 5 Scott Arth (c) 509ARivers Henrv (c) uphol 0 Mitchell Hattie M (c) 511 (510) Danielv Arth J (c) 7 Shinholster Matilda (c) 512AMason Geo W (c) 8 Gray Robt (c) 512a Mason Geo (c) confr 518 Wright Edw (c) 521 Williams John (c) 524 Bostick Victoria (c) 525 Blount Martha (c) 526*Garv Sami D (c) 529 (528)&Little Annie (c) 531 (530) Williams Jesse (c) 535 Brunson Zack A (c) THOMAS--From Log Cabin blvd south, 1 west of Edna pi 100 (104) Boland Andrew D 110058 CDaenrrniockn EVdewrna Mrs 119 Vacant 121 Donaldson Revester V 123 Nichols John W 538 (539) Wise Annie (c) THOMAS (East Macon) -- From 217 540 Williams Lucy (c) Garden north to Broad 541 Smith Bertha (c) 99 Axam Wm (c) 542 Pitts Daisy (c) 100 (101) Snell Judge G (c) 544AParis L V gro ^ intersects 600'"-Hendrick's Grocery 101 (421) Morris Alonzo (c) 102 Sinclair Birdell (c) 103 GOO) Binns Lloyd (c) 602 Clemont Apartments (c) Apartments: 104 (120) Walker Emma (c) 105 (104) Crowder Elnora (c) 1 Starling Mattie (c) 106 Williams Eva (c) . , _ ^ White Minnie M (c) hair drsr 108 (158) Cooper Andrew jr (c) 2 White Lucius (c) 109 Harden Wm (c) 3 Harvey Allen (c) 110 Tomley Willie (c) 4 Cook Ruby (c) 112 (209) Thomas Eug (c) Street continued 603 Welch Lois (c) 114 Cannady Fred (c) 116 (112) Wimberley Henry (c) 606 Bango Mamie (c) 609 Johnson Wm J (c) 610 Lay Vera (c) 611 Dunn Geo H Rev (c) 612 Vacant , 617 Mathis Wiley S.(c) 620 Patterson Aurelia (c) 622 Patterson Jesse (c) gro 623 Mann Adam (c) 625 Winn Ella (c) Forest av i.ntersects 118 Stroud Jesse R (c) 222 Whitby Nathamel (c) THHOoMusAtoSn a(vMeikaasdt oto PMI)ika--do Favro, m2 so3u94th8 of Chatham 3 Kah Geo T 1ll0O0AHEanrgrliisshRBichWd aPllace 200ARichards Wilmer E THOMASON (Payne Mills)--(Changed 700 (702) McBride Elnor (c) 701 Zellner smith (c) 702 (700)ASheftall Jackson (c) 704 Howard Jas (c) 705 Hunt Thos J (c) 707 Bailev Boysie (c) 709 Harris Henry (c) 710 Pitts Eug A (c) 711 (708) Davis Geo (c) 711% (713) Jones Ophelia (c) 712 Hood Prank (c) 713 (711%) Abram Monroe (c) 714 Felton Robt L (c) 715 McKinney Robt (c) 716 Felton John (c) 717 Harden Step (c) to Gardner) THOMPSON'S AL -- From 809 Elbert north to Chappell 200 (413) Akeridge Wm (c) 201 (410) Griswold Robt (c) 202 (411) Vacant 203 (408) Ringwood Sallie (c) 205 (406) Russell Mattie (c) 206 (244) Harris Walter (c) 207 (228) Allen Richd (c) 208 (240) Vacant , . 209 (248) Stevenson Frances (c) 211 (434) Mitchell Ella (c) drsmkr 212 (239) Odom Jas (c) 214 (236) Hicks Chas (c) S3 E? r DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 534 o ccnc o o o C=^O Hd01 U, U3 oz i CDuC3oDOQsi Z5Q5 2 HoO- i3u^ ^ 2 O o VaS } . < yj as o o b / A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 TINDALL AV (South Macon) -- From Edgewood av south, 1 west of Campbell 101 Height Jesse (c) 102 Finney Jos (c) 103 Lamar Annie P (c) 104 Benford Carrie (c) 105 Williams Cleveland (c) 106 Durham Wm (c) 107 Booker Mamie (c) 108 Hardeman Columbus (c) 109 Carter Arth (c) 110 Chapman Annie B (c) 111 Bass Eva (c) 112 (116) Vacant 115 Jackson Lillie (c) 116 (188) Marshall Uriah (c) 117&Mallard Richd (c) 118 Baker Rosa (c) 120 Sanders Edw (c) 122 Smith Priscilla (c) 124 Jones Frances (c) 194 Wynn Jas (c) ' 196 Riley Fred (c) 198 Johnson Nathaniel (c) , Prince intersects 202 Calhoun Lyman (c) 206 Stephens Burrell (c) 210AMcCrary Mary (c) 214 Hart Dock L (c) 224 Harrington Ernest (c) 226 (133) Simmons Jos (c) 239 Harvey Luther (c) 241 Hudson Wm (c) 243 Barrett Jos (c) 245 King Alex (c) 271 Carswell ShermEalniza(bce)th intersects 301 (302) Durham Thos (c) 303 (300) Dixon Jerome (c) 305 ( 308) Hill Mary L (c) 307 (304) White Lucius (c) 309 (306) Davis Eug (c) 310 (346) Lamar Annie (c) 312 (344) Hazzard Wm 314 (342) Waters Moses (c) 316 (340) Chappell Amos (c) 326 Irvin Wm (c) 329*Williams Lula (c) Henrietta ends 400 Bledsoe Ervin R (c) 402 Vacant 436 Perrv Addie (c) 437 Kilgore Walter K (c) 438 Hill Walter (c) 440 Codv Edw (c) 441 (466) Learv Oscar (c) 443 Bell Alf (c) 444APatrick Sami (c) 445 Gragg Chas H (c) 446 Trinity C M E Church (Cc)urd ends 541 (441) Stafford Olivia (c) 545 (445) Smith John (c) 547 (41) Mohone Grant (c) 549 (439) Rawlins Sarah '(c) TINDALL FIELD (SouthMacon)--South of Elm bet Calhoun and Adams TINSLEY LA--From College west bet Washington av and Forsyth 101 Banks Mamie (c) 102 (554) Carter Frank (c) 103 King Della (c) 106 (540) Battle Minnie L (c) 109 Vacant Arlington pi intersects Forsyth la intersects 109 (541) Humphries Adolphus (c) 111 (543) Andrews Julia (c) 112 (550) Little Oscar (c) 114 Lockett Wm (c) Sparks al intersects 117 (114) MiddlebrookMs oAnlroonezoint(ecr)sects 118 Chambliss Frank (c) 119 (11) Bonner Eliz (c) 120 Eatonton Indiana (c) 121 (10) Scott Fannie (c) 123 (9) Vacant 124 (21) Taylor Emanuel 125 (18) Vacant (c) 126 (22) Sasner Mary (c) Bear's al intersects 128 (4) Vacant Kahn al intersects 130 (6) Oates Arth (c) 133 (405) Seay Robt (c) restr 134 (400) Leay Robt (c) 136 (404) Jackson Emma (c) 138 (434) Downs John (c) TOOMBS (Mikado Place) --East from 4012 Houston av, 3 south of Davis 100 Smith Jas S contr TOOMBS (South Macon)--From Daley's Ditch south to Nelson, 2 west of Waterville rd 98 (201) Proctor Jas (c) 99 Bowman Patsy (c) 100 (12) Flounders Julius (c) 101 (203) Little Frank (c) 104 (6) Smith Wm (c) 106 (4) Dolman Danl (c) 108 (2) Dolman Frank (c) Colquitt intersects 200 Vacant 201 Roberts Jas (c) gro 202 Dorsey John (c) 203 Ross Hilliard (c) 204 Jordan Thos (c) 205 Williams Peter (c) Charles intersects Crisp intersects 406 (136) Roberson Wm (c) 408 Williams Chas C (c) TRACY'S LA From 622 Hawthorne south 102 (1) Benjamin Emma (c) 104 (3) Hicks Harvey (c) 104% (5) Willis Amos (c) 109 (48) Williams Ardecia (c) 110 (10) Thomas Wm (c) 112 (1233) Sutton Sally (c) 113 (122) Mapp Wm (c) 114 (1235) Reid Bertha (c) 116 (1229) Jones Frances (c) Hazel intersects 208 (960) Melt Robt (c) TRAMWELL AV (Lynmore Est)--South from Gantt City rd to Carman pi, 3 e of Worsham AWilson Henry M TROUP--From Houston av east to Mikado av, 1 south of Fulton 100 Wynn Nora 101*Gordon Jas A 102AStarke John T 103 Gordon John J TUPELO--From limits west to C of Ga Ry, 1 north of Bay 100 (148) Wall Geo (c) TURPIN (Tybee)--From limits west to Division, 1 south of Bay Sou Ry crosses Turpin la intersects 100 102 (148) (150) Pitts Geo Manghum (c) Geo (c) 106 (228) Roundtree Geo (c) 107 (220) Summerfield Amerson (c) 108 (227) Allen Judge (c) 109 (210) Brisbv Annie (c) 110 (231) Lewis Preston (c) 111 (215) Hall Thos (c) 112 113 Sapp (214) Jos gro Vacant 115 (216) Vacant Harris intersects 201 (225) Glover Albert (c) 203 (224) Wilcher Zadie (c) 1 535 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner .rj-lVii?eank Nl ln00rp0'ated BANKING IN ALL ITS BRANCHES Snow's 565 WE MULBERRY ST. WRITE INSURAMNACCONE, OGAF. ALL KINDS PHONE 1536 Laundry TURPIN (Tybee) --Contd 205 (226) Mitchell Chas (c) 207 (222) Hill John (c) 210 221112 DS(3iam4v8im)s oVJnaascnaiDenatv(i.cd) (c) 213 (350) Thomas Matthew (c) 215 (327) McClain Ira (c) 217 (325) Davis Chas B(ocn) aire intersects 302 (321) Smith Clark (c) 304 (66) Vacant 308 Vacant 310 Vacant 311 Nixon Altoe (c) 312 Peterson Wm (c) 448 Ball John W 445505-M57oAoCrehaJpepflfeesrsSoenrvMice Station filling sta VINE E--Changed to Huguenin av VINEVILLE AV (Vineville) -- From junction of Hardeman av and Forsyth west, 1 north of C of Ga Ry 99 Vineville Court Apartments Apartments: A1 Henderson Ruth J Mrs A2 May Ralph E A3AStern Morris L lawyer A4ARawls H Grady B1 Roberts Jos L B2 Gemer John H and Dry Gleaning Go. TURPIN DA (Tybee)--South from 106 (95) Bay to Turpin, 2 east of Division 100 (186) Mallory Marie (c) 102 Stanley Chas (c) 104 Hunter Addie (c) 106 Logan Sara (c) 108 Mitchell Jas (c) 109 Vacant . ,, 110 (18) Bussev Dennis (c) 111 (190) Redmond Ray (c) 112 (17) Williams Brick (c) 114 (16) Harris Jos (c) 116 (15) Vickers John (c) 118 Streeter Jos (c) 120 (13) Sherman Emmett (c) B3 Williams Jas B B4 Hicks Epsie Cl&Chenev Willoughby H C2 Yancey Sidney T CC34AVDaocuagnhttie Claude H DIALipson David D2AWilliams Talmage T D3 Vacant D4 Vacant ElAPoe Wm R E2*Windt John S E3*Wilcox Gerald E EF14&AFJoehanrssoEndgLarHLilton F2ASmith Richd N Licensed "Sanitone" Gleaner Phone TYRONE BLVD (Ingleside)--From ForI1s5y't-hDarvdisnEodrwth Rto WVoiostdalacni.dr i.anvt,ersect,s 120 Riordan Russell M F3*Wilke Theo E F4ANorman Thos W Street continued llOOOlAASScchhooffiieelldd JFolohynd SO 102AStandard Oil Co filling sta 6000 UNION (Unionville) --See Rock av 103*Domlngos Angus B UNION AV (East Macon) -- From 602 Main north to Church 3 Jones Lamar UNIONVILLE -- A residential suburb southwest of city 104ABirdsey Emily Mrs 110056*JSohhenlsl toPnetrEodlewumP Corp filling sta 147hHoltzclaw Garnett W,,ard, ,beg.ins 205-Taylor Robt J UNIVERSITY PL--See College dr 208hDavis J LaFayette 214AWilIingham Broadus E VAHLoLmEeYrd(Bseolluetvhue) -- From Industrial 219hCarmiehael Ruth A Mrs 245 Vineville Methodist Church (South) L: VILLA AV (Bellevue)--From Grand av west, 1 south of American blvd 247 Johnson Silas RFeovrest av i.*nt,ei*-se*cts 100 Thompson Leila Mrs 304ARainey Enoch J VIHLLouAstoCnREavSTea(sLtymtooreFlaPmI)ing--o Fdrr,om1 1s0o2uAtThriobbfleHCeahrads J 104ABrice Walter O 106&Wanslev Wm FSan Juan i.nt,ersect.s Beverly pi intersects 300hBirdsey Buford S 302AWillingham Broadus E jr 304ABirdsey John S 312 Vacant 315AGates Paul G 317hRaines Frank G contr 318Jacobs Edwin G 319ANeal Roy I O 2. VV22213232332I'3241220200It0H0L21n1104110o!N100l17917393193o6ALo73-E0A'Hr(AOCMMFlAhWKS(((r2ttV32i2CulhS40c2Dea12(eah00aDnia1h0Nnm76Enurr0yvi7rm)at))drttnsr)cSbah)oiidpioA^btis*nnptoTDLeEennmCttyDSgirenrAgeoveDoaRhoaoaJttrraJ--dEunwLaoucsoaJaanegmhltndHenaschslshFy'oheCerihnEsnptes,rnrJseehoorMiDDE)eonlW4nmaC'BrCJmanbHsSuoMa--nlesrLamsmieoplrLTfHrnnLgtshueehoFBNroayttyO JnorhuwtPauossvtaLmLtoo,onGfnnN1iH.innaaete.ptveaeairrerssdsrteeeaccasot,tsvtls 33334444444444443230011412132233D1563902024556549AAAAAA-AAAAeATGS0VJDFYVVCDLnLSTJM-LeuGtaTuiartuniariioionanrnettnmoaeanlatomatwrneenelegyawelnzeslereesdvesoilrevteviatdorfnssoitertisoilrMtJTnFglTrllLWCJrlAleSMsEerdheFhaoaJHFJaenoz'mosorvoanHrauBRnAeHsyasivhsnPtckcreTraovtainnemerLEkriiEcErpbeeeyrisDreeblKttasyGPiMbEenMsSSSiMGMrytnCrttDrtsdarelrsLCsiFetsrsiarihboag_myunnaCrarpcurtfihCeillvni.ilh*ennurtsteert*crbarssheeeg*cci.ttnsss D E 444- OPilcher J Alton 446 Meeks John W Rogers av begins 536 AUTHORIZED DEALER PRINTING BINDING R. A. McCORD MOTOR CO. SALES AND SERVICE CARS, TRUCKS AND PARTS 215-221 2d St. Tel. 11 VINEVILLE AV (V)--Contd 1309*Blum Leo J RUBBER STAMPS 550097-V0-aHcuamnpt hreys & Lamb Service Sta 551151*KHiundnseotnt KJoahtine RMrs AChurchwell Daisy L Ledsinger Hattie L 1310 Whitaker Felton A 1311ARyle Sami G . 1313-0-Milbum Bennie T Mrs 1315AThorp Geo H 1317 Robinson Cleon A/*1320'0-Pate Jesse H 523-0-Orr Sami L THE BEST WORK CORRECT PRICES 406 Cherry St., MACON 570 Clisby Joseph SchoCoolrbin av begins 609 Toole Eula Mrs OllAHarris John B 623h-'SMloccCuomrdb WWmClEifford jr 630-OStubbs Robt E Means Wm M Kinney Rodric B -Sistare Marion M hO'Berry John W 6314'Holt Jesse R 633 MBoawtheersnyBJartAo1w Mrs 635hPlayer Sami T 637-0-Cole Clifford Mrs 637 (2) Wynn Geo 707 Wynn Osborne Calloway Annie Tucker Allen P Little Edw W 712&JToahynlosor nEvJa SAbMnerrs jr 717*Lewis Julian S Buckingham i*nte*rse*cts Calloway intersects 300--Wofford Oil Co filling sta 801-0-Watson Hubert C filling sta 810-CGreat A & P Tea Co gros 811 Costa Ice Cream Co whol 1401-0Tallent Cardonia Mrs 1403 Vinson John H 14040-Avant Norman A 11440065-0C-hPaatmricbkerVs aEssliazr RMrs 1408-0-Kaplan Henry 1410-OC'arter Ray Carolina av intersects 1500ADannenberg Joe W 1501-0-Ga Academy for the Blind 15020-Duffell Richd S .. 15060'McLucas Luna Mrs -OBryant Ginna C Mrs 1508-OHardeman Robt H OGassaway John S 1510-0-Jones R Frank 1512-0-Smith Jas A jr 1514 Livingston Donald F 11660031-OCCamonpnberelHl eRnorybtTD 1605-0-Gwynes Roy H 1607 Roberts Thos J 1608 Benford Alonzo B Kenmore pi intersects 1701-0-Smith Walter E 1703-0-windom John W 1705-0-Limerick Benj C 1706 Couch Clifford A fruits 1707 Couch Clifford A First av intersects 813AGill's Bakery 1801ACallaway Service Sta 881156-*QH-VililneDvirllye CDlreuagniCngo Co 1803-0-VinevHle Furn Co 1805 Vacant 817ARogers Stores gros 818APiggly Wiggly Stores gros 11880171-ODDaavviiss Wwmm HHfilling sta Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Rushin W Clifford meats 820 Vineville Barber Shop 842-OHays Pharmacy Oak Haven intersects 904*Happ Lee M 911ARichardson Wm R 912hHapp Prank R 918*Moses Harry Hines ter intersects 920AStewart Thos J 926-Garrett Chas H 930*Lyndon Andrew J 933AAnderson Eug 934hAlfriend Kyle T 945*Anderson Wm DCleveland intersects lOOOhBurden Richd P 1013AGrice Warren 1014-OTalley Jas N 11002118AHJeoynwesarAd WAnadrrreenw H 1033*McKenney Robt L 1035 Vineville Baptist Church 1036hComer Maud G Mrs Pio Nono i*nte*rse*cts Pierce intersects 1107bBateman Clifford H 1109AMartin T Baldwin 1133-0-Moyer Harvey P whol Ibr 1139-0-Wagnon D Sidney 11221015*VGaecwanintner HaSzteolnewall pi intersects 1219-C-Findlay Mary B Mrs 1225ABullard Chas M 1301AElfe Thos B Holmes av begins 11330043hCBolookunEt dWmmundC Pjr Rev 1305ABush Clarence R 1306AUUman Ploretta Mrs 1307-OBaggs Linton DFljorrida av intersects 1308*Farrar Sami L 1890-0-Chicken Grill restr Ingleside av intersects 1901 Lee Jas B gro 1902-0-Power Oil Co br filling sta 1903 Joyner Hattie 1904 Vacant 1905 Smith Chas M 1906-0-Harper Lewis H rear C of Ga Ry (creosote plant) 1907 Wilson John B 1909-OIngleside Elec Co 1910 Vacant 1911 Vacant 11991132-- King Jas R meats 1915 Vacant 1917 Wellons Kenneth B barber 11Q911Q8 VVpaccaarnUt 11992220 VInagclaensitde Shoe Shop reprs Hartley av intersects 2001-OParker Leon B filling sta 2002 Mutt &> Jeff Lunch 2004 Mutt & Jeff Filling Sta 2005 Smith Jas A restr 2008 Sisk Walter E 2010 WLaanldlacFereOdtisL B 2011 Swearingen Mary F Mrs 20130-Cotton Martha M Mrs 2015 Brown Leon D gro Marshall av intersects 2101-OMcAfee Robt K gro ,2103-0-ingleside Pharmacy 2104 McFadden Richd A auto repr 2105-OMarvin Grocery 2108 Wynn Thos N r2e1a10r-0M-SccFotat dFdeilnlinRgichSdtatAion 2111ACarlisle Bros auto reprs VINEVILLE STATION -- C of Ga Ry, Holt and Roff Home avs (V) 537 Moving - Packing - Crating Prompt Efficient Service NEW AND USED FURNITURE 408 BROADWAY PHONE 304 VIOLET AV (South Macon)--From east EofdgTewhiorodd wavest to Second, 2 south c, 1 Carswell Eva (c) 2 Vacant 3 Jones Maggie (c) 4 Harris Chas (c) 5 Wright Pink (c) 93 Womack Lucille Mrs 97 McBride Thos F T_hi.rd. i.nt.ersects 110 Vacant 111 Horne Wm N 112223-DdCaavmidpsboenll RRoobbtt OE 124 Reynold Gladys Mrs 127 Hall Morris H 112381&DLaevaidptsroont HHuebnerryt MC VIOLET LANE (East Macon)--Changed to Clara VIRGIN (Vineville) -- Southwest from 128 Hardeman av to Forsyth, 1 w of Franke av , ,, 104 (156)ASmith Louise (c) 105 (165) Berry Jackson (c) 106 (158) Cole Cater (c) 108 (162) Alford Henry D (c) 110 (164) Howard Robt (c) 112 (166) Norris Amanda (c) 114 (194) Adams Artis (c) 116 (196) Allen Malissa (c) 112202 A(1l9le8n) RJoohbnins(oc)n Pink (c) 124 (490) Boyd Ollie M (c) 126 (492) Thorpe Mary (c) 128 (494) Johnson Mary (c) VIRGIN ALLEY--East from 215 Virgin la 209 (206) Vacant , ., 216 (206) Simmons Sarah (c) 218 (367) Vacant 220 (408) Vacant 228 (44) Vacant VIRGIN LANE (Vineville) -- Southwest from 660 Forsyth, 1 north of Franke av 204 (100) Harris Peter (c) 206 (120) Wright Hattie (c) 207 (123) Walker Sol (c) 208 (122) Hill Willie (c) 209 (125) Howard Hayes (c) 211 (127) Taylor Mamie (c) 212 (6) Thomas Lizzie (c) 213 (143) Marvin Jas (c) 215 (131) Vacant 224 (446) Rouse Wm (c) 226 (43) Byars Thos (c) 230 (21) Caldwell Jessie (c) 232 (23) Barrow Fannie (C) 236 (102) Byrd Jennie Mrs gro VIRGINIA AV -- South from Log Cabin blvd, 2 e of Macon VIRGINIA AV (IT) -- South from 505 Montpelier av lOlALancaster Wm G 107*Williams Mary mus tchr mdJackson Annie B Mrs 125 Dooley Claude W 126&Gibson Thos B 127 Lloyd Horace C 128 Randolph Jas 129ACollins Nell P Mrs 130 Marshall Wm L 113312ATCyllienrksJcuadlegse CEody G 133AReynolds Earl E 134 Jennings Mansfield M 137ABatton Hardy L 113685&CClaaprlpisleDMoralaundde ML rs 166&Dunbar John W 117703'0H-Laelwl isGeJonehrnalWS 1750-Andrus Edwin M 1800-Munsch Wm C 1850-Rogers Elisha HJasami.ne intersect.s 215AJames John W 217AGordon Wm FBelmont av i.ntersect,s 401 Hartzog Anderson E 406 King Benj H 407 Vacant 4090-Knowles Rebecca Mrs 415AJames Walter W 450 Terry Mack I 457 Hogan Wm 459 (455) Oney Chas A 460 Barnette E Hartley 477 Sanders John L Wmship intersects 507 Steven Thos E VISTA CIRCLE (Ingleside) -- From Ridge av east to Ingleside av 102Ascharff Byron D 104AMcDaniel J Bruce 106AHolmes Wm B 107-AThomas Jas A 116ATharpe Robt A 119AWinchester Thos H 121AGrubbs Alf L 123ASubers NettiWe oMordsland av intersects 201ATharpe Geo H 202ALong Margt M Mrs 2200340A-FLeaawgrienncRe RDooyugElas 207ADuncan Whiteford W 208ANims Arth L jr 215-ARice Geo C 219-AThomas Hugh G 220*Brant Ora F _ 250AO'Neal Ben.1 P jCrlaire pi i.ntersec,ts 341&Garrity Mary A Mrs 334509-AAMBaurrnreasv AWEMmmerceettr j.r 351APridgen Guardrow WADE'S LANE--From 3d west between Edgewood and Gordon 524 (528) Samuel Adolphus (c) 526 Millford Wm (c) 558 Wynn John H (c) WALKER (Log Cabin Hts) -- From Highland av east to Edna pi, 1 south of Thomas TOO Hitchcock Melvin R rear Josephson Raymond WALKER LANE -- From 548 Ocmulgee to Walnut 109 Commer Gertrude (c) 110 Parker John (c) 111 Stephens Isabella (c) 121 Abram Andrew (c) 123 Mitchell Susie (c) 124 Johnson Hanna (c) 151 Waller Jennie (c) 152 Harris Fannie (c) 153 Davis Robt B 154 Vacant 155 Goodloe Lilia (c) 156 Robinson Alberta (c) 214 Calhoun Andrew (c) 216 Dixon Geo (c) WALL--From Cotton av east to 5th bet Mulberry and CherrySecond intersects 22 Vacant 2223%AWVilascoannJt W Elec Repair Shop 23% Vacant 2245AVDaacvaisntD Plmbg & Htg 2267-SAaHraamtoligna SRheeesttauMraentatl Works 29 Belos Louis restr 29% Vacant 38 Vacant Thi.rd, i.nt,ersects YOUR CITY D I R P C T O R Y MIRRORS the CIVIC Of Your CITY 538 D. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Go. Sfudebaker Wiliys Hupmobile Sales Service 655-657 Third St. PHONE 2997 YOUR CITY D I R C T O R l Y MIRRORS the CIVIC Life Of Your CITY WALL--C ont d 318 Vacant 444235 A(1d) aVmascaBnutffeteria restr 451-453AMacon Machine Shop 455 Vacant 457 Vacant 459-61 Jarrett Paint & Glass Co whse 515 Ross & Clements beer 516 Vacant 517 Vacant 525 Vacant Broadway intersects WALL STREET LANE--From 7th north to 6th bet Mulberry and Cherry 4 Reynolds Adele (c) 5 Bell Roosevelt (c) 6 Haddock Bessie (c) 19 Bright Mary (c) 26 Baltright Benj (c) 28 Vacant WALL'S AL (North Highlands)--From Clinton rd west, 1 north Davis 100 (69) Ridley Lee (c) 101 (26) Ingram Davis (c) 102 Harris Elijah (c) 103 (1) Wise Sami (c) 106 (913) Forest Viola (c) 107 Bowen Archie (c) 108 Ridley Annie (c) 109 Bowens Fred (c) rear Davis Bristol R (c) 111 Adams Holt (c) 112 Forest Nathaniel (c) 113 Pitts Thos (c) 115 Felton Jay (c) 117 Clay Edw D (c) 119 Glowers Benj (c) 121 (52) Vacant WALNUT--From 7th west to Orange, 1 south Ocmulgee Seventh intersects ftbMD&SRRCo (yd mstr) amd&SRRCo (train mstr dept) AMD&SRRCo (storekpr dept) MD&SRRCo (chf dispr) MD&SRRCo (asst genl mgr and rdmstr) amd&SRRCo (mstr mech dept) 100 Vacant lOlAFofford Oil Co planStixth intersects 214AAtlantic Ice & Coal Co (br) C of Ga Ry crosses 215AMacon Iron & Paper Stock Co 225AMansfield Dray Line trucking 259 Johnson Annie (c) 261 Vacant rear Stevens Jas (c) 265 West Cottrell (c) 267 Fields Wm (c) 277 Sawver Coal & Ice Co fill sta 301APeeples Oil Co Sta No 2 fill sta Fifth intersects 313 Goolsby Lilia (c) 316 Salter Mattie (c) 318 Walker Willie D (c) 319 Tyson Sallie E Mrs 353 Whitney Alice Mrs 355 Butcher Albert 363 Butts Ernest C 367 Everidge Jos J Broadway intersects 401&Cameriero Nicholas 404 Vacant 407 Stanley John H 408 Howell Perry S 412 BBirrorwicnk GFaeonnTy pShyMsiros therapist 413 Stalev Jas (c) 418*Smith Geo B 421 Damour Hypolite real est 452*DHaumhnouWr aPlatuerl Mreal est 453*Stephens Robt A rear Hicks Alice 'c) 4554-Conner Aileen Mrs 456*Fogarty Nicholas J 447618 VNauctatinntg Sarah C Mrs fum rms rear Vacant Third intersects 502AFreeman Robt S beauty shop 504 Freeman Robt S 506 Cooner Jacob L 508 Carroll A Roland 511 Kemp Mary M Mrs 512 Jones Julia Parkham Benevolent Home 518AChrist Episcopal Church (Parish House) 519*Harris Ernest C 520 Christ Episcopal Church 553&Hawkins Belton L 567AClinic The AClay J Emory phys AMassenburg Geo Y phys AHurley Thos A phys AWatson Otho O phys AMcLaughlin Chas K phys AMcAfee Linton C phys ACraddock Harry W dentist 568AWashburn Abram C fum rms 569AClinic Nurses Home The Second intersects 601 Stevens Robt L filling sta 615-19 Belmont Apartments ApalArtTmheonmtsp:son Andrew P 2ABroaeh Altoff C 3 Baker Theo 4 Waddell Daisy Mrs 5 Willis Louis K 6 Brown Sudie Mrs 7 Cheves John W 8 Kennington Viola Mrs Street continued 616 Flury Carrie M Mrs ABryant Eliz Mrs 620 Livingston Sallie Mrs 623ACreamer Mary F Mrs 624 Frick John B 629AErwin Lenoir M Academy ends 660 Johnson Nora Mrs 661AHardwick Callie R Mrs 662ABarksdale Julian H 663ATyler Billie beauty shop 664AReid Wm T Brownlow Jas E 668 Smith Mattie Mrs fum rms First intersects 701AJarrett Jas P 709ASloan Crowell L 711 Kelley Jos B 715ABennett Wm J 722 James Homer E Spillers Eustace 725 Rutland Thos C 726 Schell Chas E Krewson Luther H 727AReinhart Sallie H Mrs 728 Futen John J 730 Couch Clarence E Couch Geo A 742 Samples J Milton 744 Barton Mae Mrs 746 McGahee Nina Mrs 748 Arnett Willie Mrs 750 Langford Dan L 759Astroberg Kate Mrs 765AMeadows Nettie B Mrs 767 Evans Ernest E 771AHolloway Jas M 772 Berger Lewis 774 Shier Sami 776 Galkin Benj 778 Nirenstein Geo L 803AWorley Chas P New intersects APriester Chas E 808ALott John T tailor SllASmith Geo W 817AStork Amelia L Mrs 539 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 WALNUT--Contd 818 Stripling Randolph B Kenyon Roy E 819 Brooks Richd P 820 Brantley Celevia Mrs 822 Vacant ' 885501&HBeumrgmMinigcwhlayR W.irm L 852 Tucker Lucile Mrs 853 Backer Flora Mrs Backer Sidney 8551-AOGpaorrdtmy eLnetswis E 2ARoberts Wadis A 3 Fruitticher Jas C 4 Sands Wm A Street continued 856 Baber Blackshear Mary 859ACollins Louise H Mrs 865 Stuckey Robt L 867 Smith G Harvey Spring intersects 906 Sheffield Carlton M 908 Vacant 909 Fernandez Lott P mus tchr 910&Ragsdale Susie F Mrs 911AAndrews Gillie C Mrs 912ABrady Fannie F Mrs 915 Walnut Apartments Apartments: 1 Elliott Mary L Mrs 2 Avera Mattie Mrs 3 Holland Benj W 4 Bostick Marion B 5 Vacant 6 Stewart L Richd 7 Hinson Jas A 8 Barnes John T Street continued 918 Burnett Vallie Mrs Ward Fletcher C 920 Narkas Theo 922 Tucker Jos T 924 Willis Arlington O 928 Smallwood Oscar K Clance Jas M 930 Ouzts M Emmett 961hHill Emma M Mrs 963 Miller Sarah L Mrs 965-0-Adams Mamie M Mrs 967 Norris Frank E 997724&RMiecsGeIermJoasWS 976 Vacant 978 Lamb Chas F Franklin ends 1001 Bost Varley Mrs 1003 Hawthorne Jas L 1004 Godfrey Roscoe A 1005 Kahdv Assif G 1008 Miraglia Edw 1010 McKinley Louis G 1015 Moody Edith Mrs 1017hHenry Louisa L 1020 Dunham Howard H 1052 Vacant 1053 AWbebaovtetrWWmatsBon O 1055 Haskin Harry B Watson