A. $. Hatcher Co. 588 THIRD ST., COIL OF PLUM ST. AUTOMOTIVE EQUIPMENT WAGONS, BUGGIES, HARNESS, BICYCLES LOUIS A. THORPE REAL ESTATE--LOANS--INVESTMENTS FARM LANDS, INSUR%JCI EXCLUSIVE AGENTS FOR ilGI SIDE 30S 22 m N t-j SawaK tttlilMIl -CfiUjAa. Im**J Ell AHK)MMDDATING SECURE ens and Souther* Banlf 2JK2Z *" QiCil o hio MEMBHgpFEI RESERVE SY: MACON., GA. and Prefi GO LARGE SMALL Over 50 Y< We Pay1 Cotton Ave. and! Wi VI Telephone 941 Ries & Armstrong, Inc. JEWELERS Reliable Goods Only 315 THIRD STREET TELEPHONE S38 HBS WH0p2*r**T Plioaes 4386-4387-3957 T. C. BURKE, lie. 353-60 Third Street ,, jkf ^ IP Archibald England CHIROPRACTOR 613-618 Bibb Realty Building, Macon, Ga. GRADUATE PALMER SCHOOL OF CHIROPRACTIC If You Are Sick You Need Me-- I Get Results Telephone 4557 X-RAY SPINOGRAPHIC DEPT. GEORGIA CASUALTY COMPANY W. E. SMALL, President Home Office, Macon, Ga. General Offices, Atlanta, Ga. Incorporated Under the Laws of Georgia Capital Stock $50,000 Surplus and Reserves for the Protection of Policyholders Over $3,000,000 Automobile Pbyslclans'-Druggists Liability Plate Glass Workmen's Compensation --All Lines Burglary E. H. STRICKLAND, Manager City Office J. C. McAFEE, Vice-Pres. CHAS. B. LEWIS, Finance Claims Department JUDGE W. B. BIRCH POPE F. BROCK Home Office Claims Service Second Floor Georgia Casualty Building MACON CITY DIRECTORY (1925) 4 Association ot North American Directory Publishers General Office 52N4e-5w28YBorrkoaCdwityay cepOtpeSnunedvaeyr.y day exDbiItnnhdeeigeeOcArsaoesrnsPmtcgyh.tuaeoenrbrpiyyrDzaoeesPipdreMuueEbcitoenalxtfmiobcsr1lbhhIey8meea9rnr8p.B,grmCuoifnisaovtigyy--r ldectwuiyorasbhsAApeinrleeavylanlwreorcynpeofdr,iiainmietpritetnneephercNcvllreeeetsieopsttaweeharondyroftdehfdnYieptceioaayroeu,etlsrblmckdyolt.eiaaofostsfnhkrhukeydee-rr, serHvaicvee. your mail addMvriaesksitseedytohhueersreelMfweahttreonhpooymloiesu.. FSSPeeriR5Srecc2sospri4tcinerdhidtneamVBgnrrVyioftoci--n-eieaTcdl-ddeR,rPw,e-raPaeaVlMsrsypaeuiO,h.dasrfsieefdNsLnri.ec--.teen--wrPtEs--oH..Yl.kJo.,JrA.LkD.,.eLMtNHroo.iarlianltY,n.n.giJnergr.,,, DR.. BL.. GPooulkld,P, 1a19s80t908-P-11r9e809s19i-d.1e9n0t2s.. W. E. Murdock, 1903-1904. BAWGWJGHJ.....e..moMLDDJ.V.H...'.aW.WGHrFAt.WL..iialnnelrTOi,nMenlo,leGvhi1raweaaca91rrmmchra91tdyol01is,ta,nn5-,,1ne-,1191ar11991,91,99102(910876-112418-.-990.119-21-919112519039--90711.2.9.991-21.1369..10. JHJGLWDHARW...l....ae.ilLMlwDJpBAsWL..oh..'.a.W.nFrHWBtLMR.aiBiHo.nirliallcyon.Ml,PnhBdwihGaLnmo,aaomJmielramranokceRr.asrgny.,,d,nd,e,d,n,aDN,RJNeodrBSereiAef.iY,cw.pntowrhkrgoTsoCTimrtn.HnirooHiotkugonnn.aresfan.c.voirtvdieneesne.l.netdnnos..a...ti. . Executive Committee. GW. ilDso'Wn .HM. aLrecey,, NCehwairHmaavne,n.Boston. J. Martin Gardner, Toronto. HHeFnaurrtycnhhiEaHnmd.s.u, cBautJir.odnicaLkl., CCHohmilalmi,rimttJaeren,,.; HA.lexJ.. L. C. CaMroenm, bCehrashirimp aCn;omEm. Cit.teGe.eer GWT.hiolDssMo'.WneH.m.HMAb.MenarLansrcceueRyNAaal.a((etAAAiDoNN.(unACAAeaB.slDD,DWPCPP$)).o5)m011.919m029206i25.s.7.s.io n, CCCBBAAaooluMttLAPTerkylnrvoaaoecrdein,necnnnuh,melantsilaasdoloWnDyvDerndCii,.ial-irlErilDeeCtHeDyr,ccBil.itreiteoelKDrovdCercerygMiyDcotylr.o.a.te,,ieonrCrcmyrdeCAto5yoc,ob.0t,tr.elCo,yOaCrAorsn.Coy..C1k,t.,2aoro7o,Cu.C,n5roGht1.,4,,Sa8a1.O-.t5ER5t.a1re3Wni9daeode,oisTnSgPlhegtaa.ey,,,. HHKFHiieiaWHSBtmlnzrltlta,,dgbdafreegaorDtrrlrW.fr,sleaoidornlrDiRednndcPiin,SctrrDoitehip.DCrcn,mieyrtotigoeToirnn,ecrnnrCyctged.oMotn,orC.t,CiarVooeyon.nsa,.Ii,,,.ntWocL1CNb.9,atoa.d5t.,,e.J,8rC.C1t22o1ha74wun9.rMncGN,huNaotSurr.rYttahy.l,. Leshnick Directory Co., Directory LoBs ldAg.n,ge1l0e5s-7 D4itrhecAtovrey., CPoe.,ori2a1,9-I2I1I. E. Lo4vtehll,StJ,,ohLnos&ASnogne,leLs,tdC.,al2.3 St. NichoMMclaaCnsno, yinMgDoinrHter.cetaolAr,y. CCCaono.a.,,dRa3,o3cPk.LfoQyrm.d,an111.St., PPMMMoieeiSrwiWlngoekdpenkhntmhrs,ettiatRonaoerHDg,p.nfr,foenitLirOlneeiS.DlrsnBcday&titll,.roedD,eMmrMgCcii.Ce.ro,t,,aeo.sa,sc,MPrMnsyt4..uoLa3ibnrs1tCydslnoi..Hes,.,ahCop7Aiow4no.,sglaihCrs9ed,Ch0v,uo3iM.rlD,lcNeihenD,,tonerN.roTrt.bihoCty--,. MCiitcyh;.; 553264-5-53288 SBoruotahdwCalayr,k,NeCwhicYaogrok, PPPooo11MCSlll17kktkh1.1i,,-.n-i2;CpGnRSp.loM.t4ee.u9mLw6al.Ldearko&nEueDtStiCntsDi,,or,dSe.ii,rtMBcc.eotoucooftf.trtfoyParlhyBoCi,lloCad.Ndog, .e..,,5lpI0Yn5hS.cit.a.N,,o7P.107a71Wut0lh-, PRPRSSPaooroioOHPALwmcimalrcbhkortovaaaeepeldm-recykvarrsHst.kc,len&t,oloasainpudnnanBDnY,osLdldodtBrDoie,eC&ts,rPDe,rndteiooICorkMc.inNseC,nDrMaet.nce.oa,olr.N.itsci.urro,YnM,Cytereero.1dowcyN.ar9o.ts,yC.ocsCCOokr.YCo5.yo,r.8.o,lnCe-.CL,g61aoo09rtn4..de9,,5ss.,,M4sF3W7L7eA06a7da1arv.15ekreB3bre.a,tutrChloNrotaSSSoemdtttwn...--,,, VeSrtn.,onH, aHmeinltroyn,& OSnotn.,, 3C7anK. ing William WWWWoTSScirrlioirttelg.g,,lir,xeal.heyamVMtys3, sdaiJDlnDBowacDilhirndoarneiegudurcc.kve,FtteecVoo.ertDrrio,.yDniaereBWyils,rlC.,aeiCoscCsLC.,.t,i.otond.T,rc3.y,ei6nxW61Cn.9aoa8M.tl,isH,ih5lwatOhs.Batufillndkoggeo.esr, Honorary Life Members. Docnagnoe,lle1y11,. R. H., 652 S. State St,, Chi- (1925-26) R. L. POLK & CO.'S POLK'S MACON CITY DIRECTORY 1925 CONTAINING AN ALPHABETICAL LIST OF BUSINESS FIRMS AND PRI- VATE CITIZENS, A STREET AND AVENUE GUIDE, A DIRECTORY OF THE CITY AND COUNTY OFFICERS, CHURCHES, PUBLIC AND PRIVATE SCHOOLS, BENEVOLENT, LITERARY AND OTHER ASSOCIATIONS, BANKS, INCORPORATED INSTITUTIONS, ETC., A "BUYERS' GUIDE" AND A COMPLETE Classified Business Directory R. L. POLK & CO., Publishers BIRMINGHAM, ALA. AND DETROIT, MICH. Member Association of North American Directory Publishers Copyright, 1925, by R. L. POLK & CO. 2-3 INTRODUCTION The publishers herewith present to its patrons the 1925 edition of R. L. Polk & Co.'s Macon City Directory. The work embodies all available and vital data relating to the civic, commercial, financial, social and industrial interests and activities of the municipality, and the publishers add their assurance that the volume is complete in all its parts. The publication has had the benefit and advantage of the complete organization and the resources of the publishers solely devoted to publication of Directories, and of the skill and experience of their corps of enumerators and compilers added to the generous co-operation of citizens in the production of the volume. The several features of the Directory which have given such satisfaction to patrons in former issues have been retained, while several have been amplified and improved, as suggested by experience. The standard attained in the previous issues is fully maintained in this one, and the directory will prove to meet the needs and requirements of patrons as fully as its predecessors. The statistics which follow this introduction, prepared by the Secretary of the Chamber of Commerce, are impressive as showing the progressive character of the city in all lines. The several essential features of the Directory are set forth in the order following: THE MISCELLANEOUS DEPARTMENT, pages 23 to 47, includes data concerning Federal, State, city and county officials, public and private institutions, cemeteries, churches, courts, hospitals and homes, libraries, miscellaneous schools and colleges, clubs, associations, newspapers, parks, public buildings, halls, postoffice data, secret and benevolent societies, and information covering every phase of industry and activity in the territory covered by the Directory. THE BUYERS' GUIDE occupies pages 49 to 88. This section of the Directory, printed on tinted paper, includes numerous advertisements of the leading manufacturing, business and professional interests of Macon. They have been carefully grouped by departments, and are indexed under classified headings and otherwise in various parts of the Directory. A casual perusal of these advertisements will picture many interesting phases of the city's activities. They are not display advertisements, primarily, however, but rather are reference advertising at its best. In a bustling, manufacturing city like Macon need tor this kind of information readily at hand is very great, and the general appreciation of this need is evidenced by 8 INTRODUCTION the liberal patronage the City Directory enjoys in many and varied lines of trade. THE ALPHABETICAL LIST OF NAMES of citizens, business firms and corporations is embraced in pages 89 to 1002. THE STREET GUIDE AND DIRECTORY OF HOUSEHOLDERS extends from page 1003 to 1134. THE CLASSIFIED BUSINESS DIRECTORY is em- braced in pages 1135 to 1232, and shows the various manufacturing, mercantile and professional occupations, compiled under headings appropriate to the class of business pursued. This department will be appreciated as a special trade directory. MACON The Rose City of the South Famous as a Cotton and Peach Growing Center in the Heart of Georgia Macon, the judicial seat of Bibb County, is located six miles from the geographical center of Georgia, on the Ocmulgee River, the Dixie, National and Transcontinental Highways. The city occupies a group of hills overlooking the river, and the elevation ranges from 324 to 525 feet. Atlanta, the capital of the state, is 100 miles to the north, Augusta 125 miles to the northeast, and Savannah 191 miles to the southeast. According to the United States census of 1920, Macon's population within the corporate limits was 52 995. In 1923 it was 56,331. The 1925 estimate is 60,500'; to which number 45 states in the Union have contributed. Including the suburban population, Macon is a city of 67,500. Within a radius of 60 miles there is a population of over 800,000. The average temperature in Macon the year around is 64 degrees. Extremes of heatand cold are rarely known and the winter season is uniformly mild. Prostrations from heat are unknown. The percentage of sunshine is 70. Macon has one of the best school systems in the United States, handsome buildings of brick, modern in every way, house the youth of the city in grammar and high schools! here are 49 public schools in the county with an average enrollment of 15,000. Wesleyan College, chartered in 1836, the oldest chartered college in the world for women, ranks withthe highest institutions of learning in the United States. The at- endance is 500 yearly. This institution will soon move to larger quarters on a site five miles from the heart of tne city, where expansion and extension will be made. Mercer University, founded in 1833, is a co-educa- Unal, specialaction of the trustees. Dur- enrolled 1924-25 season more than 1,000 students were , . Mouat ^ales, located on a beautiful elevation in the nt+i rasidential section, is attended by more than 150 women- In addition to the colleges and rlnvv-Slt?S acon's educational institutions include the nlJnan a(le"y for the Blind> Georgia-Alabama Busischools HeSe aUd ther private' commercial and industrial 10 INTRODUCTION There are eleven religious denominations in Macon, with 89 different churches. Practically every creed known to the South has a house of worship in the city, making Macon a center of religious activity. Macon has an excellent water system with a daily capacity of 15,000,000 gallons. Adequate motor firefighting apparatus, well distributed throughout the city, protects property holders efficiently. A large municipal hospital and several private sanitariums care for the wants of the ill and afflicted, and have a large patronage from Middle Georgia. There are fifty miles of paving in the city, and more than 500 acres of parks and playgrounds. Commercially, Macon is the wholesale and jobbing center for this section of the southeast. All lines of business are represented, and the annual volume of business in the wholesale trade is $50,000,000 annually. Macon is the cotton concentration point of this section of the southeast, receiving, warehousing and distributing the staple throughout this territory. It is one of the largest inland cotton markets in the southeast, and is also the concentration point and distributing point for peaches, watermelons and other farm products in this territory, with permanent headquarters of the Georgia Peach Growers' Exchange and all large buying concerns during the season. Macon is the retail shopping center of Middle Georgia and the business establishments are large and thoroughly modern, comparing favorable with like businesses in larger cities. Macon's annual industrial output amounts to $65,000,000 in manufactured products. In the Macon district there are 168 industries manufacturing 510 different products, including textiles, brick, lumber, sash, doors and blinds, vegetable oils, engines and boilers, fertilizers, overalls, furniture, cotton yarn and twine, knit goods, cotton seed cake and meal, book bindings and printing, canned vegetables and fruits, agricultural implements, optical supplies, boxes, crates and baskets, flour, toilet articles, medicines, wagons, dray and automobile bodies, saw mills and other kinds of machinery. The Central of Georgia Railway Company operates a $3,000,000 repair shop at Macon. The Southern and M. D. & S. Railroads also maintain shops here. There is trolley car service to all parts of the city, and