Thos W 1057-CWiggins Clifford W 1060 Staamer Agnes Mrs 1063ADavis Velma H rear Swain Wade (c) 1064Harison Anna E Mrs 1065 Rodgers Wm R 1066 Wuom Henry W 1070&Phelts Emma C Mrs 1071hLlovd John F 1073*Scott Wm E 1074 Thompson Jas A 1076*Levens Lance 1078 Weiss Lathan O Hill ends 1103 Vacant 1105hLingo Maude M Mrs 1114AHammack Gussie M Mrs 1115 Greer Alvin E 1120AHappoldt Bessie 1121 Hancock John W 1122 Vacant 1127 Andrews John T 1133AFlynn Wanda Andrews Henry F Orange intersects WARD (V) -- North from 208 Vineville av, 1 west Forsyth 108 Goode Sol (c) 110098%SmViathcaJnot s A (c) 110 Lewis John H (c) 112 Beda Etta College (dom science bldg) 116 Smith Minnie L (c) 125 Duncan H Levi (cH) olt av intersects 201 Duncan R Lee (c) 203 Jackson Monroe (c) 204 Griggs Edw Rev (c) 205 Farmer Charity (c) 207 Goodman Anna (c) 210-i Jones Arth R (c) 211 Coleman Carrie (c) 215 Wilson Frank (c) Third av intersects 3O10Bivins Jas (c) 302 Vacant 303 Hudson Wm (c) 304 Mann Larkin (c) Price intersects 306 Bryant Clayborn C (c) 308 Gibson Oscar (c) 320 Shank Elsie (c) restr 323 Green St School (c) 324 White Maggie (c) 332256 VScaocfaineltd Mehale (c) 330 Evans Isom W Rev (c) Pond begins 400 Taylor Susie (c) 403 Comer Rutherford Rev (c) 405 Howard Chas W Rev (c) 406-OMoughon Mamie L (c) 407 Brown Mary W (c) 440098ARPohbiilnlisposnWZmeoWna R(ce)v (c) 410 Redding Robt (c) 411 Holt Beatrice (c) 412 Cotton Mattie (c) 413 Gilbert Mattie (c) 414 Trimble Edw (c) 415 Hight Lucius (c) Amos begins 416 Cox Julia (c) 417-CJones Donie (c) 418 King Edw (c) 442221ABAorwnodledn FJaonhnnieO (c(c)) 423-0-Ferrell Mamie (c) 424 Foster Albert (C) 425 Blount Sarah (c) 426 Smith Richd (c) 427 Simmons Jas (c) 428 StPeter Claver Convent StPeter Claver Cath Sch (c) StPeter Claver Cath Ch (c) 429 Ellington Oralee (c) 430 StPeter Claver's Rectory Barthlen Alfonsus Rev 431 Bailey Wm (c) 460 Collier Dianna (c) 497 Green John (c) 551 Sims Edw (c) 557 Jones Benj (c) 558 Barnes Oscar (c) 560 Turner Henry (c) 562 Mitchell Philip (c) WARE'S AL--From 522 Elm south WASHINGTON (Cherokee Heights) -- North from Berry, 1 w of Bartlett's la 102 Vacant 104 George Washington (c) 106 Vacant 110 Vacant Macon Federal Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Bankers Encyclopedia The Bank Directory of the World issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 540 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AVE. LOANS TEL. 6130 WASHINGTON (East Macon)--From 416 First west 123 Brewington Eugenia (c) rear Johnson Thos (c) 138 (150) ADumas Nora (c) 140 Mitchell Walter (c) 141 Gordon Annie (c) 142 Etheridge Claude L (c) 144 (196) Stafford Jennie E (c) 146 (198) ADaniels Nelson A (c) WASHINGTON AV -- From 817 Poplar west to limits 103 Creamer Marvin Blanton Forrest A Bellflower Eddie M Mrs 109 Maynard Apartments Apartments: 2lAPDluelnliknegtetr WJoHhnazeEl 3-4AGammage Angeline H Mrs 5 -Regero Rose 6*Finney Perry S Street continued 112 First Baptist Church 115 Beasley Maude Mrs Barkley Richd D 117 Grace Lucia Mrs 121 VBraacyanTthos 123 Sellers Gerald 124 Smith Nora Mrs 125ACampbell Richd W 126AWyche J Alden 127 Kitchens Wm T 128 Stringer Thos 204/-Fox O'Hara B Spring intersects 206-OJohnson Andrew 207 Smith Geo L 208-0-Holcomb Martha Mrs 221121AVSaacnadnetrs Jas C 215 Jones David N 221 Washington Av Presby Ch 222233173//--W''MHhacmeDeolAenranlAndilebJaeNrst W Mrs 235 Ware Thos 237 Peavy Jas W 239 Combrevi Lula Mrs 240 Rowland Gertrude Mrs 242 Vacant 244 Faulkner Mary Mrs 246 Moon Calvin E 250-OMartin Lyndon J 251ACaserio Lucretia gro 252*Joiner Mabel Mrs 253 Caserio Lucretia 254 Bozeman Mattie L Mrs 256* Bruner Moncrief 258 Gable Albert E 260 Ezelle Eunice Mrs 261 Holsey Temple C M E Ch (c) 262 Johnston Janie Mrs 264*Fullington Benj H 267 Richerson Mellie Mrs 271 Vacant 273 Vacant 281*Burnett Erastus D 285 Everett Jas T 288*Lyons Cash Market gro 289*Ard Cash Grocery 290*College Hill Pharmacy 291*Rogers Stores gros Orange intersects 306*Reddick Paul T 310*Gaddy Paul C 316-OBarnes Beulah L Mrs furrier 320*Washington Memorial Library 400*Karesh Sami College intersects 430*Clisby Jos R AStephenson Jas L jr 436*Malone Kate C Mrs 442AV-Caocnannotr Saxton A 446*West Anna B Mrs 450*Sparks Johnnie Mrs ADavenport T Fred Arlington pi begins 504&West Frank B 512*Johnston Lucille AMcKinney Frank M AJones Alice W Mrs 553200ASCcoayrlbeorCouulgahMMrsarbtehaautMy rsshop 534AMonsees Jas A Rev 538*Snow Georgia C Mrs ARatliff Barney 540AHolt A Flewellyn jr '544AWimbish John 612 White Hattie (c) Monroe intersects 614 Johnson Geo W (c) 616 Williams Fannie (c) 661282 AHnodwearrsdonREodbwt ((cc)) 628 Gant Margt (c) 630 Standridge Chas C shoe repr 638 Vineville Barber Shop (c) 640ADennis Everett D (c) auto repr 646AVineville Dog & Cat Hospital WbAeTrtER (EM)--From Main north to El302 Woods Ophelia Mrs 315 Hester Clara Mrs WATER (Paynes Mill)--South from 2226 Forsyth rd, 1 e of Oak av (For houses see Bellevue rd) WsAoTuSEthwRiVtfotIL&liLm ECitosR, (D2coet--atosntFogrfoinmB) roEaddgweawyooo Swift & Co (oil mill) Sou Cotton Oil Co The Central Sash & Door Co (plant) AAtlantic Ice & Coal Co 3 Brown Chas (c) rear Walker Jas (c) 5 Burke Henry (c) Reid intersects 167 Hunter Sylvester (c) 239 (240) Craig Lindsey (c) 241 Patrick David (c) 242 Walker Marie (c) 261 Williams Danl (c) 300 Jackson Lonnie (cC)olquitt intersects 301 (552) Beasley Pasco (c) 303 (205) Field Rosa (c) 305 (207) Coswell John (c) 307 (209) Dean Wash (c) 311 (211) Dean Mattie (c) gro Charles intersects 401 Perkins Wm (c) 403 (303) Thomas Oscar (c) 405 (305) Lewis Leonard (c) 407 (307) Hamilton Clifford (c) 409 (309) Thomas Frank (c) 411 (311) Stewart Edw Z (c) Crisp intersects 515 (798) Spivey John (c) 525AGreen Foushious S (c) restr 891 Williams Sami (c) soft drinks Dickey W S Clay Mfg Co (plant) Cherokee Brick Co Inc Sou Ry System (shops) Ga Sou & Florida Ry (shops) Sou Ry System (store house) WATERWORKS ROAD -- North from nr end Rogers av to River, 1 e Corbin av City Water Works WATKINS--North from 850 Woolfolk, 1 west of Fort Hill WATSON AL (South Macon) -- From Pebble south, Vz block east of Telfair 225 Hill Rena (c) 304 Vacant 317 Vacant 335 Vacant 1053 Jackson Buddy (c) 541 MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 WAYNE AL (South Macon) -- From Bright south to Pebble, 1 east of Telfair 100 (723) Phillips Chaney (c) 102 (729) Gray Cecil (c) 103 ( 26) Geddows Jas (c) 104 (724) Bivins Primus (c) 105 (726) Stokes Bertha (c) 106 (730) Baker Sara (c) 107 (128) Stewart Cornelius (c) 108 (732) Reid Wm (c) 110 (134) Crew Nelson (c) WEBB LANE--South from 114 Orchard av to Green WEST BOUNDARY -- South from 544 Forsyth to C of Ga Ry, continuation of Frank la. 1 (4) Vacant 2 (5) Thomas Edw (c) 3 (6) Holmes Obie (c) 4 (3) Williams Carrie M (c) 5 (10) Keith Wm (c) 7 (128) Richardson Pearl (c) WEST END AV (Western Hts) (Formerly Pauline av)--From Linden av, 1 west of Montpelier av 101- Hicks Raymond R 110048&CPBloowydlesJeMssaiye I llO&Elder Chas BJohnson av intersects 207*Hatcher Wm H 209C-Bailey Jas T 210&Anderson Julia L WHITE (South Macon) -- From Jeff Davis south to Central av, continuation of Sixth av 22 (23) Ward AndCreewntrJal av intersects 34 (498) Lucas JohWn h(cit)e al intersects 37 Sellers Edw (c) 41 Lavender Walter J 43 (252) Stokes Leonard S 45 Jones Vernon A gro 46 Opry Stella B Mrs 47 Moore Enoch C gro Long intersects 157 Hickson Walter 165 (242) Walters Benj A Ell intersects 303 Crosby Marion E 307 Vacant 311 Ward Oliver R 315 McLaughlin Edwin E 317 McCollum Herman 319 Smith Nancy E Mrs Bates Roy C 325 Bates Vernon 340 Leverett Carlton A 342 Mann John 499 Gibson Robt (c) WHITE AL (SM) -- From White west, south of limits 2 Hughes Rachael (c) 4 Jones Ella (c) 5 Jones Wm (c) 6 Vacant 8 Hopkins Ernest (c) 9 Jordan Wm (c) 10 Jones Milton (c) 257 Battle Annie (c) 259 Nelson John (c) 262 Vacant 267 Billingsly Arth (c) rear Vacant 271 Huff Lawrence (c) 272 Cornelius Annie (c) 274 (358) Reid John (c) 280 Billingsly Calvin (e) WHITEHALL--East from Bartlett av to Hillyer av, 1 north of Napier av 582 Johnson Bennie (c) 584 Stephens Geo (c) 586 Lightfoot Leola (c) 590 Smith Annie L (c) WHITEHEAD (SM)--From 2224 Broadway west 102 Patterson Richd A 103 Thomas J W gro 104 Mayfield Allie Mrs lOSAWatkins Sallie 110 Allen Carl P 112 Valentine John B 114 Davis John D WHITEHEAD AL--North from 859 1st to New bet Hemlock and Orange 715 Ward Davis (c) 717 Moore Sallie (c) 719 Parker Arth (c) 720 (218) Davis Bethonia (c) 721 Cubby Nancy (c) 722 (353) Johnson Bessie (c) 760 Little John H (c) 762 (152) Parker Wilda (c) WHITT (East Macon)--From Fort Hill west, north of Pringle WILBOURNE (East Macon) -- Changed to Melrose WILDER (NH)--From Montpelier north to Beech, 1 east of Pio Nono av WILDER (South Macon)--From Bright south to Pebble, I west of 2d 77 Spivey Oliver (c) 79 Dixon Horace (c) 30 Thomas Ira (c) 81 Gibson Wm (c) 83 Booker Sim (c) 85 Hikes Hattie (c) WILLIAMS (East Macon) -- East from 1101 Clinton rd to Maynard, 1 north of Hall 204 (622) Johnson Arth (c) 206 (620) Ingraham Joshua (c) 208 (203) Hightower Sylvanius (c) 209 (242) Childers Carrie (c) 211 (600) Smith Annie (c) 314 (321) Browers Jas (c) 316 (317) Warren J Wesley (c) 318 (319) Humphries Medie (c) 320 Booker Wilson F(oc)rt Hill intersects 322 Vacant WILLIAMS (South Macon) --From 2d west to Jeff Davis, I south of Anderson 1130-Baggarly Wm V 117 Irby Robt 118 Till Henry A 119 Raby Wm P 125 King John T 127 Whitten John A 128 Carver Chas H 1300-King Wm H 133 Armstrong Jas H 134 Croom Clara Mrs Roberts Eliz E 1133890DTyueckRerobJtasE I 143 Bowden Mattie Mrs 144 Ammons Geo 149 Cannady Clarence 150 Tucker Crowley 153 Watson Gussie T 155 Yughn Mabel Mrs 156 Palmer Wm C 1574Alexander Martha E Mrs 160 Tidwell Jas M Freeman intersects 204-O.Kitchens E Mack 208 Melvin Kate Mrs 209 Dunbar Chas C 215 Hoke Wm A 246*Parker Nelson H 247 Chancellor Wm A 248 Kent Louis WILLIAMS LANE -- From 217 College west to N Boundary 121 (21) Johnson Cora (c) 123 (127) Vacant 125 (117) Ashley Mollie (c) 1 SIGNATURE ONLY SAME DAY M 0 N E Y For Reliable Salary People Macon Trading & Investment Co. 220 Georgia Casualty Bldg. Phone 3368 i--- 542 YATES MOTOR CO. DeSoto 707 THIRD ST. PHONES (ISf Plymouth WILLIAMS LANE--Contd 127 (123) Able Georgia (c) 128 Isabell Jas (c) 129 (125) Clark Geo (c) 130 (181) Taylor Martha (c) 132 (22) Vacant 113340WScehsetllMLaoruyisSCMrs 135136146 Williams H Milton 1600-Sawyer John H 134 (24) Wilson Rufus (c) 217 Williams Robt LMa(dci)sognrointersects 219 (237) Williams Robt L (c) WILLINGHAM (East Macon)--From 359 Church, 1 west of Milledgeville rd 15 Manderson W Steph 17 Williams Oscar Fort Hill intersects 105 Kirk Mina Mrs 108 Stokes Clarence E 109 McNeil G Elbert 110 Cranford Jewell Mrs 113 West Edw W 118 Radfield Geo W 120 Campbell Eug 121 Bowden Clyde M Mrs 125 Alford Elijah F 130 Herndon Wilbur L 132 Fountain Beulah Mrs Herndon J Adolphus , ___. MayrtarcT Intersects/ 210 221 Lyles (261) John King L Jesse C \ " , 1 ! ' 223 (262) Thompson Wm K 225 (264) Vaughn Chas 227 (265) King Jesse C OF 229 Land Oscar 244 Vacant 246 Roberts Wilson L 256 Wood Jas 268 Britt Paul T 274 Hudson Willard 276 McCrary Geo C Norris intersects Carling*av* en*ds Belmont ay begins 2060-Elder Elwyn G 210OGriffin Walter D contr 2370,shinholser Mamie Mrs gro Barron Wm J 241-O-Mitchell Louis T 24300dom Ollie L 2450jones Earlie C 2460ivey Rufus L 247 Lowe John A jT West Geo 249 Shell Clifford P 250 Garrett Ettie Mrs 2&Lft,Ya 550Cassini -2590Jones 2600-Cowhc4'd (Ralph d> j'yer Rose L nurse /ard Geo 271ojones_ Wp 2740OMin9h Tcontr 286 Philips] 2860ffinge^Ell!i 11 I 289-OSutton Thos W .IE Oakland av intersects 302Ojones Wm E 314 Neesmith Myrtle Mrs 318 Moore E Cecil 330 Graham Florida M Mrs 331 Holland Minter E 333 Moore Willie M 335 Gammage Carlton D WILLINGHAM AL--From 246 College to 231 Orange, bet Bond and Walnut 305 (246) Scott Lucinda (c) 306 Hamm Jos (c) WILLINGHAM LANE (East Macon) -- North from 268 Willingham to Stewart, 1 west of Norris 267 (260) Clark Edw (c) 269 Lingo David (c) 271 Washington Wash (c) 279 Robertson Norman (c) Virginia av intersects 402 Meadows Annie Mrs 410 Thomas Berry L 411 Donaldson Battie G 412 Shell Clifford H llS&Patterson Louis 417 Patterson John C 418 Wood Minnie W Mrs 420 Carr John L 425 Jackson Jos 443320 VAarncoalndt Mollie F Mrs WILLINGHAM ROW--(See Harris Row) WINTON AV (Formerly 8th av)--From WILLOW--From New west to Spiring, I Napier av east to Cherry av, 3 north north of Ocmulgee of Pi,o Nono av 803 Brown Rosalee (c) 6970.(607) Burnham Jas W 807 Massey Andrew (c) 6980-McSwain Hector L 853 Macon Gas Co (meter sta) 854 Stewart Pierce (c) 701-0-Smith Chas L Beech av intersects 855 Edwards John (c) 703*Bateman W Chas 858 Smith Eunice (c) 749-0-Mabry Robt H 862 Green Dennis (c) 761-Jones Chas S 866 Weathersby Bertha (c) 868 Lockett Mamie L (c) 777725-0V-Haocmanet Eug WILSON (East Macon)--From Washington north to Bond, 1 west of Duval 132 Vacant 133 Malone Cleveland (c) 136 Cook Robt (c) Date av intersects 811-OBozeman Robt L 8120-Gunnels Alva L 881134-OSBmauitnhdeWrs ASltbanerftorHd 836-0-Haskins Thos H WINDSOR (South Macon) -- From 838-ODomingos Robt B @ Broadway west to Second, 1 south of Giles WING AL (See Wayne al) 886419-SOwStaewnnartAClbhearst JA 873-OCotter John S 885-0-Lasseter Horace S WING'S HILL (See Elk pi) WINSHIP (WH) (Formerly Rose)--From 896-0-Tipton Edw W 8970-Gibbs Walter D 1414 Edgewood av west to Fourth av, 3 south of Montpelier av 120hGreer Wm H WTSE AV (Vineville)--From Northwest Boundary to Hudson, 1 east ,of Green 101 Broady Arth (c) 121-i'Thomas Paul T 102 Jackson John (c) 125-0-Otto Fredk R. 104 (4) Moore Roy (c) 127 Arrington Sami L 128129- O 0 111000756-IOCnLagserhoanmaWrG-dBmMrueCeloal(nricrnter)oginetJoanSLs EH((cc))Stevens 543 WISE AV, (V) --Contd 108 Jackson Geo (c) 109 Vacant 110 (10) Mitchell Isaiah (c) lllAPope Wm C (c) 112 (12) Bales Henry (c) 113 (11) Word Phillip (c) 114 (14)ACummings Alice (c) 115 (19) Taylor Georgia (c) 116 (16) Brunson Walter (c) 117 (15)ASanflord Mamie (c) 118 (18) Bryant Rose (c) 119 (17) Little Alzada (c) 120 Smith Janie (c) 121 (21) Simmons Fluellen (c) 122 Whitfield Richd (c) WITKOWSKI'S LANE--From 720 Hazel south 4 (453) Scott Clinton (c) 6 (555) Dennis Lucile (c) 8 (557) Greer Carrie (c) 9 Vacant 10 (559) Humph Koht (e) 11 Ryan Tiny (c) 12 (561) Walker Ella (c) 13 (6) Walker Essie M (c) 14 (563) Johnson Adeline (c) 15 (5) Long Mary (c) 17 (130) Vacant 19 (133) Bell Nona (c) WOMACK (East Macon) -- From 720 10C3-h-l-uMrcihtchneollrtCh arrie 105&Hunnicutt LuthWerooHlfolk intersects 245 ( 649) Jackson Angeline (c) 247 ( 650) Ussery Julius (c) 253 (653) Council Clayburn (c) 298 (651) Harris Clayburn (c) Cowan intersects 304 Mattox Addie (c) 305 Brannon Wm B (c) 307'. James Lizzie L (c) 309 Bryant Gus (c) .310 Pitts Rosa (c) 311 Taylor Robt (c) 312 Hunt Robt (c) 313 Dennis Alf (c) 315 (312) Morris Thelma (c) 317 (313) Wiggins Gertrude (c) 319 Bowman Robt (c) Hall intersects 401 (414) Bronson Thos (c) 403 (414) Grant Wm (c) 405 (412) Vinson Wm (c) 407 (450) Byrd Addis (c) 409 (452) Silas Sarah (c) 410 Harvey Hattie (c) 411 (454) Shepherd Oscar (c) 413 (456) Payne John (c) 414 (446) Gibbons Thos W (c) 428 (460) Culp Lily (c) 430 (101) Watson Lucy P (c) Mitchell intersects 512 Carr Venie (c) 514 Farrow Wm (c) 516 Smith Wm (c) WOOD (SM)--From 2d west to Broad- way, 3 south of Edgewood av 101 Lingo Jennie Mrs 102 Willis Maggie M Mrs 200 (102) Vacant Third intersects WOOD AL--From 338 Maple south to Edgewood av, bet Calhoun and Ross 119 (124) Williams Georgia (c) 121 (123) Fordham Sami (c) 123 (110) Patterson Mary (c) 125 (114) Shedrick Irvin L (c) 112279 J(a11c2k)soDnixLouncyJos(c)(c) 131 (122) Farrow Della (c) 133 (121) Durden Rufus (c) 135 Haines D C (c) 175 Wilder Jane (c) Hazel intersects 201 Hawthorne Jack (c) 203 Bentley Cherry (c) 205 Daniel Rosa (c) 207 Daniels Geo (c) 208 Vacant 209 Banks Leonard (c) 211 Parker Amanda (c) Ash intersects 301 Smith Annie (c) 302 Bailey Wm (c) 303 Vacant 304 Banks Danl (c) 305 Longstreet Wm (c) 306 Rines Dock (c) 307 Vacant 308 Robson Ollie (c) 309 Griffin Edw (c) 311 Vacant WOODARD (Unionville)--From Mosley south to Parker, 1 east of Grayson WOODCLIF F --From 287 College to Brewery la, 2 north of Georgia av 1 White Robt (c) 1 (2) Marziel Jesse (c) 2 Chappell Ben] (c) 34 BKreolsuegyhtWonmLu(cl)a (c) 5 Howard' Jos (c) 6 Banks Thos (c) . 7 Vacant 8 Singletary MaryM(acd) ison intersects 101 Daniel Emma (c) 103 Carter Ethel (c) 104 Daniel Milledge (c) Bostic la intersects 105 Tuff Roland (c) 106 Little Jerry (c) 107 Vacant 108 Sterling Cornelia (c) 109 Vacant 111 Ford Matilda (c) 113 Newsome Sparta J (c) 115 Anderson Louise (c) 117 Vacant 119 Vacant 121 Marshall Wm (e) 123 Richardson Ida (c) 127 Wesley Romeo (c) 129 Church of God (C) 134 Culpepper Robt (c) 136 Stanford Jas (c) 138 Stubbs Ella (c) Monroe intersects 202 Williams Willie M (c) 204 Johnson Beatrice (c) 206 Tharpe Martha (c) 208 Simmons Azalea (c) 210 Pennyman Jos (c) 212 Wilder Elmer (c) 214 Seay Judge D Rev (c) 216 Little (Eug (c) 218 Taylor Edw (c) 219 Freeman Mary E (c) 222210 TBhroroekastt FAanrtnhieR(ecv) (c) 226 Harris Paul (c) 227 Todd Sylvester (c) 222298 WDuilrkhearmsonAaMroanry (c()c) 230 Wright Georgia (c) 231 Vacant 232 Bardsdale Frances (c) 233 Goodrum Wm (c) 234 Wimberly Lonnie (c) 234% Cubie Annie (c) 235 Dugan Lela (c) 237 (2O0)bCheeves Albert (c) 238 Fluellen Ida (c) 239 Lockhart Geo (c) 240 Sutton Mattie M (c) 241 Holmes Clayton (c) 242 Gardner Henry (e) 243 White Sallie (c) 247 Culpepper Lena (c) 249 Lane Wm (c) 251 Vacant S| g g g_g. a Linen Service DISCOUNT CASH AND CARRY Cleaner# Dyers Rug Cleaners Phones 1000-1001 1002 DIRECTORY LIBRARIES We Have on Pile in Onr DIRECTORY LIBRARY Copies of tlie Directories of Practically Every City in the UNITED STATES and Canada These are for your conven- ience If you want information you are unable to procure elsewhere, call on us R. L. POLK & CO, DETROIT J 544 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 New St. Phone 2044 WOOD CLIFF--Contd 253 Vacant 255 Felder Jennie (c) 257AJohnson Arth (c) 259 Vacant 261 Thomas Fannie (c) 263 (90) Vacant 265 Jones Aaron (c) 267 Pennymon Andrew (c) WOODLAND AV (Ingleside) -- From, Ingleside av north to Osborne pi 102 Ingleside Kindergarten 103-O.Meadown Adelaide Mrs 109 Morgan Guy P WOOLFOLK (East Macon)--From IntReerseesec,tio2n nSoprtrhingofanBdroCadlinton east to 102 Grier Alex S (c) 106 Mims Ruby (c) 112 Glenn Thos (c) 307 Crumbliss Serell 352 Stephans Lovie (c) 353 Cowan Thos W Clinton intersects 442278 SLteimllmmainng MVialtsosenr 429 Roberts Frank 452<0-Flowers John W 445553 BSaorwgeenntJeWssme RJ 465&Ledbetter Hubert 530 Keen Wm O 556 Hose Felton H 557 Vacant 560AOgbum Leon B 563 Beck Otis 600 Hinson HenLryexTington av intersects 602 Hinson Wm A 604 Stephens Wm L 606 Carmichael Jos F 607 Crumbliss Sewell AHstor pi intersects 611 Hollman Jas F 615 Norris Robt O 700 Stembridge Jack CCenter intersects 702 Mitchell Wm R 700 Holloway E Hughes 770964APJioenrseos nCJlaorhennceS G 708 Cdrtwright Chas B 710 (720) Hightower Richd A 713AWyche Ben.i F 716 Couch Ei L 720 Hightower R A 804 Munsch Annie MWrosmack intersects 880065AVHaucbabnatrd Lucy I Mrs 80 Vacant 881009AHivoewyarEdrnHesatrrNy L 812 Vacant 813ALavender Minnie L Mrs 814 (812)ALiles Wiley W 815 Vacant 850 Maddox Asa 931 Avery Chas (c) Fort Hill intersects 933 Cullens Wm (c) Smith i*nte*rse*cts Maynard i*nte*rse*cts 1100 East Side MemoriaNl oIrnrisstiitnutteirosneaclts Baptist Church (c) 11011 (801) Edmond Tut (c) 1103 Taylor Hattie (c) 1105 (805) Vacant 1107 (807) Finney Frank (c) 11113 (222) McCarthy Chas (c) 1115 (221) Sanford Thos (c) 1119 Peoples Aaron (c) 1149 (349) Lyles Duke (c) 1151 (811) Keaton Arkie (c) 1200 (1100) StClair Eug S(hco)rt intersects 1202 Cullens Linnie (c) 1201 (339) Vacant 1206 (402) Stallworth Bradwell G Rev (c) 1210 "Whitehead' Anthony (c) 11221110 ((131206)) BPootoekaetre LWeem (c()c) 1212 (327) Stevens Napoleon (c) 1213 (175) Williams Ida M (c) 1214 (1132) Wilder D Walker (c) 1215 (1123) Calhoun Walter (c) ,1,,3,,01 (,123) Hill Ben.i B(co)wman intersects .1,,301,, (,514) Wimberly GGleilnfonradv (icn)tersects 1305 Vacant WOOTEN HEIGHTS--A suburb south of city just beyond limits WORSHAM AV (Lynmore Estates) -- South from Gantt City rd to Wise Crossing, 4 blks east of 4012 Houston rd 56AKeen Jas W 369 Vacant WRIGHT AL--North from 23 Spring % block 27 Bunkley Mary (c) WYCHE (South Macon)--From 2166 2d east 108 Briscoe Agnes (c) 111 Wilder John T (c) ' 112 Brown Jos (c) 114 Ringwood Lee (c) 117 Wilder Mamie (c) 124 Atkins Thos (c) 127 Vacant WYCHE'S AL--From Second to Cedar, bet Giles and Jenkins 2115 Vacant 2116 Knight Edith (c) 2117 Mack Edw (e) 2118 McCy Sampson (c) 2119 Thomas Wm (c) YATES AL--A continuation ,of Yates av 203 Card Booker (c) 205 Stone Frank (c) 209 (258) Vacant 212 Hanks Roberta (c) 214 Gray Annie M (c) 216 (213) Middlebrooks Mattie (c) YATES AV (East Macon)--From Emerald to Powell, 1 north of Flanders 96 (95) Leslie Lena R Mrs 101 Shelton Needham 102 Boatwright Jennie 104 Cross Henry C 105 Carroll Henry C 108 Asbell Walter W Grant intersects 109 Pruett Ira A 110 DeFore Danl 111 Peeler F Royal AHudson Ben.i 112 Carr Robt I 113 Vacant 114 Waters Oswell 115 Vacant 116 Hornsby Paul 117 Byrd Hiram V 118 Cook Clarence L 119 Stephens Prentice Center begins 120 Sharp Geo B 122 Lavender Ida 123 Carr Arth 125 Stephan Laura E Mrs 126 Foster Henry 128 Vacant 1132091 AVBarcisaenntdine Jas J CLASSIFIED BUYERS' GUIDE OF THE CITY OF MACON (GEORGIA) 193 7 The Buyers'Guide contains the advertisements and business cards of the more progressive business men and firms in the city classified according to lines of business R. L. POLK & CO., Publishers BIRMINGHAM, ALABAMA 2 AUTOMOBILE SERVICE STATIONS (1937) K. L, POLK & CO.'S AUTOMOBILES 3 YATES MOTOR CO. DISTRIBUTORS OF DeSoto and Plymouth Automobiles SALES AND SERVICE BARGAINS IN USED CARS 707 THIRD ST. Telephones 1445 1446 Dunlap Chevrolet Co. 620 3d St. SALES - USED CARS - SERVICE Macon, Ga. Phone 2297 Huckabee Auto Company Cadillac - LaSalle - Buick - Pontiac GMC Trucks Third Street at Pine MACON CITY DIRECTORY (1937) Phone 5100 4 R. A. McCORD, Pres. AUTOMOBILES H. PINK PERSONS, Sec.-Treas. R. A. McCORD, Jr., V.