gas, electrical and telephone service to all needs of the city. Hydroelectric power is secured from a plant having a capacity of 24,000 horsepower, for which large additional development is in progress. Through the service of the Central of Georgia, the Georgia, Southern and Florida, the Southern, the Macon, Dublin and Savannah, and the Georgia Railroads there are 14,000 miles of railroad directly tributary to Macon. Forty-three hundred passengers make use of Macon's mil- INTRODUCTION 11 lion dollar terminal station each day--1,548,000 during the year. This handsome station is said to be one of the finest and best equipped in the South. The annual volume of freight handled through the Macon terminals each year amounts to 1,680,000 tons. There are 88 passenger trains daily and 4,624 railroad employees living in Macon. Macon is the heart of Georgia, and is the center of the Georgia fruit belt with more than 12,000,000 bearing peach trees within a radius of 60 miles. The city is in the center of a rich agricultural district, which produces a great variety of staple crops and fruits of almost every kind, except that restricted to the tropics. There are five cuttings of alfalfa regularly each year. Live stock, dairy- ing and poultry raising are carried on profitably in this section on an extensive scale due to 300 "open days" in the growing season. , Ten years ago the combined deposits of nine banks amounted to $7,150,000; at the close of 1924 they showed $14,413,697.25 on checking deposit and $7,988,597.96 on time deposit. Bank clearings for last year amounted to over seventy-eight million dollars. Debits to individual accounts from the banks are as follows for the past four years: 1921, $213,554,243.75; 1922, $213,736,976.68; 1923, $253,881,620.60; 1924, $260,- 010,773.94. Macon building activity in 1925 shows a large gain over preceding years, and for the past two years is greater in proportion than recorded for any other city in the Southeast. The growth of Macon as a city of home owners is reflected in the building in suburban territory. The city is just completing a million-dollar auditorium which will provide room for all public functions; a new concrete bridge is being stretched across the Ocmulgee River to replace an ancient structure connecting the down- town business section with East Macon; in the vicinity of Mercer University a municipal stadium is being erected to seat 55,000 people at a cost of over $100,000; paving is being torn up and replaced at a great cost, and hitherto unpaved streets are being made highways of travel with concrete. Plans are also under way to construct an entirely new plant for Wesleyan College, while new buildings are being added to the Mercer University domain. An 18-hole golf course, owned and operated by the Idle Hour Country Club, is located at Rivoli, one of Macon's most beautiful suburbs. Professional golfers declare the course to be one of the finest in the South. Two beautiful lakes, three miles from Macon, accessible by bus lines operated on regular schedule, provide swimming, boating and other water sports for visitors and Macon lovers of the great outdoors. Private clubs of various organiza- tions are scattered throughout the city. Macon has a team in the South Atlantic Baseball League, which is supported by the city fans and fans from 12 INTRODUCTION Middle Georgia. Games are played at Central City Park on a diamond, which big league teams that have trained in Macon claim to be one of the best in the South. Port Hawkins was established in 1806 on the site of what today is the City of Macon. The city was founded in 1823 and named for Nathaniel Macon, patriot and statesman. The 100th anniversary of the city was commemorated May 9-11, 1923, with a mammoth Centennial celebration. In the historic pageant which featured the jubilee, 6,284 individuals participated. A well organized and efficient Chamber of Commerce is recognized as the community clearing house in Macon. Co-operating with this organization in its progressive program for a Greater Macon are civic clubs and other agencies, including Rotary, Kiwanis, Lions, Civitan, Exchange, Pilots, Business and Professional Women, Junior Chamber of Commerce, Macon Real Estate Board, Farm Bureau, Women's Clubs, Boy Scouts, Y. M. C. A., Y. W. C. A., and other trade and social groups. Many national fraternal organizations are represented by lodges in Macon, including the Shriners and other Masonic orders, Elks, Knights of Pythias, Knights of Columbus, Odd Fellows, Red Men, Woodmen of the World, Eagles, etc. Organized social activities are conducted by each order, seveTal of which have private clubs and meeting places. Headquarters for the Thirtieth Division of the National Guard has been allotted to Macon. The city has Brigade Headquarters for the 59th Infantry. There are 600 enlisted men and 50 officers in the Macon units. Embracing the headquarters organizations as it does, Macon is the military center for National Guard affairs in the State. Macon has a strong American Legion Post and a chapter of the Veterans of Foreign Wars, there being several hundred war veterans enrolled in these organizations. Macon offers motor tourists free use of a beautiful automobile camp at Central City Park. Paved highways radiating from Macon in all djrections, provide easy access to the city. First-class hotels, theatres and other accommodations and amusements for visitors encourage an increasing number of tourists to visit Macon each year, the estimated annual number now reaching 200,000. The average number of motor vehicles traversing five paved highways entering Macon is 25,000 daily. The volume of travel is very largely increased during the tourist season and during the movement of farm crops. Macon is the motor gateway to the Southeast and the center of system of trunk-line highways to Augusta, Savannah and Brunswick, Ga., Jacksonville and the East Coast of Florida, Tampa and the West Coast of Florida, Tallahassee and the Gulf Coast, Columbus and the South- INTRODUCTION 13 west, Chattanooga to the North and Middle West, Athens, Greenville, Asheville, and points east. In Macon and vicinity there are numerous points of natural and historic interest to the traveler. The City Hall, new $600,000 county court house, the Federal building, the Washington Memorial Library and other public buildings are notable examples of beautiful architecture. A city planning commission is now engaged in the development of a program for municipal expansion and beautification. Horticultural experts have designated Macon as the "Rose City of the South" because of the fact that the soil and climate are ideal for the cultivation of roses. Macon is the home of the Masonic Grand Lodge of Georgia; Idle Hour Nurseries, operating the largest greenhouses in the South; the Georgia Casualty Company; the national "Own-Your-Home" movement; Sidney Lanier, the South's greatest poet; the 151st Machine Gun Battalion, and numerous other famous military organizations; Admiral Wm. S. Benson, chief of naval operations during the World War; Pilots International, an organization of business and professional women similar to the civic clubs for men; Wesleyan, the oldest chartered college for women in the world; the Georgia State Exposition; Sixth Regional Headquarters of the Boy Scouts of America; the site of the ancient capital of the aborigines, visited by De Soto in 1540, when the first Christian baptism was performed and the first cannon fired on North American soil; first railway survey in the State; first State fair; first state encampment of Georgia troops, and numerous other important institutions, organizations and events. POPULATION A count of the names in this year's book gives a total of 27,000. Multiply this by 2y2 to allow for the women and children not listed--and we have a population of 67,500 for the territory covered by the directory. But the growth of the city, or its advancement, is not to be indicated by mere figures. The pages of this volume present' evidence of general civic, social and commercial advancement, new business blocks, new dwelling houses and new factories, all meaning a progress even more important to a municipality than mere number of inhabitants. THE MACON CHAMBER OF COMMERCE The one organization in a community which upholds the ideals of good citizenship, right living and active co- operation among individuals and organizations making up the city's life is the Chamber of Commerce. It surveys the community with a telescope to see the whole at once and at the same time with a microscope to search out the details. It encourages and co-ordinates individual 14 INTRODUCTION efforts and takes its prominent place in all worth while community activities. The Chamber is the guide, philosopher and friend of the home town and the community. With this background in mind any community must thoroughly realize that the efforts of community upbuilding tend toward evolution. It, therefore, becomes of the utmost importance to each of us to realize that the Chamber is an organization through which public spirited citizens in a community may express themselves collectively on questions of community welfare, and through which they may make their collective desires effective. Cities do not happen--co-operation builds them. In business, as in life, he gets most out of it who gives the most to it. The dividends are based on the investment. DIRECTORY LIBRARY A Library of City Directories is maintained by us at the offices of the Macon Chamber of Commerce for the free use of our patrons. As the latest directories are issued they will be added to the Library, thereby keeping it up to date from year to year. We extend a cordial invitation to each and every one of our subscribers to make frequent use of this library and to consult the Directories on file as often as desired when information in regard to any individual, firm, corporation or institution located in another city is desired. MUNICIPAL PUBLICITY Advertising Macon An important function of the Directory is to set forth the characteristics and advantages of the city as a place of residence, as a business location, as an industrial site and as an educational center. The Directory acts as a mirror, reflecting all that is noteworthy in the city in the above respects. In order to spread this information regarding the city broadcast over the country the publishers place copies of this issue of the Directory in Directory libraries which are maintained in all the larger cities of the country, where they are readily available for reference use by the public. There they serve as perpetual advertisements of Macon, for business men the country over realize that the City Directory represents the community as it really is. The publishers take this opportunity of thanking the citizens for valuable assistance rendered in the way of furnishing information concerning themselves and their friends for this Directory, and also the public-spirited and progressive business and professional men for support given them in the way of patronage. R. L. POLK & CO., Compilers and Publishers. GENERAL INDEX Abbreviations Alphabetical List of Names Bands and Orchestras Board of Education Board of Health Buyers' Guide Cemeteries Chamber of Commerce Churches--White Churches--Colored City Government Classified Business Directory Clubs and Societies Convents County Government Courts Educational Fire Department Health Department Hospitals Labor Directory Libraries Members of Congress Military Newspapers Parks Police Department Post Office Department Public Halls and Buildings Public Schools Railroads ,N Schools and Colleges Secret Societies--White State Government Street Directory United States Officials (Local) Pago 89 89 32 31 27 49 32 32 32 34 25 1135 36 37 24 25 31 28 27 39 40 42 23 42 42 42 27 24 37 31 42 43 43 23 1003 23 INDEX TO ADVERTISERS Page Adams C M & Son Bankers Finance Corporation Barron & Reagan Beeland-Conrad Motor Co Beneficial Loan Society left top lines and 84 left top lines and 51 73 Bibb National Bank Bloch Carl Builders Lumber Co Burden-Smith Co Burghard L H Co Burke J W Co The right top lines 80 74 64 66 right top lines, 84 and opp 200 Burke T C Inc Burns Kenmore Inc Calhoun & Thomas Canepelli Vincent - front cover left bottom lines and 80 right top lines and 81 right side lines and 84 Central City Undertaking Co 66 Central Sash & Door Co right side lines and 74 Citizens & Southern Bank The front cover and 54 City Realty Co 81 Clark R E 57 Coleman Motor Co 51 Consolidated Natl Detective Agency. . .back cover and 64 Crescent Laundry Co right side lines Cutler J M Jr Dannenberg Co The front stencil and 73 63 Day's right bottom lines and 58 Dennis & Dennis front cover Dessau Washington Dickey W S Clay Mfg Co Dixie Coal Co 81 left side lines and 83 left side lines and 60 Dunlap-Huckabee Auto Co left top lines and 52 Elder W F Lumber Co 74 Ellis Motor Co England Archibald right side lines and 52 right top lines and 3 Equitable Life Assurance Society of the US 70 Federal Clothing Store Finch W R Motor Co 58 left top lines and 52 Fourth National Bank. right top lines and 54 Georgia Casualty Co 3 Georgia Grocery 68 Gulf Refining Co 78 Hamlin & Subers 85 Hardeman Avenue Pharmacy 64 Hardeman G G Co 81 Hardeman & Williams.. < 71 Harris Morris left top lines Hatcher A S Co front cover INDEX TO ADVERTISERS 17 P^g0 Hatcher-Turpin Co 82 Holt AT Co right top lines and 82 Hotel Lanier 89 Hubbard Undertaking Co 66 Humphries Sheet Metal Works 85 Hunnicutt C H Clothing Co right side lines and 58 Hutchings C H & Sons 67 Ideal Battery Co right top lines and 52 Idle Hour Nurseries right center lines and 65 Independent Laundry Co 73 James O D left bottom lines and 68 Jarrett Paint & Glass Company 78 Johnson, Durham & Burke left top lines and 67 Jones Motor Co right top lines and 53 Jones & Coney gQ Jordan Realty Co 82 Kaigler's Business College.' .'left 'top lines and 57 Kmnett-Odom Co 70 Letter Shop The 50 Liberty Savings & Real Estate Corp" 55 McCook J M Lumber Co 74 McCrary DeWitt Drug Co !.!!.!! 64 Macon Chero Cola Bottling Co .' right center lines and '''''' ' ' ' ' ^ '' 55 Macon Cigar & Tobacco Co 58 Macon Coca Cola Bottling Co right bottom lines and 57 Macon Daily Telegraph 76 Macon Electric Co gg Macon National Bank Macon News back bone and 55 77 Macon Optical Co right center lines and 78 Macon Orange-Crush Bottling Co. 56 Macon Savings Bank front cover Macon Supply Co front cover Macon Transfer & Storage Co. .. .right side lines and 86 Matthews Jewelry Co '70 Maxwell Bros & Bridgers. .! fi7 Mercer University '' ' gi Merchants & Mechanics Savings Bank 55 MmlttRCoal & Wood Co left bottom lines and 60 MoltnnBpT t' " u" 'A left side Unes and 79 Morgan G&/ivMrnom rgbaenr ?InPsurance Ariggehntcybottom lines and 75 left bottom lines and Murphy Taylor & Ellis 71 back cover nOrhep\h/an!t ?J T lerfitsh cet nttoePr lines lines aanndd 59 75 Parcel^Delivery Co.' ^ *"*" lineS and 50 63 lhoeCnixEHotei:.'.'.'.'.'.'.'.'.'.'.'.';; TM ^ lines and Rainbow Coal Co 53 70 60 18-22 INDEX TO ADVERTISERS Page Reliable Outfitters Ries & Armstrong Inc Roller & Millirons Schwartz & Phaul Scott-Parker Co Shadburn W H Shropshire J T Smart Herbert Clothing Co Snyder's Ready-to-Wear Solomon Steve M Jr 59 front cover and left side lines and 72 79 79 right center lines and 86 right side lines and 68 _ 79 left top lines and 59 / 72 left bottom lines and 53 Southern Business College Sparks Motor Co Standard Brick & Tile Co right top lines and 60 backbone and 51 57 Stroberg Chas W right top lines and 53 Terminal Transfer Co right side lines and 86 Thaggard W L 50 Thames Walter P 63 Tharpe Louis A front cover and 82, Tharpe's Pharmacy: left side lines and 65 Thorpe R S & Sons 59 Try-Me Bottling Co > left top lines and 56 U-Drive-It System 50 United American Life Insurance Co 71 Wesleyan College 62 Whitehead Henry 83 Williams-Guttenberger Music Co 75 Williams Jewelry Co 72 Williams Luther Bank & Trust Co right top lines and 55 Williams R A left side lines and 83 Willingham Sash & Door Co left top lines and top edge Wilson John E bottom edge Wood T L back cover and 80 Wooten Marble Co right side lines and 75 Yates Motor Co right center lines and 54 Yellow Cab Co left side lines, back cover and 85 MACON, GA. CITY DIRECTORY 1925 Miscellaneous Information STATE GOVERNMENT OF GEORGIA Capital--Atlanta Executive Department Governor--Hon Clifford Walker Adjutant-General--C H Cox Secretary of State--S G McLendon Comptroller-General--Wm A Wright Treasurer--W J Speer Attorney-General--G M Napier Commissioner of Agriculture--J J Brown State Geologist--S W McCallie Librarian--Mrs Maude B Cobb State School Commissioner--F E Land Prison Commissioners--Judge R E Davidson chairman, E L Rainey, T E Patterson Railroad Commissioners--P B Trammell chairman, J A Perry, J T Boifeuillet, J D Price, W R McDonald W J Harri.s, CedaUrtnoiwtend; SWtaFtesGeSoerngaet,oVrsilma 1st Distri.ct--C GUnEidtewdaSrdtaste(sDCemon),grSeasvsmanennah 2d District--E E Cox (Dem), Camilla 3d District--C R Crisp (Dem), Americus 4th District--W C Wright (Dem), Newman 5th District--W D Upshaw (Dem), Atlanta 6th District--Sami Rutherford (Dem), Forsyth 7th District Gordon Lee (Dem), Chickamauga 8th District--C H Brand (Dem), Athens 9th District--T M Bell (Dem), Gainesville 10th District Carl Vinson (Dem), Milledgeville 11th District--W C Lankford (Dem), Douglas 12th District--W W Larsen (Dem), Dublin U S OFFICIALS Court Room, Federal Bldg, Mulberry ne cor 3d Circuit and District Judge--W H Barrett Referee in Bankruptcy--J N Talley, 303 Grand Bldg 24 MISCELLANEOUS INFORMATION District Attorney-- F G Boatwright, B S Deaver asst Marshall--George B McLeod Office Deputies--Scott A Edwards chief deputy, P P Connell, C W Moseley and M C McLeod office deputies Clerk of Court--L M Erwin Deputy Clerks of Court--Cecil Morgan, Meta Erwin Commissioner---W E Martin Internal Revenue Office--A A Cook div chief, W P Bell, J B Stanley, A E Covington, depy collectors Post Office Inspector--H H Hudson U S Army Recruiting Station, 6 Jaques Bldg, Sergt E L Hendricks in charge U S Veterans Bureau, Grand Bldg, J W Butler sub regional mgr Weather Bureau--Harry Raynes official in charge, P A Miller asst observer POST OFFICE U S Government bldg, cor 3d and Mulberry General Delivery--Open from 8 a m to 6 p m Registry Department--8 a m to 8 p m Money Order Department--9 a m to 5 p m Postmaster--J H Bailey Secretary--Julia E Green Assistant Postmaster--C B McElroy Supt of Mails--Piercy Chestney Station No 5 (694) College--J N Smith clerk in charge University Station--Cor Elm and Adams. S W Garrett clerk in charge BIBB COUNTY OFFICIALS Court House--Mulberry nw cor 2d Commissioners--J H Heard, J T Moore, W O Kinney, L M Happ, L A Mitchell, J Ross Bowdre clerk Attorney--Walter Defore Coroner--Lee Wages Physicians--Herring Winship, O C Gibson Court Stenographer--A E Barnes Court of Ordinary--C M Wiley ordinary, W C Stevens clerk and attorney Engineer--S R Shi Jury Commissioners--J F Hart, R E Finley, W K Young, John L Anderson, Giles G Hardeman, W G Lee County Administrator--Robert L Anderson Registrars of Voters--W K Young, H F Strohecker, R E Findlay Sheriff--James R Hicks jr Solicitor-General--Charles H Garrett, P H Lamb asst to Solicitor-General Superintendent of Roff Home--W T Watson Surveyor--R M Hall Tax Assessor--J C Holt chairman, W J Heard and J E Bailey Tax Collector--U T Winslett MISCELLANEOUS INFORMATION 25 Tax Receiver--D D Dunwody Treasurer--Michael Lattice County Jail--350 Mulberry, T J McCommon jailor COURTS v (Court House) Bibb County Superior Court--Regular terms first Monday in February, third Monday in April, 3d Monday in July, first Monday in November; H A Mathews and M D Jones judges, Vivian H Roberts clerk, Warren Jones deputy clerk, C R Wright deputy clerk City Court of Macon--Regular terms firsti Monday in March, June, September and December; R C Jordan judge, R W Moore solicitor, C H Smith clerk J H Burns deputy clerk, P H Lamb bailiff Bibb County Court of Ordinary--Regular terms first Mon- day of each month; C M Wiley ordinary, W C Stevens clerk and attorney Bibb County Municipal Court--Regular session every 3d morning; Hugh Chambers judge, B R Truesdel clerk W C Turlington sheriff Juvenile Court of Bibb County, 303 Grand bldg--Bridses Smith judge 6 (Federal Bldg) U S aDnidft^OiccttoC beoru;rtW--RHegBualarrrettetrmjusdgfei,rsLt MMonEdrawyininclMerakv, tUt Sn B,,eacni1krM upotrcgyanCoaunrdt--MJeNta TEarlwleiyn rdeefperuetey, cSleoruktshern Dis- trict of Georgia, for Counties of Baldwin Bibb Buffs Crawford, Hancock, Houston, Jasper, jines%ZTr' Laurens, Macon, Monroe, Peach, Pike, Putnam Treut- len, Twiggs, Upson, Wilkinson ' 1 -p, , , (City Building) Recorders Court--Regular session every morning 9-15 oclo^k; V McKibben Lane recorder" Paul Stlnfield CITY GOVERNMENT Mayor--Luther Williams Mayor Pro Tern--James E Yates Tax Assessor--E B Harrold Treasurer--Osgood Clark Asst Treasurer--O V Speer Clerk--D S Jones Attorney--Harry S Strozier Assistant Attorney--Grady Gillon Recorder J V McKibben LanePhysician--0 S Spivey Bacteriologist--Dr S A Anderson Engineer--E L Gostin Supt of Streets--J F Holley Marshal--W P Gaillard Sextons--F R L Stroberg, J M Day Electrical Engineer--C H Humphreys 26 MISCELLANEOUS INFORMATION Chief of Police--M J Thompson Chief of Fire Dept--L M Jones Building Inspector--W J Beeland License Inspector--D C Glendenning City Scavenger Dept--J F Holley supt City Street Sweeping Dept--J F Holley supt Supt of Parks--T C James Purchasing Agent--D S Jones Weighmaster--G F Alexander Aldermen Frst Ward--G P Rankin, W L Collier, C S Joyner Second Ward--R T Chappel, B R Layfield, F G Gilleland Third Ward--M E Goode, J B Yates, Mrs C C Harrold Fourth Ward--B J Dasher, R G Williams, S L Orr Wards in the City First Ward---All that portion of Macon east of 1st and Pine Second Ward--All that portion of Macon south of 1st and Pine, Jeff Davis to White Third Ward--All that portion of Macon north of 1st and Pine, Forsyth to Monroe and C of Ga Ry to Holmes av Fourth Ward--All that portion of the city west of 1st, Telfair, Jeff Davis and White and Pine and Forsyth and Central of Ga Ry to city limits Standing Committees of Conncil Auditorium--Gilleland chairman, Mrs Harrold, Dasher Fire--Yates chairman, Layfield, Chappel Charities and Health--Mrs Harrold chairman, Joyner, Layfield Encroachments--Chappel chairman, Dasher, Orr Finance--Dasher chairman, Yates, Harrold, Goode, Williams Fire--Yates chairman, Layfield, Chappel Libraries (including Washington) and Printing -- Lay- field chairman, Rankin, Goode License and Tax--Dasher chairman, Yates, Williams Lights and Electricity--Rankin chairman, Chappel, Goode Ordinance and Resolutions--Goode chairman, Harrold, Rankin Parks--Joyner chairman, Mrs Harrold, Gilleland Playgrounds--Mrs Harrold chairman, Gussie Riley supt, Gilleland, Orr Police--Orr chairman, Collier, Rankin Public Property--Williams chairman, Yates, Dasher Railways and Public Safety--Layfield chairman, Williams, Gilleland Sidewalks--Joyner chairman, Chappel, Williams Sewers--Goode chairman, Joyner, Collier Streets--Collier chairman, Layfield, Gilleland Water--Yates chairman, Rankin, Joyner The Mayor and Council meet every Tuesday evening at 8 City Board of Tax Assessors E B Harrold chairman, Morris Harris, W J Beeland MISCELLANEOUS INFORMATION 27 City Board of Water Commissioners J L Anderson chairman, B L Hendricks, C T Williamson, R E Findlay sec and treas, W H Shepard supt Macon Hospital Commission Walter Defore chairman, Dr E G Jacobs, L M Happ, Reb Massenberg supt The Mayor and chairman of the Bibb County Board of Commissioners are members ex-officio Park Commission 1st Ward--J T Moore chairman, E M Middlebrooks, Mrs Ella Wasner 2d Ward--W J Yarborough, Mrs Mamie Paschal 3d Ward---J T Moore, Miss Laura Hill 4th Ward--W A Taylor, Mrs Milo Medlock; T C James supt of parks Playgrounds Commission (From City at Large) L M Happ chairman, C H Bruce, Miss Rosa Taylor, Miss Gussie Riley supt Recorder's Court Recorder--McKibben Lane Clerk--Paul Stanfield HEALTH DEPARTMENT Health Officer--Dr C L Ridley Food Inspector--D L Proctor Meat Inspector--A D Southard Milk Inspector--C J Durham Chief Sanitary Inspector--H L Dennard Assistants--W T King, J M Wilson Inspector Sanitary Plumbing--Lafayette Green Inspectors of Sewers--E B Campbell, F A Bazemore Health Department (City and County combined) Board of Health--Dr C H Richardson chairman, Mrs C C Harrold vice-chairman, W O Kinney, B J Dasher, C H Bruce, Dr C L Ridley sec-treas and health officer' City Sanitary Inspectors--H L Dennard, J M Wilson W T King County Sanitary Inspector--B L Moore Plumbing Inspector--Lafayette Green Milk Inspector--Dr C J Durham Food and Meat Inspectors--Dr D L Proctor, Dr N E Southard POLICE DEPARTMENT Chief--Martin J Thompson Lieutenants--J G Jackson, E R Griffin, R E Glenn T E Garrett Brevet Lieutenants--J T Avent, G H Knight, J B Roberts Detectives--W H Vallette, J F Jackson, S B Arnold, J F Clance, H C Burns, S A Wheaton, E L Foster Sergeants--C M Nutting, R W Smith, H N Oliphant 28 MISCELLANEOUS INFORMATION 'r FIRE DEPARTMENT (1st, rear City Bldg) Chief--L M Jones First Asst Chief--J F Roquemore Fire Inspectors--D J Griffin, J F Wester Drivers to Chief--J P Miller and L T Mitchell Hook and Ladder Company (1st, rear City Bldg) Captain--J F Roquemore Anto Company No 1 (Center and Gordon B M) Captain--C L Collins Auto Company No 2 (Monroe bet Georgia av and Washington av) Captain--J E Dellinger Chemical Co No 2 (Monroe bet Georgia av and Washington av) Captain--V E Armstrong Truck Company No 2 (Monroe bet Georgia av and Washington av) Captain--P A Raby Auto Company No 3 (1st, rear City Bldg) Captain--J T Herrington Chemical Co No 3 (1st, rear City Bldg) Captain--V C Shepard Auto Company No 4 (3d and Oglethorpe Captain--Virgil Guerardie Auto Company No 5 (2d cor School) Captain--W A McPherson Fire Alarm Stations 9--First and Cotton av 11-- Second and