-Pres. R. A. McCORD MOTOR CO. Authorized Dealer Macon I 215-221 2d St. Fords -- Lincolns TRUCKS SALES--SERVICE--PARTS LINCOLN Tel. 11 (1937) K. L. POLK & CO.'S BANKERS AND SECURITY DEALERS 5 COURTS & CO. INVESTMENT SECURITIES CORPORATION, GOVERNMENT AND MUNICIPAL BONDS, STOCKS We Specialize in Atlanta Bank Stocks and other local securities. We maintain a Statistical Department and will be glad to supply information regarding securities at any time. Members New York: Stock Exchange Members Chicago Board of Trade Members New York Cotton Exchange Associate Members New York Curb Exchange 405 Ga. Casualty Bldg. Phone 1681 BANKS This Is Macon'S Bank Part of an institution which is one of the three largest banks in all the South, the Citizens & Southern National offers Macon individuals and business houses service whose viewpoint is strictly local, but whose scope is the result of statewide operation. Citizens & Southern National Bank ATHENS MACON ATLANTA SAVANNAH AUGUSTA VALDOSTA POLK'S BANKERS ENCYCLOPEDIA The Bank Directory of the World Contains lists of banks with bank statements, bank officers, bank directors, stock exchange members, investment dealers and other general information in connection with banking and finance. Issued in March and September at $15.00 per volume R. L. Polk & Co., Publishers 431 Howard St., Detroit, Mich. 354 Fourth Ave., New York MACON CITY lilKKCTOHY (1937) 6 BANKS THE FIRST NATIONAL BANK & TRUST COMPANY IN MACON Complete Banking Service Trust Department Acting in All Fiduciary Capacities CAPITAL $500,000.00 SURPLUS $115,000.00 WM. G. LEE, Chairman of the Board M. H. LILES, President JAS. K. HOGAN, Executive Vice-President H. P. FLEMING, Cashier C. E. NEWTON1, Jr., Vice-President and Trust Officer W. G. COBB E. S. LEE Assistant Cashiers JAMES W. OLIVER, Assistant Trust Officer Member of Trust Company of Georgia Associates Federal Reserve System Federal Deposit Insurance Corporation (1937) R. L. POLK & CO.'S BANKS 7 MACON CITY DIRECTORY (1937) 8 BROKERS PERSONAL SERVICE WHEN YOU NEED IT MOST M-O-N-E-Y For Salaried People With Steady Positions MACON TRADING & INVESTMENT CO. Phone 3368 220 Georgia Casualty Bldg. BUILDING MATERIALS AND SUPPLIES Roofing: Compositions and Asbestos Building Specialties THE DUNLAP ROOFING CO. 266 5th St. Contractors' and Dealers' Builders Supplies MIXED CARLOADS A SPECIALTY Office and Warehouse Macon, Ga. Phone 1400 (1937) K. L. POLK & CO.'S BUILDING MATERIALS AND SUPPLIES 9 McNAIR LUMBER & SUPPLY CO. Lime - Plaster - Cement - Metal Lath Wall Board - Waterproofing Materials CELOTEX Insulating Lumber 262 5th St. Phone 5200 BUILDING AND LOAN ASSOCIATIONS MACON FEDERAL SAVINGS & LOAN ASSOCIATION OFFICERS DIRECTORS J. D. CHUMP President P. T. ANDERSON T. E. BILLINGS H. X. MITOHELL ARTHUR P. NEWTON C. C. HARROLD Vice-President BRUCE C. JONES Vice-President P. T. ANDERSON Secretary and Treasurer W. H. WATSON Assistant Sec. and Treas. J. D. CRUMP G. G. HARDEMAN DR. C. C. HARROLD J. MILTON HEARD BRUCE C. JONES MORRIS MICHAEL JAMES H. PORTER OHAS. K. SMALLING EDEN TAYLOR, JR. W. ,H. WATSON WM. T. WOOD JONES, JOHNSTON, RUSSELL & SPARKS, Attorneys Safest Investment on Earth PHONE 5036 MACON CITY DIRECTORY (1937) 417 BROADWAY 10 BUSINESS COLLEGES R. L. WILSON, President J. A. KNOTT, Vice-Pres. and Secy. 567 Mulberry "G. A. B. Students Succeed" Macon, Georgia CABINET MAKERS Tel. 621 MUECKE & SONS CO. Cabinet Makers and Manufacturers Service Satisfaction STORE FIXTURES SHOW CASES FINE UPHOLSTERING FURNITURE REPAIRING ANTIQUE FURNITURE AND REPRODUCTIONS 614 New Phone 636 CEMETERIES MACON MEMORIAL PARK A Garden of Memories Non-Monumental ---Non-Sectarian Location of Park Columbus Road U. S. Highway 80 Office 153 Cotton Ave. Phone 2666 (1987) OR. L. POLK & CO.'S CLOTHING R. S. THORPE & SONS Next to Hotel Dempsey, Cherry Street Everything for Men and Boys Ladies' and Children's Sanitary Hair Cutting and Beauty Parlor on Second Floor 515-17 Cherry Phones 159-761-314 COAL DEALERS QUALITY COAL COKE and WOOD WHOLESALE AND RETAIL B. F. Merritt Goal Company First and Ash Phone 4977 CREDIT REPORTS AND COLLECTIONS Macon Credit Bureau Publishers of Credit Reference Book Dependable Credit Reports Collections and Adjustments 316 Georgia Casualty Bldg. Tels. 881-882-883 DEPARTMENT STORES The World's Largest Store -- And an Open Door to its Savings Right Here at Home-- Sears, Roebuck and Co. THIRD STREET MACON, GEORGIA MACON CITY DIRECTORY (1937) 12 DEPARTMENT STORES DANNENBERG'S Macon's Foremost Department Store PHONE 6400 Men's Clothing Men's Furnishings Boys' Wear Footwear Shoes Drugs Toilet Goods Hosiery MAIN FLOOR Art Goods Optical Dept. Umbrellas Patterns Gloves Handbags Underwear Chinaware Jewelry Stationery Silverware Electrical Dept. Yard Goods Domestics Cafeteria Glassware SECOND FLOOR Women's Coats Women's Dresses Women's Furs Corsets Cotton Dress Shop Beauty Shop Millinery Children's Wear Infants' Dept. Furniture Draperies and Rugs Rest Room Curtains Window Shades Interior Decorating Linoleum Luggage Refrigerators THIRD FLOOR Art Portrait Studios General Offices Furniture Department BARGAIN BASEMENT Tires Auto Accessories Shoe Repairing Men's and Boys' Wear Millinery Electric Washers Receiving Room Delivery Dept. Women's Coats and Dresses Underwear and Corsets Electric Cleaners Hosiery Yard Goods Shoes Hardware Housewares (1937) K. L. POLK & CO.'S FLOORS 13 Southern Flooring Co. Floor Contractors VENETIAN BLINDS We Contract For HARDWOOD, ASPHALT CORK AND RUBBER TILE FLOORS We Specialize in Refinishing Floors Estimates Free--Work Anywhere in Georgia "No Job Too Large or Too Small 616 POPLAR ST. TFJl. 5695 FLORISTS un&yjcuterf; Idle Hour Nurseries 109 Cotton Ave. South's Leading Florists Telephone 224 FOOD MARKETS MULBERRY MARKET "Everything Good To Eat" WHOLESALE AND RETAIL 418-22 Mulberry MACON CITY DIRECTORY (1937) Tel. 4181 14 FUNERAL DIRECTORS BURGHARD-CONNALLY R. COKE CONNALLY FUNERAL DIRECTORS Efficient -- Courteous -- Prompt 24-Hour Ambulance Service 718 CHERRY STREET TELEPHONE 1627 "SERVICE" A Service Institution which has connections in all principal cities, Can take complete charge anywhere. Extra Service at no extra cost. HART'S MORTUARY Efficient -- Reasonable -- Dependable AIR CONDITIONED--STEAM HEATED 755 CHERRY ST. PHONE 161 PITTS' MORTUARY PHONES 146-147 AMBULANCE SERVICE 814 MULBERRY (19'3'7) R. L. POLK & CO.'S FUNERAL DIRECTORS--COLORED 15 R. E. HARTLEY, Manager Prompt Attention Given All Orders Carriages Furnished for Any Occasion Central City Funeral Home PHONE 57 NIGHT PHONE 1156-W 530 Cotton Ave. Open Day and Night Day PHONE 2044 NIGHT PHONES 2044, 3439 and 3728 HUTCHINGS' FUNERAL HOME "Hutchings' Service" 518 NEW ST. Funeral Directors MACON, GA. FURNITURE Maxwell Bros. Furniture Co. FURNITURE and RADIOS 455-57 SECOND ST. PHONE 4401 MACON, GA. Your Home Should Come First In Macon It's A. G. RHODES & SON Complete House Furnishers 359 Second St. through to 160 Cotton Ave. Tels. 337 and 338 MACON CITY DIRECTORY (1937) 16 FURNITURE "A Safe Place to Trade" STERCHI'S The South s Largest Home Furnishers S. W. Cor. Cherry and Broadway Phone 3100 E. B. DURHAM, Pres. K. P. ALLEN, Treas. I. D. GREENE, Sec. WOOD-PEAVY FURNITURE CO. Macon s Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 HARDWARE " DUNLAP-PEELER HDWE. CO. WHOLESALE RETAIL Paints Sporting Goods Electrical Supplies Builders' Farm and Household Supplies Broadway and Cherry Sts. Tels. 26-27-634-635 HOTELS ARLINGTON HOTEL V 5 Broadway, Near Poplar * Modern and Reasonable Rates "A GOOD PLACE TO SLEEP" Free Storage VVisi..t. TTkhe Onlud S<=outhL Mn* useum--,,Rear of Lobby THOMAS pOro. pMOSELEY (1937) ;R. L. POLK & CO.'S HOTELS 1 7 CENTRAL HOTEL 125 Rooms from $1.25 Comfort, Convenience, Courtesy On U. S. Highways 41-80-129 BROADWAY AT MULBERRY TEL. 1961-1962 HOTEL LANIER EXCELLENT CAFE Comfort at Reasonable Rates 525 MULBERRY ST. TEL. 2771 HOTEL MACON The Friendly Hotel TOURIST AND COMMERCIAL MODERATE RATES Mulberry at Broadway Tel SOUTHLAND HOTEL MACON'S NEWEST HOTEL 100 ROOMS ALL OUTSIDE TUB AND SHOWER BATHS EXCELLENT COFFEE SHOP OTIS M. TARVER, Prop. 569-571 Broadway Telephone 3047 MACON CITY DIRECTORY (1937) 18 INSURANCE JOHN E. WILSON & SON INSURANCE To Fit Every Need Fire Life Accident Health Group Plate Glass Elevator Surety Bonds Automobile Liability Compensation Steam Boiler Burglary Explosion Floater Tornado Rain Hail Rents Profits Aircraft Use and Occupancy 702-703 BIBB BUILDING PHONE 214 (1937) B. L. POLK & CO.'S INSURANCE 19 E. H. STRICKLAND & COMPANY Insurance With a Savings Fire Tornado--Burglary--Full Coverage Auto Insurance Complete Facilities for Every Kind of Insurance at a Savings Under Dividend Paying Policies. Second Floor Georgia Casualty Bldg. PHONE 236 The Co-Operative Fire Insurance Company of the State of Georgia HOME OFFICE 508 MULBERRY ST. MACON, GA. CHARTEREO Fire Insurance 1.0 7 Tornado Insurance Plate Glass Insurance Automobile Insurance THE EQUITABLE LIFE ASSURANCE SOCIETY OF THE U. S. MACON STAFF W. H. MARQUESS, Jr., Dist. Mgr. EDWIN R. HOVEY WM. E. PENDLETON, Rep. LOUIE A. SHIRLEY, Home Purchase Agt. 409-412 Grand Bldg. MACON CITY DIRECTORY (1937) Phone 4305 20 INSURANCE EDWARD B. HARROLD General Insurance Fire -- Automobile -- Surety Bonds Workmen's Compensation CO. 461 NNTIGf HHTT *( jEdwR. SBc. aHndarrertotld2136031-9W 321 FIRST NATIONAL BANK BLDG. THE PENN MUTUAL LIFE INSURANCE COMPANY (Of Philadelphia) ORGANIZED 1847 Ofne of the oldest and largest life insurance organizations. Purely Mutual. Rendering unsurpassed service at actual cost. The more one knows of life insurance the better one likes The Penn Mutual. D. LEON WILSON Associate Gen'I Agent g. E. PAINE General Agent 306-07-08 Grand Bldg. SOUND INSURANCE + OUR PERSONAL SERVICE = YOUR SAFETY WM. WORTH WILLIAMS WM. WORTH WILLIAMS, JR. WM. WORTH WILLIAMS INSURANCE AGENCY LIFE -- ACCIDENT -- CASUALTY -- AUTOMOBILE FIRE AND MARINE INSURANCE 310-311 FIRST NATIONAL BANK BUILDING TELEPHONE 64 INVESTMENTS " Logan Lewis & Co. Investment Securities Georgia Casualty Bldg. Tel. 738 (1937) as. L. POLK & CO.'S JEWELERS 21 Friedman's Jewelers c c It's Easy To Pay The Friedman Way R DIAMONDS WATCHES A JEWELRY SILVERWARE E G. E. RADIOS D S --COMPLETE OPTICAL SERVICE-- H 566 Cherry St. Eyes Tested--Glasses Fitted Expert Watch and Jewelry Repairing Macon, Ga. I Phone 6344 T LAUNDRIES "ESTABLISHED 1900" CRESCENT LAUNDRY CO. "Known for Quality Work" LAUNDERERS DRY CLEANERS and DYERS Phone 16 Don't Use an Old Directory! One Address taken from an old Directory may send you miles out of the way and waste a whole day's time. You take pride in keeping a fresh stock of merchandise on your shelves-- Why not avail yourself of fresh information for your daily use ? MACON CITY DIRECTORY (1937) 22 LAUNDRIES 20% Discount--Cash and Carry INDEPENDENT LAUNDRY CO. Dry Cleaning and Dyeing Rug Cleaning Pleating Family Finished and Thrift-y Wash PHONES 1000-1001-1002 INDEPENDENT LINEN SERVICE A Complete Rental Service of Linen and Towels--Coats--Vests--Caps--Bib and Waist Aprons Uniforms, Barber Towels, Etc. 452 SECOND ST. PHONES 1000-1001-1002 Snow's Laundry and Dry Cleaning Co. Licensed "SANITONE" Cleaner "Clean With Snow" Poplar and New Sts. Phone 6000 (1937) K. L. POLK & CO.'S LOANS 23 BIBB BROKERAGE CORP. 207 BIBB BLDG. Financial Service $5 to $50.00 NO COLLATERAL NO INDORSEMENTS PHONE 995 COMITY SAVINGS & LOAN CO. 201 Cotton Ave. LOANS W. H. DAVENPORT, JR., Mgr. Tel. 6 FINANCE SERVICE OF MACON, Inc. EMORY C. SMITH, President "A Complete Loan Service" AUTOMOBILES FURNITURE ON SINGLE SIGNATURE ENDORSEMENT 413 First National Bank Bldg. Phone 366 T M. WILLINGHAM, Pres. A. R. WILLINGHAM, V.-Pres. LUMBER AR.. JR.. CWAIRLMLIINCGHHAAELM,, TJrre.,as.Sec. Central Sash & Door Company DuPont Paints, Lime, Plaster, Cement, Roofing Hardwood Flooring, Interior Trim, Cedar Lining, Mantels MANUFACTURERS Sash, Doors, Millwork, Lumber OFFICE AND STORE: 354 SECOND ST. PHONE 3011 FACTORY: WATERVILLE ROAD PHONE 5011 MACON CITY DIRECTORY (1937) 24 LUMBER WILLINGHAM SASH & DOOR COMPANY Manufacturers--Wholesale--Retail Yellow Pine Sash, Doors, Blinds, Mouldings Rough and Dressed Lumber Glass Paint Roofing -- Lime -- Plaster Store and Sales Office 457 3d St. Phones 277-278-279 Factory and Lumber Yard Seventh and Cherry Sts. Phones 157-158 MACHINISTS TAYLOR IRON WORKS & SUPPLY CO, MACHINE SHOPS, FOUNDRY, BOILER WORKS PUMPS, BELTING, VALVES, PIPE ENGINES, BOILERS, SAW MILLS HIGH GRADE MACHINERY and MILL SUPPLIES Estimates on Iron and Steel Work Furnished Broadway and Oglethorpe Streets Long Distance Telephone 102 MAILING LISTS Accurate Mailing Lists Any Business--Any Locality R. L. POLK & COMPANY, Publishers BIRMINGHAM, ALA. PAINTS ` "Don't Put It Off - Put It On" P aints--Brushes--V arnishes Stains--Kalsomine--Glass FOR PROMPT EFFICIENT SERVICE CALL SOUTHERN PAINT & VARNISH COMPANY "The Home of Southern Beauty & Dixie Queen" Manufacturers of Paints and Varnishes, Stains Wholesale and Retail Phone 2276 Macon, Ga. 561 Mulberry St. (1937) R. L. POiLK & CO.'S WHOLESALE PAINTS AND OILS FACTORY DISTRIBUTORS 25 RETAIL SCHALL PAINT CO., Inc. Paints Varnishes Oil Wall Paper Brushes Decorators' Supplies 307 MULBERRY ST. PHONE: 326 QUALITY SERVICE COURTESY Jarrett Paint & Glass Company v Home of 320 Third Street Macon, Georgia Telephones 2200-2201 PAINTS -- VARNISHES -- OILS -- BRUSHES -- WINDOW GLASS -- PLATE GLASS AUTO GLASS -- WALL PAPER -- MASONITE INSULATION AND PRESDWOOD PICTURE FRAMING -- ARTIST SUPPLIES MACON CITY DIRECTORY (1937) IIiT*iICS'DTTHIHREEvTCCrhTOneOuMRuMYAO*iNi1* INTERMEDIARY BETWEEN . r BUYER^SELLER" 26 PLUMBERS PLUMBING AND HEATING CONTRACTORS Steam, Hot Water and Warm Air Heating Systems Plumbing, Repair Work Given Special Attention DEALERS AIR CONDITIONING GAS AND ELECTRIC WATER HEATERS 107 Cotton Ave. Phone 3176 "We Do It Right" (1937) E. L. POLK & CO.'S A. B. LEE, Sr. PLUMBING AND HEATING 27 A- B- LEE' Jr- A. B. LEE PLUMBING & HEATING CO. Steam, Hot Water and Warm Air Heating Systems Repair Work Given Special Attention Air Conditioning 258 2d, Opp. Court House PRINTERS Tel. 2851 ptbfj printing Company Commercial Printers 518 FIRST STREET TELEPHONE 1671 PRINTING -- BOOKBINDING -- RUBBER STAMPS The Largest and Best Establishment in this Section is THE J. W. BURKE COMPANY 406 CHERRY STREET Equipped with Improved Typesetting Machines and Automatic Presses We are prepared to handle promptly and satisfactorily any kind of work in our line DIRECT ADVERTISING A SPECIALTY SATISFACTION OUR GUARANTY CHARLES S. JONES CHARLES L. CONEY JONES & CONEY COMMERCIAL PRINTERS Telephone 3087 411 BROADWAY BOOK AND JOB WORK MACON, GA. MACON CITY DIRECTORY (.1937) 28 REAL ESTATE A. T. Holt Co. REALTORS PERSONAL SERVICE Real Estate and Renting Agents Also Specialize in Sales and Leases on All Classes of Property 569 MULBERRY ST. TELEPHONES 946-947 MURPHEY, TAYLOR & ELLIS, Inc. REALTORS REAL ESTATE RENTAL AGENTS COMMERCIAL LEASES SURETY BONDS Insurance--All Lines Cherry and Third Sts. Phones 267 and 268 (1937) E. L. POLK & CO.'S 29 REAL ESTATE "WE SPECIALIZE" ESTABLISHED 1912 Dessau Realty & Insurance Co. REALTORS REAL ESTATE, RENTING AND INSURANCE 101 Georgia Casualty Bldg. Macon, Ga. Phones 271-272-273 ROBERT 0. THOMAS REALTOR Real Estate -- Sales and Rentals 569y2 Cherry Tel. 1067 RENTAL AGENTS ROBERTSON-WALKER, INC. REAL ESTATE SALES AND RENTALS GENERAL INSURANCE MORTGAGE LOANS F. H. A. Low Interest -- Long Terms First Natl. Bank Bldg. Tel. 35 ROOFERS PHONE 3121 Roofing Contractors and Distributors WE DO WORK ANYWHERE IN GEORGIA EVERLOX SHINGLES Terms--3 Years to Pay Georgia Roofing & Supply Co 306 OGLETHORPE ST. ALBERT E. SHERIDAN. Mgr. MACON, GEORGIA MACON CITY DIRECTORY (1937) 30 SHEET METAL WORKERS (1937) R. X,. I'OLK & CO.'iS TRANSFER COMPANIES 31 MOVING SPECIALISTS IN FURNITURE MOVING PACKING and CRATING Special Rates on Shipments of Furniture to Out of Town Points WE INVITE YOU TO INSPECT OUR FACILITIES FOR SERVING YOU MACON TRANSFER COMPANY PHONE 304 MACON TRANSFER CO. and FURNITURE EXCHANGE New and Used Furniture Dealers 408 BROADWAY OIACON CITY DIRECTORY (1937) TELEPHONE 304 32; TRANSFER COMPANIES MOVING STORAGE Shipments to All Points OUR MOTTO IS SERVICE PACKING AND CRATING Special Rates on Furniture We Pride Ourselves on Being One of the Most Competent Transfer Companies in Macon TAYLOR TRANSFER CO. 458 PLUM STREET PHONE 388 (1937) It. L. POLK & CO.'S TRANSFER COMPANIES 33 WASHBURN STORAGE CO. Storage of All Kinds Macon's Only Interstate Household Movers Local and Long Distance Hauling "When in doubt, play trumps" How many times have you heard that trite statement ? When in doubt about the location of an address; the proper spelling of a name; a correct address; in fact anything pertaining to your city or any other, the CITY DIRECTORY is your trump card. R. L. POLK & COMPANY PUBLISHERS .MACON CITY riTRKCTORV H037I 34 When You Want to Know: --where a person lives. --what his occupation is. --who lives at a certain number on a street. --where a street is located. --the correct spelling of a name. --the officers of a corporation. --the partners in a firm. --the solution to any of scores of prob- lems that pop up unexpectedly to annoy and baffle you. --you can quickly find th answer in the City Directory. (1937) R. L. POLK & CO.'S MILLIRONS PLUMBING & HEATING CO. Plumbing, Heating and Air Conditioning 107 COTTON AVE. PHONE 3176 POLK'S MACON Classified Business Directory 1937 INCLUDING Associations and Clubs--Commercial Buildings--Office and P^lic, Cemeteries, Churches. Clergymen, Clubs. Hospitals and Dispensaries, Labor Orga*u_ tions, Libraries, Parks and Playgrounds, Savings and Loan Ass^`\"3'' SchooU Public, Schools, Colleges and Academies, Social Settlements and Societies. Copyright, 1937, by R. L. Polk & Co. Names appearing under headings marked thus (*) are inserted only when specially contracted for. `Accountants--Certified Public GEOGHEGAN & NORRIS, 505 Happ Bldg 150 Cotton av, Tel 6266 Accountants and Auditors Baggs L D & Co 308 2d DMaclPyerJroins JKas61M7 M40u3lbCerhreyrryR31R1604 Adding, CalcuMlaaticnhgineasnd Tabulating Underwood Elliott Fisher Co 557 Mul- berry `Addressing and Mailing POLK R L & CO, Martin Bldg, Birming- ham, Ala Adjusters Fire Companies Adjustment Bureau Inc Mu51r6pheMyulObteirsryA RC1o00I1nc (ms) 403 Cher- ry R601 `Administrators LEE A B PLUMBING & HEATING CO, 258 2d Opp Court House, Tel 2851 (For further information see left top lines SCaHndWApRagTeZ 2&7 PBHuyAeUrsL' IGNuCid, e5)14 Plum, Tel 340 (For further information see back cover and page 30 Buyers' Guide) Airports Miller Field 4 mi ne of City on Miller Field rd Ambulance Service BURGHARD-CONNALLY, 718 Cherry, Tfreoln1t6c2o7ve(rFaonr dfupratgheer14inBfuoyremrsa'tiGonuidsee)e HART'S MORTUARY, 755 Cherry, Tel 161 (For further information see right top lines and page 14 Buyers' Guide) Amusements--Places of Riverside Arena 615 Ocmulgee Animal Hospitals--Small Animals Pineville Dog and Cat Hospital 646 Washington av FIRST NATIONAL BANK & TRUST CO IN MACON, Cherry cor 2d, Tel 2b8a3c4kbo(nFeo,rba'cfkurcthoevrer iannfdorpmaagteio6nBusyeeers' Guide) Advertising Agencies Packer Advertising Corp 452 Plum Advertising Novelties Greater Foster Advertising Service 115 Academy Agricultural ImpDleemaleenrst and Machinery McCormick Deering Store International Harvester Co 760 3d Aericultural MImapnluefmacetnutrearnsd Machinery Cropper R C Co Mulberry se cor 7th `Air Conditioning GEORGIA POWER CO, 179 Cotton av, Tel 4100 (For further information see inside front cover) Apartment Buildings Albion 920 College) BBaarrnnwesell35S6 qNuaerwe 119-21 Birch (NHts). Belmont 615 Walnut Biltmore 811 Poplar Block 810 Mulberry Capitol Hotel 560 Plum Cherrydale 818 Cherry Clemont (c) 602 3d av (V) College Hill 476 College Colonade 263 Georgia av CElolliosonniailan524078OCraonlgleege Ellisonian Annex The 222 Magnolia Forsyth Terrace 579 Orange FGreeodrogniaian 281133 BPoonpdlar Georgian Terrace 261 Georgia av Highland 901-07 Orange Holt 321 New Jefferson 605 Orange Jordan 613 Orange Katherine Court 855 Mulberry Lafayette Terrace The 305 College Laurine 559 Orange YOUR CITY D I R E C T O R Y MIRRORS the SOCIAL Life Of Your CITY 546 V O O o z < i 3 ,,o g sQ(5 d 68 v a V) OS z 00 a o V MORE GOODS -arebought --AND-- SOLD THROUGH THE Classified Business Directory THAN BY Any flther Medium on Earth YATES MOTOR CO. 707 THIRD ST. Apartment Buildings--Contd Linden 316 Linden av Marshall 232 High Massee 401-05 College Maynard 1109 Washington av Naperian The 307 Napier av Nevarro 533-47 Orange Newman 853 Cherry Palisades 571 Orange Park View 105 Park pi Siesel 563 College Spring Street 163 Spring Sloan 296 College Tatnall 930 College Terrace 864 Mulberry Vineville Court 99 Vineville av Walnut 915 Walnut Washington 475-79 Orange Willow 233 Bond Aprons and Uniforms INDEPENDENT LINEN SERVICE, 452 2d, Tels 1000-1001-1002 (For further information see right side lines and page 22 Buyers' Guide) Architects Behr Henry J 357% Cherry Dennis & Dennis 556 Mulberry Dunwody W Elliott jr 460 Broadwav League Ellamae E Mrs 617 Mulberry R Macon HussarsA(rAmromrioersy) 617% Poplar Macon Volunteers Armory 468 1st Art Goods and Bric-a-Brac (See also Gift Shops) Davis Studio The 506 Orange Vigal ElizA7rt1i6sts--MuClobmermryercial Artists' Materials and Supplies JARRETT PAINT & GLASS CO, 320 3d, Tels 2200-2201 (For further information see right side lines and page 25 Buyers' Guide) DUNLAP R*AOsObeFsItNosG--CShOingTlHesE, 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) *Asphalt Floors SOUTHERN FLOORING CO, 616 Pop- lar, Tel 5695 (For further information see left side lines and page 13 Buyers' Guide) Associations and Clubs--Commercial Georgia Better Business Assn Inc 506 Orange Georgia Peach Growers Exchange 409 2d R318 Georgia Retail Lumber & Building Supply Assn 1105 Cotton av R5-6 Macon Bar Association Court House MACON CHAMBER OF COMMERCE, Cherry nw cor 1st (Municipal Auditorium), Tel 1767 (For further information see page Y) Macon Community Chest 516 Mulberry R218 Macon Junior Chamber of Commerce 308 2d Macon Production Credit Assn 417 Broadway National Pecan Marketing Assn 100 Mulberry Southeastern Underwriters Assn (eng dept) 403 Cherry R313 Young Men's Christian Assn 371 1st Young Women's Christian Assn 45)3% Cherry residence 763 2d *Attorneys-at-Law See Lawyers PHONES {U45 Automobile Accessories--Firestone FIRESTONE AUTO SUPPLY & SERV- ICE STORES, 667-6731 Mulberry cor 1st, Tels 116-117 Automobile Accessories and Parts-- Retail Bailey Auto Parts 621 3d Bearings Supply Co 651 3d Economy Auto Stores Inc 420 2d Goodrich Silvertown Stores 301 1st Heard Jacob F 610 Broadway Levine Tire & Parts Service 100 5th McCord Used Auto Parts 667 Broadway MOTOR PARTS CORP, 619 3d, Tels 4800- 4801 (For further information see right top lines and page 4 Buyers' Guide) SEARS, ROEBUCK & CO, 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) Standard Parts Co 702 3d Automobile Accessories and Parts-- Wholesale and Retail HATCHER A S CO, 596-98 3d, Tels 106- 307 MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) Automobile Body Manufacturers Stroberg Body & Fender Works 403 Mul- berry Automobile Dealers--Passenger Cars ADAMS-BUCHANAN MOTOR CO, 716- 720' Broadway, Tels 3497-6277 ADAMS D H MOTOR CO, 655-657 3d, Tel 2997 (For further information see left side lines and page 2 Buyers' Guide) Brant Motors 521 3d DUNLAP CHEVROLET CO, 620 3d, Tels 2297-2298-2299 (For further information see right side lines and page 3 Buyers' Guide) HUCKABEE AUTO CO, 652-690 3d at Pine, Tel 5100 (For further information see left top lines and page '3 Buyeys' Guide) McCORD R A MOTOR CO, 215-221 2d, Tel 11 (For further information see left top lines and page 4 Buyers' Guide) SOLOMON STEVE M JR, 462 Broadway, Tels 4956 and 4957 (For further information see right side lines and page 4 Buyers' Guide) Sparks Motor Co 613 3d YATES MOTOR CO, 707 3d and 510 Pine, Tels 1445-1446 (For further information see left top lines and page 3 Buyers' Guide) Automobile Dealers--Second Hand ADAMS D H MOTOR CO, 655-657 3d, Tel 2997 (For further information see left side lines and page 2 Buyers' Guide) Automobile Dealers--Used Cars Cone W L Auto Co 710 3d Jones Wm H 689 3d Macon Auto Exchange 362 1st Stubbs Used Car Exchange 411 Poplar Young Bob Used Car Exchange 451 1st Automobile Equipment Dealers MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) 547 WILLIN _ _ GHAM mm SA^SHA.& ' DOOR CO. Lime - Roofing -- Cement -- Plaster 457 Third St. Phones 277-278-279 Automobile Garages BCoHyAePttMe'As NS'tSoragGeAGRAarGagEe, 541195-2-4119PoMpulal-r berry, Tel 2951 (For further informa- Automobile Washing McKENNEY & ADAMS SERVICE STA- TinIfOoNrm, a6t0io0n1sset,e Tpealge63246Bu(yFeorsr' fGuurtihdee)r tion see front cover, right side lmes and page 2 Buyers' Guide) City Storage Garage 517-19 Broadway Fried's Garage 352 Broadway HARRIS D C JR, 441-17 Poplar, Tel 66 Ideal Storage & Garage 256 2d Monk's Garage 618 Broadway Supreme Storage Garage 451 2d Automobile Laundries Automobile Wreckers Bibb Auto Wrecking Co 755 Broadway Clay Wrecking Co 1212 Broadway Automobiles DE SOTO-PLYMOUTH MOTOR CARS, Yates Motor Co Dealers, 707 3d and 5in1f0orPminaet,ioTneslsee 1l4e4f5t -t1o4p46lin(eFsoranfdurpthageer CHAPMAN'S GARAGE, 415-419 Mulberry, Tel 29511 (For further information see front cover, right side lines and page 2 Buyers' Guide) Nutting Sarah C Mrs 210 3d Automobile Owner Lists POLK R L & CO, Martin Bldg, Birmingham, Ala Automobile Parking DODGE^BROTHERS MOTOR CARS-- PLYMOUTH CARS, 462 Broadway, Tels 4956 and 4957 (For further infor- mation see right side lines and page 4 Buyers' Guide) ,, , DUNLAP CHEVROLET CO, 620 3d, Tels 2297-2298-2299 (For further informa- tion see right side lines and page 3 Buyers' Guide) ,, ,,, , HUCKABEE AUTO CO, 652-690 3d at CHAPMAN'S GARAGE, 415-419 Mul- Pine Tel 5100 (For further informa- berry, Tel 2951 (For further informa- tion'see left top lines and page 3 tion see front cover, right side lmes Buyers' Guide) __ ,, , _, _ and page 2 Buyers' Guide) PACKARD MOTOR CARS, Packard Ma- Automobile Parts MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information con Co Dealers, 707 3d and 510 Pme, Tel 4871 (For further information see left top lines and page 3 Buyers see right top lines and page 4 Buyers Guide) PLYMOUTH MOTOR CARS, Yates Motor Co Dealers, 707 3d and 510 Pme, Automobile Repairing Baldwin Wm L 2921 % Houston ay (SM) Tels 1445-1446 (For further information see left top lines and page 3 Buy- Bibb Body & Fender Works 454 Plum Boland J Lee 419 Pine Butler Wilman (c) 1801 Broadway Carburetor & Electric Service Inc 706 3d Carlisle Bros 2111 Vineville av (V) Cassidy Garage 409 Mulberry CHAPMAN'S GARAGE, 415-419 Mul- berry, Tel 2951 (For further information see front cover, right side lines and page 2 Buyers' Guide) Clay's Garage 611 Broadway ROBERTSFRANK, 711-715 3d Tel 595|1 STUDEBAKERS, D H Adams Motor Co Distributors, 655-657 3d, Tel 2997 (For further information see left side lmes and page 2 Buyers' Guide) Automobiles--Buick Motor Cars HUCKABEE AUTO CO, 652-690 3d at Pine Tel 5100 (For further information see left top lines and page 3 Buyers' Guide) Colbert Mfg Co 447 Pine Crittle Walter (c) 211 5th Davis John D 114 Whitehead (SM) Dennis Everett D (c) 640 Washington av Dudley Geo L (c) 1016 Main (EM) Automobiles--Cadillac Motor Cars HUCKABEE AUTO CO, 652-690 3d at Pine, Tel 5100 (For further information see left top lines and page 3 Buy- Edwards Wm F 901 3d ers' Guide) Evans Ernest E 553 Pine Evans J Cullen 444 Pine Automobiles--LaSalle Motor Cars Evans Murphy L 321 (17) Vine (NHts) HUCKABEE AUTO CO, 652-690 3d at Georgia Auto Co 517 Plum Pine, Tel 5100 (For further informa- Guarrafia Quinto _444 Pine tion see left top lines and page 3 Buy- Harper Henry G 3110 Houston av (SM) ers' Guide) Hartis Sami ' B 3019 Houston av (SM) Kacisk Frank 769 Broadway Automobiles--Pontiac Motor Cars Macon Fender & Body Shop 466 Plum McCallum Hubert B 444 Pine McFadden Richd A 2104 Vineville av (V) Morgan Oliver 3000 Houston av (SM) Pritchett Claudius P 444 Pine HUCKABEE AUTO CO, 652-690 3d at Pine, Tel 5100 (For further information see left top lines and page 3 Buyers' Guide) Sheffield M Carlton Post Office al Snipes Garage 617 Broadway Souther Robt L 811 Broadway Swann L Frank 403-05 Mulberry Tyler Bros Garage 215 3d Bag Manufacturers -- Canvas -- Burlap and Cotton Bibb Bag Co 472 Broadway Central City Bag Co 423 Plum United Auto Co 860 Broadway Willis Robt R 411 Poplar Bakers--Retail Atkins Andrew H 204 Forsyth Automobile Top Manufacturers Shadburn John D 438 Oglethorpe Automobile Trucks DODGE BROTHERS TRUCKS, 462 Broadway, Tels 4956 and 4957 (For further information see right side lines and page 4 Buyers' Guide) Atkins Leah M Mrs 128 Hardeman av COLLINS BAKING CO, 205 Cotton aV, Tel 4900 (For further information see left side lines and page 4 Buyers' Guide) Gill's Bakery 813 Vineville av (,V,T). Sunlite Electrik Bake Shop 466 2d Voellinger Willis E 309 Mikado av (SM) SOLOMON STEVE M JR, 462 Broadway, mTealtsio4n95s6eeanridgh4t95s7id(eFolirnefsuratnhderpiangfoer4Buyers' Guide) Bakers--Wholesale American Bakeries Co 451 Plum Atkins Bakery 414 2d Folk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 548 'tMot GO 03 W .s zId *.? sas, w 03 Cttdo6 *TCJeSJ J gH .Sv. 3 "b-2 tCO *n*w cwt*cc * Xu ICCDDD FINANCE SERVICE OF MACON EMORY C. SMITH, Manager ROOM 413, FIRST NATIONAL BANK BUILDING TELEPHONE 366 LOANS ARRANGED on Furniture Automobiles Endorsed Note Single Signature Rakers--Wholesale--Contd Ceanvtral Georgia Baking Co 216 Cotton COLLINS RAKING CO, 205 Cotton av, Tel 4900 (For further information see left side lines and page 4 Buyers' Guide) National Biscuit Co 555 5th *Bank Directories POLK'S BANKERS ENCYCLOPEDIA, 431 Howard, Detroit, Mich * Banks--National FIRST NATIONAL BANK & TRUST CO IN MACON, Cherry cor 2d, Tel 2834 (For further information see backbone, back cover and page 6 Buyers' Guide) WILLIAMS LUTHER & SON, 565 Mulberry, Tel 1586 (For further information see right top lines and page 7 Buyers' Guide) Stripling Robt G bsmt 471 3d Tatnall Square Barber Shop 607 Linden av Terminal Barber Shop Terminal Station Thompson Budrow (c) 246 Main (EM) Trevick Wm R 2120 Forsyth rd Vineville Barber Shop 820 Vineville av (V) Vitnoenvilalev Barber Shop (c) 638 WashingWatkins Barber Shop 400 2d Wellons Kenneth B 1917 Vineville av (V) Williams Henry W 2140 2d Barbers' Supplies Southland Barber Supply 566 Poplar *Bath Room Supplies MILLIRONS PLUMBING & HEATING CO, 107 Cotton av, Tel 3176 (For further information see right top lines and page 26 Buyers' Guide) Baths Class John F Vapopath 284 College Who Sells It? IS Answered By tiie Classified Business Lists in this Directory FIRST NAT*IBOaNnkAsL--SBaAvNinKgs & TRUST CO IN MACON, Cherry cor 2d, Tel 2834 (For further information see backbone, back cover and page 6 Buyers' Guide) Battery Dealers and Service FIRESTONE AUTO SUPPLY & SERV- ICE STORES, 667-673 Mulberry cor 1st MTanenls J1a1c6k-11B7 attery Co 669 3d Smith's Battery & Electric Co 654 Mul- berry Banks and Trust Companies Storage Battery Co The 570 2d CITIZENS & SOUTHERN NATIONAL BANK THE, 3d cor Cherry, Tel 4671 Battery Manufacturers (For further information see front cover and page 5 Buyers' Guide) City Bank & Trust Co 617 C'herrv Southeastern Battery Co Inc 757 Broadway FIRST NATIONAL BANK & TRUST Beauty Shop Equipment and Supplies 2C8O34 IN(FoMrACfOurNth, eCr heinrrfyormcoartio2nd, Tseeel Johnson Johnnie Beauty Supply Co 511 2d backbone, back cover and page 6 Buy- ers' Guide) Beauty Shops Macon Savings Bank 150 Cotton av R408 Artistic Beauty Shop 151 Cotton av Allen Ernest C B3a1r8b%ersDannenberg av Allen P Frank 202 (95) Holt av (NHts) Bailey lola (c) 413 Cotton av Bateman's Barber Shop 318 Broadway Bradley Clinton (c) 408 Poplar Braswell Jas A (c) 507 Broadway Braswell Willis Barber Shop 313 3d av Brewer Wm J 312 Main (EM) Brown's Barber Shop 315 Broadway Callaway John (c) 101 Cedar (U) Commercial Barber Shop 308 Cherry DuPree Barber Shop 510 2d Flynt's Barber Shop 404 Cherry Genone's Barber & Beauty Shop 568 Mulberry Giles Foster (c) 205 % 5th Harrison O Homer 426 Main (EM) Hatfield Geo W jr (c) 313 Broadway Hawkins Wm W 2004 2d Betty's Beauty Shop 127 Lawton av College Beauty Salon 451 College Coyle Cula Mrs 520 Washington av Curley Top Beauty Shop 605 Cherry DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) Davis Ethel B Beauty Shop 514 Mulberry Freeman Robt S 502 Walnut Elmore Pauline T Mrs 204 Park (I) Godwin's Beauty Shop 352% 2d Josef's Permanent Wave & Beauty Salon 312% 2d Lueree Beauty Shop 572% Cherry Marinello Beauty Shop 403 Cherry R318 Mary Ann Beauty Shop 620% Cherry Puckett's Beauty Salon 125 Cotton av Robinson Estelle 403 Cherry R215 Tyler Billie 663 Walnut Hayes Barber Shop 557 Cherry Hotel Dempsey Barber Shop 363 3d av Jones Jas E 1012 2d Lane Clayburn B (c) 613 Broadway Lightfoot Robt (c) 11213 Broadway Long's Barber Shop 1005 Broadway *Bed Room Furniture RHODES A G & SON, 357-63 2d, Tels 337-338 (For further information see; left top lines and page 15 Buyers' Guide) Odom Wm (c) 720 Elm Palace Barber Shop 5518 Mulberry Palm Barber Shop 316 2d Bedding Manufacturers Central Bedding Co 325 Oglethorpe Palmetto Barber Shop 463 Broadway Peeks John W (c) 464 (2) Poplar Pierce Lewis 102 Melrose (B) Ross Dallas L 803 Montpelier av Sanders & Tripp 1504 Broadway Smith Gertrude (c) 319 Broadway Smith Solomon (c) 216 5th Smith Wm O 3106 Houston av (SM) Snipes Wayne (c) 219 5th South Macon Barber Shop 2661 2d Southland Barber Shop 565 Broadway Stephens Barber Shop 206 Cotton av Stewart IRichd C (c) 117 Douglas av (V) Beer--Retail Brass Rail 311 3d Brown Jug The 153 5th Bruskie's 508 2d Bullock Oath Mrs 317 Cherry Burnett Wm 1602 Broadway Calhoun Fred 513 Poplar Cricket The 620 Poplar Green Front 564 Poplar Jones Kenneth E 872 Hazel Kitchens Jas B 1237 Broadway Morris W H 705 Log Cabin blvd Night Owl 19 (17) 5th 549 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS S69 MULBERRY STREET PHONES 946-947 Beer--Retail--Contd Osborne Otto O 465 Mulberry Oscar's Place 523 Mulberry Rankin Clarence M 220 Cotton av Red Front The 452 Poplar Ross & Clements 515 Wall Smith John T 453 Clinton (EM) Sportsman's Place 420 Poplar Webb's Place 670 Cherry Belting Dealers Bibb Supply Co 201 Poplar Beverages--Carbonated MACON COCA-COLA BOTTLING CO, 416-420 Oak, Tels 3266-3267 (For further information see left side lines and page 7 Buyers' Guide) Bicycle Dealers and Repairers Capitol Cycle Co 506 2d DIXIE CYCLE CO, 410 2d, Tel 9178 (For further information see right side lines and page 7 Buyers' Guide) Walker Cliff Co 515 Poplar Bicycle Enameling DIXIE CYCLE CO, 410 2d, Tel 9178 (For further information see right side lines and page 7 Buyers' Guide) Bicycle Tires DIXIE CYCLE CO, 410 2d, Tel 9178 (For further information see right side lines and page 7 Buyers' Guide) Billiard and Pocket Billiard Rooms Arcade Billiard Parlor 561 Cherry Arthur Geo P 4513 Broadway Douglass Chas H jr (c) 361 Broadway Hatfield Pelligrine M (c) 323 Broadway Bonds and Stocks--Investment LEWIS LOGAN & CO, 605 Georgia Cas- ualty Bldg 516 Mulberry, Tel 738 (For further information see right side lines and page 20 Buyers' Guide) Booksellers Brown's Book Store 416 2d Bottlers--Carbonated Beverages CMaAnCaOdaN DCrOy CGAi-nCgOerLAAleBOInTcT3L1I2NCGheCrOry, 416-420 Oak, Tels 3266-3267 (For further information see left side lines and page 7 Buyers' Guide) Macon Three Centa Bottling Co 80 MurNerhayi Baol ttling Co 768 Broadway Nu Icy Bottling Co Inc 510 Broadway Pepper Dr Bottling Co of Macon 650 3d Bowling Alleys (See also Billiard Rooms) Lucky Strike Bowling Alleys 359 Cotton Box Manufacturers--Wooden Jeffreys-McElrath Mfg Co rear 2300 Forsyth rd Maxwell Bros Inc ft Poplar Southern Crate & Veneer Co ft Poplar Brewers' Agents Cook's Beer Co 355 5th Georgia Beverage Supply Inc 802 Broad- way Brick Manufacturers Cherokee Brick Co Inc 891 Waterville rd Brokers--Cotton Levie Otis H 516 Mulberry R406 Warlick & Co 516 Mulberry R406 Blacksmiths Barnett Ferdinand F (c) 816 Montpelier Fletcher Jas (c) 102 Cedar (U) Herndon John A 1161 Milledgeville rd (EM) James Paul (c) 3707 Houston av (SM) Nixon Danl (c) rear 203 Hardeman av Taylor Robt (c) 108 Middle (V) Blockers--Knit Wear and Boucles CRESCENT LAUNDRY CO, 519 2d, Tel c16ov(eFroarnfdurtphaegre in21forBmuayteirosn' sGeueidfero) nt Brokers--Food Products United Food Brokers Co Inc 5th nw cor Pine Brokers--Investment LEWIS LOGAN & CO, 605 Georgia Casualty Bldg 516 Mulberry, Tel 738 (For further information see right side lines and page 20 Buyers' Guide) Brokers--Merchandise Ouzts-Mitchell & Whaley Inc 5 Terminal Ruan & Co 9 Terminal aV Boarding Houses Barnwell Clara L Mrs 533 Orange apt 23 Dunn Myrtice Mrs 218 Georgia av Etheridge Drew B Mrs 318 New Haynes Virginia Mrs 212 2d Leggett Mamie Mrs 619 2d McGinty Susie H Mrs 664 Plum Parrish Sallie T 209 1st Roberts Leila Mrs 554 1st Watson Mattie J Mrs 866 Mulberry Bonded Warehouses WASHBURN STORAGE CO, 201 Poplar, Tel 5376 (For further information see front stencil and pages 30 and 33 Buyers' Guide) Bonds--Surety HARROLD EDWARD B CO, 321-24 First National Bank Bldg 409 2d, Tel 461 (For further information see back cover and page 20 Buyers' Guide) ROBERTSON-WALKER INC, First Natl Bank Bldg 415 2d, Tel 35 (For further information see right side lines and WpILagSeON29 JOBHuyNersE' &GuSidOeN) , 702-703 Bibb Bldg 403 Cherry, Tel 214 (For further information see bottom stencil and page 18 Buyers' Guide) Brokers--Stocks and Bonds BROWN & GROOVER, 503 Cherry, Tels CO30U0R0 TaSnd& C30O0,1405 Ga Casualty Bldg 516 Mulberry, Tel 1681 (For further information see left side lines and page 5 Buyers' Guide) Fenner & Beane 363 3d Newton Arth F 610 Mulberry Brushes--Wholesale and Retail SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Builders Hardware CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Ofofrfmicaeti3o5n4 2sde,eTbealc3k01c1ov(eFroranfudrtphaegrein23WBILuLyIeNrsG' HGAuMideS) ASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Building--Specialties DUNLAP ROOFING CO THE, 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L POLK GO. Directory Publishers Detroit, Mich. We make up Special Lists 550 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bidg. SURETY BONDS Telephone 1811 Polk's Bankers Encyclopedia Tfce Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York Building Materials and Supplies CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) Clarke R L Co 1218 Broadway Ross Co The Poplar nr 8th Standard Brick & Tile Co 460 Broadwav W3ILd,LITNeGlsH2A7M7-27S8A-2S7H9 &(FDorOOfuRrthCeOr, 4in57f2o4rmBautyieorns'seGe uriidgeh)t top lines and page *Building and Loan Associations MACON FEDERAL SAVINGS & LOAN A(FSoSrOfCurIAthTeIrOiNnf,o4r1m7aBtiroonadsweeayr,igThetl 5s0id3e6 lines and page 9 Buyers' Guide) HOTEL LANIER CAFE, 525 Mulberry, Tel left 2,S7I7d1e (For further information see lines and page 17 Buyers' o-uiae) MA. C_O,,NT*CCOarCbAon-CatOeLdABeBvOerTaTgLesING CO, t4h1e6-r4i2n0foOrmaka,tiToenlsse3e26le6f-t32s6id7e (lFinoers faunrdpage 7 Buyers' Guide) ! Rugs and Floor Coverings f64i0^0 (FoBrEf?uSrvth.CerOi-n'If7oIrEm' a4t6i2o-n70se3ed-paTgeel 12 Buyers' Guide) Cash Registers--Dealers National Cash Register Co 155 Cotton av BankeBrsuilIdninsugrsa--ncOeffiBcueiladnindg P2u1b1liCc otton Bibb Building 403 Cherry MacoCnasCkaestkMet aCnuofa1c5t0u1rerBsr--oaBduwraiayl Bibb County Court House 2d cor Mulberry Broadway Building 461 Broadway CITIZENS & SOUTHERN BANK CiBtyUIBLaDnIkNG&, CThreursrty Cseo cBouril3dding 617 Cherry Doctors' Building 700 Spring Douglas Building 351 Broadway Ellis Building 201 Cotton av Exchange Building 460 Pine Federal Building Mulberry ne cor 3d First National Bank Building 409 2d Georgia Casualty Building 516 Mulberry Grand Building The 617 Mulberry . Happ Building 150 Cotton av Hardeman Building 105 Cotton av JONES &*CCaOtaNloEgYu,e 4P11rinBterorsadway Tel 320787Bu(Fyoerrs'fuGrthuiedrei)nformation see page RHODES A GCe&darSOCNh,es3t5s7-63 2d, Tels 337-338 (For further information see left top lines and page 15 Buyers' Guide) *Celotex M5cJtLhA, ST?e,lL5U20M0B(EFRor &furStUhePrPiLnYforCmOa,ti2o6n2 see back cover and page 9 Buyers' Guide) Indinegpe5n1d5en2tdOrder Odd Fellows BuildJaaues Building 407 Broadway Knights of Pythias Building (c) 556 New Lee Building 512% 3d MaCcotntonCitayv Hall ss Poplar bet 1st and Masonic Temple 710 Mulberry Monica Court 353% 3d Napier Building 502% Poplar Order of Railway Conductors Building 408 Poplar McNAIR LUMBECRem&enStUPPLY CO, 262 5th, Tel 5200 (For further information see back cover and page 9 Buyers' Guide) Cement Dealers W3IdL,LITNeGlsH2A7M7-27S8A-2S7H9 &(FDorOOfuRrthCeOr. i4n57formation see right top lines and page 24 Buyers' Guide) Salvation Army Building 610-20 Mulberry Washington Building 566 Mulberry Willingham Building 569 Cherry East MacoCnemCeemnteMntaWnuofrakcsturerearrs119 Jones av (EM) MACON M*BEuMriOaIRGIAroLunPdAsRK INC, Columbus rd, U s Highway 80, Office 153 Cotton av, Tel 2666 (For further information see page 10 Buyers' Guide) _U_ni.on Bus TBerumsiSnatalti3o2n0s Broadway Cemeteries Po(rEtHMi)ll Cemetery es Norris cor Mitchell JLoynnewsooCdhaCpeeml eCteermyet(ecr)yewnds CLyendwaroo(dSMav) MACON MEMORIAL PARK INC, Col- Bus and Coach Lines--Motor Bass Bus Lines 320 Broadway Hood Coach Lines 320 Broadway Southeastern Greyhound Lines 320 Broadway Southern Stages Inc 320 Broadway umbus rd, U S Highway 80, Office 153 Cotton av, Tel 2666 (For further inforOamkatRioindgeseeCepmageeter1y0 MBuaydeirsso'nGuide) Riverside Cemetery Madison ne cor Jones Rose Hill Cemetery Ocmulgee ne cor College GAB SCHBOuOsiLneOssFCoClOleMgeMs ERCE, 567 Mulberry, Tel 621 (For further information see front cover and page 10 Buyers' Guide) TorchBuAtcrhneorlsd' 4S5u4pp1lsites and Tools UnionviUe Cemetery (c) 928 Pio None av Wolff Wlm, Cemetery Madison Chain Store Leases MURPHEY, TAYLOR & ELLIS INC, 470 Cherry, Tels 267-268-269 (For further information see front cover and mae 28 Buyers' Guide) Bntter, Cheese and Eggs--Retail Macon Bntter Co 617 Linden av Chemists--Analytical Morris-Flinn Co 650% 3d MUECKE & CSaObNinSetCMO,ak61e4rsNew, Tel 636 (For further information see left side lines and page 10 Buyers' Guide) Odom Variety Works 513 Cotton av Chevrolet Automobiles DUNLAP CHEVROLET CO, 620 3d. Tels 2297-2298-2299 (For further information see right side lines and page 3 Buyers' Guide) 551 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Chiropodists Rhodenhiser Roy B 316 2d Simmons Stokes T (c) 261 5th Stevens Jas B 403i Cherry R307 Chiropractors CHIROPRACTIC HEALTH HOME THE, 501 College, Tel 431 Cox Hobart C 403 Cherry R507 Dick Thornton A 576 Mulberry R208 England Arch 403 Clherry R617 Heaps Louis P 501 College White A Wilson 501 College Christian Science Practitioners Snelling J Palmer 516 Mulberry R609 Churches ADVENTISTS Seventh Day Adventist Church 114 Montpelier av AFRICAN METHODIST EPISCOPAL Bellevue A M E Church (c) 100 6th av (B) Gray's Chapel A M E Church (c) 607 Hall (EM) Greater Allen Chapel A M E Church (c) 426 North (V) Jones Tabernacle C M E Church (c) 612 Ro(b6i9n8s)onCTowabaenrn(aEcMle) A M E Church (c) 118 Gaillard (V) StLuke's A M E Church (c) 1048 Pio Nono av (V) StMark's A M E Church (c) 307 Madison StPaul's A M E Church (c) 210 Powell (EM) Stewart Chapel A M E Church (c) 565 Cotton av Stinsonville A M E Church (c) 116 Main (S) Turner Tabernacle A M E Church (c) 3d se cor Hawthorne BAPTIST Aveline Baptist Church (C) 223 (285) Moore la Bellevue Baptist Church 305 American blvd (B) Bellevue Baptist Church (c) 103 3d av CB) Berthadale Baptist Church (c) 11 Bertha- dale dr Bethel Primitive Baptist Church (c) Hen- derson (B) Bethlehem Primitive Baptist Church (c) Be9u8laFhlaBmaipntgisot Cdrhurch 1613 Broadway Brown's Chapel Baptist Church (c) 119 N Tatnall la Bsryant Tabernacle Baptist Church (c) 217 (117) Disroom al Cedar Grove Baptist Church (c) 134 Blrewery al Chappell Lizzie Baptist Church (c) 126 Bartletts la Cherokee Heights Baptist Church 718 Na- pier av Corinth Primitive Baptist Church 323! Beech av East Macon Baptist Church 255 Church (EM) East Side Memorial Institutional Bap- tist Church (c) 1100 Woolfolk (EM) Ebenezer Baptist Church (c) 757 Elm Elizabeth Primitive Baptist Church 912 Clinton rd First Baptist Church (c) 567 New FFririesnt dBsahpiptisBt aCphtiusrtcChh1u1r2chW(acs)hi1n3g04to1nstav Fulton Baptist Church (c) 506 Hawthorne Oilfield Primitive Baptist Church (c) 85 (92) Hazel Greens Tabernacle (c) 704 (208) 'Colquitt Ha(rVm) ony Baptist Church (c) 330 2d av Jordan Street Baptist Church (c) 236 Jordan's al Lee Street Baptist Church (c) Lee Little Rock Baptist Church (c) 164 (400) Nussbaum (SM) Lizabora Baptist Church (c) 105 Davis (EM) Macedonia Baptist Church (c) 164 Hazel Magnolia Baptist Church (c) 316 Jackson Mallory Baptist Church 219 Roff Home av (V) Memorial Baptist Church (c) 233 Norris (EM) Mikado Baptist Church 210 Mikado av Moriah Baptist Church (c) 213 Powell (E M) Mt Calvary Baptist Church (c) 200 Gantt City rd Mt Lebanon Baptist Church (c) 115 Key Mt Moriah Baptist Church (c) 213 Powell Mt Olive Baptist Church (c) 957 Ogle- thorpe Mt Pleasant Baptist Church (c) 13 Gra- hams Lot Mt Temah Primitive Baptist Chinch (c) 303 North New Bethel Baptist Chinch (c) 404 Divi- sion (T) New Hope Baptist Church (c) 217 3d av (V) New Jerusalem Primitive Baptist Church (c) 200 Short la (EM) New Zion Baptist Church (c) 304 Edge- wood av Olive Grove Baptist Church (c) 308 Bright la Pleasant Grove Baptist Church (c) 417 Maynard (EM) PSrtJimamitievseBBapaptitsitstCChuhrinchch(c()c)21171E0 d2idso(nU) StJohn's Baptist Church (c) 104 Bonaire StLuke's Baptist Church (c) 161 Broad (EM) StMary's Baptist Chinch (c) 135 5th av (V Salem Baptist Church (c) 101 (209) Henry (SM) Second Baptist Church 1439 2d Seventh Street Baptist Mission (c) 351 7th Shaivloh(EBMap)tist Church (c) 421 Applewood Spring Hill Baptist Church (c) 500 1st av (U) Stinsonville Baptist Church (c) 107 Grant av (S) Tabernacle Baptist Church 902 2d Tatnall Square Baptist Church Ash bet College and Adams TrCemototonnt Taevmple Baptist Church (C) 534 Tremont Temple Baptist Church (c) 853 Pine Union Baptist Church (c) 306 E 2d (EM) Unionville Baptist Chinch (c) 932 Pio Nono av (V) Vinnuevt ille Baptist Church (c) 461 Chest Vineville Baptist Church 413 Vineville av Vineville Baptist Church 1035 Vineville Wahvite Mable Memorial Baptist Church 2634 2d Willingham Baptist Church 208 (140) Holt av (Napier Hts) CHRISTIAN Central Church of Christ 710 Grange First Christian Church 265 High CHRISTIAN SCIENTIST First Church of Christ Scientist 455 Georgia av CHURCH OF CHRIST Church of Christ (c) 501 Henrietta (SM) Church of God in Christ (c) 823 Ash Church of God in Christ (c) 503 Crisp East Side Church of Christ 375 Church South Side Church of Christ 2620 Broad- why CHURCH OF GOD Church of God 110 American, blvd (B) Church of God (c) 129 Woodcliff DUNLAP C H E V R 0 L E T co. Sales Service Used Gars 620 3d St. Phone 2297 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want information you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 