Poplar 12-- Second and Cherry 13-- Second and Mulberry 14-- Second and Walnut 15-- Third and Poplar 16-- Third and Cherry 17-- Third and Mulberry 18-- Broadway and Cherry 19-- Broadway and Mulberry 112-- Sixth and Cherry 113-- Willingham Sash & Do 114-- Seventh and Poplar 116--Central City Park 121-- Broadway and Walnut 122-- Fifth and Ocmulgee 21-- Second and Plum 22-- Second and Oak 23-- Second and Hawthorn 24-- Second and Elm MISCELLANEOUS INFORMATION 29 25-- First and Arch 26-- Third and Pine 27-- Broadway and Haw 28-- Third and Hazel 212-- Broadway and Plum 213-- Broadway and Oak 214-- Broadway and Haw 215-- Standard Oil Co 216-- Bibb Brick Co 221-- Broadway and Elm 222-- Proctor & Gamble O 223-- Proctor & Gamble 231-- Central Railway Sh 232-- Central Railway Sh 233-- Division and Tupelo 241--Third and Edgewood av 24--Second and Anderson 243-- Broadway and Woo 244-- Jeff Davis and Plan 245-- Third and Jenkins 246-- Chappell and Reid 251-- Second and Broadw 252-- Central and Sixth a 253-- Waterville rd 31-- First and Mulberry 32-- New and Cherry 33-- 34-- Magnolia bet Orang New and Walnut 35-- Bond and Orange 36-- Jefferson and Mad 37-- 38-- Franklin and Waln Madison and Wood 311-- 312-- 313-- 314-- 321--College and Jones 331-- 332-- 333-- 334-- 41-- 42-- 43 Spring and Forsyth 44 First and Pine 45-- 46-- 47-- 48-- 411-- 412-- 413-- 414-- 415-- 416-- The Grand Theatre College and Gresha Georgia av and Ora Spring and Mulber Middle and First av Craft and Second a Middle and Third a Hudson and Green New and Plum High and Orange College and Forsyth College and Applet Spring and Washin College and Washin Arlington pi and T Forsyth and Monro Forsyth and Virgin Forsyth and Hardem Vineville and Lama Vineville and Roge go MISCELLANEOUS INFORMATION 417--Vineville and Pierce 421-- 422-- 423-- 51-- 52-- 53-- 54-- 55-- 56-- 57-- 58-- 512-- 513-- 514-- 521-- 522-- 523-- 524-- 525-- 526-- 527-- 528-- 531-- 532-- 533-- 534-- 535-- Hardeman and Middle Hardeman and Craft Third av and Ward New and Oak Spring and Orange Ross and Ash Telfair and Ash Jackson and Elm College and Ash Calho'un and Hazel Campbell and Elizabeth First and Hawthorne College and Oglethorpe Adams and Hazel Ross and Oglethorpe Carling and Rembert avs Duncan and Lawton Carling av and Coleman Bell and Montpelier Duncan and Montpelier Virginia and Montpelier Pionona and Montpelier E Vine and Napier av Holt and Lawton av Hendley and Napier av Pionona and Napier av Hillyer and Napier av 536-- 537-- Iverness and Napier av pionona and Hill Crest 5538--Cherokee and Hillyer 541-- Belmont and Winship 542-- 61-- 62-- 63-- 64-- 65-- 66-- 613-- 614-- 631-- 632-- 633-- Oakland and Winship Bibb Mill No 1 Main and Clinton Clinton and Center Broad and Clinton Broad and Center Five Points, East Maco Lee and Church Ft Hill and Main Laurel and North av Summit av Laurel av, N M Explanation of Taps Two taps--Superintendent's test Three taps--Noon drill Four taps--Fire out Seven taps--General alarm Twenty taps--Police call MISCELLANEOUS INFORMATION SI BOARD OF PUBLIC EDUCATION (Office Court House) Officers President--A L Miller Vice-President--T D Tinsley Secretary--W T Morgan Treasurer--Jos N Neel Superintendent of Schools--C H Bruce Superintendent's Clerk--Miss Nellie F Edwards Members--W T Anderson, J E Hall, Lee M Happ, J T Moore, A L Miller, W T Morgan, J N Neel, M F Hatcher, T D Tinsley, J B Riley, W T Johnson, A R Willingham Ex-Officio Members--Hon C M Wiley, ordinary; Luther Williams, mayor of Macon, M D Jones, judge County Superior Court School Organizations 1922--City and Suburban White Schools Alexander School No 1--670 2d, Mary E Hodgkins prin Alexander School No 2--836 College, Mabel H Harris prin Alexander School No 3--117 North av (N H), Ruth C Mangum prin Arbaugh Private School for Deaf Children--Log Cabin Heights, Laura L Arbaugh prin Bellevue School--American blvd, Bellevue, Nora E Ed- mondson prin Boys' High School--Holt av N H bet Lawton and Napier avs, Paul R Anderson prin Clisby School--470 Vineville av, Minnie Burghard prin Fort Hawkins School--450 Fort Hill (E M), Emma 0 Smith prin Gresham Grammar School--Cor Forsyth and Spring, Mrs Stewart Jones prin John W Burke School--2133 2d, Mrs M A Weir prin Lanier High School--126 (644) Forsyth, W P Jones supv, Newberg School--3047 Houston av cor Newberg (S M) Mamie Holt prin Virgil Powers School--1200 2d, Minnie C Robertson prin Whittle School--1 Hill Park av, Rosa Taylor prin Winship School--Pio Nono and Beech av, Jessie Rice prin City and Suburban Colored Schools Antioch School--Charles sw cor Mason (S M), Cora C Moore prin Cressville School--6th av cor Burkner, Ida M Brown prin East Macon School--724 Fort Hill Green Street School--111 Green, M T Danforth prin Hazel Street School--652 Hazel. E E Butler prin Hudson Industrial School--Monroe and Jefferson, B S Ingram prin Pleasant Hill School--323 Ward (V), Zella Benton prin Unionyille School--Straight sw cor May av (U), Elizabeth J Disroon prin SW7hlneSa(!t-lVeVyillSec^hocolll0--olS~s SAtinltlhsoonnvyilrlde 3(Nw HS )C,oJlleAgeB, rAooJkBs apnrkins prm 32 MISCELLANEOUS INFORMATION BANDS AND ORCHESTRAS Georgians' Orchestra-^14 College Hill apts, Bob Lee mgr K of P Band--556 New, E C Carvest mgr, J S Standard lead6r Kaler's Band--509 Mulberry, W C Kaler mgr Southern Serenaders--Crump's Park Ga, Lee Davis mgr, O Hamilton Middlebrooks leader 121st Infantry Band--655y2 Poplar, C F Baumgartner leader BANKS (See Classified Directory) BOY SCOUTS OF AMERICA Boy Scouts of America, 460% Broadway--Millard Westcott scoutmaster CEMETERIES Cedar Ridge--W of Houston av s of limits Evergreen--Houston av beyond limits Fort Hill--Hall bet Short and Mitchell Lynwood--N end Lynwood av (V) Oak Ridge--Northwestern part of city Riverside--Cor Madison and Jones, C T King supt Rose Hill--N end of College Saints Rest--Foot of White (S M) Siloam--Bellevue ws Pio Nono av Unionville--Pio Nono av cor Cherry (U) CHAMBER OF COMMERCE Macon Chamber of Commerce--419 Broadway. P T Anderson pres, Lincoln McConnell sec, J O Cromwell traffic mgr, T J Browder asst traffic mgr, D F Bruce agricultural agt, Rosa McGee dist agt Home Demonstration Bureau, J A Johnson district agt Bibb County Farm Bureau Junior Chamber of Commerce--419 Broadway. A R Menard pres, Eliz Clark sec, J K Bryant treas, Harold Platt sec, Community Service Morgan F Vining execu- tive transportation dept James C McCowan CHURCHES--WHITE Adventist Log Cabin Heights Seventh Day Adventist--Cor Montpelier and Johnson av. Rev M J King pastor, preaching 10:30 a m, Saturday Sabbath School 11:30 a m Baptist Beach Av Primitive--Rev J E Spillers pastor Bellevue--American blvd, Bellevue, Rev H H Connell pas- tor, services 11:30 a m, 8 p m, prayer meeting Wednesday 8pm Cherokee--Ws Courtland av 1 s of Napier, Rev J H Barber pastor Corinth (Primitive)--323 Beach av (N H), Rev W P Nipper pastor MISCELLANEOUS INFORMATION 33 East Macon--255 Church (E M), Sunday services 11:30 a m and 7:30 p m First--101 High, Rev W R Oweft pastor, Sunday services 11:30 a m and 8 pm, Sunday school 10:30 a m, prayer meeting Wednesday 8pm Free Will Baptist Church--Rev J R Hunt pastor, Cedar ne cor Whitehead Mabel White Memorial--2634 2d (S M), Sunday services 11 a m and 7:30 p m, Sunday school 10 a m, prayer meeting Wednesday 7:30 pm, BYPU meets 6:30 p m Macedonia--Cedar la se cor Whitehead, Rev J R Hunt pastor, Sunday services 11 a m and 8 pm, Sunday school 10 a m, prayer meeting Tuesday 8pm Mallory Chapel (Free Will)---239 Roff Home av Mikado Baptist--Mikado av and Fulton, Rev J M Sullivan pastor Primitive--1000 Clinton rd, Rev J A Monsees pastor Primitive--2620 Broadway Primitive--401 S College, Rev Jas Smith pastor Second--1439 2d (S M), Rev L J Baker pastor Tabernacle Baptist Church--902 2d, Rev A C Baker pastor Tatnall Square--Ash and Adams, Rev H M Fugate pastor, Sunday services 11:30 am and 8 pm, Sunday school TO a m, prayer meeting Wednesday 8pm Vineville--415 Vineville av, Rev M A Wood pastor Willingham--4 Holt av Catholic St Joseph--812 Poplar, Rev T D Madden pastor, Revs Daniel J Murphy and Patrick Ryan asst pastors Christian First Church---265 High, Rev B F Foster pastor, Sunday services 11:30 a m and 8 p m, Bible school 10 a m, prayer meeting Wednesday 8pm Church of Christ--375 Church (E M) Christian Science First Church of Christ, Scientist--Georgia av and Arling- ton pi, Reading Rooms, Public Library 410 Grand bldg Episcopal Christ Church--520 Walnut, Rev O J Hart rector St James--101 Courtland av, Rev W W Silliman rector Sunday services 8 and 11:15 a m and 7:30 p m St Paul s 601 College, Rev C H Lee rector, Sunday ser- vices 11:30 a m and 8 pm, Sunday school 10 a m prayer service Friday 5pm Free Methodists Belmont Avenue--220 Belmont av, Rev C E Withrow pas- tor Sunday services .11 a m and 8 pm, Sunday school 9:45 a m, prayer meeting Wednesday 8pm Hebrew Congregation Beth-Israel Synagogue--870 Cherry Rev I E Marcuson rabbi Congregation Sherar Israel--601 1st, Rev Benjamin Yelin 34 MISCELLANEOUS INFORMATION Lutheran Church of The Redeemer--723 Holt (N H), Rev L W Strickler pastor, Sunday services 11:30 a m and 8 pm, Sunday school 10:15 a m Methodist Centenary--940 College, Rev J S Grahl pastor, Sunday services 11:30 a m and 8 p m, Sunday school 10:15 a m, prayer meeting Wednesday 8pm Cherokee Hts--670 Napier av (N H), Rev LA Harrell pas- tor, Sunday services 11:30 a m and 8 pm, Sunday school 10:15 a m, prayer meeting Wednesday 8pm Bast Macon--100 Church (E M), Rev P P Holloway pastor, Sunday services 11:30 a m and 7:30 p m, prayer meeting Wednesday 7:30 p m First Street--859 1st, Rev J R Webb pastor, Sunday services 11:30 a m and 8 pm, Sunday school 10 a m, prayer meeting Wednesday 8pm Ingleside--428 Ridge av (C P), Rev J M Bass pastor Methodist Chapel--218 Clinton (E M) Mulberry Street--Mulberry ne co rlst, Rev Walter An- thony pastor, Sunday services 11:30 a m and 8 pm, Sunday school 10 a m, prayer meeting Wednesday 8pm Newberg--170 Henry, Rev Monroe Spivey pastor, Sunday services 11:15 a m and 8 pm, Sunday school 8:15 a m, prayer meeting Wednesday 8pm Second Street--2021 2d, Rev J A Sconyers, Sunday ser- vices 11 a m and 7:30 p m, Sunday school 10 a m, prayer meeting Wednesday 7:45 pm Vineville (M E South)--221 Vineville av (V), Rev O F Cook pastor, Sunday services 11:30 a m and 8 pm, prayer meeting Wednesday 8pm Presbyterian East Macon--Clinton cor Hydrola, Rev Carl Barth pastor, Sunday service 9:30 am, prayer meeting 8pm Wednesday First--670 Mulberry, Rev G S Frazer pastor Log Cabin Church--194 Log Cabin dr Tatnall Square--752 College, Rev A H McNair pastor Vineville--439 Vineville av (V), Rev McK Robbins Long pastor Westminster--249 Jeff Davis Iton-Denominational Salvation Army Hall--518 Broadway, Capt Demas Mataxas in charge CHURCHES--COLORED Adventist Pleasant Hill--501 3d av (V) Baptist Bellevue--Industrial Home rd, Rev L S Patterson pastor Bethseda--423 Bright al Brown's Chapel--117 (119) Tatnall la Ebenezer--757 Elm MISCELLANEOUS INFORMATION - 35 Elizabeth (N H)--Bartlett la Free Will--400 Bailey av Friendship--1304 1st Fulton--506 Hawthorne Oilfield (Prim)--8 Hazel Harmony--330 2d av (V) Littlerock--400 Nussbaum (S M) Macedonia--164 Hazel Missionary--143 Bay, Rev Alex Reynolds pastor Mt Moriah--213 Powell (E M), Rev W H Hall pastor Mt Olive--957 Oglethorpe Mt Temah--232 North (V), Rev Jackson Jordan pastor New Hope--217 3d av (V) New Zion--305 Edgewood av Pleasant Grove--400 Ballard Primitive--100 Bay, Rev Wm Warren pastor St John's--94 Bay, Rev Emanuel Gordon pastor St Luke's--155 Broad (E M), Rev Wm Phillips pastor St Phillip's Missionary--75 Long la Seventh Street Mission--351 7th Simmons Chapel--9 White al Stewart A M E Church--565 Cotton av Tabernacle Baptist Church--220 Mutual av Tremont Temple--534 Cotton av Union--330 2d (E M), Rev Wm Goolsby pastor Unionville--Pio Nono av se cor Cherry (U), Rev Ashley Neville pastor Vineville--461 Chestnut (H H), Rev W M Phillips pastor, Sunday services 11 a m and 8 pm, prayer meeting Thursday 8pm Catholic St Peter Claver--430 Ward, Rev Alfonso Barthlen rector Congregational First--440 Monroe Methodist Allen Chapel--498 North (V), Rev LeRoy R Parker pas- tor, Sunday services 11:30 a m and 8 pm, prayer meeting Wednesday 7:30 p m Bethel (C M E)--806 Pio Nono av Bethel--Industrial Home rd Crump's Park A M E Church--Stinsonville Grant's Chapel A M E Church--524 Grant's Chapel al (S M), Rev J H Hall pastor Gray's Chapel--508 Hall Holsey Temple (C M E)--261 Washington av Jones Tabernacle (C M E)--Cor Jackson and Maynadr Rev A H Tyrus pastor Ocmulgee A M E Church--25 (525) Clayton Stewart's (A M E)--565 Cotton av, Rev B S Hannah pastor St Paul's (A M E)--210 Powell (E M), Rev J H Estes pas- tor, Sunday services 11 a m and 8 pm, Sunday school 9:30 a m Stinsonville (A M E) 115 Main 36 MISCELLANEOUS INFORMATION Turner's Tabernacle (A M E)--3d cor Hawthorne, Rev Calvin Johnson pastor, Sunday services 11:30 a m and 7:30 p m, Sunday school 10:30 a m, prayer meeting Wednesday 8pm Trinity (C M E)--446 