552 EDWIN S. DAVIS, District Agent Where To Buy? Consult the Classified Business Lists In This Directory JOHN HANCOCK MUTUAL LIFE INSURANCE CO. 3d Floor First National Bank Building Phone 1142 Churches--Contd COLORED METHODIST EPISCOPAL Bethel C M E Church (c) 708 Pio Nono av (V) Holsey Temple C M E Church (c) 261 Washington av Trinity C M E Church 446 Tindall av (S M) Turners C M E Church (c) 84 Hazel CONGREGATIONAL First Congregational Church (o) 440 Monroe EPISCOPAL Christ Episcopal Church 520 Walnut StJames Episcopal Church 101 Courtland av StPaul's Episcopal Church College nw cor Forsyth FREE METHODIST Free Methodist Church 220 Belmont av HEBREW Congregation Sherab Israel Synagogue 601 1st Temple Beth Israel 870 Cherry HOLINESS Church of God (c) 103 Grant av (V) Pentecostal Holiness Church 858 Hazel Rains Tabernacle Holiness Church (c) Ro1c1k2hiBllaLyane Church (c) 126 Rockhill la StJames Holiness Church 709 Hall LUTHERAN Lutheran Church of The Redeemer 723 Holt av METHODIST Cherokee Heights Methodist Church (South) 670 Napier av East Macon Methodist Church 100 Church (EM) Ingleside Methodist Church (South) 427 Ridge av (V) Vineville Methodist Church (South) 245 Vineville av (V) METHODIST EPISCOPAL Barsds M E Church (South) 3102 Forsyth Centenary M E Church 940 College First Street M E Church 859 1st Morrison Memorial M E Church 170 Henry Mulberry Street M E Church 701-51 Mulberry Second Street M E Church 2120 2d Vineville M E Church (South) 245 Vine- ville av Warrens Chapel M E Church (c) 147 1st av (V') NAZARENE Church of the Nazarene 960 1st Church of The Nazarene 520 Montpelier av PRESBYTERIAN East Macon Presbyterian Church 377 Clinton First Presbyterian Church 660 Mulberry Log Cabin Presbyterian Church 144 (192) Log Cabin dr Tatnall Square Presbyterian Church 752 College Vineville Presbyterian Church 439 Vine- ville av (V) Washington Avenue Presbyterian Church (c) 221 Washington av ROMAN CATHOLIC StJoseph's Roman Catholic Church 810 Poplar StPeter Clavers Roman Catholic Church (c) 428 Ward (V) SANCTIFIED Bivins Tabernacle Sanctified Church (c) 521 E 2d (EM) House of Prayer (c) 104 North Street La MISCELLANEOUS Assembly of God 145 Knott (SM) Bailey Avenue Mission 405 Bailey av CO H) Church of God in Christ (c) 823 Ash Church of God in Christ (c) 503 Crisp Church of Jesus Christ 591 Giles (SM) Gospel Tabernacle 728 Blackburn (NH) Salvation Army The 616 Mulberry Cigars and Tobacco--Retail Brown Eug C 453i 2d Hotel Dempsey Cigar Stand 363 3d Hotel Lanier 525 Mulberry United Cigar Stores Inc 501 Cherry Cigars and Tobacco--Wholesale Macon Cigar & Tobacco Co 653 Broad- way ^Circulars Addressed and Mailed POLK R L & CO, Martin Bldg, Birmingham, Ala Circus Companies Downie Bro Circus 7th at Central City P&rk Rogers Show Co Inc 516 Mulberry R308 *City and Suburban Property HOLT A T CO, 569 Mulberry, Tels 946947 (For further information see right top lines and page 28 Buyers' Guide) Cleaners--Garments, Curtains and Draperies Economy Shoe Repairers & French Dry Cleaners 564 Cherry *Cleaners and Dyers INDEPENDENT LAUNDRY CO, 452 2d, Tels 1000-1001-1002 (For further information see right side lines and page 22 Buyers Guide) SNOW'S LAUNDRY & DRY CLEANING CO, 770 Poplar cor New, Tel 6000 (For further information see right side lines and page 22 Buyers' Guide) * Cleaners and Pressers CRESCENT LAUNDRY CO, 519 2d. Tel 16 (For further information see front cover and page 21 Buyers' Guide) SNCOOW, '7S70LPAoUpNlaDrRcYor&NDewR,YTeClL6E0A00N(INFoGr further information see right side lines and page 22 Buyers' Guide) Clergymen Ainsworth Wm N (M E South) 401 College apt 6G Bailey Jos J (c; Sanctified) 111 (302) Craft (V) Baker Azro C (Bapt) 232 High apt 2 BBaalrltahrldenJoAhlfnonWsus(B(RapCt)) 433205 WDaurndca(nV)av Bivens Emmett O (c; Bapt) 208 Cedar (U) Boone Jos P (Bapt) 121 High Cephus Nathaniel S (c; Bapt) 706 Elm Chapman M Elton (Adventist) 225 Nina- dell dr ClaHiiblol rCnereRstanadvol(pChHR) (Epis) 410 (460) Clem Walter W (Epis) 635 College CCooollkinEs dOmbuiendMF(c(;MBE)ap1t3)0437V4 inMevoinlrleoeav (V) Cronin Patk (RC) 814 Poplar Davis Henry H (c; CME) 314 Patterson (NHts) Dorough Augustus B (Bapt) 602 Mikado Ducker Wm J 106 (170) Cherokee av Edwards Acie C (c: AME) 100 Bonaire Evans John H (c; Bapt) 558 Monroe Forrester Clifton A (Bapt) 1138 College Goolsby Wm M (c: Baptist) 612 Center (EM) Greene H Vernon (c: AME) 422 North (V) Hall Wm M (c; Baptist) 529 Clinton (E M) Harmon Jas A (ME) 219 High 553 MOTOR PARTS CORP. Complete Parts Service--Cars--Trucks--Busses and Tractors--Automotive Machine Shop 619 THIRD ST. PHONE 4800 Clergymen--Contd Harrell Wm R (c: Bant) 113 (167) De Borde (SM) ,, , THORPE R S & SONS, 515-517 Cherry, 2d fl, Tels 159, 314 and 761 (For further information see page 11 Buyers' Guide) Harris Albert G (Presby) 112 Buford pi Hudson Jas H (c; Bapt) 552 Chappell (S M) *Clothing Dealers KAYBEE STORE, 416 3d, Tel 2226 Jefferson Robt J (c; Bapt) 212 Powell (E M) Johnson Silas (MESouth) 247 Vineville av (V) Johnston Ohas F (ME) 166 (136) Oak- land av Jones Wm M (c; Bapt) 1235 (,40v) _ Demp- sey av (U) Justeen Doreen (Miscl) 140 Knott (SM) Kelly Oliver L (Miscl) 613 Duncan av Landrum C Logan (Presby) 426 Carling av Lewis Harvey (c; Bapt) 105 Pulton (EM) Marcuson Isaac E (Hebrew) 204 Buford pi McClendon Berrv B (c; Bapt) 217 Telfair McDonnell Peter (RC) 614 Poplar McElroy Jack (Church of Christ) 726 Date av _ , McLaughlin Clifford (RC) 814 Poplar McNair Elisha B (c: AJVEE) 575 Monroe Clothing DealersR--etMaiel n's and Roys'-- BURDEN SMITH & CO INC, 350-356 3d, Tels 690-803-804 Crow's Toggery 309 Cherry DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) DAY'S, 406 3d, Tel 3026 Gay Clothing Co 458 3d' Hayes Clothing Co 557 Cherry KAYBEE STORE, 416 3d, Tel 2226 Mayo's 604 Cherry NEEL JOSEPH N CO, 456-60 Cherry, Tel 2800 Reliable Outfitters 572 Cherry Schwob Co The 403 Cherry SMART HERBERT CLOTHING CO INC, 559 Cherry, Tel 951 X V Clothes Shop 454 Cherry Monsees Jas A (Bapt) 534 Washington av Norris David (c: AME) 466 Hawthorne Oglesby Graham (Church of God) 112 American blvd Phillips Wm L (c: Bapt) 408 Ward (,V)s Reese John E (c; AME) 653 Spring Clothing Dealers--Second Hand Dunn Roy L jr 1749 Broadway Moran Chas A 1227 Broadway Trio Bargain Store (c) 650 Poplar Walker Alice V Mrs 406 Main (EM) Reeves Wm S (c: Bapt) 804 (440) Hall (E M) Sammons J Ellis (Bapt) 208 Delaware av (V) Saxon Jas T (c: Bapt) 125 Norris (EM) Scott Wade E (ME) 104 Church (EM) Seay Judge D (c; Bapt) 214 Woodcliff Shaw Martin A (ME) 128 Pearl Shelton Elbert M (Nazarene) 251 Jeff smDaallviEsdw(SMT )(Christian) 132 Rembert av Clothing Dealers----RWeotamilen's and Misses' Barfield's Dress Shop 451 3d Betty Maid Shop 608 Cherry DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) Darling Shop 552 Cherry Elberta Dress Shop 412 Cherry Eleanor Shop The 414 3d Smith G Reid (ME) 861 1st Stanford Thos B (ME) 203 Jeff Davis Globe Dress Shop 404 3d Helds Dress Shop 564 Cherry Lerner Shops 520 Cherry StittcW (Bapt) 210 (250) Church (EM) Sutton Walter L (ME) 1808 2d Taylor Henry P (c; Baptist) 409 (536) Henrietta (SM) Threatt Arth (c: AME) 221 Woodcliff Webb Jas A (ME) 648 Pio Nono av (V) Wilcox Geo W (Presby) 102 Culver (V) Mangels of Georgia Inc 420 3d Mary Lou Shop 468 Cherry Mayson's Women Apparel 359 3d NEEL JOSEPH N CO, 456-60 Cherry, Tel 2800 Peggie Hale Dress Shop 560 Cherry Snyder's Ready-to-Wear 622 Cherry Wimberly Jas H (Bapt) 610 Hall (EM) Wright Lewis H (Bapt) 111 Coleman av (CH) Clothing ManufRacotyusr'ers--Men's and Clinics Adams Manufacturing Co 7 Express West Happ Bros Co 670 Broadway Bibb Mfg Co Clinic No 1 226 (227) Clinton (EM) Clubs CLINIC THE, 567 Walnut, Tel 1721 Payne City Clinic 70-71 Davis (PM) Bibb Mfg Co (Club House) 1013 1st Business & Professional Women's Club 200 Baconfield (EM) Clothes Pressers and Cleaners Catholic Club House 521 New Bishop John T 558 Mulberxy Broadway Cleaners (c) 1220 (1232) Broadway Economy Dry Cleaners 102 Montpelier av Economy Shoe Repairers & French Dry Cleaners 553 Cherry Gladman Clarence (c) 103 Hardeman av Hill Dry Cleaning Co 115 Cotton av and 816 Vineville av (V) Lemapatnrot Dry Cleaning Co 108-10 HardeMilady Cleaners 692 College New York Cleaners 411 3d Porter Ernest C 610 New Tatnall Square Dry Cleaning Co 605 Ian- ClCH LV Tremble Cleosia (c) 133 5th av (V) Civitan Club Hotel Dempsey Elks Club 127 Cotton av Idle Hour Club Forsyth rd Kiwanis Club Hotel Dempsey Lions Club Hotel Dempsey Macon Motor Boat Club North av at Oc- mulgee River _ Macon Women's Club 200 Baconfield (E M) Masivic Club 710 Mulberry Owls Club 469 % 2d Pilot Club of Macon 200 Baconfield (E M) Rivoli Riding Club Rivoli dr Rotary Club 453% Cherry Shirley Hill Club 432 Nottingham dr (N H)' ` Social Workers Club 453% Cherry South Side Social Club (c) 423 Cotton av *Clothiers DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) *Coal Burners LOWE ELECTRIC CO, 131 Cotton av, Tel 6300 We Grow Through Service Let Us SERVE YOU ExcelsiorGreyhound Bicycles DIXIE CYCLE 410 2d Phone 9178 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume fl. L. Polk & Go, Publishers 431 Howard St. Detroit 354 4th Ave. New York 554 T. WM. WORTH WILLIAMS INSURANCE AGENCY Sound Insurance + Our Personal Service = Your Safety L. 310-12 First National Bank Bldg. Tel. 64 W Coal Dealers--Retail Yards EMPIRE-DIXIE COAL CO, 5th and Plum, Tel 5721 Houston Coal Co 1052 5th Mason Geo (c) 512 3d av (V) Mathis Chas (c) 334 Monroe Miller Acy (c) 307 Patterson Plar, Tel 5376 (For further information sBeueyefrrso'ntGsutiednec)il and pages 30 and 33 Polk's Bankers Encyclopedia Dental Laboratories DiRxi2e Dental Laboratory 407 Broadway Macon Dental Depot 556 Mulberry Dentists Anderson Otis C 569% Cherry Bell Junius J (c) 226% Cotton Boone Toof A 516 Mulberry R803 Childs Wyatt B 516 Mulberry R701 CCrlaardkdoGckilliHamarry403WC5h6e7rryWRal7n1u1t Farmer Frampton W 700 Spnng R315 Gates Paul G 516 Mulberry R1005 Gleason Ovella M 516 Mulberry R503 Harden Timothy 403 Cherry R511 Heard J Milton jr 516 Mulberry R803 Holley John C (c) 556 New R300 Holmes Wm B 556 Mulberry Jenkins Wm A 516 Mulberry R608 Joanis Wm C 617 Mulberry R208 Lovelace John W 605 Cherry Mabry Robt H 409 2d R510 Mason R Holmes 409 2d R406 Murphy Robt H 516 Mulberry M20 Perdue Chas H 150 Cotton av R303 RESPESS E ROY, 606 Georgia Casualty Bldg 516 Mulberry, Tel 4817 Doll Hospitals Muecke Doll Hospital 616 Poplar Dressmakers Beebe Eliz 817 Mulberry Butler Celie (c) h318 Jackson Byrom Ada (c) 354 Ash Dawson Josephine (c) 159 Middle (V) Ellis Hattie (c) 548 Hazel Hanks Mary K Mrs 153 Magnolia Jackson Leila (c) 104 *-4) Orchard av Maynard Alice (c) 110 Middle (V) Mitchell Ella (c) 211 (434) Thompsons al Nowell Myrtie 484 Orange Roberts Saphronia Mrs 103 Nelson (ISM) Truesdell Pearl M 1332 3d Druggists--Retail BALKCOM'S PHARMACY, 340 Main (E M), Tels 4317-4318 BBleollo'ds-wPohrathrmWaciynto4n00 EM1o0n0t2pe2lider av CHAPMAN'S PHARMACY, 574 Mulberry, Clierokee6 Pharmacy 801 Montpelier av Clark Drug Co 103: Cotton av Coleman's Pharmacy 124 Hardeman av The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume fl. L. Polk & Go, Publishers 431 Howard St. Detroit 3S4 4th Ave. New York 556 WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 153 l&l C) i54co?) * Consult the CLASSIFIED LISTS of the DIRECTORY If You Would Find What You Wish to Buy 558 A. B. LEE PLUMBING & HEATING CO. Contracting--Repairing--Air Conditioning 258 2d, opp. Court House Tel. 2851 Funeral Directors--Contd CENTRAL CITY FUNERAL HOME (c), 530 Cotton av, Tel 57, Night Tel 1156W (For further information see page 15 Buyers' Guide) East Side Funeral Home (c) 520 Cowan (E M) HART'S MORTUARY, 755 Cherry, Tel 161 (For further information see right top lines and page 14 Buyers' Guide) Hubbard Co 466 Cotton av HUTCHINGS' FUNERAL HOME (c), 518 New, Day Tel 2044, Night Tels 2044, 3439 and 3728 (For further information see left top lines and page 15 Buyers' Guide) Independent Funeral Home (c) 457 Cotton av FITTS MORTUARY, 814 Mulberry, Tels 146-147 (For further information see right top lines and page 14 Buyers' Guide) Thomas Funeral Home (c) 1000 Pio Nono Fur Dealers and Furriers Barnes Beulah L Mrs 316 Washington av Art FurFnuitrunrietuMrefMg aCnoufTachteur3e1r4s Fulton (SM) Macon Cabinet Works Poplar nr 8th MAC*OFNumTRitAurNeSMFoEvRerCs Oan, d40P8aBckroeardsway, Tel 304 (For further information see nght top lines and page 31 Buyers' Guide) Furniture Repairers (See also Upholsterers) Anderson Alice Mrs 103 Pierce av (V) Ansley Robt E 767 3d Duval Paul & Son (c) 450- Cotton av Gray John T (c) 441 Craft (V) Muecke Art Craft Studio 615 Poplar MUECKE & SONS CO, 614 New, Tel 636 (For further information see left side lines and page 10 Buyers' Guide) 'Furriers CRESCENT LAUNDRY CO, 519 2d, Tel 16 (For further information see front cover and page 21 Buyers' Guide) Furnished Rooms Butler Tommie Mrs 504 Hemlock Hunnicutt Emma Mrs 754 Cherry Jones Lizzie Mrs 559 2d *Gas Companies MACON GAS CO, 220 2d, Tel 6561, Plant 415 Mulberry, Tel 5611 Magnolia Inn 555 2d Nutting Sarah C Mrs 468 Walnut Smith Mattie Mrs 668 Walnut Solomon Eliz D Mrs 220 1st Stanley John H 407 Walnut Washburn Abram C 568 Walnut *Gas Heaters MILLIRONS PLUMBING & HEATING CO, 107 Cotton av, Tel 3176 (For further information see right top lines and page 26 Buyers' Guide) Zettler House 518 Pine Gasoline and Oil Service Stations Furniture Dealers--Retail Backer J Furniture Co 460 Poplar 'Carr & Johns 109 North av (NH) DANNENBERG CO THE, 462-70 3d, Tel 06J4200Bu(yFeorrs'fuGrtuhideer)information see page EMPIRE FURNITURE CO, 522 Poplar, Tel 402 Adair Service Station 570 1st American Oil Co 170 Spring Atlantic Refining Co 571 Mulberry Balkcom Fred Sinclair Station 2723 Hous- ton av (SM) Bawlkacyom's Service Stations 1137 BroadBellevue Service Stations 399 American blvd Exchange Furniture Co 113 Cotton av Goldgar Furniture Co 518 Poplar Johnson Bros 461 2d Broadway Service Station 603 Broadway Burnett Service Station 101 Montpelier Callaway Service Station 1801 Vineville CO MACON TRANSFER & FURNITURE EXCHANGE, 408 Broadway, Tel 304 (For further information see right top lines and page 31 Buyers' Guide) Marshall Furniture Co 556 Poplar MAXWELL BROS FURNITURE CO, 455 2d, Tel 4401 (For further information see right top lines and page 15 Buyers' Guide) RHODES A G & SON, 357-63 2d, Tels 337338 (For further information see left top lines and page 15 Buyers' Guide) SEARS, ROEBUCK & CO, 552-56 3d, Tels 3326-3S27 (For further information see right top lines and page 11 Buyers' Guide) STCEhReCrrHy IaBndROBSroSadTwOaRyE, STeINl C3,10s0w acnodr 565-575 Poplar, Tel 5957 (For further information see left top lines and page l'S Buyers' Guide) Tabor Herbert T 763 Broadway TAYLOR FURNITURE CO, 161 Cotton av, Tel 2051 Toole Furniture Co 367 2d Union Furniture Co 5.10 Poplar Vineville Furniture Co 1803 Vineville av (V) WOOD-PEAVY FURNITURE CO, Triangle Block Entrance on Oh-ewry, Second and' Cotton av, Tel 103' '(For further information see left top lines and page l'S Buyers' Guide) av (V) Carr H E 3107 Houston av (SM) Causey 'Stephen B 11129 Montpelier av Champion B Jeff Oglethorpe se cor 1st Chandler Service Station 600 3d CHbAerPryM, ATNe'lS295G1AR(FAoGr Efu, rt4h1e5r-4i1n9foMrmual-- tion see front cover, right side lines and page 2 Buyers' 'Guide) ChHaptsp)el's Service Station 455-57 Vine (N Charles Place 2447 Broadway Cherry Street Service Station 673 Cherry Cheves J P & J W 209 2d Clark & Jordan 702 Broadway College Street Service Station 225 Forsyth Corbin Service Station 701 Broadway Davis Harry Forsyth rd Davis Wm H 1811 Vineville av (V) Dennard Service Station 443 Vine (N Hts) Dixon Horace L 768 2d FIRESTONE AUTO SUPPLY & SERVICE STORES, 667-73 Mulberry cor 1st, Tels 116-117 First & Last Chance Forsyth rd Georgia Market Service Station 426 Oglethorpe Georgia Service Station 2846 Houston av (SM) Glawson Service Station 280 (2) Main (E M) Gober Service Station 501 Montpelier av Gordon Jas A 3611 Houston av (SM) Grover B Hudson 3213 Houston av (SM) Furniture Dealers--Second Hand Trading Post 1st Williams Fred W 515 Oglethorpe Gulf Oil Coro (For service stations see Alphabetical Section) Hartness Service Station 91 Coleman av (CH) 559 HART'S MORTUARY EFFICIENT REASONABLE DEPENDABLE AIR CONDITIONED STEAM HEATED 755 CHERRY TEL. 161 Gasoline and Oil Service Stations--Contd Hightower Service Station 2915 Houston Huamv p(hSrMey)s & Lamb S_ervi.ce Stat.i.on 507 WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Vineville av (V) HInugnletsiLdeetcOheilr CBo33201030HFooursstoynth arvd (SM) Joiner Bennett A 320 1st Jones Thos M 265 Broadway Kennington Jerome P 600 Broadway Kitchens John C 1156 MilledgeviUe rd (E Liberty Service Station 2226 Forsyth rd Log Cabin Service Station 1148 Milledge- Glass Dealers--Window and Plate CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) SOUTHERN PAINT & VARNISH CO, 5fo61rmMautilobnerrsye,eTpealg2e27264 (BFuoyrefrus'rthGeuridine)- w ville rd (EM) Lunsford Clifford M l* 5th Martin Wm A 1143 MilledgeviUe rd (EM) McKENNEY & ADAMS SEKVICE STA- TION, 600 1st, Tel 6346 (For further information see page 2 Buyers' Guide) Meadows Eug H 4101 Houston av (SM) * Greenhouses . IDLE HOUR NURSERIES, 109 Cotton av, Tels 223 and 224, Greenhouses Forsyth rd nr Rivoli Station, Tel 875-J (For further information see top. stencil edge and page 18 Buyers' Guide) 3P e ?2. S-'B S) 2 2 ^ __ 1 ? ^ a O tsJ Morris Paul I Forsyth rd Mutt & Jeff Filling Station 2004 Vine- ville av (V) Grinding and Sharpening O K Grinding Co 356% 2d r 0j 3 Odom Wm W 903 3d . Parker Leon B 2001 Vineville av (V) Peoples Oil Co Sta 301 Walnut Pilcher J Alton 444 Vine (NHts) Pilcher's Service Station 918 Napier av PoAwleprhaObieltiCcaol (SFeocrtiosenr)vice stations see Reeves Chester R 1163 MilledgeviUe rd (EM) Rivers & Chambers 500 Cotton av Robinson Qhias W jr 1308 roadway Rogers Service Station 4011 Houston av Grocers--Retail Abel Sidney W 970 Oglethorpe Abraham Melham 2998 Houston av (SM) and 2243 2d Acme Cash Market 666 Poplar Allen Jas W 852 Hazel lAAlllmenersRon BCu&rtisSoDn 5S1O2S 2'd(I1IS5) Bay Anderson Geo (c) 204 Industrial Home rd Anderson Geo R (c) 101 Morris Appling Irving (c) 521 (122) Elliott (E M) tfP ROOFINGS EVERLOX SHINGLES SHEARLIBDEARNT, EM. gr. Sawyer Coal & Ice Co 277 Walnut Scott (V) Filling Station1 2110 Vineville av Shell Petroleum Corp 106 Vineville av (V) Simmons Service Station 4000 Houston av (SM) Ard Cash Grocery 289 Washington av Ard T Edw 167 Spring Ard Wm F 126 (780) Nussbaum (SM) AArsnhoklednaBzieeniLuFla52M2 rsOc6m55ulgReoess Atwell Mary F Mrs 545 Telfair Avera Milton J 2402 Broadway Bailey H Woodfin 303 (304) Campbell YOUR Sloan Kyle Service Station 571 Mulberry Southern Oil Stores Inc 200 Broadway Standard Oil Co (For service stations see Alphabetical Section) Stevens Robt L 601 Walnut Stewart Oil Co 501-09 Mulberry and 2d nw cor Oglethorpe Sullivan & Hilley 363 Cotton av av (SM) Baker Jas 1139 MilledgeviUe rd (EM) Barnes Jas B 200 Orange Barnett Sami 514 Church (EM) Bateman Robt L 1108 Napier av Bay St Cash Grocery 124 (102) Bay Beilizia Frank 21 5th Belson Max 1200 Broadway CITY D 1 Tank Car Service Station 852 Broadway and 431 Main (EM) Taptenlaiellr Sao,vuare Service Station 99 MontTerminal Service Station 342 Cherry Bennett & Co 1540 Broadway Birdsey Flour Mills (For branches see Alphabetical Section) Blackshear C Albert 221 (220) Hydrolia (E M) R E Texas Co The 500 Forsyth Blocker Jos P 1117 Plant (SIM) Tip Top Service Station 1600 2a Wall J Brad 714 Poplar Watson Hubert C 801 Vineville av (V) Wilder & Jones 501 Cotton av Williams John H C 3203 Houston av (SM) Wofford Oil Co 400 Main (EM) 99 North av (NH) and 672 Spring Bolton Annie Mrs 100 Johnsons al Bolton Geo S 520 Elnf Boone John D 514 Pine Boyer Geo 500 Smith (EM) Bradley Oscar 454 Cotton av Brady Jas E 940 Napier av Eiray Edw 308 Pio Nono av (V) C T O General Merchandise--Retail Bray Perry M 117 Hardeman av Bridgers G Herbert 231 Holt av (V) R Crutchfield Cash Grocery Clinton rd (E M) nr River rd Karesh Sami 115 Hardeman aV Saloom Jos 1243 Broadway Sands & Co Inc 573 Broadway Broadway Cash Market 410 Broadway Broady Arth (c) 2 Gustin av Brown Leon D 2015 Vineville av (V) Brown Weldon W 1083 Pio Nono av (V) Bryant 8Jos3(c) 315 (312) Stevens OSM) Y mirrors Gift Shops (See also Art Goods and Bric-a-Brac) Oak Art & Gift Shop The 2514 Forsyth rd Popper Steve 186 Magnolia Butler Walter C 3011 Houston av (SM) BCyamrdeJrieenrnoieNMicrhso2la36s (310052) BVriorgaidnwLaay (V) Campbell Chas B 316 Plant (SM) Cannon W Edw 816 Main (EM) Carswell Vera I 980 (935) Montpelier av the Industrial *Glass--Window--Plate--Store Front JARRETT PAINT & GLASS CO, 320 3d, Tel's 21200-3201 'CFor farther information see right side lines and page 25 Buyers' SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Carter J Wm 308 Fulton (SM) Caserio Lucretia 251 Washington av Chambliss Loris C 316 (228) Pio Nono av (V) Chianin Barnett 652 Poplar* Chapman John A 3104 Houston av (SM) Childs Ellen Mrs 670 Ash Childs John D 1119 Ash LIFE Of Your CITY 560 PRINTING ARLING I ON HOTEL" BINDING FREE STORAGE BMRoOdeArnDWanAdY, RNeaEsAonRabPleOPRLaAteRs "A Good Place to Sleep" THOMAS O. MOSELEY, Prop. RUBBER STAMPS CGhroucrecrhsi--ll RJeothainl--RCo6n0t7d Main (EM) Clark Chas M 231 Ross Home av (V) Clemons Jefferson H (c) 111 Franklin Clowers Bessie (c) 201 Telfair Clowers Randall D (c) 501 Martha (EM) Cltoewaierrs3>S7bara2hd Lav(c)(V3)01 North (V) and Cobb Chas W 120 Edgewood av Hendley Wm T 33 Bellevue rd Herrington Grocery 408 Calhoun Hester Robt L 120 Enterprise (SM) Hi-Lo Grocery 516 Montpelier av HHoogdugees SRamexi DB 934200 MDaonnntpeenlbieerrgavav Holloman Jim (c) 98 Forest av (V) Holt Jos (c) 310 Green THE BEST WORK Coffee Andrew J 261 Madison Cohen Max 300 (200) Pio Nono av (V) coher Bertha Mrs 210 (99) Myrtle (E Copier Clifford (c) 199 Industrial Home HM) d Edmburgh (c) 607 Fort Hill (E Hubbard Edw (c) 436 Chestnut JDHauubdtotsoonTnThoDlisoasn6lt70E94P82o02p(l9a4Er(l)m) E^rt (SM) CORRECT PRICES Couch & Woodall 701 Main (EM) Croom Robt F 500 Chappell (SM) Darity Freeman A 1021 Davis E Clifford 2904 Forsyth rd Dean Mattie (c) 311 (211) Waterville rd Dean Otis Grocery 478 Cotton av Dean W Bonnie 478 Cotton av Oean Walter G 1624 Broadway DDeinmkpinsesy HCelnifrfyordE A1350016 3Cdlinton (EM) DiVenuto Enrico 2918 Houston av (SM) Johnson Ernestine Mrs 412% Montpelier Jones Addison D 1402 Broadwav Jones Grover J 3481 Houston av (SM) Jones Lamar 600 Clinton (EM) Jones S Co 310 3d Jones Vernon A 45 White (SM) Jones Wm E 267 Oakland av Jordan Chas (c) 620 Hazel Joyner Wm 102 Hazel Kelly Thos E 700 Broad (EM) Kendrick Anthony D (c) 271 (269) 4th av DDDyyueemsrassBeCLnhjeeeHst2e0r716M5(2307d20)4 Hawthorne Crisp (SM) Economy Markets 455-57 Arch Edwards Jas E 800 Elbert (SM) Kennington's Market 38!8 Main (EM) Kitchens Clarence M 1100 Ocmulgee Kitchens Jas E 104 Center (EM) Kitchens Jas W 1190 Milledgeville rd (E 406 Cherry St, EElddwerarEdsrwJionhWn w102250C2 liTnetolfnairrd (EM) EEllldiserIdWaU(hcs) CGlin25to2n (n23r4)RiMvearinrd o(wEMn) KoiodneJraMsHorn1s131312(617B93ro) aMdwoanytpaenlider8a6v9 Ham MACON Ellis R Sapp 859 Cherry Emilio Carlo 530 Flanders (EM) Lackay & Latekay 15012! Broadwav Lassetter Robt L 909 Clinton (EM) E|PthPeSri,dgeennBroAs 9347105EHlboeurtsto(SnMa)v OSM) Leaptrots Market 1003 Market Lee Jas B 1901 Vineville av (V) Evans Lewis (c) 602 Hammond Liles Wm C 803 Main (EM) Everett Amelia (c) 1001 Pio Nono av (V) Everett Nash M (c) 309 Madison Lipsey Jos (c) 207 Forest av (V) Littleton Dewey G 614 Poplar Fluellen Obie (c) 1024% Main (EM) Folsom Gussie A Mrs 301 Duncan av Four Point Grocery 268 Maple LLuMg)s Randa11 (c) 498 (28) Mitchell Chas (c) 216 (353) Elizabeth (E (S Francis Antonio 518 2d Freeman Mary 1219 2d Lyles Wm S 385 Monroe Gates Thos (c) 1125 Montpelier av Lyons Cash Market 288 Washington av Gebara Chas 641 Fort Hill (EM) Mansfield Willis S 397 American blvd Getson Carrie J Mrs 304 (317) Log Cabin MMaartvhiins'sWGmroLcer(yc)2130255 VMinoenvriolele av Gholsons Chas A Clinton (EM) Gibson Danl (c) 424% Pio Nono av (V) Gibson Geo W 327 Dannenberg av Goins Geo W 204 (96) Holt av (NHts) Goins Robt W 200 (56) Holt av (NHts) Goodin Ida Mrs 2097 3d GolioedrwainvJackson T (c) 982 (939) MontpeGoodwin Lester C 3496 Houston av (S McAfee Oscar H 205 Hardeman av McAfee Robt K 2101 Vineville av (V) McCahill Tinus 99 Rutherford av (SM) McConnell Columbus A 317 Giles (SM) McCrary Geo D 406A Church (EM) McCreary Wm T 1002 Oglethorpe McDaniel Wm F 1015 Log Cabin blvd McDaniels Grocery 127 (111) Colquitt McKinney Jos O 533 Forsyth Meadows Jas W 106 Emory av (SM) Gordon Robt W 2120 Forsyth rd Meadows John C 1156 Edgewood av Meeks Bernard H 1547 College Go-269 (For further information see front cover and page 28 Buyers' Guide) PAINE GUY E (Life), 306-08 Grand Bldg, Tel 887 (For further informa- tion see page 20 Buyers' Guide) ROBERTSON-WALKER INC, First Natl Bank Bldg 415 2d, Tel 35 (For fur- ther information see right side lines and page 29 Buyers' Guide) 565 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Insurance Agents--Contd Schofield Insurance Agency Inc (genl) ST6R16ICMKLuAlbNerDry ERH210& CO, 201 Georgia Casualty Bldg 516-22 Mulberry, Tel 236 (For further information see back cover and page 19 Buyers' Guide) WILLIAMS LUTHER & SON, 565 Mul- berry, Tel 1586 (For further informa- tion see right top lines and page 7 Buyers' Guide) ,, WILLIAMS WM WORTH INSURANCE AGENCY, 310-11 First National Bank mBiadtsio4n09se2ed,leTfetl t6o4p (lFinoersfuarnthdepraignefo2r0- Buyers' Guide) Willingham Benj B (genl) 258 2d Willingham & Payne Inc (genl) 350 2d Wilson John E & Son (genl) 403 'Cherry R702 Insurance Companies Afro-American Life Insurance Co (c) , 556 New R4Q6 AlCl hIeSrtraytes Life Insurance Co 669,,% American National Life Insurance Co 617 Mulberry R404 AtRla4n23ta Life Insurance Co (c) 556 New BANKERS HEALTH & LIFE INSUR- AtoNnCEav,GOTeTlsHE2,44H0o-2m44e1Office 211 Cot- Carolina Life Insurance Co 617 MulCobmermryercRia5l04Casui alty Insurance Co 617 Mulberry R207 Connecticut Mutual Life Insurance Co 30 2d CO-OPERATIVE FIRE INSURANCE CO OF THE STATE OF GA, 508 Mulberry, Tel 6186 DeMssualubeRrreyalRtylOl& Insurance Co 516 Dure & Beeks Co (genl) 321 Mulberry GUARANTEE MUTUAL LIFE CO, 3d Floor First Natl Bank Bldg 409 2d, Tel 1142 (For further information see left top lines) Guaranty Life Insurance Co (c) 556 New R410 HASNUCROACNKCEJOCHON, 3MdUFTlUooArLFLirIsFtENIaNtl- Bank Bldg 409 2d, Tel 1142 (For fur- ther information see left top lines) Industrial Life & Health Insurance Co 409 2d R414 Interstate Life & Accident Co 617 Mulberry R608 JEFFERSON STANDARD LIFE IN- SURANCE CO, 310 First National Bank Bldg 409 2d, Tel 64 Kabnesrarys CRi2ty06L-0if7e Insurance Co 516 Mul- Liberty National Life Insurance Co 409 2d R'523 . . Life Insurance Co of Virginia 617 Mul- berry R508 LIFE & CASUALTY INSURANCE CO OF TENNESSEE, 315-316-317 Bibb Bldg 403 Cherry, Tel 4821 Metropolitan Life Insurance Co 516 Mulberry R'505 Metropolitan Life Insurance Co (farm loan div) 403 Cherry R410 Mutual Benefit Life Insurance Co 409 2d R426 Mutual Life Insurance Co of New York Na4t0i9on2adl LRif2e02& Accident Insurance Co of Nashville Tenn 705 Georgia Casualty bldg Ne6w13EnGgeloarngdiaMCuatusuaal lLtyifeblIdngsurance Co NebwerrYyorRk2;1L0ife Insurance Co 617 Mul- North Carolina Mutual Life Insurance 'Co (c) 556 New R417 Northwestern Mutual Life Insurance Co PaR4n74-02ASmC1 heerircrayn ILIife Insurance C_o 4,,0,,9,, ,,2d, Peninsular Life Insurance Co 617 Mul- berry R502 Penn Mutual Life Insurance Co (farm loan dept) 409 2d R519 Phoenix Mutual Life Insurance Co (mortgage loan div) 409 2d R20T Pilgrim Health & Life Insurance Co (c) 527% Cotton av PrboegrrreyssiRve30L91ife Insurance Co 617 . Mul- Prudential Insurance Co of America 516 Mulberry R301-06 Interior Decorators Small Ralph B Mrs Studios 115 Rogers av ( V) Investment Bankers (See 'also Brokers--(Stocks and Bonds) Dure Leon S Co 321 Mulberry Investors Syndicate 409' 2d R404 O'Neal B P Jr & Co 516 Mulberry R712 LECWasIuSaltLyOGBlAdNg 5&16 MCOul,be6r0ry5, GTeeol r7g3ia8 (For further information see right side lines and page 20 Buyers' Guide) Trust Co of Georgia 417 2d investment Securities COURTS & CO, 405 Ga Casualty Bldg i5n1f6orMmuatlbioenrrys,eeTelleft168s1ide(Folirnefsurtahnedr page 5 Buyers' Guide) Iron and Steel Work Macon Iron & Paper Stock 'Co 754 Broadway Janitors' Supplies Kuhn Mfg Co The 547 Mulberry Jewelers--Retail FRIEDMAN'S JEWELERS, 566 Cherry, Tel 6344 (For further information see left side lines and page 21 Buyers' Guide) Kernagihan-Goodman Inc 411 Cherry Matthews R H Inc 409 Broadway OPeRkRor-SCoLokCOJ,ew51e1lrCyhCerory,60T3elC4h1e1r1ry Regero & Regero 370 2d Sherwood John H 650 Cherry WILLIAMS JEWELRY CO, 457 Cherry, Tel 737 Junk Dealers Coplan Junk Co Inc 816 Broadway DuBose J H & Son 121 Poplar Macon Iron & Paper Stock Co 215 Wal- Standard Paper & Paper Stock Co 1911 Broadway *Kalsomincs SOUTHERN PAINT & VARNISH CO, 5in61forMmualtbieornry, seTeel p2a2g76e (2F4or Bfuurytheresr Guide) *Kitchen Cabinets--Dealers RHODES A G & SON, 357-63 2d, Tels 337-338 (For further information see left top lines and page 15 Buyers Guide) Knit Goods--Manufacturers Southland Knitting Co 216 Holt av (V) *Kodaks and Supplies BURKE J W CO THE, 406 Cherry, Tels 74-75 (For further information see left side lines and page 27 Buyers' Guide) Jarrett Paint & Glass Co. Pittsburgh Sun Proof Paint Wallhide Gold Stripe Brushes Window Glass Plate Glass Masonite Insulation and Presdwood May Flower Wall Paper Picture Framing Artist Supplies 320 Third St. Phones 2200-2201 Who Sells It? Is Answered By the Classified Business Lists In this Directory 566 "A SAFE PLACE TO TRADE" STERCHI'S THE SOUTH'S LARGEST HOME FURNISHERS S. W. COR. CHERRY AND BROADWAY PHONE 3100 Allied1 Labor Organizations Trades & Ry Transportation Council 408 Poplar Anderson R Lanier .ir 409 2d R421 -*AAtnkdinerssoonn MRaolblotryL C4059162dMuRl4b2e1rry R410 Amalgamated Association of Street & s' Baldwin Cecil A 516 Mulberry R407-08 Electric Railway Employees of Amer- r. Barkley Riehd D 017 Mulberry RifSl'l ica No 898 408 Poplar - Barnett John W 403 Cherry R305 AsMsouclibaeterrdy Barbers Chapter No 284 568 Bartlett Chas Bell Hallie B L 1218 Ash 516 Mulberry R320 Boilermakers Union 1502% Broadway - Benton Edw L 516 Mulberry 10th fl Brotherhood of Locomotive Engineers No Bloodworth & Bloodworth 105 Cotton 210 (C of G Div) 515 2d av R4 Brotherhood of Locomotive Engineers No Bootle Wm A 150 Cotton av R5O1-0T 786 (Sou Ry Div) 515 2d Bowlbv Noble E 617 Mulberry R316 BrEonthgeirnheoeorsd 4o0f8 LPoocpolmaor tive Firemen & < ``CCaarmlipsbleelJl Robt D Douglas C 105 Cotton av R15 150 Cotton av R501- Brotherhood of Railroad Trainmen No 07 376 515 2d - CARLISLE & BOOTLE, 501-2-3-7 Happ Brotherhood of Railway Signalmen 515 Bldg 150 Cotton av, Tels 664 and 665 2td Casson R Habernicht 516 Mulberry R215 Brotherhood of Railway Signalmen 408 Churchwell Daisy L 566 Mulberry R2 Poplar Clements F Larcus 106 Cotton R15 Central of Georgia Railway Clerks 408 Conaway Paul M 516 Mulberry R308 Poplar Central City Lodge No 256 Brotherhood of Railway Carmen 1502% Broadway Cooper Wm O jr 403 Cherry R204 CCournknin&ghCamorkC5o1l6beMrt uAlbe3r6ry2%R620d1 Clark Edgar A Lodge No 174 Ladies' Daly Augustin 566 Mulberry R3 Auxiliary O R C 408 Poplar Electrical Workers Union 408 Poplar Interior Painters & Decorators Union 408 Poplar International Assn of Machinists 408- Poplar International Assn of Theatrical Stage Employees & Motion Picture Operators Local No 507 408 Poplar International Printing Pressmen & Assistants Union No 214 408 Poplar Ladies' Auxiliary B of L E 615 2d ladies' Auxiliary B of L F & E 515 2d Ladies' Auxiliary B of R T 515 2d Macon Federation of Trades 408 Poplar Magnolia Camp No 88 WOW 408 PopShleaert Metal Workers Union 1502% Broadway United Brotherhood of Carpenters & 'Joiners No 144 408 Poplar United Garment Workers of America No 157 408 Poplar Unity Life Assurance Co 408 Poplar DeFore & Estes 516 Mulberry R501 Dunaway Ralph T 403 Cherry R705 Edwards Miller G jr 403 Cherry B618 Fausett J Albert jr 60S Mulberry R9 FFeealdgeinr TRhoDsouSgla5s16jrM10u5lbCeroryttoRn9a0v6 R2 Fowler Benj J 516 Mulberry R415 Freeman Eurastus N 564% Poplar Gillon Oscar G 566 Mulberry R2 Grace Walter J 566 Mulberry R12 GHrailcle && BGlroicche 551166 MMuulblbeerrrryy RR261154 Hancock John M 566 Mulberry R1 Hardin Alene 1218 Ash Harris John B 516 Mulberry R518 Harris Walter A 516 Mulberry R516 HARRIS, HARRIS, RUSSELL & WEA- VER, 912-919 Georgia Casualty Bldg 516-522 Mulberry, Tels 4861-4862 HHaertcrihnegr SEirdnneesyt WC 340532 C2dherry R525 Hirsch Emile 566 Mulberry R9 Hunter Sami B 316% 2d Jackson Emmett L 403 Cherry R201 *Ladies' Furnishing Goods--Retail KAYBEE STORE, 416 3d, Tel 2226 Jackson J Millard 403 Cherry R201 JACKSON & JACKSON, 201 Bibb Bldg 403 Cherry, Tel 2241 *Ladies' and Misses' Ready-to-Wear Clothing--Retail BURDEN, SMITH & CO INC, 350-356 DA3dNNanEdN4B5E0RCGheCrOry,TTHeEls, 680-803-804 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) DAY'S, 406 3d, Tel 3020 RELIABLE OUTFITTERS, 572 Cherry, Tel 2056 Jacobs Thos A jr 566 Mulberry R14 Johnston Edw P 516 Mulberry 10th fl Jones Bruce C 516 Mulberry 10th fl JJoonneess CGeBoaxSte5r16516MMulublebreryrry101t0hthflfl JONES, JOHNSTON, RUSSELL & SPARKS, 10th fl Georgia Casualty Bldg, Tels 96-97-98 Jones Robt B 516 Mulberry 10th fl Jones S Gustavus 150 Cotton av R403 Land Aaron J 516 Mulberry R914 *Lath--Metal Lane V McKibben 516 Mulberry R515- McNAIR LUMBER & SUPPLY CO, 262 5th, Tel 5200 (For further information see back cover and page 9 Buyers' 18 LeConte Jos 403 Cherry R522 Lewis C Arth 566 Mulberry R2 Guide) \ LMoawrrteinv JFarsedARjr 450136 CMhuelrbryerrRy61R8515-18 Laundries--Chinese MARTIN, MARTIN & SNOW, 618-626 Jung Frank 519 Mulberry Bibb Bldg 403 Cherry, Tel 4731 Martin T Baldwin 403 Cherry R618 Laundries--Steam CRESCENT LAUNDRY CO, 510 2d, Tel Maynard Elijah W 150 Cotton av R403 McClellan Wm A jr 566 Mulberry R8 16 (For further information see front cover and page 21 Buyers' Guide) INDEPENDENT LAUNDRY CO, 452 2d, McCREARY JOHN J, 3 Washington Block, 566 Mulberry, Tel 5626 McGowen Riehd B 566 Mulberry R5 Tels 1006-1001-1002 (For further information see right side lines and page MMiilllleerr W& aLlloawcere5y1651M6 uMlbuelrbryerrRy51R55-1185-18 22 Buyers' Guide) Moore Johnson & Thomas 516 Mulberry SNOW'S LAUNDRY & DRY CLEAN- R301 ING CO, 770 Poplar cor New, Tel 6000 Napier J Hamilton 516 Mulberry R614 KFor further information see right Nelson Peter J 403 Cherry R308 side lines and page 22 Buyers' Guide) Nottingham Geo M 516 Mulberry R410 Nottingham Harry E 516 Mulberry R410 . Lawyers Nottingham & Nottingham 516 Mul- ^Adams V Jas 516 Mulberry R501 berry R410 Akerman Chas 616 Mulberry R410 Oliver Carl S 516 Mulberry 10th fl I K7 DUNLAP-PEELER HARDWARE CO. Painters--Builders--Household and Farm Supplies Sporting Goods BROADWAY AND CHERRY STS. PHONES 26-27-634-635 Macon Federal Lawyers--Contd '-OOrlirveOr liWvearrr7e0n9 H 308 2d Forsyth Park Orville A jr 516 Mulberry R401 PARK & STROZIER, 401-404 Georgia Casualty Bldg 516-522 Mulberry, Tel 3667 *^---PPiinnddaarr Geo Mary A R 403 Cherry R705 Mrs 403 Cherry R705 Plunkett Robt G 516 Mulberry R407 POPPER JOSEPH W, 604 Georgia Cas- ualty Bldg 516 Mulberry, Tel 1376 Ramey David R 566 Mulberry R8 Reagan Frank 107 Culver (V) Renitz Benj B 216 2d Roberts Warren 403 Cherry R208 Russell H D 516 Mulberry R912 Russell Scott 516 Mulberry 10th fl RYALS, ANDERSON & ANDERSON, 409 2d R421, Tel 6311 Ryals T Edw 409' 2d R421 Sanders Wm H 516 Mulberry R308 Scarborough Richd F 516 Mulberry R407 Schmidt Burt A ns Pine cor 7th '- Smith Furman 403 Cherry R522 Smith John R L 403 Cherry R522 * Smith Robt L (c) 411% Cotton av SMITH & SMITH, Suite 522 Bibb Bldg 403 Cherry, Tel 375 Snow Cubbedge 403 Cherry R618 Sparks Augustus O B 516 Mulberry 10th fl Stern Morris L 99 Vineville av apt A3 Strozier Harry S 516 Mulberry R401 Taylor Edw F 150 Cotton av R403 Tipton Edw W 105 Cotton av R13 Turpin Wm C .ir 516 Mulberry R515-18 Turpin & Lane 516 Mulberry R515-18 Urquhart Julian F 105 Cotton av R13 Walker Chas W 409 2d R421 Wallace Weaver A&lexWHallSace516617MMulbuelbrreyrryR9R15211 1 * West Jos W 516 Mulberry R515-18 West Wm M 566 Mulberry R8 Wilson & Vandiver 150 Cotton av R305 WIMBERLY JAMES L, 316% 2d, Tel 1130 Leather Dealers Boston Leather Co 414 Poplar OWtitloenLskeyathJearkeGoHodsLeCaoth3e5r5 CPoopIlanrc 514 Poplar Letter Shops Letter Shop The 563% Mulberry Libraries Beda Etta College Library 100 Grant (V) POLK R L & CO DIRECTORY LIB- RARY, Chamber of Commerce Municipal Auditorium PWriacsehiSngBtonFrMeeemLoibrriaalryLOibrraanryge40c8orM1asitn W'a(EshMin) gton Mem orial library (c) (hr) 554 New Light, Heat and Power Companies GEORGIA POWER CO, 179 Cotton av, Tel 4100 (For further information see MAinCsiOdNe GfrAoSntCcOo,v2e1r2)0 2d, _Tel 66611, Plant 115 Mulberry, Tel 5611 "Lime, Plaster and Cement--Dealers CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) DUNLAP ROOFING CO THE, 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide)' McNAIR LUMBER & SUPPLY CO, 262 , s5ethe, bTaeclk52c0o0ve(Fr oranfudrthpeagr einf9orBmuayteiorsn' Guide) WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) *Linen Service INDEPENDENT LINEN SERVICE, 452 2d, Tels 1000-1001-1002 (For further information see right side lines and ; page 22 Buyers' Guide) Linens--Retail Madeira Linen Shop 466 Cherry * Lists--Mailing POLK R L & CO, Martin Bldg, Birm- ingham, Ala Lithographers Stecher-Traung Lithograph Corp 403 Cherry R305 AbLeirvceroSmtobciek WDmealCersjran56d3 C3dommission Kingman & Burnette 460 Plum Lee & Smith Mule Co 557 Plum 'Living Room Furniture RHODES A G & SON, 357-63 2d, Tels 337-338 (For further information see left top lines and page 15 "Buyers' Guide) Loans BROADWAY TRADING CO, 8 Jaques Bldg 407 Broadway, Tel 1701 COMMUNITY SAVINGS & LOAN CO, 201 Cotton av, Tel 6130 (For further information see left top lines and page MA23COBNuyFerEs'DEGRuAidLe)SAVINGS & LOAN ASSOCIATION, 417 Broadway, Tel 5036 (For further information see right side lines and page 9 Buyers' Guide) MACON TRADING & INVESTMENT CO, 220 Georgia Casualty Bldg 516 Mulberry, Tel 3368 (For further information see right side lines and page 8 Buyers' Guide) Loans--Collateral and Salary BIBB BROKERAGE CORP, 206-07 Bibb Bldg 403 Cherry, Tel 995 (For further information see page 23 Buyers' Guide) CCiItTizYenFsINLAoaNnCECoC4O03INCCh,er4r0y6%R2P1o7plar, Tel 5667 FINANCE SERVICE OF MACON INC, 411-13 First Natl Bank Bldg 409 2d St, Tel 366 (For further information see left top lines and page 23 Buyers' Guide) Guardian Finance Co 406 2d Industrial Loan & Investment Co Inc 156 Cotton av and 355 2d Mack Purchasing 'Co 411% 3d MACON TRADING & INVESTMENT CO, 220 Georgia Casualty Bldg 516 Mulberry, Tel 3368 (For further infor- mation see right side lines and page 8 Buyers' Guide) Mutual Investment Co 406 2d NAwTaIyO, NTAeLl 3F2I3N3ANCE CO, 461 Broad- Sanders Wm L 566 Mulberry R1 Southern Investment Co 407 Broadway R10 Loans--Mortgage Crockett Roy W 610 Mulberry Elkins Henry W 403 Cherry R202 ELKINS & CO INC, 202-03 Bibb Bldg 403 Cherry, Tel 2028 FIRST NATIONAL BANK & TRUST CO IN MACON, Cherry cor 2d, Tel 2834 (For further information see backbone, back cover and page 6 Buyers' Guide) Savings & Loan Ass'n Loans on City Real Estate 417 Broadway PHONE 5036 Polk's Rankers Encyclopedia The Bank Directory of the World issued Mar. and Sept. $15.00 per volume R. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York 56 COMMUNITY SAVINGS & LOAN CO. 201 COTTON AYE, LOANS TEL. 6130 Loans--Mortgage--Contd Georgia Loan & Trust Co 409 2d R302 Mortgage Investment Co 470 Cherry ROBERTSON-WALKER INC, First Natl Bank Bldg 415 2d, Tel 35 (For further ipnafgoerm2a9tioBnuyseeres' riGguhitdes)ide lines and SOUTHERN MORTGAGE CO, 354 1st, Tel 3315 POLK R L &" MCaOili,nMg aLritsitns Bldg, Birmingham, Ala "Mantels, Tile and Grates W3IdL,LITNeGlsH2A7M7-27S8A-2S7H9 &(FDorOOfuRrthCeOr, 4in57formation see right top lines and page 24 Buyers' Guide) *Loans--Federal Housing Administration ROBERTSON-WALKER INC, First Natl iBnafonrkmBaltdiogn41s5ee2dr,igThetl 3s5id(eFolirnfeusrtahnedr page 29 Buyers' Guide) "'Local and Long Distance Hauling WASHBURN STORAGE CO, 201 Poplar, Tel 5376 (For further information see front stencil and pages 30 and 33 Buyers' Guide) Locksmiths Huhn H & H R 419' 2d *Luggage Dealers DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see -page 112 Buyers' Guide) Lumber--Retail BUILDERS LUMBER CO, 130 Cherry cor 6th, Tels 467-468 Chamber Lumber Co Inc 150 Railroad av (V) Hillman Robt H 736 Hillyer av CCH) LMoavceolanceLuRmalbpehr ACo40815PlBumromadewrsayal McCook J W Lumber Co Broadway se cor Ash Middle Georgia Lumber Co ft Kemper Sherwood Lumber Co 800 San Juan av Lumber--Wholesale Chapman HD&Co 617 Mulberry R203 Halligan & McLellan Inc 403 Cherry R420 James Lumber Co ft Poplar James & Kingman Lumber Co ft Pop- lar Moyer Harvey P '1133 Vineville av (V) Redding W C Lumber Co 407 Broad- way R16 Reid H M & Co 617 Mulberry R203 Richardson Lumber Co 409 2d R505 Riverside Lumber Co ft Poplar Ross T L Lumber Co 409 2d R507 *Lumber Manufacturers and Dealers CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Manufacturers Agents Akers Wm D (tobacco) 403 Cherry R704 Blossom Geo L 559% Mulberry Markets--Public Georgia Market House 460 2d Georgia State Farmers Market 430 Ogle- thorpe Mattress Manufacturers BIBB MATTRESS CO, 415 Pine, Tel 5576 Macon Mattress Co 325 Oglethorpe MEADERS MATTRESS CO, 425 Arch, Tel 5136 Meats--Retail Allen R B .& Son 512 2d Boone John D 514 Pine Broadway Cash Market 410 Broadway Brown Leon D 2015 Vineville av Chanin Barnett 161 5th Davis E Clifford 2904 Forsyth ml DDaevanis OWtims G(cr)oc2e7ry5 M478adiCsoontton av Great Atlantic & Pacific Tea Co (For branches see Alphabetical Section) Green Lewellyn D 707 Log Cabin blvd HHaamrplinGeWner'aEldwM 32968 MClaaiynton(EM(V)) Harris Andrew L 248 Main (EM) Henderson-Turner Co 1000 Napier av tHendley Wm T 33 Bellevue rdi HKoamshe &MaKrkaertryCoMa4r6k4et2d412 2d Kennington Godfrey A 338 Main (EM) King Jas R 1913 Vineville av (V) Leoptrot's Market 1003 Broadway Lyons Cash Market 288 Washington av Marvin's Grocery 2105 Vineville av McAfee Robt K 2101 Vineville av MULBERRY MARKET, 418-22 Mul- berry, Tel 4181 (For further information see left side lines and page 13 Buyers' Guide) Oates Market 474 2d Pleasant Hill Cash Market 425 (424) 3d av (V) Rogers Stores (For branches see Alphabetical Section) Rushin W Clifford 818 Vineville av (V) Sagnibene Jos 1301 Broadway Sam's Market 316 Main (EM) Trawick John C 1007 2d Vineville Packing Co 123 Hardeman av Warren Hubert E 203 Hardeman av Wilder Lillian Mrs Bellevue rd nw cor Melrose (B) Williams Chas H 101 Bellevue rd Lunches--Prepared and Supplied Pattillo Lula W Mrs 114 Buckingham pi ' Machine Shops--Automotive MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) "Machine Shops, Foundry and Boiler Works TAYLOR IRON WORKS & SUPPLY CO, 1014 Broadway, Tel 102 (For further information see page 24 Buyers' Guide) Macon MachinMe aSchhionpist4s51 Wall Meats--Wholesale Armour & Co 250 Broadway Swift & Co 361 Plum T & T Packing Co Division cor Boun- dary Medicine Manufacturers--Patent and Proprietary Marshall Larkin (c) 157 5th' Men's Furnishings--Retail (See also CloBtohyins'g--DReeataleilr)s--Men's and Dixie Jobbing House 554 Poplar Mercantile Agencies DUN & BRADSTREET INC, Suite 709- 10 Bibb Bldg 403 Cherry, Tel 184 569 Mercantile Agencies--Contd MACON CREDIT BUREAU, 316 Geor- gia Casualty Bldg 516-522 Mulberry, Tels 681-882-683 (For further information see right side lines and page 11 Buyers' Guide) Messenger Service Parcel Delivery Co rear 652 Cherry *Metal Laths WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Atkins Miz (c)M7id4wiOvelisver av (SM) Collins Roberta (c) 118 Neal av (V) George Amelia (c) 440 Liberty (SM) Irving Delia (c) 231 Norris (EM) (SeMe ilaklsoDeDalaeirrsies) Dixie Dairies 658 Arch Durr's Creamery 800 Montpelier av Rivoli Dairy New Columlbus rd RID Mill Supplies Corbin Supply Co 502 Broadway Mlacon Supply Co 25 5th TAYLOR IRON WORKS & SUPPLY CO, 1014 Broadway, Tel 102 (For further information see page 24 Buyers' Guide) Milliners Belle Millinery Co 451 3d DANNENBERG CO THE, 462-70 3d, Tel 614200B(uFyoerrs'furGthueidrei)nformation see page DAY'S, 406 3d, Tel 3026 Hat Box The 412 Cherry Suzanne Hat Shop 568 Cherry Millwork WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Mimeographing MACON TYPEWRITER & OFFICE SUPPLY CO INC, 414 Broadway, Tel 1087 Mirror Manufacturers Macon Mirror Works 1127 Broadway Monumental Work Clark Memorials Inc 2200 Forsyth rd *Morticians HUTCHINGS' FUNERAL HOME (O, 518 New, Tel 2044, Night Tels 2044, 3439 and 3728 (For further information see left top lines and page 15 Buyers' Guide) PITTS MORTUARY, 814 Mulberry, Tels 146-147 (For further information see right top lines and page 14 Buyers' Guide) Mosaic Work Cassini Louis 620 Carling av Motion Picture Theatres Capitol Theatre 368 2d Douglass Theatre (c) 357 Broadway Grand Theatre 617 Mulberry Macon Little Theatre 619 Ocmulgee Rialto Theatre 173 Cotton av Rite Theatre 418 Cherry Moving, PaSchkiipnpgi,ngStorage and TAYLOR TRANSFER CO, 458 Plum, Tel 3to8p8 l(iFnoesr faunrdthpeargienf3o2rmBautyieorns' sGeeuildeef)t IVTiieiir* Tpiirliprc Becker Ida Mrs (piano) 310 Cherokee Boone Eliz (piano) 652 Pine Chambers Minnie L Mrs (piano) 139 Daisy Park Charles Sourie G Mrs (piano) 520 Or- ange apt 1 Clemons Mamie (c; piano) 104 Spring Colquitt Mary (piano) 105 Clayton (V) Edenfield Margt Mrs (violin) 500 Holt av (NHts) Fernandez Lott P (guitar) 909 Walnut Giglio Cecilia Mrs (piano) 800 Orange Glover Eliz Mrs (piano) 520 Orange apt 1 Grechi Gueseppi (clarinet, saxaphone) 125 Beech av Harper Eunice (voice) 716 Mulberry Holliman Annie L (piano) 153 Summit av (NH) Johnson Clebie Mrs (vocal) 554% Mul- berry Jones Lucille Mrs (piano) 554% Mul- berry Jones Marianne 494 Orange Latimer Florine (piano) 111 Cleveland av (V) MMaarytsin,RHacahidaeeel J(pia(pnioa)no7)02 1N15a5piAershav MeCarren Helen G (piano) 389 Orange Reynolds Nellie M (piano) 216 Mag- nolia Richardson Mary H (piano) 201 