Tindall av (S M), Rev J J Williams pastor Warren's Chapel--150 (171) 1st av (V) Non-Denominational Church of the Living God--675 Jordan Fire Baptism Holiness Church--10 Rock Hill la Sanctified--1161 (325) Woolfolk St Paul Sanctified Church--122 Woodliff Presbyterian Washington Avenue Presbyterian--219 Washington av. Rev T A Thompson pastor, Sunday services 11:30 a m and 8 pm, Sunday school 10 a m, prayer meeting Thursday 8pm Protestant Episcopal St Mark's--307 Madison CLUBS AND SOCIETIES American Legion Post Club--652% Cherry American Red Cross--Mrs O L Molloy sec, 412 Grand bldg Better Films Committee--Meets 3d Monday of each month at Rialto Theatre, Mrs Mary Chefstney pres, Mrs Bertha Nussbaum sec Bibb County Farm Bureau--419 Broadway, J A Johnson dist agt, D F Bruce county agt Bibb County Medical Society---H G Weaver sec, meets 1st and 3d Tuesdays in each month, Macon City Hospital Business and Professional Women's Club--Meets the 2d and 4th Thursday of each month at the Macon Cafeteria, Mrs V R Napier pres, Nellie Edwards sec Central of Georgia Railway Clerks' Organization--J S Dodd (Macon), v-pres, annual meeting Savannah, Ga Daughters of the American Revolution--Meets once a month at call of regent or vice-regent Daughters of the Confederacy--Miss Caroline Patterson pres and sec, meets 1st Wednesday of each month Hotel Dempsey Elks Club---Elks Home 127 Cotton av, N R Winshop sec Georgia Bar Assn--Harry S Strozier sec, 715 Ga Casualty bldg Georgia Peach Brokers Exchange--310 Broadway Georgia State Exposition--E G Jacobs pres, Louis Rossig- nol sec, Central City Park Harrison Mutual Burial Assn--718 Cherry, L H Burghard mgr Home and Farm Demonstration Work--Miss Rosa McGee dist home demonstration agt, J A Johnson dist County Agricultural agt, 419 Broadway Idle Hour Country Club--O J Massee pres, A F Wilson mgr, 7 miles n of city on Forsyth rd MISCELLANEOUS INFORMATION 37 Kiwanis Club--W M Collins pres, H T Harris sec, Citizens & Southern Bank bldg, meets every Wednesday at noon at Hotel Dempsey International Bible Student's Assn--Meets Sundays and Wednesdays at 120 Rogers av Macon Association of Credit Men--207 Macon Natl Bank bldg, Mrs Marie McGhee mgr Macon Baseball Assn--Central City Park, R G Williams pres Macon Pood Clinic--666 Cherry, L L Gibson mgr Macon Gun Club--End Glenn avLP,DC Morgan sec Macon Mutual Burial Assn--559 Mulberry, J F Hart mgr Macon Retail Food Dealers Assn--563% Mulberry, Lester Grady pres, S E McKenna sec Mary Hammond Washingtoin Chapter D A R--Meets 2d Wednesday of each month at homes of members, Mrs Olive Porter regent Methodist Centenary Headquarters--37 Fourth Natl Bank bldg, Rev W H Buddfield sec Masonic Club--710 Mulberry, R D Feagin pres, H G Hollingsworth sec-treas Nathaniel Macon Chapter 665 (D A R)--Meets first Monday of each month at homes of members, Mrs H A Blackshear regent North Carolina Pine Assn Inc--721 Citizens & Southern Bank bldg, R H Morrison mgr Pilot Club--Frieda May pres, Miss Nell Perry sec, 410 Bibb bldg Progress Club--814 Mulberry, Jerome Herman sec-treas Rotary Club of Macon--Dr F F Jones sec, 354 2d, meets every Wednesday at Y W C A Travelers' Aid Society--Mrs Mattie Griffin, Mrs O W Gil- lon, Mrs Mae Bowles and Lula E Glass matrons, Terminal Station United Confederate Veterans--R A Smith Camp No 484, U C V, B A Moore comdr, W R Evans adjt, meets 3d Sunday evening of each month at Court House Woman's Club of Macon--Mrs M L Fuller pres, Mrs Bruce Carr Jones sec, meets on call Woman's Exchange--159 Cotton av, Mattie N Nutting and Cora C Walker mgrs W C T U--Meets at First M E Church Y m C A--1st cor Cherry, O E Maple genl sec Y W C A--Margaret C Hayes genl sec, 453% Cherry dubs and Societies--Colored Y M C A 452% Cotton av, Sargent Cole sec eSt Peter Claver--428 W COaNrdVE(VN)T,SSister Mary Raymond mother superior .... halls and public buildings Albin Apartments--920 College Andrew Cottage--1211 (237) Edgewood ay Attaway Cottage--1127 College Bankers Insurance Building--211 Cotton av 38 MISCELLANEOUS INFORMATION Barnes Apartments--356 New Belmont Apartments--615 Walnut Bibb County Court House--Mulberry nw cor 2d Bibb Building--403 Cherry Biltmore Apartments--811 Poplar Carey's Hall--451% Cotton av Cherrydale Apartments--818 Cherry Citizens & Southern Bank Building--461 Cherry City Auditorium--712 Cherry City Hall--Poplar bet 1st and Cotton av City Market--Poplar bet 1st and 2d Clisby Building--574 Cherry College Hill Apartments--472 College Colonade Apartments--263 Georgia av Colonial Apartments--520 Orange County Court House--Mulberry nw cor 2d County Jail--350 Mulberry Douglas Office Building--355 Broadway Duggan Cottage--rear 1311 (311) Edgewood av Eagles Club--258% 2d Ellis Building--201 Cotton av Ellisonian Flats--478 College Federal Building--Mulberry ne cor 3d Floyd Rifles Armory--651% Poplar Forsyth Terrace--579-587 Orange Fourth National Bank Building--502-4 Cherry Fredonia Apartments--213 Bond Georgia Casualty Building--516-522 Mulberry Georgia Cottage--1321 (321) Edgewood av Georgian Apartments--813 Poplar Georgian Terrace Apartments--261 Georgia av Grand Building--617 Mulberry Grand Theatre--617 Mulberry Hard Cottage--1123 College Hardeman Building--105 Cotton av I O O F Building--511-515 2d I O O F Hall--509 Mulberry Jaques Building--407 Broadway Jordan Apartments--930 College Katherine Court Apartments--855 Mulberry K of C Hall--567 Mulberry Payne Mill Auditorium--Davis nr Payne av K of P Hall--556 New Lackay's Hall--1502% Broadway Lafayette Terrace Apartments--305 College Laurine Apartments--559 Orange Lee Building--512% 3d Luther Williams Bank Building--617 Cherry McCall Cottage--1353 (353) Edgewood av McDaniel Cottage--1133 College McGinty Cottage--1307 (307) Edgewood av Macon Hussar's Armory--617% Poplar Macon Machine Gun Co Armory--655% Poplar Macon Savings Bank Building--150 Cotton av Macon National Bank Building--Cherry sw cor 2d MISCELLANEOUS INFORMATION 39 Macon's Volunteers Armory--468 1st Manly Cottage--1317 (317) Edge-wood av Marshall Apartments--232 High Martin Cottage--1134 University pi Masonic Hall--111 Cotton av Masonic Hall--429 % Cotton av Massee Apartments--401-5 College Maynard Apartments--109 Washington av Mercer College Cottage--35 S College Miller Cottage--1132 University pi Monica Court--353% 3d Morgan Cottage--1311 (311) Edgewood av Morgan's Hall--1444% Broadway Mosley House--1355 (355) Edgewood av Nancy Mills Hall--31 S College Napier Apartments--1924 2d Napier Building--502% Poplar Napierian Apartments--309 Napier av Nevarro Apjartments--533-547 Orange Newman Apartments--853 Cherry O R C Hall--408 Poplar Odd Fellows Building--411% Cotton av Odd Fellows Hall's--5515 2d and 509 Mulberry Palisades Apartments--571-577 Orange Payne Community House--Bellevue rd nr Green Penfield Hall--1200 Elm Pierce Cottage--1300 University pi Posey Cottage--1128 University pi Pythian Castle Hall--616 Mulberry Pythian Temple--556 New Reynolds Cottage--1136 University pi Ryals Cottage--Rear 1307 (307) Edgewood av Seals Cottage--1211 (237) Edgewood av Smith Cottage--1131 College Spring St Apartments--163-65 Spring Terminal Station--5th and Cherry Tolefree Cottage--1121 College Tyrone Hall--1354 Edgewood av U S Government Building--Mulberry cor 3d Washington Apartments--475-479 Orange Washington Building--566 Mulberry Williams Cottage--1126 University pi Willingham Building--569 Cherry Wise Cottage--1138 University pi Young Men's Christian Association Building -- 1st cor Cherry Young Women's Christian Association Building 763 2d HOSPITALS, HOMES, ETC Appleton Church Home (for orphan girls)--Forest Hill av, Agnes Treat in charge Bibb Mfg Co Community House--706 Oglethorpe Bibb Mfg Co Day Nurseries--No 1, 210 Clinton (E M), No 2, 706 Oglethorpe 40 miscellaneous information Child Welfare Council--601 Main Clinic Hospital--567 Walnut, Lucile Lucas supt Georgia Academy for the Blind--247 Madison Georgia Industrial Home for White Orphan Boys ana Girls--Nr Log Cabin Club on Belevue car line, J A Harris mgr, Industrial Home rd 1 mi w American blvd Hephzibah Orphanage--Forsyth rd (C P), Bettie Tyler mgr Home for the Friendless--266 Maple, Eva Woodruff matron Julia Pji.r1tma.Ti Jones Benevolent Home--512 Walnut, founded in 1886, opened May 1, 1891, trustees the rector, wardens and vestrymen of Christ Episcopal Church, Lilia Morel matron Juvenile Detention Home--Smithsonia County Farms 6 mi east of city nr Swift St Station, J A Knox supt Lundy Hospital--601 3d av (V), J W Lundy M D in charge Macon Hospital--820 Pine, C R Massenburg supt Macon Hospital Nurses Home--700 New Masonic Home--Masonic Home rd beyond limits, J E Summer supt Mercer Infirmary--Elm nr College Methodist Orphans Home--121 Pierce av (V), H Daugh- erty supt Middle Georgia Sanatorium--722 Spring, Dr C H Richard- son jr in charge Oglethorpe Private Infirmary--1309 Oglethorpe, Mary Campbell supt Smithsonia County Alms House--Smithsonia 6 mi e of city nr Swift St Station, W T Watson supt South Georgia Conference Orphans Home--Founded 1873 by the M E Church (S), under management of and supported by the South Georgia conference, 121 Pierce av, Harrison Daugherty supt Tabernacle Rescue Home--938 (926) Columbus rd, P B Hampton mgr Vineville King's Daughters Home--207 Rogers av (V), Mrs Della Poole matron LABOR DIRECTORY Macon Federation of Trades Meets 2d and 4th Wednesdays at 509 Mulberry, W A McKenna sec American Federation of Musicians Meets 1st Sunday of each month 2:30 p m at K of C Hall Barbers' Union No 274 Meets 3d Tuesday K of P Hall Blacksmiths' Union No 3 Meets 3d Thursday night at 509 Mulberry, Coleman Brice sec Bricklayers' Union No 17 Meets every other Thursday night at Clisby Hall MISCELLANEOUS INFORMATION 41 Brotherhood of Locomotive Engineers Central of Georgia Division No 210--J T Cox chief engi- neers, O T Lavender sec, meets every Sunday 2pm Odd Fellows Hall Southern Railroad Division--A C Baggarly sec, J J Holley chief, meets every Sunday 2 p m K of P' Hall 116 Mulberry Brotherhood of Locomotive Firemen Lodge No 264--Meets 2d and 4th Sundays in each month at Lackay Hall, Chas B Langston pres, E L Sitton sec Brotherhood Railway Car Men of America Central Georgia R R Division--Meets 1st and 3d Thursday nights 8pm Lackay Hall Southern Railroad Division No 76--Meets every Monday 8pm Lackay Hall Brotherhood of Railway Clerks Meets 1st and 3d Tuesdays at 509 Mulberry, J H Leigh sec Brotherhood of Railroad Trainmen John B Gordon Lodge No 376--Meets 1st and 3d Sunday of each month at 8 p m central time, at 408 Poplar J C Fitts sec ' Auxiliary B R T Meets 1st and 3d Tuesday of each month ORC Hall 408 Poplar at 2 p m Carpenters' and Joiners' Union 144 Meets every Thursday nights 7:30 p m, A F McGinnis pres, R H Bloodworth sec, 562% 2d Cigarmakers' International Union Local 471--Meets 1st Monday each month at 404 Walnut Morris Moses sec International Association of Machinists Central City Lodge No 8--Meets every Thursdlay night at Clisby Hall Corley No 8--Meets every Tuesday night at 574% Cherry Iron Moulders Union No 349--Meets 1st and 3d Mondays 8pm Morgan's Hall Macon Typographical Union No 98 Meets last Sunday at 2:30 p m of each month at I OD F Hall Mulberry, M J Sires sec Moving Picture Operators Meets 1st and 3d Sunday in each month at 509 Mulberry R A Godfrey sec, P O Box 431 Order By Conductors of America Macon Division No 123--G H Waller sec and treas, meets 1st and 3d Sunday in each month at 2:30 p m Con- ductors' Hall 408 Poplar Auxiliary No 174, O R C--Mrs F Martin sec and treas, 4086poplar nd ^ Wednesdays of each month at 3 p m, ,, , Painters' Union Meets every Tuesday night 8 p m at 1215 Broadway, Jacob Doctor pres, E W Pickett sec 42 MISCELLANEOUS INFORMATION Plasterers' Union I 0 P A MeetLs o1cskt haanrdt 3pdreMs, oLnedoanyanrdigFhitesld8spsmec, 336 Monroe, Sandy Plumbers' and Steamfitters' Local No 47-, Meets every 2d and 4th Monday night 7:30 p m, H W Criswell pres, H W Burdick sec, Odd Fellows Hall, 509 Mulberry United Brotherhood of Maintenance of Way Employees and Railway Shop Laborers J M Hancock pres, 140 Charles LIBRARIES Christian Science Reading Room--410 Grand bldg, Laura Myers librarian Price S B Free Library--Sw cor 1st and Orange, Minnie F Rice librarian T ,, , Washington Memorial Library--320 Washington av, Sal- lie M Akin librarian MILITARY Floyd Rifles (Co C 1st Inf)--651% Poplar, D C Harris capt ,, .. Georgia State National Guards--104 Georgia Casualty bldg Macon Hussars--617y2 Poplar Macon Machine Gun Co--655% Poplar, J W Barnett capt Macon Volunteers--468 1st NEWSPAPERS Macon Daily Telegraph--Published every morning by the Macon Telegraph Publishing Co, 452 Cherry, W T Anderson pres and editor, P T Anderson v-pres and genl mgr . x. _ Macon News--Daily, published by the News Printing Co, News bldg, 412-414 Cherry, R L McKenney editor, R R Wallis business mgr PARKS Bernd Park--Magnolia, Spring and Cherry Central City Park--E end of Walnut Rose Park--E side Orange bet Rose pi and Park pi Tatnall Square--College bet Oglethorpe and