Hill Crest av (CH) Walker Robt L (piano) 506 Orange Walker Wm F .ir (cornet) 620 Arch Weisz Jas G (saxaphone) 800 Orange Williams Mary (piano) 107 Virginia av Music and Musical Instruments-- Elbert Jas M 65D2ea2ledrs Guttenberger Music Shop 353 3d! WILLIAMS MUSIC CO, 419 3d, Tel 3831 (See also EmNbeerodildeweroyr,k Hemstitching Macon Pleatainngd SShtaomp p6i2n0g%) Cherry News Dealers--Retail Union News Co Terminal Station News Dealers--Wholesale Bibb News Co 563 Broadway Southern News Co bsmt 403 Cherry News Service Bureaus Ahern J Francis 563 Broadway Chapman Lewis P 559 Broadway MACON EVENNeIwNsGpapeNrsEWS, 450-452 Cherry, Tel 6500 (For further information see opposite title page) MACON TELEGRAPH THE, 450-452 Cherry, Tel 6500 (For further information see opposite title page) Miacon Telegraph The (colored branch) 558 New Novelties--Manufacturers Edwells Trick & Novelty Co 320 2d Nurseries IDLE HOUR NURSERIES, 109 Cotton av, Tels 223-224; Greenhouses Forsyth rd nr Rivoli, Ga, Tel 875-J (For further information see top stencil and page 13 Buyers' Guide) Nurses BBaanrrkosn MMaattritehaL 277021 CFoollresgyeth Bizzell Mary L Mrs 712 Hillyer av Blount Frances Mrs 3809 'Houston av (S M) Bond Rayme 272: College Booker Ruth 860 New 125 ROOMS Mulberry at Broadway Tel. 4600 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 570 DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of Practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on u9 R L. POLK & CO. DETROIT WOOD-PEAVY FURNITURE CO. Macon's Oldest Furniture Store MACON, GEORGIA Triangle Block, Entrance on Cherry, Second and Cotton Ave. Tel. 1S3 Nurses--Contd Brewer Nina L Mrs 535 Georgia av Brown Mabel Mrs 2908 Forsyth rd Bruner Sulinda Mrs 2129 Broadway Bryan Louise 845 Courtland aV Burnette Annie L 216 Adams Burton Sarah 233 Bond apt 1 Oarey Aurie 722 Mulberry Cauthen Caroline 129 Rembert av Charleston Equilla C (c) 243 Jones Cone Osolene Mrs 206 Rutherford av (SM) Cooper Julia 233 Bond apt l1 Copeland Mary 278 College' Davis Lemuel B 401 Napier av Devlin Sarah 236 High. Donaldson Annie (c) 164 Lynwood av (V) Emerson Martha 264 Columbus Fryer Rose L 260 Winship (WH) Gardner Ella F (c) 120 Green Gose Annie L 533 Orange apt 21' Hardman Margt C Mrs 3805 Houston av (SIM) Harper Nora Mrs 204 Mikado av (SM) Harrison Erma Mrs 516 Orange HHuarmtlpehyreRyusbMye C53a3mmOruaentgt e10a1ptRi2d1ge av (V) _ Jackson Blanche 554 Orange Janney Mary F 637 Forsyth Joanis Marian Mrs 125 Curry pi (NH) Joiner Cora Mrs 516 Orange Lawrence Beatrice (c) 347 4th av (V) T .ifspy Hewlitt M 215 Clisby pi (V) MacvDer(mSMot>t Sarah Mrs 206 , Rutherford ,, McDuffie Sarah 213 Bond apt B4 McGee Erith E 862 New Maddison Irene (c) 955 Hazel Maddox Mary 216 Adams Mathews Erma 262 Columbus Newman Florida 34 Arlington pi Nonris Ethel 855 Mulberry apt 102 Olive Verna 262 Columbus Patterson Hilda 860 New Phillips Abbie 272 College Powell Mary A 855 Mulberry apt 102 Presley Julia 860 New Rachels lone 121 Holt Raigin Marie (c) 269 Madison Redding Mattie M 280 College Roger Ann 147 Rose Park Slappey Virginia 865 Orange" Spear Jewel 616 Arch Stevens Minnie Mrs 261 Georgia av apt TaCy4lor Bessie 514 Orange Thompson Eldora 216 Adams Todd Hath 262 "Columbus! Twillery Maude 250 College apt 3 Waldorf Leila 104 Ayers blvd! Walker Daisy G (c) 235a Middle (V) Ward Helen 736 College Wheeler Julia 711 Orange Wilder Hattie E 126 Stonewiall pi (V) Woods Lummie 131 Cole Wright Doris W 862 Orange Young Loette 3004 Houston av (SM) Nuts--Dealers and Importers Dixie Peanut Co 617 Poplar Lewis Pecan Co 455 Broadway Middle Georgia Pecan Growers Assn 100 Mulberry National Pecan Marketing Assn 100 Mulberry Royal Peanut Co 212 Cotton av Office Supplies and Equipment BURKE J W CO THE, 406 Cherry, Tels 74-75 (For further information see left side lines and page 27 Buyers' Guide) ,,. ,, , _ Macon Typewriter & Office Supply Co Inc 414 Broadway McClure Office Equipment Co 560 Mul- Remington Rand Inc 516 Mulberry R104 Oils and Lubricants--Dealers American Oil Co (bulk plant) 75 Pop- lar Anderson Oil Co 155 5th Atlantic Refining Co 571 Mulberry Georgia-Carolina Oil Co Inc 603 Ham- mond Gulf Oil Corp (plant) 210 Edgewood av (SM) Power Oil Co Inc 1053 5th and 511 Pine Shell Petroleum Corp (office) 1368 Broadway Sinclair Refining Co 333 Hammond SStteawndaartrdOOililCCo o103507Oc(1m19u)lgeBeay TEXAS CO THE, 770 Division, Tel 200 Wofford Oil Co 101 Walnut Opticians--Retail DANNENBERG CO THE, 462-70 3d, Tel 6400 (For further information see page 12 Buyers' Guide) Kalish Optical Co 563 Cherry Keily Wm B 505 Cherry Macon Optical Co 453 Cherry National Optical Stores Co 403 Cherry R412 Rex Optical Co 504 Mulberry Opticians--Wholesale American Optical Co 516 Mulberry R109 Southeastern Optical "Co 358 2d Optometrists EFRthIrEidDgMeARNo'Sbt JAEW3E66LE2RdS, 566 Cherry, Tel 6344 (For further information see left side lines and page 21 Buyers' Guide) SHpilrbautlni'nsg 62J0 HCohoekrry652 Cherry *Orthodontist CHILDS WYATT B, 701-703 Georgia Casualty Bldg, Tel 4341 Osteopathic Physicians Chaplin Art'h W 403 Cherry R219 Jelks Albert A 516 Mulberry R519 Jones Frank F 409 2d R406 Jones Grover C 403 Cherry R610 * Overhead Doors DUNLAP ROOFING CO THE, 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) *Packers and Shippers TAYLOR TRANSFER CO, 458 Plum, Tel 388 (For further information see left top lines and page 32 Buyers' Guide) *Paint, Oil and Glass CENTRAL SASH & DOOR CO, Water- viile rd sw cor Steele, Tel 5011, Mam Office 354 2d, Tel 3011 (For further information see back cover and page JA2R3 RBEuTyTersP'AIGNuTide&) GLASS CO, 320 3d, Tels 2200-2201 (For further information see right side lines and page 25 Buyers' Guide) SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' WGILuLidINe)GHAM SASH & DOO,,R CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Paint, Oil and Varnish Dealers--Retail DCoUleNyLPAaPi-nPtEE&LEHRardwHaArReDCWoA4R59E 3dCO, Cherry se cor Broadway, Tels Store 26, Office 736 (For further information see right top lines and page 16 Buyers Guide) '* A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET PHONES 946-947 Faint, Oil and Varnish Dealers--Retail LO--MCAoXnt-dHAKRIS PAINT CO, 415 3d, Tel 5151 McMillan E C Paint & Glass Co 358 3d SCHALL PAINT CO INC, 307 Mulberry, Tfreolnt326co(vFeorr faunrdthepraignefor2m5 atiBounyesrese SEGAuRidSe,) ROEBUCK & CO, 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) Bazemore & Golsan 516 Mulberry R817 Boswell Chas W 516 Mulberry R709 Brown J Frank 722 Spring Chrisman Wm W 700 Spring R210 Clay J Emory 567 Walnut Coleman Young R 124 Hardeman av Corn Ernest 700 Spring R301 Daniel Orman 409 2d R512 DAVIS F CLARK, 504 Mulberry, Tel 2700 DDoavveisWWmanBza6A17 (Mc)ul5b5e6rrNy eRw21R5412 Dyer Crawford (c) 119 Tatnall Fountain Jas A 516 Mulberry R417 Paint and Color Manufacturers Southern Paint & Varnish Co 561 Mul- berry Frayser W Neale (c) 526 New R400 Gibson Obediah C 362% 2d Golsan Willard R 516 Mulberry R817 Goolsby R Cullen 700 Spring R320 Painters and Decorators HStiagphlteotwoner JJaoshnAW201124SiGmrmadonys'(SM) Gostin Bernard S 636 Orange Hall John I 516 Mulberry R818 HaTlhl roTaht)o,s SuHite (E4y16e, GEraarn,d NBolsdeg. and 617 ^Painters' and DSeucoprpaltioesrs' Materials and SOUTHERN PAINT & VARNISH CO, 5in61forMmualtbioenrry,seTeel p2a2g7e6 (2F4or Bfuurytehresr Guide) Mulberry, Tel 4216 Harrell Sandy B 605 Cherry Harris Ernest C 403 Cherry R509 Harrold Chas C 700 Spring R210 Harrold Thos jr 700 Spring R210 Holmes John R 516 Mulberry R204 Hurley Thos A 567 Walnut *Paints _ PEASLEE-GAULBERT AND DU PONT, Willingham Sash & Door Co Dealers, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Keen Osee F 1309 Oglethorpe Keiser John M 403 Cherry R312 Kemp Paul S 516 Mulberry R804 King Jas L 516 Mulberry R418 Martin John W 403 Cherry R718 Massenburg Geo Y 567 Walnut McAfee Linton C 567 Walnut *Paints, Oils and Varnishes SOUTHERN PAINT & VARNISH CO, 5in61forMmualtbioenrry,seTeel p2a2g7e6 (2F4or Bfuurytehresr Guide) McLaughlin Chas K 567 Walnut Meriwether Wm W 516 Mulberry R520 Miller Geo T 323 Georgia av Miller John N 516 Mulberry R510 Mitchell Frank B 21 Arlington pi Mitchell Melvin C (c) 552 New *Paints, Varnishes and Enamels GRFAacYtoSryEADLis, tSriCbuHtAorLsL30P7AMINuTlbCerOry,INTCel, 326 (For further information see front cover and page 25 Buyers' Guide) Mobley Walter E 700 Spring R220 Moses Harry 403 Cherry. R515 Newman Wm A 700 Spring R310 Newton Ralph G 516 Mulberry R804 Palmer Sami B 403 Cherry R723 Phillips A Maynard 516 Mulben-y R818 Paper Dealers--Wrapping--Wholesale Hirsch Jacob 352 Plum Macon Paper Co 513 5th Standard Paper Co 518 Broadway Porch Leon D 516 Mulberry R810 RRaicwhlasrdLseownisCLhas51H6 M70u0lbSeprrryingR7R10330 Richardson Rhea W 516 Mulberry R904 Ridley Chas L 820 Pine Parks and Playgrounds Rogers Jos W 201% Cotton av Central City Park 7th nr Ocmulgee Mercer Stadium ss Morgan av nr Oak- land av (WH) . Ocmulgee Park end Corbin av (V) PWriacsehinLgibtoranirvPaPrkarkCoOllreagnegeatcWor as1hsitng- ton av Weir Cynthia Park Edgewood av sw cor 2d Rogers Thos E 700 Spring R330 Ross Thos L jr 700 Spring R330 Rozar A Robt 1309 Oglethorpe Rubin Sami N 617 Mulberry R403 Selden John A 516 Mulberry R801 Siegel Alvin E 516 Mulberry R607-11 Smith J Allen 700 Spring R220 Smith Relliford S (c) 319% Broadway Suarez Raymond 516 Mulberry R715 Swilling Evelyn 521 Mulberry R715 Pawnbrokers Avrunin Louis 508 Poplar Goldman Pawn Shop 318 3d Thomas Wm Thompson O HRic(hc)d 266A Main 700 Spring (EM) R201 Walker Duncan D 700 Spring R201 Ware Ford 516 Mulberry R901 Photographers Wasden Chas N 516 Mulberry R818 Atwood E Jay 210% Cotton av Capitol Art Studio 362 % 2d Coke's Studio 161% Cotton av Film Shop The 123 Cotton av Metro Studio 572% Cherry Mize Clarence S 620% Cherry Watson Weaver Otho O 567 Hudnall G Walnut 700 Spring R_023_0. Weaver Olin H 700 Spring R230 Williams Joshua S (0 556 New R404 Williams W Augustus 512! Mulbeiry R710 Williams Wm C jr 403 Cherry R516 Warlick Hillyer C 117 Cotton av Physio Therapists Photographic Developing and Printing Farrar Wm E 280 College Brown Geo T 412 Walnut McArthur Lucile W Mrs 353 1st Physicians and Surgeons AAdLaDmRsICIrHby'FHRE5D16 NM,ul4b2e0rryGeRo8r0g4ia Cas- ualty Bldg 516 Mulberry, Tel 3387 Anderson Carl L 700 Spring R310 Anderson Jas C 516 Mulberry R710 Atkinson Harold C 700 Spring R101 Bashinski Benj J 700 Spring R320 Bazemore Wallace L 516 Mulberry R817 Piano Tuners and Repairers Hammond Andrew J 283 Rutherford av (SM) ^Picture Framing JARRETT PAINT & GLASS CO, 320 3d, Tel 2200-2201 (For further informaRtioovnersse'eGruigidhet) side lines and page 25 MAILING LISTS Complete Accurate for Any Locality Write for Catalog "Mailing Lists That Pull" It's Free R. L. POLK & GO. Directory Publishers Detroit, Mich. We make up Special Lists j 572 MORGAN & MORGAN FIRE AND CASUALTY INSURANCE 603-605 Grand Bldg. SURETY BONDS Telephone 1811 Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume R. L. Polk & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York *Piston Bings MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) McNAIR LUMBER & SUPPLY CO, 262 5th, Tel 5200 (For further information see back cover and page 9 Buyers' Guide) ^Piaster and Plaster Board WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) *Pleating and Fluting CRESCENT LAUNDRY CO, 519 2d, Tel 16 (For further information see front cover and page 21 Buyers' Guide) INDEPENDENT LAUNDRY CO, 452 2d, Tels 1000-1001-1002 (For further information see right side lines and page 22 Buyers' Guide) LEE A B PLUMPBluINmGber&s HEATING CO, 258 2d opp Court House, Tel 2-851 (For further information see left top lines and page 27 Buyers' Guide) Plumbers, Steam and Gas Fitters Criswell Andrew F 411 Cotton av Daly F X Co 613 Poplar Davis D Plumbing & Heating 25 Wall LIrebeyABBroPsluImncbin5g69&MHuelbaetirnryg Co 258 2d Macon Plumbing & Heating Co 615 PopMiller Bros 222 Cotton av MICLOU, R10O7NCSotPtoLnUaMvB, ITNeGl 31&76H(EFAorTIfNurG- ther information see right top lines and page 26 Buyers' Guide) SWhOroOpDshiTre LJoPhLnUMT B5I1N7GCo&ttoHnEAavTING, 512 1st, Tel 529 (For further information see left top side lines and page 26 Buyers' Guide) Yetter Geo F Inc 451 Cotton av BURKE J W CO THE, 406 Cherry, Tels 7le4f-t75sid(eFolrinefsurtahnedr pinagfoerm27atioBnuyesrese' Guide) Coggin & Mann 618 Poplar Flynn Printing Co 505 Broadway Holt & Hanberry 314 Broadway JO3N08E7S(F&or CfuOrNthEeYr ,in4f1o1rmBartoioadnwsaeye,paTgeel 27 Buyers' Guide) Lyon Harris & Brooks 560 Mulberry Murray Printing Co 471% 3d Smith & Watson 517 Poplar Produce Commission Merchants (See also Fruit Dealers--Wholesale) Burney Bros Co 451 5th FKreenetm&anH-Deerinnt-S5 uTlleirvmaninaClOa4v53 5th DonovanPrPordoudcueceDCeaole6r5s--9 PRoeptalialr Prince Produce Co 422 2d Richardson Produce Co 617 Poplar HOLT A-rTropCeOr,ty56M9 aMnauglbeemrreyn,t Tels 946947 (For further information see right top lines and page 28 Buyers' Guide) GEORGIA POWER CO, 179 Cotton av, Tel 4100 (For further information see inside front cover) Publishers--Book, Newspaper and Macon TelegraPpehriodPiucballishing Co 450 Unerry ^Publishers--Newspaper MCOT2HLEJ, E4L5E0GCRhAePrrHy, TPeUlB6L5I0S0HI(NFoGr further information see opposite title page) Gnnalds APruchrchSasi(nlmg bAr)gen6t1s7 Mulberry Radiator Repairers--Automobile Georgia Radiator Co 614 3d *Plumbing Repairs LEE A B PLUMBING & HEATING CO, 258 2d opp Cuurt House, Tel 2851 (For further information see left top lines and page 27 Buyers' Guide) Plumbing Supplies--Dealers Crane Co 500 Broadway Noland Co Inc 550 Broadway ^Plymouth Dealers YATES MOTOR CO, 707 3d and 510 Pine, Tels 1445-1446 (For further information see left top lines and page 3 Buyers' Guide) Potato Chip Manufacturers Stansell Potato Chip & Sandwich Co 516 1st General ReductiPoontteCroiesft Poplar Poultry Dealers--Retail Bibb Poultry Co 419 Cotton av Smith Thos E 422 2d Poultry Supplies Karsten & Denson Co Inc 517 3d Printers--Book and Commercial American Printing Co 552 Mulberry BIBB PRINTING CO, 518 1st, Tel 1671 (For further information see page 27 Buyers' Guide) rtauio Broadcasting Stations Southeastern Broadcasting Co Inc 211 Cotton av W M A Z 211 Cotton av Radio Repairing SJoEnAeRsSMRaOlcEoBlmUCDK j&r C61O9, 5M52u-l5b6er3rdy, Tels 3326-3327 (For further information Guide)ht t0P UneS and page 11 Buyers' Radio Sets and Supplies--Retail Dasher Electric Co 312 3d Evans Rufus R 113 Cotton av FRTIeElD6M34A4N('FSorJEfWurEthLeEr RinSf,or5m60atCiohnersreye, Gleuftides)ide lines and page 21 Buyers' Radio Service Co 722 1st RHODES A G & SON, 357-63 2d, Tels 337-338 (For further information see left top lines and page 15 Buyers' Guide) SEARS ROEBUCK & CO, 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) Stanton Sound Service 203 Cotton av Radio Sets and Supplies--Wholesale White Guy M 654 Mulberry MaconRTaielrrmoaidnaPl a5stshenagterChSetarrtiyons Terminal Station 5th at Cherry 573 MACON Moving - Packing - Crating Prompt Efficient Service TRANSFER NEW AND USED FURNITURE CO. 408 BROADWAY PHONE 304 Railroads Atlanta & West Railroad (frt agt of- fice) 403 Cherry R605 Central of Georgia Railway 101 Term- inal Sta , Georgia Railroad (frt agt) 403 Cherry R605 ., ,, Georgia Southern & Florida Railway Co (frt depot) Plum sw cor 5th Louisville & Nashville R R coml agt 201 Terminal Station Macon Dublin & Savannah Railroad Co 106 Broadway ,, .,, Nashville Chattanooga & StLouis Rail- way 403 Cherry R209 Norfolk Southern Railroad 407 Broad- way R15 , ,, Seaboard Air Line Railway 403 Cherry R 302 South Western Railroad Co 516 Mul- berry R808 Southern Railway System (frt depot) Plum sw cor 5th Western Railway of Alabama (frt agt)s 403 Cherry R605 Reading Rooms Christian Science Reading Room 516 Mulberry R314-15 Real Estate Adams Realty Co 504 Mulberry Avant Norman A 105 Cotton av R1 Bloch Carl 472 Broadway Burns Kenmore Inc 157 Cotton av Clemons Sol C (c) 465 Cotton av Cullen L J Co The 409 2d R418 Damour Hypolite 421 Walnut Damour Paul 421 Walnut Davis J LaFayette 557 Mulberry Hardeman G G Co 563 Mulberry HATCHER & McCRARY INC, 508 Mul- berry, Tel 6186 (For further information see back cover and page 19 Buyers' Guide) HOLT A T CO, 569 Mulberry, Tels 946947 (For further information see right top lines and page 28 Buyers' Guide) Johnson Arth M 105 Cotton av R15 MAACSOSONCFIAEDTIEORNA,L 4S1A7 VBINroGaSdw&ayL, OTAeNl 5036 (For further information see right side lines and page 9 Buyers' Guide) mMiukardpohReyea,ltTyaCyol4o7r0 C&heerlrlyis inc, 470 Cherry, Tels 267-268 and 269 (For further information see front cover and page 28 Buyers' Guide) Napier E Tris Co 421 2d Realty Investment Co 321 Mulberry Roberson Realty Co 361 Cotton av ROBERTSON-WALKER INC, First Natl Bank Bldg 415 2d, Tel 35 (For further information see right side lines and page 29 Buyers' Guide) Stokes Thos W 156 Cotton av THOMAS ROBT O, 569% Cherry, Tel 1067 (For further information see right top lines and page 29 Buyers' Guide) Vincent F T Realty Co Inc 154 Cotton av Willingham Loan & Trust Co 350 2d *Real Estate Loans CITIZENS & SOUTHERN NATIONAL BANK THE, 3d cor Cherry, Tel 4671 (For further information see front cover and page 5 Buyers' Guide) FIRST NATIONAL BANK & TRUST CO IN MACON, Cherry cor 2d, Tel 2834 (For further information see backbone, back cover and page 6 Buyers' Guide) HATCHER & McCRARY INC, 508 Mulberry, Tel 6186 (For further information see back cover and page 19 Buyers' Guide) HOLT A T CO, 569 Mulberry, Tels 946947 (For further information see right top lines and page 28 Buyers' Guide) Real Estate Owners and Dealers City Investment Co 470 Cherry Vineville Improvement Co 409 2d R321 'Realtors DESSAU REALTY & INSURANCE CO, 101 Georgia Casualty Bldg 516 Mulberry, Tels 271, 272 and 273 (For further information see page 29 Buyers HATCHER & McCRARY INC, 508 Mul- btieornrys,eTe ebla6c1k86co(vFeorrafnudrtphaegrein19foBrmuya-- ers' Guide) _ , HOLT A T CO, 569 Mulberry, Tels 946- 947 (For further information see right top lines and page 28 Buyers' Guide) MURPHEY, TAYLOR & ELLIS INC, 470 Cherry, Tels 267-268 and 269 (For fur- ther information see front cover and page 28 Buyers' Guide) THOMAS ROBT O, 569% Cherry, Tel 1067 (For further information see right top lines and page 29 Buyers Guide) *Refrigeration Supplies--Wholesale LOWE ELECTRIC CO, 131 Cotton av, Tel 6300 ^Refrigerators--Electric SEARS, ROEBUCK & CO, 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) T?pnfn1 Ap'ATlfc DESSAU REALTY & INSURANCE CO, 101 Georgia Casualty Bldg 516 Mulberry, Tels 271-272-273 (For further information see page 29 Buyers' Guide) HATCHER & McCRARY INC, 508 Mulberry, Tel 6186 (For further information see back cover and page 19 Buyers' Guide) HOLT A T CO, 569 Mulberry, Tels 946947 (For further information see right top lines and page 28 Buyers' Guide) MURPHEY, TAYLOR & ELLIS INC, 470 Cherry, Tels 267-268 and 269 (For further information see front cover and page 28 Buyers' Guide) NROevBaErrRoTASOpaNrt-mWeAnLtsKCEoR3I2N1 CM, uFlibresrtryNational Bank Bldg 415 2d, Tel 35 (For further information see right side lines and page 29 Buyers' Guide) THOMAS ROBT O, 569% Cherry, Tel 1067 (For further information see right top lines and page 29 Buyers' Guide) Repair Shop Skelly Edison 1034 Broadway Restaurants and Lunch Rooms Adams Buffeteria 425 Wall Alexander C W (c) 115 Telfair Amerson's Sandwich Shop 462 Cherry Andrews Chas (c) 101 Hardeman av Bailey Sami A 625 Oglethorpe Bankston John E 508 3d Barfield Robt M 25% Bellevue rd Basser Bath Clinton nr River rd (EM) Belos Louis 29 Wall Berry Claiborne B (c) 656 Poplar Betsy Ross Coffee Shop 513 Cherry Bloodworth Frances 311 Mulberry Bon Ton Cafe 301 Cherry Booth's Cafe 440 Oglethorpe Broadway Lunch (c) 361A Broadway Brooks Obie (c) 344 Gilmer Brown Rosa M (c) 207 5th Busy Bee Lunch 1007 Broadway YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Of Your CITY 574 0. H. Adams Motor TAYLOR TRANSFER COMPANY 458 PLUM ST. STORAGE SHIPPING PACKING PHONE 388 Go. Studebaker Willys Hupmobile Sales Service 655-657 Third St PHONE 2997 YOUR CITY D I R E C T O R Y MIRRORS the CIVIC Life Of Your CITY Restaurants and Lunch Rooms--Contd Chicken Grill 1890 Vineville av (V) Cobb Lee (c) 1122 Broadway Colbert Annie L (c) 212 (307) Elizabeth (SM) Cole Edw R (c) 353 Broadway Combs Grover C 2996 Houston av (SM) Cox Wilmer M 3403 Houston av (SM) Crwawayford's Barbecue Lunch 677 BroadCrescent Restalurant 623 3d Curtis Nettie (c) 701 Elbert (SM) Dannenberg's Cafeteria 462 3d DeLuxe Cafe 555 Cherry Dixie Cafe & Commissary ns Pine cor 7th Douglass Hotel Grill (c) 363 Broadway Dumas Hamlet H ft Poplar Ellis Cafe 456 Poplar Eveready Lunch Room (c) 627 Division Fincher Douglas B 3212 Houston av (S M) Fultz Homer (c) 460 (456) Clinton (E M) Gibson Lawrence H (c) rear 303 North (V) Green Foushious s (c) 525 Waterville rd Gregory Juanita Mrs 516 Mulberry R103 Greyhound Sandwich Shop 320 Broad- way Harden Gilbert (c) 112 Edgewood av Harris Mattie Mrs 201 Poplar Harry's Cafe 311 Cherry Hathaway Wm H 268% Main (EM) Hickey's Coffee Shop 310 Broadway Higgins Leila Mrs 2226 Forsyth rd Hill Viola (c) 348 (336) Monroe HHootlemlesDeTmayplsoery (Dc)in2i2n3g 5Rthoom 363 3d Hotel Dempsey Tavern 363 3d HOTEL LANIER CAFE, 525 Mulberry, Tel 2771 (For further information see left side lines and page 17 Buyers' Guide) Ingram Sami (c) 429 Cotton av Ivey Edw (c) 123 Middle (V) Jackson Joshua R 806 Hazel Johnson Willie 176 Hazel Jones Dalton L (c) 613% Broadway Jones Irene (c) 207 Division (T) Jones Lillian (c) 207 (310) Elizabeth (S M) Kitchen's Kitchen 572 Mulberry Leary Robt (c) 101 Franklin LMyalecsk BCehnajsF(c5)541M19ul(b1e4r6r)y Hudson Macon Cafeteria 415 Cherry Mathis Frank (c) 336 Monroe McCall Josephine Mrs 1241 Broadway Miller Sami 464 Poplar Milner Willie (c) 455 Clinton (EM) Minute Lunch 320 2d Moaovre's Dinty Lunch Room 224 Cotton Morris Sami (c) 610 (270) Prince (SM) Mutt & Jeff Lunch 2002 Vineville av (V) New Life Lunch 226 Cotton av New Yorker The 312 2d Nu Way Weiner Stand 218 Cotton av Peeler Wm H 26 Bellevue rd Pig'n Whistle Sandwich Shop 605 Georgia av Plantation Lunch 515 Broadway Plaza Cafe 310 2d PPooulalors BGeeaor 3T14he3d2915 Forsyth rd Redd Lula (c) 405 Madison Rice Wm J 312% Main (EM) Robert's Cafeteria 668 Cherry Roberts Drew M 504 Plum Rogers Rufus M 4011 Houston av (SM) Sappington Alberta (c) 550 Hammond Saratoga Restaurant 26 Wall Searcy Henry (c) 217 (103) Bay Seay Robt (c) 133 (405) Tinsley la Second Street Cafe 516 2d Shank Elsie (c) 326 Ward (V) Shorty's Tavern 2915 Houston av (SM) Silver Moon Cafe 311 Broadway Simmons Wm S 414 2d Sims Jas (c) 1100 Montpelier av Six Point Lunch 469 Cotton av Smith Chas L 117 Douglas av (V) Smith Chas L 467 2d Smith Misha (c) 931 Pio Nono av (V) Smith Felix (c) Clinton (EM) Smith Jas A 421 3d and 2005 Vineville av (V) Smith Lonnie (c) 241 Cedar (U) Smith Wm (c) 361 Broadway Smith Wm L (c) 970 Ocmulgee Southland Coffee Shop 567 Broadway Speller's Restaurant 470 Mulberry Stephens Arth (c) 344 Middle (V) Stewart Jas T 266 Main (EM) Su(mSMm)erford John (c) 711 (617) Prince Taylor Chas (c) 301 Edgewood av (SM) Thomas Lee (c) 411 Crisp (SM) Travers Thos 865 Broadway Tyler Martin F 726 Hawthorne Union News Co Terminal Station Ward Louis A 254 New and 3499 Hous- ton av (SM) Watson Thos H 3141 Houston av (SM) Williams Henry (c) 658 Poplar Williams Jos (c) 314 Elm Wisteria Cafe 420 Cherry Roofers Davis-Passmore Roofing Co 1343 Broad- way DUNLAP ROOFING CO THE, 266 5th, Tel 1400 (For further information see back cover and page 8 Buyers' Guide) GEORGIA ROOFING & SUPPLY CO, 306 Oglethorpe, Tel 3121 (For further information see right side lines and page 29 Buyers' Guide) Pittman M C Roofing Co 559 Mulberry SCHWARTZ & PHAUL INC, 514 Plum, Tel 340 (For further information see back cover and page 30 Buyers' Guide) Roofing--Material and Supplies CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main. Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) *Roofing--Tile and Composition WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) *Roofing Contractors GEORGIA ROOFING & SUPPLY CO, 306 Oglethorpe, Tel 3121 (For further information see right side lines and page 29 Buyers' Guide) *Roofing Materials and Supplies GEORGIA ROOFING & SUPPLY CO, 306 Oglethorpe, Tel 3121 (For further information see right side lines and page 29 Buyers' Guide) *Roofing Paints SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Rubber Goods--Wholesale Farmer Chas W 419 Poplar Rubber and Seal Stamps Manufacturers and Dealers RU74R-7K5E J(FWor COfurTthHeEr, 4i0n6foCrmheartriyo,nTseelse left side lines and page 27 Buyers' Guide) Scarborough Jas A 314 Broadway 575 S MAXWELL BROTHERS FURNITURE CO. Complete Home Furnishings and Radios 0 455-57 SECOND ST. TEL. 4401 u Rug Cleaners INDEPENDENT LAUNDRY CO, 452 2d, Tfoerlms a1t0io0n0-10se0e1-1r0i0g2ht(Fsoidr efulrintheesr ainnd- Schools--Parochial StJoseph School 201 High StPeter Clavers Catholic School (c) 428 Ward (V) T H page 22 Buyers' Guide) Rug- Cleaning and Renovating Schools--Public Alexander School No 1 670 2d L CRESCENT LAUNDRY CO, 519 2d, Tel 16 (For further information see front cover and page 21 Buyers' Guide) Safe Deposit Boxes CITIZENS & SOUTHERN NATIONAL BANK THE, 3d cor Cherry, Tel 4671 (For further information see front cover and page 5 Buyers' Guide) AAlleexxaannddeerr SScchhooooll NNoo 32 181376 NCoorltlhegeav Alexander School No 4 1231 Ridge av Antioch School (c) 308 Charles (SM) Bellevue School 864 American blvd Brooks J A School (c) 103 Mam (S) BrOucrme oCnhdasteHr Sch,ool, Houston av se cor Burke John W School 2133 2d Clisby Joseph School 570 Vineville av A N D HOTEL Safe Deposit Vaults FIRST NATIONAL BANK & TRUST C28O34 IN(FMorACfuOrNth,eCr heirnrfyormcoartio2nd, Tseeel backbone, back cover and page 6 Buyers' Guide) Salary Buyers BIBB BROKERAGE CORP, 403 Cherry, R206-207 (For further information see page 23 Buyers' Guide) BIBB INVESTMENT CO. 203-204 First National Bank Bldg 409 2d, Tel 2517 MACON TRADING & INVESTMENT Cr(eVss)ville Public School (c) 109 6th av (B) East Macon School 724 Fort Hill Fort Hawkins School 450 Fort Hill Green Street School (c) 323 Ward (V) Gresham School 102 Forsyth Hazel Street School (c) 652 Hazel Hudson Industrial School (c) 419 Mon- TOG Ingram B S School (c) 425 Telfair Lanier High School for Boys Holt av cor Lawton (Napier Hts) _ Lanier High School for Girls 126 For- "Macon's Newest" 100 Rooms with Bath Coffee Shop in Connection CO, 220 Georgia Casualty Bldg 516 Mulberry, Tel 3368 (For further information see right side lines and page 8 Buyers' Guide) Salary Purchasing MACON TRADING & INVESTMENT MCOu,lbe2r2r0y, GTeeolrg3i3a68Ca(sFuoarltyfurBthldegr i5n16- MiHer A L High School 515 Montpelier Open Air School 901 (950) Maynard (E PlMea)sant Hill School (c) 350 North (V) Powers Virgil School 1200 2d Stephens Pearl School Log Cabin blvd cor Log Cabin way Unionville School (c) Straight sw cor 2d 569-571 Broadway Tel. 3047 formation see right side lines and page 8 Buyers' Guide) RIGHT WAY FINANCE CO, 3 Hardeman Bldg 105 Cotton av, Tel 6 UNITED PURCHASING CO, 361 5th, Wheatley School (c) Anthony rd nr WRhoitctkleaSvch(SoMol) 1 Hill Park av Winship School 624 Beech av Tel 3567, Night Tel 1515 Sanitary Engineers Schools, Colleges and Academies Ballard Normal School (c) 50 Forest av WOOD T L PLUMBING & HEATING, 5m12ati1osnt, seTeellef5t29sid(eFolirnefsuratnhderpaignefo2r6Buyers' Guide) Sash, Doors and Interior Trim (V) Beda Etta College (c) 100 Grant av (V) Central City College (c) 1035 Clinton rd (EM) Davis Ethel B Beauty Culture School 514 Mulberry Polk's CENTRAL SASH & DOOR CO, Water- GAB SCHOOL OF COMMERCE, 567 ville rd sw cor Steele, Tel 5011. Main Office 354 2d, Tel 3011 (For further Mulberry, Tel 621 (For further information see front cover and page 10 Bankers information see back cover and page Buyers' Guide) W2IL3 LBINuyGeHrsA' MGuSiAdeS)H & DO- OR CO, 4,-577 Georgia Academy for the Blind (c) 247 Encyctopedia Madison 3fdo,rmTaetlison277s-e2e78-r2i7g9ht(Ftoorp fulirntehser ainnapage 24 Buyers' Guide) Georgia Academy for the Blind 1501 Vineville av (V) Hill Winnie M 106 Courtland av Homemaking Schools 501 (483) Charles The Bank Directory of the World Sash, WindowDs,eDaloeorsrs and Trim- Ingleside Kindergarten 102 Woodland av Kaigler's Business College 566 Mulberry Issued Willingham Sash &> Door Co plant 7th at Cherry Savings Banks CITIZENS & SOUTHERN NATIONAL BANK THE, 3d cor Cherry, Tel 4671 (For further information see front cover and page 5 Buyers' Guide) Macon Academy Music Co 617 Mulberry R617 , ^,,,, Mercer University Ash at College Merriman School of Business The 652% 01i6rirv Mount de Sales Academy 639-45 Orange Vineville Avenue Kindergarten 425 Vine- ville av (V) Mar. and Sept. $15.00 per volume R. L Polk Savings and Loan Associations MAACSOSONCFIAETDIEORNA, L 4S17AVBINroGaSdw&ayL, OATeNl 5s0id3e6 (liFnoersfuanrtdhepraignefo9rmBautyioenrsseGe uriidgeh)t STANDARD SAVINGS & LOAN CO, 352 2d, Tel 2437 Saw Filers, Setters and Repairers Delk Saw & Knife Works 863 Broadway Scale Dealers Macon Scale Shop 655 Poplar WESLEYAN COLLEGE, Forsyth rd, Tel 6371 (For further information see opp inside front cover) WESLEYAN CONSERVATORY, 451 College at Georgia av, Tel 4437, Home Dept Tel 151 (For further information see opp inside front cover) Screens WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) & Co. Publishers 431 Howard St. Detroit 354 4th Ave. New York 576 COURTS HUCKABEE AUTO COMPANY CADILLAC--LA SALLE--BUICK--PONTIAC & GO. SMtoecmkberEsxcNh.anTge. N. T. Cotton Exchange ChicagTo raBdoeard ot AssNoc. iaYte. MCeumrtber* Exchange Local Stocks and Bonds THIRD AT PINE GMC TRUCKS PHONE 5100 GMeaocrogniaPSeeeedd &SSeteoSdreese--d46RS9etot3ardiel 461 3d Wright Harry 306 3d Sewer and Drain Tile--Manufacturers Dickey W S Clay Manufacturing Co Pine at 10th Sewing Machine Dealers Singer Sewing Machine Co 618 Cherry Social Settlements Atlantic Community House 2 Atlantic BiVbbillagMe anufacturing Co Community House 219 (226) Clinton (EM) Societies--Benevolent and Fraternal BENEVOLENT PROTECTIVE ORDER Macon Lodge NOoF 2E30LK1S27 Cotton av Government Bonds Home Owners Loan Corp. and Fed. Farm Mortgage Corp. Bonds Municipal Bonds Bank Stocks 405 Ga. Casualty Bldg. Phone 1681 Sheet Metal Workers Andrews Sheet Metal Works 507 Cotton Bartlett Sheet Metal Works rear 653 Broadway Hamlin Sheet Metal Works 27 Wall SCHWARTZ ,& PHAUL INC, 514 Plum, Tel 340 (For further information see back cover and page 30 Buyers' Guide) Welch John M 411 Cotton av Shoe Dealers--Retail Arnold's Shoe Parlor 418 3d Boyd Shoe Store 558 Cherry Burns Boot Shopne Inc 402 3d Cannon Shoe Store 562 Cherry Chandler Jas K 464 Cherry Clark Walter P 559 Cherry DA64N00NE(FNoBrEfRuGrthCerOinTfHorEm, a4t6i2o-n70se3ed,paTgeel 12 Buyers' Guide) Jakes Shoe Store 568-70 Poplar MACON SHOE CO, 361 3d, Tel 740 Marilyn Slipper Shop 578 Cherry McAn Thom 576 Cherry Southern Shoe Shop 410 Poplar Strong Shoe Co 360 2d GeFoRrgAiTa EAReNriAe LNoOR97D7 EFROOEF E45A4G%LE1sSt IMPROVED BENEVOLENT PROTECMelba LodTgIeVENoO5R55DE(cR) 4E5L1%KSCotton av INDEPENDENT ORDER OF ODD United BrotherFsELLoLdOgeWNSo 5 515 2d Lillian LoDdagueg5h1t5ers2dof Rebekah JUNIOR ORDER AMERICAN J_uni.or OrdeMr ECUHnAiteNdICSAmerican Me- chanics 515 2d DaughterDs aoufgAhtmeresricoaf 5A15m2edrica ,, . , , KNIGHTS OF AMERICA ^Mulberry America Lodge No 1 402% Kni.ghKtsNoIfGCHoTluSmObuFs CLOodLgUeM51B5U2Sd Lt o^dge NKo N1IG4H02T%S OMFulMbeArLryTA KNIGHTS OF PYTHIAS--COLORED Shoe Repairers Bibb Shoe Shop 254 (236) Main (EM) Bledsoe Ervin R (c) 343 (437) Alabama (SM) DA64N0N0 EN(FBoErRGfurCtOherTHiEnf,o4r6m2-a7t0io3nd, sTeeel .page 12 Buyers' Guide) Dixie Shoe Repair Shop 307 Broadway Economy Shoe Repairers Sa French Dry Cleaners 553 and 564 Cherry Nenw 3dffe Knights of Pythias (c) 55 MASONIC F & A M fort HuaLwok.di-gnes LJodGgeeor4g1i0a M80a1inM(uElbMe)rry Mabel Lodge No 255 710 Mulberry Macon Lodge No 5 111 Cotton av berryIal'Shall A Lodge No 448 710 MulWolithin Lodge No 390 710 Mulberry Who Sells GM)en Wm (C) 203 (159) Peacock (S Gray Robt W 505 Broadway Gullatt Wm E (c) 1219 Broadway Hughes John W (c) 122 Neal av (V) Jhgleside Shoe Shop 1920 Vineville av McyhstaicnteOdrdRerealVmeGilreNodtotocParmophGetrsototof E7n10Mulberry We.ir M,,arsKhanlilghAtsCoofuKncaidl o7s1h0 Mulberry It? IS Answered By the Classified Lists la this Directory JKoerldl aAnleJxoh5n172M13u5lbtherry Keppler Louis 806 Montpelier av LMinayenLkouhcli'uss SJho(ce) S6h60opPo2p1l4arCotton av Modernistic Shoe Repair Shop (c) 329 Monroe New Service Shoe Shop 466 Poplar O K Shoe Shop 356 2d Parham Alonzo J (c) 299 1st av (V) Schelling Shoe Shop 117 Cotton av Sharps Shoe Shop 618 Cherry Shier Sami 365 Broadway Spence Geder A 1235 Broadway Standridge Chas C 630 Washington av Trawick Wm L jr 610 Hawthorne Union Shoe Shop 456 Cotton av Wolf Abr 416 Poplar Shoe Shiners Howard Wm F (c) 363% Broadway Pearson Martin (c) 217 5th Sign Painters and Manufacturers Acme Sign Service 618 Cherry Brown Sign Co 511 Mulberry Crimmins Sign Co 469% 2d Dixie Neon Shop Inc 1912-16 Vineville av Kline Frank W 407 Broadway R13 Macon Neon Sign Co 362 Pine Grand. ChRaopytearl 8A0r1chMMulabseorrnys Constantine Chapter No 4 111 Cotton av PCooyuanlcialnodf GSeeloercgtiaM8a0s1teMrsulberry Washington Council No 6 111 Cotton av . Knights of Rose Croix Kadmiel Chapter No 6 710 Mulberry StOmar C_oKmnmiganhdtserTyeNmopla2r 111 Cotton . .. AAcc&ePAtedSoSfcFotM tish Rite of MulbeirySOnry Maoon Consistory 710 Zmjal Lodge of Perfection A A S R of Free Masonry 710 Mulberry A1 Sa.i.ha,h TAemApleO 7N15 oPfoMplaSr C_en,tral, CitOyrdCehraEpatesrterNnoS2t8arill Cotton av Elberta Chapter No 215 710 Mulberry Weir C,,hapOterrdeNroo1f D71e0 MMoulalbyerry MASONIC--COLORED Central City Lodge No 8 411% cotton av MagnWolOiaOCDaMmEpNNOoF8T8H5E15W2Od RLD 577 The World's Largest Store SEARS, ROEBUCK AND CO. THIRD ST. MACON, GA. Shop at Sears and Save Societies--Patriotic American Legion Jos N Neel Jr Post No 3 221 Forsyth American National Red Cross Macon Chapter Cherry nw cor 1st Boy Scouts of America County Court House Boy Scouts of America Troop No 2 67 Davis (PM) Boy Scouts of America Troop No 32 101 (139) Colquitt Boy Scouts of America Troop No 33 rear 221 Forsyth Disabled American Veterans 617% PopUntoitnedavSpanish War Veterans 127 Cot- Societies--Miscellaneous Insdaelpeemnd(ecn) t 4S0o5nGs a&ntDt aCuigtyhterrds o(SfMJe) ruSons & Daughters of Jerusalem (c) 1020 Coleman's la (EM) Union Brothers & Sisters of Zion Hall (c) 106% Concord (SM) Women's Benefit Association 515 2d Soft Drinks--Retail Lewis Jeff (c) 134 Roye (CH) Morris Geo W 200 Main (EM) Schafer Raymond F 210 Center (EM) Stripling Robt G 1011 Ocmulgee Swift Wm O 305 Mulberry Thornton Smalley (c) 527 Hazel ToMll)iver Chas (c) 237 Edgewood av (S Walker E Hurst 101 Ayers rd Williams Henry W 2142 2d Williams Sami (c) 891 Waterville rd Sporting Goods--Retail DUNLAP-PEELER HARDWARE CO, Cherry Southeast cor Broadway, Tels Store 26, Office 736 (For further information see right top lines and page 16 Buyers' Guide) SEARS ROEBUCK & CO, 552-56 3d, Ttioelns s3e3e26r-3ig32h7t t(oFporlinfuersthaenrd inpfaogrema11Buyers' Guide) Southern Sports Co 514 Broadway Sporting Goods--Wholesale DUNLAP-PEELER HARDWARE CO, Cherry Southeast cor Broadway, Tels Store 26, Office 736 (For further information see right top lines and page 16 Buyers' Guide) Store Fixtures and Fittings MUECKE & SONS CO, 614 New, Tel 636 (For further information see left side lines and page 10 Buyers' Guide) *Store Fronts WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Stove Repairs Shine J Wm 1716 3d * Stoves and Ranges--Retail SEARS ROEBUCK & CO, 552-56 3d, Tels 3326-3327 (For further information see right top lines and page 11 Buyers' Guide) * Surety Bonds AETNA CASUALTY & SURETY CO OF HARTFORD, CONN, 702-03 Bibb Bldg 403 Cherry, Tel 214 (For further information see bottom stencil and page 18 Buyers' Guide) CHANDLER SAM S INSURANCE AGENCY, Ground Floor Ga Casualty Bldg 516 Mulberry, Tel 377 (For further information see front cover) MU47R0PCHhEeYrr,y,TTAeYlsL2O6R7-26&8 aEnLdLI2S69 I(NFCor, further information see front cover and page 28 Buyers' Guide) Tailors CFlaenmipinelgliMVaitnthceenwt L316(c%) 621d8 Poplar Henry Tailoring Co (c) 807 Broadway Herschel Merchant Tailor (c) 264 Broadway Johnson Walter N (c) 425 Cotton av Lott John T 808 Walnut Sanford Clyde R (c) 421% Cotton av Smith Wm B (c) 416% 2d Spivey Harry A (c) 519 Mulberry Union Tailoring Co 510% Broadway Zemlich Karl V 406 2d Taxicab Service Reliable Cab Co 552 2d Safety pab Co 520 2d Yellow Cab Transportation & Baggage Co Terminal Station Tea and Coffee--Wholesale Kenny C D & Co Inc 306 Oglethorpe * Spring Service--Complete MOTOR PARTS CORP, 619 3d, Tels 4800-4801 (For further information see right top lines and page 4 Buyers' Guide) Stationers--Retail BURKE J W CO THE, 406 Cherry, Tels 74-75 (For further information see left side lines and page 27 Buyers' Guide) *Stocks and Bonds BROWN & GROOVER, 503 Cherry, Tels 3000 and 3001 ^Stocks and Bonds--Brokers LEWIS LOGAN & CO, 605 Georgia Casualty Bldg 516 Mulberry, Tel 738 (For further information see right side lines and page 20 Buyers' Guide) Telegraph Companies American District Telegraph Co 455 Cherry POSTAL TELEGRAPH-CABLE CO, 451 Cherry, Tel Call Postal Telegraph WESTERN UNION TELEGRAPH CO, Main Office 455 Cherry, Branches Terminal Station and 244 Main (EM), Tels Call Western Union Telephone Companies Southern Bell Telephone & Telegraph Co 213 Cotton av Textile Manufacturers' Supplies and Equipment--Manufacturers Dixie Roll & Cot Co Inc 306 Main (EM) Theatres See Motion Picture Theatres * Stokers--Automatic LOWE ELECTRIC CO, 131 Cotton av, Tel 6300 Theatrical Supplies and Equipment Macon Circus Equipment Co 516 Mul- berry R308 *Storage Warehouses WASHBURN STORAGE CO, 201 Pop- lar, Tel 5370 (For further information see front stencil and pages 30 and 33 Buyers' Guide) *Tile--Hollow, Building and Drain WILLINGHAM SASH & DOOR CO, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) DIRECTORY LIBRARIES We Have on File in Our DIRECTORY LIBRARY Copies of the Directories of practically Every City in the UNITED STATES and Canada These are for your convenience If you want in- formation you are unable to procure elsewhere call on us R. L. POLK & CO. DETROIT 578 I i ?azi--. H og < .-z 0f-54 CO 5 A. G. RHODES & SON COMPLETE HOUSE FURNISHERS 359 Second St. Tel. 337 *Tile Floors SOUTHERN FLOORING CO, 616 Pop- lar, Tel 5605 (For further information see left side lines and page 13 Buyers' Guide) Tile Manufacturers--Building Carling Tile Co 115 Poplar Elhan Stone-Tile Mfg Co 511-15 2d Tire Dealers and Repairers Central Tire Co 405 Poplar CHAPMAN'S GARAGE, 415-419 Mul- berry, Tel 2951 (For further information see front cover, right side lines and page 2 Buyers' Guide) FIRESTONE AUTO SUPPLY & SERVI1CstE, TeSlsTO11R6E-1S1,7 667-73 Mulberry cor Goodyear Service Stores 561 3d McKENNEY ,& ADAMS SERVICE STATION, 600 1st, Tel 6346 (For further information see page 2 Buyers' Guide) Veal Wm W 3021 Houston av (SM) WNheitwehead Ed Tire Service Station 600 Tobacco--Wholesale Carstaphen Inc 612 Poplar Toilet Articles and Supplies Earle Nancy 201% Cotton av Grayson Dolly Cosmetic Co 150 Cotton av R307 Tourists' Camps Flanagan's Camp 2923 Houston av (SM) Middle Georgia Tourist Cabins 4005 (3917) Houston av (SM) "Towel--Supply INDEPENDENT LINEN SERVICE, 452 2d, Tels 1000-1001-1002 (For further information see right side lines and page 22 Buyers' Guide) Towel, Apron and Coat Supply Macon Linen Supply Co 1304 Broadway * Trade Lists POLK R L & CO, Martin Bldg, Bir- mingham, Ala Traffic Bureaus Southeastern Demurrage & Storage Bu- reau Plum sw cor 5th Transfer Companies MACON TRANSFER CO, 408 Broadway, Tel 304 (For further information see right top lines and page 31 Buyers' Guide) TAYLOR TRANSFER CO, 458 Plum, Tel 388 (For further information see left top lines and page 32 Buyers' Guide) WASHBURN STORAGE CO, 201 Poplar, Tel 5376 (For further information see front stencil and pages 30 and 33 Buyers' Guide) Yellow Cab Transportation & Baggage Co Terminal Station Transportation--Freight--Automobile Atlanta-Macon Motor Express 350 Cherry Davis O F Truck Lines 858 Broadway Gamble Motor Express 756 Broadway Georgia Highway Express Inc 103 GCrehaetrrSvouthern Trucking Co 346 Poplar Moffett Transit Line 350 Cherry *Travelers' Checks CIBTAIZNEKNSTH&E, S3OdUcToHr ECRhNerrNy,ATTeIOl N46A7L1 (For further information see front cover and page 5 Buyers' Guide) Trucking and Teaming Su(mSeneeraGlsorovEexrpWress1i0n0g FaunldtonM(oSvMin)g) Trunks and Traveling Bags--Retail Luggage Shop The 364 2d CITIZENS T&ruSstOUCTomHEpaRnNiesNATIONAL BANK THE, 3d cor Cherry, Tel 4671 (For further information see front cover and page 5 Buyers' Guide) FIRST NATIONAL BANK & TRUST 2C8O34 IN(FMorACfOurNth, eCr heirnrfyormcoartio2nd, Tseeel backbone, back cover and page 6 Buyers' Guide) *Tru$tees FIRST NATIONAL BANK & TRUST CO IN MACON, Cherry cor 2d, Tel 2834 (For further information see backbone, back cover and page 6 Buyers' Guide) "Turpentine SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Typesetting--Machine Composition Macon Typesetting Co 517 Poplar Typewriting Machines--Dealers Royal Typewriter Agency 107 Cotton av Smith L C & Corona Typewriters 506 Mulberry Umbrellas and Parasols--Retail and Repairers Polenz Gust 618 New "Undertakers BURGHARD-CONNALLY, 718 Cherry, Tel 1627 (For further information see front cover and page 14 Buyers' Guide) CENTRAL CITY FUNERAL HOME (c), 530 Cotton av, Tel 57, Night Tel 1156W (For further information see page 15 Buyers' Guide) HART'S MORTUARY, 755 Cherry, Tel 161 (For further information see right top lines and page 14 Buyers' Guide) HUTCHINGS' FUNERAL HOME (c), 518 New, Tel 2044, Night Tels 20443439 and 3728 (For further information see left top lines and page 15 Buyers' Guide) PITTS MORTUARY, 814 Mulberry, Tels 146-147 (For further information see right top lines and page 14 Buyers' Guide) Undertakers' Supplies Middle Georgia Casket Co 755% Cherry "Uniforms and Aprons INDEPENDENT LINEN SERVICE, 452 2d, Tels 1000-1001-1002 (For further, information see right side lines and page 22 Buyers' Guide) "Universities WESLEYAN COLLEGE, Forsyth rd, Tel 6p3o7s1ite(Fionrsifduerthfreornitnfcoorvmear)tion see op- Upholsterers Estes Geo P 928 (937) Montpelier av Muecke Rudolph J 514 1st MUECKE & SONS CO, 614 New, Tel 636 (For further information see left side lines and page 10 Buyers' Guide) Variety Stores Woman's Exchange 159 Cotton av 579 LUTHER WILLIAMS' SON Frederick W. Williams--Sole Owner Private Bank--Not Incorporated BANKING IN ALL ITS BRANCHES WE WRITE INSURANCE OF ALL KINDS 565 MULBERRY ST. MACON, GA. PHONE 1586 *Vamish and Stains SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Watch and Jewelry Repairers Davis Walter E 414% Mulberry Folds Joshua P 763 Broadway Watch Shop The 156 Cotton av and 355 2d ^V^rnishcs VALENTINE AND PRATT & LAM- BERT, Willingham Sash & Door Co Dealers, 457 3d, Tels 277-278-279 (For further information see right top lines and page 24 Buyers' Guide) Vending Machines Martin Chas I 664 Cherry Sparks Specialty Co 525 Mulberry *Venetian Blinds SOUTHERN FLOORING CO, 616 Pop- lar, Tel 5695 (For further information see left side lines and page 13 Buyers' Guide) Duffell RichdVSete6r5i9naBrriaonasdway Lubach Anthony P 519 Cotton av Small Animal Clinic 612 3d Vinegar Manufacturers Gibson Vinegar Works 149 5th ViilpntiiTPPc MacMillan Donald M 352 1st Wagon Manufacturers Williams Paul Co 220 Fulton (SM) McNAIR LUM*BWEaRll &BoSaUrdPPLY CO, 262 5th, Tel 5200 (For further information see back cover and page 9 Buyers' Guide) Wall Paper Dealers--Retail Hainline John L 521 Mulberry Wall Paper Dealers--Wholesale and JARRETT PAINTR&etaGilLASS CO, 320 3d, Tels 2200-2201 (For further information see right side lines and page 25 Buyers' Guide) SCHALL PAINT CO INC, 307 Mulberry, Tel 326 (For further information see front cover and page 25 Buyers' Guide) Warehouses WASHBURN STORAGE CO, 201 Poplar, Tel 5376 (For further information see front stencil and pages 30 and 33 Buyers' Guide) Warehouses--Merchandise Bernd G Co Ocmulgee Georgia Power Co 1024 Ocmulgee Macon Peanut & Storage Co 23 5th Water Heaters--Dealers WOOD T L PLUMBING & HEATING, 512 1st, Tel 529 (For further information see left side lines and page 26 Buyers' Guide) Waterproofing Materials McNAIR LUMBER & SUPPLY CO, 262 5th, Tel 5200 (For further information see back cover and page 9 Buyers' Guide) Weather Stripping--Numetal CENTRAL SASH & DOOR CO, Water- ville rd sw cor Steele, Tel 5011, Main Office 354 2d, Tel 3011 (For further information see back cover and page 23 Buyers' Guide) Wedding Bouquets IDLE HOUR NURSERIES, 109 Cotton av, Tels 223-224, Greenhouses Forsyth rd nr Rivoli, Ga, Tel 875-J (For further information see top stencil and page 13 Buyers' Guide) Welders and Brazers Acme Welding & Electric Co 619 Broad- way City Welding Co 721 Broadway Macon Machine Shop 451 Wall Superior Welding Shop 444 Pine Window Shade Manufacturers Morgan Wayland B 106 Rogers av (V) Wines--Manufacturers and Wholesale Macon Beverage Distributors 359 5th Hotel DWeminpesseyanTdapLiRquooorms--36R3et3adil Kennesaw The 557 Broadway McCook Clyde F 321 Broadway Mulberry Wine Shop 406 Mulberry Rex Beer Garden The 451 Broadway Silver Dollar The 316 Broadway Women's Furnishing Goods--Retail Southern Textile Co 410 Cherry Wood Dealers--Retail Arnold Danl S 403 Main (EM) King Wm L 115 American blvd Lester Walter E 819 Broadway O'Neill Chas 422 Plum *Wood and Coal Dealers MERRITT B F COAL CO, 1414 1st, Tels 4977 and 4978 (For further information see right side lines and page 11 Buyers' Guide) Snow's Laundry and Dry Gleaning Go. Licensed "Sanifone" Gleaner Phone 6000 PROHtbt rv CITY COURT MACON PRINTING BINDING RUBBER STAMPS THE BEST WORK CORRECT PRICES BURKE'S 406 Cherry St., MACON Polk's Bankers Encyclopedia The Bank Directory of the World Issued Mar. and Sept. $15.00 per volume B. L. Polk & Go. Publishers 431 Howard St. Detroit 354 4th Ave. New York PROPERTY CITY COURT OF MACON Fr MORE GOODS ARE BOUGHT AND SOLD ^ THROUGH THE CLASSIFIED BUSINESS LISTS OF THE DIRECTORY r THAN r ANY OTHER MEDIUM J Ed . ON EARTH WJ POLK PUBLICATIONS Poollkk's Bankers Encyclo^pedia U(DniitreedctSortya)teos