Columbia av Washington Park--College bet Magnolia and Washing- ton av RAILROADS Atlantic & West Point Railroad Co--F F Powers coml agt, 209 Bibb bldg Central of Georgia--R R Cammins div roadmaster 215 Terminal Station, A M Dodd div supvr buildings and bridges 217 Terminal Station Georgia Railroad--F F Powers commercial agt, 208 Bibb bldg _ Louisville & Nashville Railroad Co--A L Burnet commer- cial agent, 501 Bibb bldg MISCELLANEOUS INFORMATION 43 Macon, Dublin & Savannah Railroad Co--J S Crews asst genl mgr, G M Norwood sec-treas, G H Whitaker traffic mgr, B M Meadows commercial agent, W S Ehney freight claim agent, L H Little chief clerk, 4th fl Citizens & Southern Bank bldg, P S Little freight agent, Broadway cor Ocmulgee, shops Walnut cor 7th Nashville, Chattanooga & St Louis Ry--E H Forbes general agent, 209 Bibb bldg Seaboard Airline Ry--D W Anderson commercial agent 405 Bibb bldg Southern Ry Co--O G Prentiss frt agt, Plum and 5th Southwestern Railroad Co--J F Minis pres, W R Cox v- pres, G I Hardeman sec-treas, 808-9 Georgia Casualty bldg SCHOOLS AUD COLLEGES Georgia Academy for the Blind--Forsyth rd sw cor Alabama (C P), G F Oliphant supt, board of trustees, A L Miller chairman, C B Jewett, T D Tinsley sec-treas, G S Jones, J R Van Buren, J N Neal, T J Stewart Georgia-Alabama Business College--616 Mulberry, Eugene Anderson pres, J D Brasswell sec Mercer University--Ash opp Tatnall Sq, Rev W R Weaver pres, Rev B D Ragsdale treas, S W Garrett bus mgr Morris Max School of Pharmacy--517% 3d Mount DeSales Academy -- 639-645 Orange, Sisters of Mercy in charge St Joseph's Catholic School--810-12 Poplar, Sisters of Mercy in charge Southern Business College--656% Cherry, E L Ray pres Struby s School of Pharmacy--416% 2d, C A Struby, J T Oliphant Wesleyan College--College bet Georgia and Washington av, Rev W F Quillian pres Colored Ballard Normal School (formerly Lewis Normal Institute) --50 Forest av, R G Von Tobel prin Beta Etta College--100 Grant av, Minnie L Smith pres Central City College--1150 Clinton rd, Rev J H Gadson pres Georgia Academy for the Blind--247 Madison, L H Wil- liams prin Macon Normal and Industrial Institute--Pio Nono av cor Lee St PBtaerrt*hlleanvirn Cchaathrogleic School--430 Ward, Rev Alfonso SECRET SOCIETIES Elks Macon Lodge No 230, B P O E, ^ R Winship sec, lodge FElikls HWoeV meer,yJ12.7UCe^odfttyonnaigvht' lod&e and club rooms 44 MISCELLANEOUS INFORMATION Fraternal Order of Eagles Aerie No 977--Meets every Thursday night at rooms 258y2 2d, Luther Henderson sec Independent Order of Odd Fellows (Hall 515 2d) Franklin Lodge No 2 --Meets every Thursday night, 509 Mulberry Fort Hawkins Lodge No 315--Meets every Wednesday night in Franklin Hall (E M) Macon Lodge No 123--Meets every Thursday night, I O 0 F Hall Macon Union Encampment No 2--Meets 2d and 3d Friday nights in I O O F Hall United Brethren Lodge No 5--Meets every Tuesday night in I O O F Hall Rebekahs Yonah Rebekah Lodge No 23--Meets every 1st and 3d Wednesday night in I O O F Hall Lilian Rebekah Lodge No 2--Meets 2d and 4th Monday night at 509 Mulberry, R A Price sec Junior Order United American Mechanics Macon Council No 9--Meets every Friday evening, 509 Mulberry, D P Ivey sec Knights of Columbus No 925--Meets 1st and 3d Tuesdays at K of C Hall, 567 Mulberry, Chas M Connor sec Catholic Women's Club Meets on call at Knight sof Columbus Hall Knights of Pythias Grand Lodge of Georgia--W C Moore (Atlanta), G C, W H Leopold (Savannah), G K of R & S Central City Lodge No 3--Meets every Wednesday night at 616 Mulberry Syracuse Lodge No 36--S T Ray K of R & S, meets every Friday night at 616 Mulberry Endowment Rank, Section No 77 -- Harry Garden sec, meets at 616 Mulberry Masonic Grand Lodges Grand Lodge of Georgia F & A M--Meets last Tuesday in October, Frank F Baker grand sec (Macon) Grand Chapter of Georgia R A M--Meets last Wednesday in April, Edgar A McHan grand sec (Macon) Grand Council of Georgia R & S M--Meets last Tuesday in April, Edgar A McHan grand recorder (Macon) F &AM Macon Lodge No 5--Meets 111 Cotton av 1st and 3d Monday evenings, J D Owens sec Mabel Lodge No 255--Meets 2d and 4th Tuesday evenings, 710 Mulberry, A C Durden sec Wolihin Lodge No 390--Meets at 710 Mulberry, 1st and 3d Tuesday evenings, E B Campbell sec Fort Hawkins Lodge No 418--Meets cor Clinton and Main (E M), 1st and 3d Wednesday evenings, W H Smallwood sec / MISCELLANEOUS INFORMATION 45 Marshall A Weir Lodge No 448--Meets 1st and 3d Thursday evenings 710 Mulberry, PRL Stroberg sec BAM Constantine Chapter No 4--Meets 111 Cotton av, 2d and 4th Monday evenings, J D Owens sec A M Wolihin Chapter No 104--Meets 710 Mulberry, 2d and 4th Thursday evenings, F F Baker sec B& SM Washington Council No 6--Meets 111 Cotton av, 2d Friday evening, J D Owens sec K T St Omar Commandery No 2, K T--Meets 111 Cotton av, 1st and 3d Thursday evenings, C R McCord rec A and A S B Zerbal Lodge of Perfection--710 Mulberry Kadmiel Chapter of Rose Croix--M A Weir, Preceptory Macon Consistory--H G Hollingsworth rec Mocam Grotto--Moses Barnes sec AA0 NMS A1 Sihah Temple Nobles of the Mystic Shrine--Meets at its temple every Friday night, 506 1st, C R McCord rec Order Eastern Star Central City Chapter No 28--Meets 2d and 4th Thursdays at 111 Cotton av, Becky Warren sec Elberta Chapter No 215--Meets 1st and 3d Monday even- ings at 710 Mulberry v Yavapai Tribe No 88, Bed Men I O R M--Meets in Odd Fellows' Hall every Thursday Ladies* Auxiliary Maricopa Council, Daughters of Pocahontas--Meets in Odd Fellows' Hall every Thursday night Women's Benefit Assn of the Maccabees Macon Review No 12--Meets 2d and 4th Tuesday nights each month at 519 Pine, Mrs Alice Turner collr Newberg Review No 15--Meets 1st and 3d Friday nights at 509 Mulberry, Mrs Lillie Allen collr ,, Woodmen of the World Magnolia Camp No 88--Meets 1st and 3d Friday nights in Morgan's Hall, G R Williams elk Myrtle Camp No 14--Meets every Friday night in K of C Hall, 567 Mulberry, J W Herrington elk Ocmulgee Camp No 938--Meets 1st and 3d Thursday nights at 607^ Main, Porter Henderson sec 509 No Mulberry 23~Meets every 2d and 4th Thursday at COLORED SOCIETIES tv Masons n3sd?w WeeTdneaeUsdfayLsdmgeeNacoh32m4oAntFh &atAOMdd--FMeleleotws s1'stbaldngd, _ ,J ox W M> Clarence Tyson sec Central City Ix>dge No 199--Meets 1st and 3d Monday of each month at 411*4 Cotton av 46 MISCELLANEOUS INFORMATION ' Bast Macon Lodge No 3368--Meets 2d and 4th Tuesdays of each month at 559 Broad (B M) Bibb County Lodge No 293--Meets 1st and 3d Thursdays at 2d fl 4111/2 Cotton av Crystal Square Lodge No 458--Meets 1st and 3d Tuesdays at 2d fl 411% Cotto hav Macon Lodge No 491--Meets 2d and 4th Mondays at 3d fl 4111/2 Cotton av Moving Sun Lodge No 466--Meets 1st and 4th Thursdays at 3d fl 411% Cotton av South Macon Lodge No 524--Meets 2d and 4th Fridays at 3d fl 411% Cotton av Square Lodge No 348--Meets 2d and 4th Mondays at 2d fl 411% Cotton av Lebanon Lodge--Meets 2d Tuesday 3d fl, 4th Wednesday 2d fl 411% Cotton av Victory Lodge No 482, Meets 2d and 4th Tuesdays at 2d fl 411% Cotton av Order Eastern Star Bibb County Chapter No 321--Meets 1st and 3d Fridays at 2d fl 411% Cotton av Central City Chapter No 46--Meets 1st and 3d Tuesdays at 2d fl 4111/2 Cotton av Bast Side Chapter--Meets 1st and 3d Tuesdays at 2d fl 411% Cotton av Hosannah--Meets 1st and 3d Wednesdays at 2d fl 411% Cotton av Phoenix Chapter No 109--Meets 2d and 3d Tuesdays at 2d fl 411% Cotton av Rosa Lee Barens Chapter No 417--Meets 2d and 3d Mondays at 2d fl 411% Cotton av South Macon Chapter No 420--Meets 1st and 3d Thursdays at 2d fl 411% Cotton av Square Chapter Uo 342--Meets 1st and 3d Thursdays at 2d fl 411% Cotton av Tindell Field Chapter No 425--Meets 1st and 3d Mondays at 2d fl 411% Cotton av Tried Stone Chapter No 419--Meets 2d and 4th Fridays at 2d fl 411% Cotton av Victory Chapter No 321---Meets 1st and 3d Fridays at 2d fl 411 % Cotton av DeMolay Consistory--Meets 2d Thursday at 3d fl 411% Cotton av K T Wm E Terry Commandery--Meets 3d Thursday at 3d fl 411% Cotton av Malta Commandery--Meets 1st Wednesday at 3d fl 411% Cotton av Terrell Commandery--Meets 1st Wednesday night in each month at 2d fl 411% Cotton av Excelsior Lodge No 6374--Meets cor Broadway and Hawthorne Odessa Lodge No 8408--Meets 2d and 4th Tuesdays of each month in Turner's Hall MISCELLANEOUS INFORMATION 47 Pleasant Hill Lodge No 3597--Meets 2d and 4th Mondays of each month in Slark's Hall, Broadway GUO Wise Men of the East Supreme Council meets April 15 and Oct 15; subordinate lodges 1st and 3d Wednesday at 523% Cotton av, T A Lumpkin supvr grand chief Knights of Pythias Grand Lodge of Ga--Meets second Tuesday in July Armour Lodge No 64--Meets 1st and 3d Wednesday nights at K of P Hall Aurelia Lodge No 591--Meets 2d and 3d Tuesday nights at K of P Hall Defiance No 13--Meets 1st and 3d Wednesday nights each month at 556 New DeHorten Lodge No 51--Meets 1st and 3d Tuesdays of each month at hall, 357 Clinton (E M) E W Ansley Lodge No 123--Meets 2d and 3d Monday nights at K of P Hall Gibraltar Lodge No 150--Meets 1st and 3d Thursday nights at K of P Hall J A Wood Lodge No 110--Meets 1st and 3d Thursday nights at K of P Hall Keystone Lodge No 5--Meets 2d and 4th Wednesday nights at K of P Hall Macon Lodge No 400--Meets 1st and 3d Thursday nights at K of P Hall B N B Williamson Lodge No 243--Meets 2d and 3d Wednes- day nights at K of P Hall Priscilla Lodge No 252--Meets 2d and 4th Friday nights at K of P Hall s R C Cody Lodge No 620--Meets 2d and 4th Thursday nights at K of P Hall Twentieth Century Lodge No 310--Meets 2d and 4th Thursday nights at K of P Hall Valiant Lodge No 340--Meets 2d and 4th Thursday nights at K of P Hall \ V It Pays To Be Prominently Displayed To let people know WHO you are, WHERE you are and WHAT you have to sell. The City Directory keeps your name before the public 365 days in the year, and it cannot be prominently displayed in any book so CONSTANTLY used as *-he City Directory. CLASSIFIED BUYERS' GUIDE OF THE CITY OF MACON GEORGIA 1925 The Buyers' Guide contains the advertisements and business cards of the most progressive business men and firms in our city, classified according to lines of business. The habit of using these Classified Lists will save the buyer large sums of money. It is the modern and up-to-date method of finding what you want and who sells it. R. L. POLK & CO., Publishers Birmingham, Ala., and Detroit, Mich. 50 ACCOUNTANTS W. L THAGGARD CERTIFIED PUBLIC ACCOUNTANT FEDERAL TAXES 708 Georgia Casualty Bldg. Tel. 2914, Res. Tel. 2262 ADVERTISING THE LETTER SHOP J. RICHARD HUDSON, Mgr. DIRECT MAIL ADVERTISING MULTIGRAPHING, MIMEOGRAPHING, TYPEWRITING ADDRESSING, MAILING 702-703 Bibb Realty Bldg. Telephone 4521 AUTOMOBILE LIVERY "RENT A NEW CAR YOU-DRIVE-IT" For Business SYSTEM For Pleasure U-DRIV-IT SYSTEM OF AMERICA, Inc. 409 Mulberry St. Macon, Georgia Telephone 281 AUTOMOBILE REPAIRERS N. E. PACE TRUCK AND AUTO REPAIRING Authorized Service Station and Parts for White Motor Trucks Brakes Lined by Machinery 657-659 THIRD ST. PHONE 4846 (1925) R. Li. POLK & CO.'S 51 AUTOMOBILES HUDSON CARS ESSEX CARS MACK TRUCKS Sparks Motor Co. SALES--SERVICE 550 BROADWAY PHONE 4787 BEELAND-CONRAD MOTOR CO. Star, Durant, Paige and Jewett Motor Cars 560 SECOND ST. TELEPHONE 2813 Coleman Motor Company G. H. COLEMAN Distributors Studebaker Automobiles PARTS AND SERVICE 218-220 THIRD ST. PHONE 2545 MACON CITY DIRECTORY (1925) 52 AUTOMOBILES Dunlap-Huckabee Auto Company BUICKS CADILLACS 682-690 THIRD ST. USED CARS PHONES 5100-5101 ELLIS MOTOR COMPANY AUTHORIZED DEALERS 362 First St. Lincoln CARS-TRUCKS-TRACTORS PARTS--SERVICE--ACCESSORIES Macon, Georgia Phones: Office 724, Service 1846 W. R. Finch Motor Company Distributors Nash Motor Cars PHONE 4354 MACON, GA. 658 THIRD ST. ASK YOUR NEIGHBOR HOW HE LIKES IT IDEAL BATTERY CO. ERNEST E. SMITH, PROPRIETOR Repairs -- Sales -- Service PHONE 4951 256 SECOND ST. (1925) R. L. POLK & CO.'S 53 AUTOMOBILES JONES MOTOR COMPANY AUTHORIZED DEALERS Fordsoiv CARS-TRUCKS-TRACTORS Ford Parts, Accessories, Service, Gasoline and Oil A WRECKER AT YOUR SERVICE 557-559 Plum St. Phone 1591 Macon, Georgia E R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT AND REPAIRED TAYLOR MADE SEAT COVERS 523 PINE ST. PHONE 1279 STEVE M. SOLOMON, Jr. Dodge Brothers MOTOR VEHICLES 462 Broadway Tels. 4956-4957 Macon, Ga. CHAS. W. STROBERG AUTO PAINTING AND TRIMMING ALL KINDS OF TRUCK AND BUS BODIES BUILT TO SUIT YOUR INDIVIDUAL NEEDS 451-453 FIRST ST., MACON, GA. PHONE 1244 The new lacquer finish applied hy experts with modern equipment. MACON CITY DIRECTORY (1925) 54 AUTOMOBILES YATES MOTOR CO. DISTRIBUTORS OF Overland, Franklin and Willys-Knight Automobiles 707 THIRD ST. Telephone 1446 POLK'S BANKERS ENCYCLOPEDIA (PUBLISHED SEMI-ANNUALLY) BcaMniatayynpkAsAoostorhfSfiuetnyolrenlwaotDchanphniesrdiwesScUhtct.aoeootfrrmeSey.tphalpaloeneuncdtbdeaBlttiealhsCidnhesa.ketnidpnao.rGdgifnaiv,cBLeiaaspshnwamoklswsoR,oirenefBsgeaenrnaeyvkcceeheearsrCssS,aiettriaTsyettserau.dbsaaltintsadhCeroTdem,gepraararinndtdoiienrsygp,oaBpnaudalonlankStgsiaovntwihniagothnsf Price $15.00 per volume--in Canada and foreign countries $20.00. BANKERS ENCYCLOPEDIA COMPANY, 431 Howard St., Detroit, Mich. 5241092346431 EBNnFr.odiafi7tcdhtowhtatAyS,Bvt.el,Nd.,geSw.,Pt.itYStLtso.borkuuPirsaguhl 4651103754612WSMM.eissaClsreikloyaenrtkMSSeSttm..t,,.o, rPSiCahalhinilcaBadFlgedrolagpn.h,ciiaAsctolanta 29910195 CEMo.laui4mnthbiSa'St.t,S.,tD.L,aolSslaesaAtntlgeeles BANKS AND BANKERS CONSERVATIVE ACCOMMODATING SECURE THE CITIZENS AND SOUTHERN BANK MACON, GA. Capital, Surplus and Profits Over $5,800,000.00 Member Federal Reserve System No Account Too Large None Too Small FOURTH NATIONAL BANK OF MACON STRENGTH--Our Resources are Ample for Your Needs. SECURITY--The Systematic and Thorough Inspection of Our Affairs by the National Government Insures the Safety of Your Deposits. CHARACTER AND ABILITY--Our Board of Directors are Successful Business Men; Our Officers are Men of Character, Conservatism and Long Banking* Experience; Our Clerical Force is Skilled and Accurate. STRENGTH, SECURITY, CHARACTER, ABILITY--Essential Elements of a Sound Banking Institution. TEL. 4166 (1925) R. L. POLK & CO.'S 55 BANKS AND BANKERS LIBERTY SAVINGS & REAL ESTATE CORPORATION Sell and Buy Real Estate Saving's Accounts and Loans a Specialty 4 Per Cent Semi-Annually All Applications for Loans Given Prompt Attention We Earnestly Solicit Your Business and Ask You to Give Us a Trial 453 COTTON AVENUE TELEPHONE 4691 MACON NATIONAL BANK The Bank of Personal Service CORNER SECOND AND CHERRY Merchants & Mechanics Savings Bank OF SOUTH MACON, GEORGIA 1446 BROADWAY TELEPHONE 14 4% Paid on Savings Accounts WE ARE OPEN ALL DAY FOR YOUR CONVENIENCE--WILL APPRECIATE YOUR BUSINESS Luther Williams Bank & Trust Co. "FOUNDED AND BUILT ON HONOR" OPEN ALL DAY FROM 9 TO 6 4V2% on Savings Corner Cherry and Cotton Ave. Phones 768 and 1755 MACON CITY DIRECTORY (1925) 56 BOTTLERS Macon Chero-Cola Bottling Company 618-620 BROADWAY TELEPHONE 2487 Macon Orange-Crush Bottling Co. EXCLUSIVE BOTTLERS OF WARD'S LIME-CRUSH ORANGE-CRUSH LEMON-CRUSH THIRD AND OGLETHORPE STS, TELEPHONE 2676 DRINK TRY ME BEVERAGES 7 VARIETIES DEMAND THE GENUINE FLAVORS OF DISTINCTION 359 COTTON AYE. PHONE 5061 MR. BUSINESS MAN! DON'T USE AN OLD DIRECTORY This Directory is issued ANNUALLY. No other medium in the world gives the information contained herein, therefore it is CONSULTED DAILY FOR TWELVE MONTHS until a new edition is issued. What better medium to gain publicity for your advertisement? (1925) R. L. POLK & CO.'S 57 BUILDERS' SUPPLIES BRICK AND TILE Standard Brick and Tile Company Face Brick, Common Brick, Hollow Building Tile Our Business Is Built on Quality and Service 46Q BROADWAY PHONES 1447 and 1448 BUSINESS COLLEGES Kaigler's Business College TERMS $12.50 PER MONTH FOR EACH COURSE Where more than one course is taken reductions are made STENOGRAPHY BOOKKEEPING ENGLISH SPANISH FRENCH 211 Cotton Ave. Telephone 3517 CARBONATED BEVERAGES Drink IN BOTTLES MACON COCA-COLA BOTTLING CO. PHONE 287 CEMENT PRODUCTS R. E. CLARK ORNAMENTAL CEMENT WORKS PORCH, LAWN and CEMETERY ADORNMENTS WINDOW SILLS and BOXES 1150 Napier Ave. Phone 3844-W MACON CITY DIRECTORY (1925) 58 CIGARS AND TOBACCO L. A. WALKER, Pres. C. P. MILLIRONS, V.-Pres. R. D. SAMS, Sec.-Treas. Macon Cigar & Tobacco Company Wholesale Cigars, Cigarettes, Snuff and Tobacco Exclusive sales on the following brands of cigars: Havatampas, Tampa Straights, Above the Average, Blue Ribbons, Entenzas, Tampa Nuggetts, Tampa Guides, Walker's Hand Made, King Edward, Franklin, Ruy Lopez. 656 BROADWAY TELEPHONE 2436 CLOTHING CLOTHING FOR THE FAMILY Day's FOUR MONTHS TO PAY Federal Clothing Store OPEN A CHARGE ACCOUNT Clothing for Men and Women THE FRIENDLIEST STORE IN GEORGIA OPERATED BY WILLIAMS CLOTHING STORES, INC. 312 SECOND STREET C. H. BUNNMT CLOTHING (0. CLOTHING, HATS, SHOES, ETC. FOR MEN 317-319 THIRD STREET (1925) R. L. POLK & CO.'S 59 CLOTHING Jos. N. Neel Co.'s New Store offers the best service, best values and best quality in MEN'S CLOTHING LET US PROVE IT 520 CHERRY STREET CLOTHING ON CREDIT You cannot afford to wait for the things you or your family need to dress stylishly and well when it is so much easier to pay weekly in small sums. You never miss the "little a week." OPEN A CHARGE ACCOUNT AND DRESS UP NOW YOUR NAME IS GOOD AT THE RELIABLE OUTFITTERS 355 SECOND ST. PHONE 2056 MACON'S OLDEST CREDIT HOUSE MACON'S SMARTEST MEN'S WEAR SHOP CORRECT APPAREL OF DEPENDABLE QUALITY HERBERT SMART CLOTHING CO. HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER CLARK, SHOE DEPT. PHONE 951 559 CHERRY ST. R. S. THORPE & SONS Next to Hotel Dempsey, Cherry Street Everything for Men and Boys Ladies' and Children's Sanitary Hair Cutting Parlor on Second Floor MACON CITY DIRECTORY (1925) C. C. BENNETT 60 COAL W. C. FETNER DIXIE COAL COMPANY BLUE GEM, RED ASH, JELLICO AND HEATER COAL Phones: 786-1503 Hawthorne and Fifth Sts. MERRITT COAL & WOOD CO. B. F. MERRITT, Prop. FIRST, N. E. CORNER ASH STREET PHONES 4977 and 4978 RAINBOW COAL CO. Wholesale and Retail DOMESTIC, STEAM AND FURNACE COAL 353 ELM STREET TELEPHONE 4597 COLLEGES Office Phone 3041 Residence Phone 2415-J Soutiiera Business College DAY AND NIGHT Our Motto: "THOROUGHNESS" Write for information E. L. RAY, President 656V2 CHERRY ST. MACON, GA. (1925) R. L. POLK & CO.'S 1833 COLLEGES 1925 MERCER UNIVERSITY MACON, GEORGIA "IN THE HEART OF DIXIE" FALL The School Year Consists of Four Quarters WINTER SPRING SUMMER A Student Can Begin Any Quarter The University Offers Work in THE COLLEGE OF ARTS AND SCIENCES THE THEOLOGICAL SEMINARY THE SCHOOL OF LAW THE SCHOOL OF COMMERCE THE SCHOOL OF EDUCATION THE DEMONSTRATION SCHOOL THE SCHOOL OF JOURNALISM THE NIGHT SCHOOL OF COMMERCE PRE-MEDICAL COURSE, PRE-ENGINEERING COURSE 43 BUILDINGS - 65-ACRE CAMPUS 90 IN FACULTY An Increasingly Large Local Patronage Enrollment 1923-1924 Was 1,147 For Further Information and Catalogue Address RUFUS W. WEAVER, Th.D., D.D., LL.D., President Mercer University, Macon, Georgia 1833 1925 MACON CITY DIRECTORY (1925) 1836 62 COLLEGES 1925 WESLEYAN MACON'S COLLEGE FOR WOMEN 60 Officers and Teachers--600 Students "A" Grade Standard College Conservatory of Music and School of Fine Arts Wesleyan, in the heart of Macon, offers UNEXCELLED ADVANTAGES at very reasonable rates. Nearly 3,000 Alumnae; Leaders Among Women WESLEYAN BELIEVES IN MACON MACON BELIEVES IN WESLEYAN A Magnificent Campus of 132 Acres Has Been Bought. A "Greater Wesleyan" Will Be Built FOR CATALOGS, ADDRESS WM. F. QUILLIAN, D. D., President MACON, GA. Jjj "A Wesleyan Welcome Awaits You" (1925) R. ti. POLK & CO.'S 63 CONTRACTORS For Brick and Frame Buildings, Brick Veneer Buildings, Store Fixtures, etc., please mail me your Plans and Specifications. Do not let your contract until you figure with me. Estimates cheerfully furnished. WALTER F. THAMES CONTRACTOR AND BUILDER Business Phone 1501 Residence Phone 4225-W 606 Holt Ave. Office, 38 and 39 Fourth Natl. Bank Bldg. Macon, Georgia DELIVERY SYSTEMS Operating Knoxville, Tenn., Charlotte, N. C., Macon, Ga. The Parcel Delivery Co. S. L. BURNS, Mgr. MERCHANTS' CONSOLIDATED DELIVERY SERVICE We Make a Special Price on Contracts PHONE 416 REAR 520 CHERRY DEPARTMENT STORES "The Busy Big Store" The Dannenberg Company "Buy Here, Pay Less" MACON CITY DIRECTORY (1925) 64 DEPARTMENT STORES 350-356 THIRD STREET 457 CHERRY STREET DEPARTMENT STORE Ladies' Ready-to-Wear, Shoes, Millinery Complete Line Men's Furnishings and Shoes Pianos and Columbia Grafonolas and Records New Edison and Diamond Disc Records MAIN BUILDING (Third Floor) DETECTIVE AGENCIES Consolidated National Detective Agency E. P. VANN, PRES. LICENSED AND BONDED 410-411 Bibb Bldg. Phone 5347 DRUGS HARDEMAN AVENUE PHARMACY E. C. JONES, Prop. 124 Hardeman Ave. Tel. 3798 DRUGS AND SUNDRIES CANDIES SODA CIGARS TOBACCO ESTABLISHED FORTY-FIVE YEARS THE ORIGINAL AND RELIABLE DRUGGIST We Appreciate Your Trade Prescriptions Carefully and Accurately Compounded DeWitt McCrary Drug Co. 336 Main St., East Macon, Ga. Phone 196 (1925) R. L. POLK & CO.'S 65 DRUGS THARP'S PHARMACY DRUGS "Quick Service Store" W. H, THARP, PROP. 672 SPRING ST. L PHONE 2171 ELECTRICAL Macon Electric Company Electrical Contracting and Repairs Motors, House Wiring, Fixtures 367-369 SECOND STREET PHONE 31 FLORAL Flowers, backed by Quality, Service and Reliability IDLE HOUR NURSERIES SOUTH'S LEADING FLORISTS 109 COTTON AVE. Don't Use an Old Directory! One Address taken from an old Directory may send you miles out of the way and waste a whole day's time. You take pride in keeping a fresh stock of merchandise on your shelves-- Why not avail yourself of fresh information for your daily use ? MACON CITY DIRECTORY (192B) 66 FUNERAL DIRECTORS L. H. Burghard FUNERAL DIRECTOR 718 Cherry Street Next Door Macon New City Auditorium MODERN BUILDING AUTO EQUIPMENT Office Telephone 6 Residence Telephone 62 J. R. WEBB, President R. E. HARTLEY, Secretary-Treasurer Prompt Attention Given All Orders Carriages Furnished for Any Occasion Central City Undertaking Co. PHONE 57 NIGHT PHONE 1156-W 457 Cotton Ave. Open Day and Night IKE HUBBARD UNDERTAKING CO. HUBBARD & BERRY, Props. C. E. SINGLETON, Manager and Embalmer 468 COTTON AVENUE PHONES: DAY 997, NIGHT 3334 AND 1495-J (1925) R. n. POLK& GOi'S 67 FUNERAL DIRECTORS Day Phone 2044 Night Phones 1528 and 3728 C. H. Hutchings & Sons Funeral Directors 510 Cotton Avenue Macon, Ga. FURNITURE Johnson, Durham & Burke "Better Furniture for Less Money" 365 Second St. Phone 3826 168 Cotton Ave. Maxwell Bros. & Bridgers FURNITURE 455 SECOND ST. PHONE 4401 MACON, GA. Everything for the Home 1m TheQassified Business heading in theGty Directory will tell you. TheGty Directory is the most complete local Buyers Guide available to residents of any city. CONSULT THE CITY DIRECTORY R.L.PolkfcCo- Publishers MACON CITY DIRECTORY (1925) 68 GRANITE AND MARBLE EXPRESS your love and reverence for the loved ones that have passed away with a beautiful Memorial erected in your Cemetery lot in Granite or Marble. 0. D. JAMES GRANITE & MARBLE WORKS Phone 4687 Shop and Office: 207 Jones Street near Riverside Cemetery GROCERS GEORGIA GROCERY "17 Conveniently Located Stores There's a Store near your door GEORGIA GROCERY HARNESS W. H. SHADBURN AUTOMOBILE TOPS AND TRIMMING Custom Made Harness and Harness Parts DuPont "Duco" Paint. Repair Work a Specialty ALL WORK GUARANTEED 708 3d ST. TEL. 4530 CITY DIRECTORY ADS (1925) R. L. POLK & CO.'S 69 HOTELS HOTEL LANIER THE LANIER, MACON, GA. Rates $1.50 per Day and Up Excellent Cafe ON DIXIE HIGHWAY LATEST NEWS OF ROADS 525 Mulberry Street T. W. HOOKS, Proprietor TELEPHONE 2771 MACON CITY DIRECTORY (1925) TRANSIENT 70 HOTELS RESIDENTIAL TOURIST jPfjoemx JMel JOHN D. BRADY, Leasee Rooms With or Without Private Bath--Hot and Cold Water in All Rooms--European Plan--Cars Stored COR. THIRD and PLUM STREETS PHONE 285 ICE CREAM MANUFACTURERS Kinnett-Odom Company Manufacturers of Kinnett's Velvet Ice Cream Cor. Sixth and Cherry Sts. Phones: 362-363 INSURANCE C. M. ADAMS ALBERT R. ADAMS C. M. ADAMS & SON, Mgrs. Rooms 205-206 Citizens and Southern Bank Building1 Tel. 677 Macon, Ga. THE EQUITABLE LIFE ASSURANCE SOCIETY OF THE U. S. H. O. TYNER MACON STAFF THOS. L. MITCHELL L. A. SHIRLEY, Dist. Mgr. W. E. PENDLETON, Dist. Agent 411-412 Citizens & Southern Bank Bldg. Phone 4305 (1925) R. L. POLK & CO.'S INSURANCE GORDON I. HARDEMAN FRED'K. W. WILLIAMS Hardeman & Williams INSURANCE--ALL KINDS Offices, 808-809 Georgia Casualty Bldg. PHONE 1381 INSURE WITH US AND GET BOTH Morgan & Morgan Insurance Agency TELEPHONE 4147 United American Life Insurance Co. M. E. ELLIOTT, Pres. J. N. WHITE, Sec.-Treas. 201-205 Georgia Casualty Bldg. Telephone 1626 INSURE "On the Job YOUR LIFE for your family'* sake YOUR PROSPERITY for your own sake YOUR BUSINESS for goodness sake, by placing your Advertisement in the 3 CITY DIRECTORY MACON CITY DIRECTORY (1925) 72 JEWELERS Matthews Jewelry Co. DIAMONDS--WATCHES "Your Credit is Good" 409 BROADWAY TEL. 4243 RIES & ARMSTRONG, Inc. JEWELERS Reliable Goods Only 315 Third Street Telephone 836 Williams Jewelry Company, Jewelers Special Attention to Repair Work 457 Cherry St. Phone 737 Macon, Ga. LADIES' READY-TO-WEAR We Save you from $5.00 to $10.00 on every garment. TELEPHONE 2511 L. SNYDER, Proprietor (1925) R. L. POLK & CO.'S 73 LAUNDRIES 20% Discount--Cash and Carry Independent Laundry Co. Dry Cleaning and Dyeing Rug Cleaning PHONE 1000 Pleating LOANS T. C. ROBERTSON, President PHONE 2961 jankers Jftnance Corporation INTEREST PAID ON DEPOSITS Private Banking--Personal Loans GENERAL OFFICES: 469 SECOND STREET MACON, GEORGIA BENEFICIAL LOAN SOCIETY CONFIDENTIAL QUICK LOANS Repayable in Monthly Installments--No Delays--No Annoyance PROMPTLY -- FAIR -- SAFE -- STRONG AMPLE CAPITAL--FAIR METHODS--LEGAL RATES 103 GEORGIA CASUALTY BLDG. PHONE 356 LOANS FARM LANDS BONDS City Applications Acted Upon Over Night J. M. CUTLER JR. GEORGIA CASUALTY BLDG. TELEPHONE 863 MACON CITY DIRECTORY (1925) 74 LUMBER W. H. BASKIN, President H. B. ERMINGER, Jr., Vice-President W. R. CLAY, Secretary-Treasurer BUILDERS LUMBER CO, Manufacturers of and Retail Dealers in All. KINDS BUILDING MATERIAL SIXTH STREET, S. E. COR. CHERRY STREET WE FURNISH EVERYTHING TO BUILD A HOUSE PHONES 220 and 3136 MACON, GA. Central Sash & Door Co. LUMBER--SASH--DOORS SCREENS--MILLWORK Waterville Road, Cor. Steel St. Tel. 5011 Macon, Ga. W. F. Elder Lumber Co. Rough and Dressed Lumber Lath, Shingles, Lime BUILDERS' HARDWARE FRONT CENTRAL CITY PARK TELEPHONE 349 PHONES 4177-4178 J. W.McC00K LUMBER CO. LUMBER SHINGLES ROOFING Builders' Supplies LIME, CEMENT PLASTER LATHS HAWTHORNE STREET, BETWEEN BROADWAY AND FIFTH (1925) R. L. POLK & CO.'S 75 LUMBER C. J. Molton Lumber Co. J. T. Molton Jr. Mgr. Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work; Brick, Laths, Shingles, Lime, Cement, Mantels, Grates, Paints, Glass, Roofing and Hardware 348 OAK STREET TELEPHONE 2687 MEDICINE MANUFACTURERS pYORA^ THE BEST MOUTH WASH USE DAILY TO KEEP GUMS HEALTHY AND CLEAN A BOTTLE MAKES A QUART BREATH SWEET AND TO AVOID RIGGS DISEASE J. T. Oliphant Manufacturer 658 Mulberry St. Tel. 2301 MACON, GA. MONUMENTS WOOTEN MARBLE CO. We wish to offer our services to you in the selection of a suitable monument or slab in memorial and in honor of your departed loved ones. We can offer a large assortment of the finest marbles to select from and can furnish any design desired. We have had years of practical experience as engravers and sculptors, and will appreciate an opportunity to serve you. C. C. WOOTEN, Mgr. 765 THIRD STREET TELEPHONE 3031 MUSICAL PIANOS, PLAYER PIANOS, VICTROLAS, VICTOR RECORDS, GIBSON MANDOLINS AND GUITARS, AND MUSICAL MERCHANDISE The House That Furnishes Macon With Music WILUAMS-GinTENBERGER MUSIC CO. 466 SECOND ST. TELEPHONE 3831 MACON CITY DIRECTORY (1925) NEWSPAPERS 100 YEARS of SER VICE Since 1826 The Macon Daily Telegraph has been exerting an influence for the advancement of Macon and Georgia. Its news columns have always brought to its thousands of readers an unbiased report of the day's happenings and its editorial columns have been used unselfishly for what it thought was right. Advertising in The Macon Telegraph has paid well because it is a newspaper that has an appeal to every member of the family. Directories show the growth of a city but a progressive newspaper records this growth day by day. The Macon Daily Telegraph Subscription Dept. Phones, 76 and 521 Adv. Dept Phone, 1264 W. T. ANDERSON President and Editor P. T. ANDERSON V.-Pres. and Gen. Mgr. j (1925) R. L. POLK & CO.'S 77 NEWSPAPERS READ The Macon News DAILY AND SUNDAY THE NEWS Is a Complete Newspaper in Every Detail INDEPENDENT IN POLITICS AND EDITORIALLY DEALS WITH CURRENT EVENTS IN A MANNER THAT APPEALS TO ALL THINKING PEOPLE READ THE MACON NEWS It is a paper you will both like and Read-- If you are not now a Subscriber TELEPHONE 1223 MACON CITY DIRECTORY (1925) 78 OILS GULF REFINING COMPANY THAT GOOD GULF GASOLINE AND SUPREME AUTO OIL SERVICE STATIONS Cotton Ave. and Plum St. Second and Walnut Sts. Hardeman Ave. and Forsyth St. OPTICIANS MACON OPTICAL CO. Frank H. Johnson Optometrists Opticians 468 CHERRY ST. PHONE 3213 QUALITY PAINTS SERVICE COURTESY Jarrett Paint & Glass Company HOME OF PATTON'S SUN-PROOF PAINT Proof PRODUCTS 312 Third Street Macon, Georgia Telephone 2606 PAINTS--VARNISHES--BUILDING AND AUTO GLASS MAILING LISTS Polk mailing lists of firms guaranteed 98% deliverable. Lists of individuals guaranteed 95% deliverable. Send for Polk folder "Mailing Lists That Pull"--a gold mine of buyers of merchandise, service or securities. R. L. POLK & COMPANY 501 Polk Directory Bldg., Detroit, Mich. (1925) R. L. POLK & CO.'S 79 PLUMBERS MIM.F.R brothers PLUMBING, STEAM, VAPOR AND HOT WATER HEATING REPAIR WORK A SPECIALTY Rapid Bath Heaters--"Hajoca" Bath Fixtures Areola Heating Systems 171 Cotton Avenue Telephone 474 _________ ROLLER & MILURONS . Steam, Hot Water and Warm Air Heating Systems Plumbing, Repair Work Given Special Attention The Queen Anne Home Heaters 115 3d AVE. "We Do It Rright" PHONE 5113 SCHWARTZ & PHAUL SHEET METAL WORKS Metal Cornices, Skylights, Ventilators, Tin, Tile and Slate Roofing, Metal Shingles, Warm Air Heating AGENTS: JOHNS-MANVILLE ROOFING 452 PLUM STREET J. T. SHROPSHIRE PRACTICAL PLUMBING Special Attention Given to Contract and Repair Work 525 COTTON AVE. MACON CITY DIRECTORY <1925) PHONE 1265 80 PLUMBERS T. L. WOOD PLUMBING AND HEATING Special Attention Given to CONTRACT AND REPAIR WORK ALL WORK GUARANTEED Telephone 529 476 COTTON AVE. CHARLES S. JONES PRINTERS CHARLES L. CONEY JONES & CONEY COMMERCIAL PRINTERS Telephone 3087 411 BROADWAY MACON, GA. REAL ESTATE REAL ESTATE LOANS RENTALS INSURANCE CARL BLOCH PHONE 1267 310-311 Citizens & Southern Bank Bldg. Kenmore Bums, Inc. REAL ESTATE RENTS AND INSURANCE 157 COTTON AVENUE PHONE 89 (1925) R. L. POLK & CO.'S 81 REAL ESTATE PHONE 2391 Calhoun & Thomas REAL ESTATE LOANS AND INSURANCE BUILDING HOMES A SPECIALTY 5691/2 CHERRY ST. City Realty Company INCORPORATED Rents - Insurance - Loans ARE YOU INSURED? Telephones 1561-1562 MACON, GA. "WE SPECIALIZE" ESTABLISHED 1912 WASHINGTON DESSAU REAL ESTATE, RENTING AND INSURANCE 101 Georgia Casualty Bldg. Macon, Ga. Phones 271-272 MBSBsmam G. a HARDEMAN CO. REAL ESTATE--RENT COLLECTIONS FIRE INSURANCE AND LOANS Telephones 1963 and 1964 Macon, Georgia MACON CITY DIRECTORY (1925) 82 REAL ESTATE Geo. E. Hatcher, Pres. Walter H .Turpin, V.-Pres. Floyd O. Schofield, Sec.-Treas. Hatcher-Turpin Co. REAL ESTATE, LOANS AND INSURANCE RENT COLLECTIONS A SPECIALTY 523 MULBERRY STREET TELEPHONE 77 A. T. HOLT PERSONAL SERVICE CO. Real Estate and Renting Agents 569 MULBERRY ST. TELEPHONE 22 REAL ESTATE LOANS RENTING Jordan Realty Company "WE SELL DIRT CHEAP" 354 FIRST STREET TELEPHONE 1136 LOUIS. A. THARPE Real Estate, Loans, Investments FARM LANDS INSURANCE EXCLUSIVE AGENTS INGLESIDE OWN A HOME 308 SECOND STREET TELEPHONES 2376 and 2377 (1925) r. l. polk & co.'s 83 REAL ESTATE HENRY WHITEHEAD REAL ESTATE--INSURANCE--LOANS 308 Bibb Realty Bldg. Phone 1227 Macon, Georgia Fire Insurance Companies represented: Commercial Union Fire Insurance Co. of New York; American Insurance Co. of Newark, N. J. OFFICE PHONE 5192 RES. PHONE 2055-W R. A WILLIAMS Real Estate, Loans and Insurance Rooms 40-41 Fourth National Rank Bldg. Macon, Georgia SEWER PIPE W. S. Dickey Clay Mfg. Co. MANUFACTURERS OF SEWER PIPE, FLUE LINING, DRAIN TILE AND WALL COPING 609-613 Georgia Casualty Bldg. Telephone 617 CAN YOU AFFORD to miss a Full Representation in the Classified part of the City Directory? It is a Buyers' and Sellers' Guide, and through its consultation thousands of dollars worth of goods are sold annually MACON CITY DIRECTORY (1925) 84 *1 STATIONERS \ OFFICE SUPPLIES We specialize on Everything for the Office and carry the most complete stock of both steel and wood equipment. We are ready to serve you with High Grade Merchandise as well ad Printing, Ruling and Loose Leaf Goods of every description. THE J. W. BURKE CO. OFFICE OUTFITTERS AND PRINTERS 406 CHERRY STREET PHONES 74 and 75 TAILORS IMPORTER OF FINE WOOLENS FOREIGN AND DOMESTIC CLOTHES MADE TO FIT YOU VINCENT CANIPELU 320 SECOND STREET PHONE 1130 I TAX SPECIALISTS AND ADVISORS BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Prepared Abatement, Refund and Credit Claims Prepared and Filed BIBB REALTY BLDG. Telephone 213 (1925) It. r,. POLK & eo.'S 85 wIi st TAXICABS For Sudden Service Call a Yellow Cab PHONE 5000 The Thinking Fellow Rides a Yellow HAIL THEM ANYWHERE YELLOW CAB COMPANY OF MACON, GA. TIN, COPPER AND SHEET METAL WORKS J. L. HAMLIN A. B. SUBERS HAMLIN & SUBERS ARCHITECTURAL SHEET METAL WORK HOT AIR FURNACES Roofing, Tin, Tile, Slate, Metal Shingles, Galvanized Sheets, Steel Ceilings, Gut- ters, Conductors, Cornice, Skylights, Ventilators Ridge Roll and Finials. Prompt Attention to Repair Work. First-Class Work Guaranteed. Terms Cash Local and Long Distance TELEPHONE 179 27 WALL STREET MACON, GA. HUMPHRIES SHEET METAL WORKS TIN, TILE, SLATE, CORNICE, SKYLIGHTS, VENTILATORS, GUTTER CONDUCTORS Hot Air Furnace Blow Piping and General Repair Work 517 3rd ST. PHONE 985 JUDICIOUS ADVERTISING CREATES a New Business REVIVES a Dull Business ENLARGES an Old Business RESCUES a Lost Business PRESERVES a Large Business SECURES Success in Any Business SAVES a Failing Business ENABLES You to Pay Your Taxes DIRECTORY ADVERTISING BRINGS SATISFACTORY RESULTS MACON CITY DIRECTORY (1925) WALTER S. HERRIN 86 TRANSFER J- N- GEE-SLIN MACON TRANSFER & STORAGE CO. Local and Long Distance Hauling Fireproof Storage--Furniture Moving OFFICE 702-704 BROADWAY PHONE 304 TERMINAL TRANSFER CO. W. T. GREEN, Mgr. Hauling, Moving and Storage Baggage Transfer a Specialty TERMINAL STATION PHONE 38 TYPEWRITERS ROYAL AND CORONA TYPEWRITERS MIMEOGRAPHS--DICTAPHONES Supplies for All Makes--Service SCOTT-PARKER CO. Bibb Realty Building, 367 Broadway TELEPHONE 1087 The Advertisement that Lives and Works for a Year YOUR ADVERTISEMENT HERE REACHES THE PROGRESSIVE CUSTOMER AT THE TIME HE IS LOOKING FOR YOUR SPECIAL PRODUCT tnVomTou S2rSSKn" (1925) R. L. POLK & CO.'S 87 THE BANK DIRECTORY OF THE WORLD The Bankers Encyclopedia Indispensable to Credit Men, Manufacturers, Wholesalers Importers and Exporters CONTENTS full and complete list of Banks, Bankers, Trust Companies and Savings Banks in the UNITED STATES and CANADA, whether National, State or Private, Year Established and Population of City or Town where located. A complete list of Foreign Banks and Bankers in all Cities and Towns in the World. A full and complete list of Members of the principal STOCK EXCHANGES in the United States. Commission Rates of the various Stock Exchanges. A full and complete list of ALL CLEARING HOUSE CITIES in the United States, with members of same. All necessary information regarding a State, such as its Officers, When Legis- lature meets, Rates of Interest, Legal Holidays, Etc., are given at the head of each State, including lists of NATIONAL AND STATE BANK EXAMINERS with their addresses. A complete up-to-date list of DIRECTORS, ACCESSIBLE POINTS and BANK ATTORNEYS follow the Bank List in each State, where they belong. SPECIAL LISTS of EXPERT BANK AUDITORS and COMMERCIAL PAPER DEALERS. A Synopsis of the Banking Laws of each State and Territory in the United States and Canada, revised to date. Maps of all the United States and Larger Cities of the Country Issued Semi-Annually--March and September $15.00 PER COPY Bankers Encyclopedia Co. 431 HOWARD ST., DETROIT, MICH. MACON CITY DIRECTORY (1925) *& gjpfes'' ONE OF 200 POLK DIRECTORY LIBRARIES This Little Library Can Answer 945,000,000 Questions MANY TRIPS AT YOUR FINGER-TIPS -- SAVE MANY MILES, MINUTES and DOLLARS There are over 300 of these directory libraries in the United States. They are installed and maintained by the Association of North American Directory Publishers as part of the service given to directory advertisers. Think what this means to you in effort, time and money saved. You want to know the relationship of the signer of a letter to the firm he represents--- the directory library has the answer; someone you vitally need to get in touch witthheindiaredcitsotrayntlicbitryarhyashams otvheed;anbsuwsienre.ss Padudbrliecssoefsfiociralfsirmhavneambeeesnharveeplaccheadngbeyd new elections; location of real estate is desired again the directory library holds the answer. Of course you could write or phone for the data you desire, but maybe you don't know just who to approach--the directory library has the answer. This service is free, for single reference, to the public. DETROIT LIBRARY R. L. POLK & COMPANY DIRECTORY PUBLISHERS MAILING LIST COMPILERS ADDRESSING AND MAILING SERVICE Polk Directory Bldg., 431 Howard St. DETROIT, MICH. (1925) R. L. PORK &- CO.'S CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable POLK'S MACON, GA. CITY DIRECTORY 1925 ^aaaaaaabbcabcclpvpgsrakdalrcckskptrtsvpstthpshmrrmtrnith cecccddcdeehholoooolnelrkepnafmlpnngcltdurtfrtstrrfnmn AABAAACEGCIEEE>edrehlrbaululaifeeconwtagrgznxhhdjslk ABBREVIATIONS advbaabeapocblrcpaoaaactrapaicrksoarsrctckrskkuepmeavhiaseemnesnsaemgimeettnhtltneaeapnleiitiauecnnnnteeecthnyeesttrrtrtt cdocecdencloporfdeechaenancoonafctrdtmlghturttrlsuacimieefieomncfclcclseenpeietttataoruooneeeiknncrrrrrrrt lmmmiimpppppppspsssstannchlltumdhlhrtrbaslgssssemrheoinplyacpmlnnrnnrssnrdrrsthbrgtmmenyrrrskorp. r. .. .. telepshupsoppatneetmsetnrhmieeipipnsmsopeannraohmpaaasrnsgrrlsmtppetauylcllamisepmereeiuensenhsrebnlasaessdimalicranaitaopddlmicccandnricagngkrhbiethepetlicidaoeaeeeoesenneesaesenynrrrrrtrrsrrtrtlrt wtuttrerpiaeldhavooslsplrsm. n. .tterlaevgerlaipnuhgptshroaeoplawleesssritmudearortaoeewnrrr ABBREVIATIONS FOR GIVEN (JAMES AFACBEAlrraeleEeCbEcAiGtnxzdDAhhdrhujauaaeeieawaalgnbhgborfmrnredairaaiuerlcinengrelmietesdnkddheeesrtl JMJMKPRRSWSSTToaoatahhioaisesamcmlcteobtprhkhhosgtihdlt ,, KMTaSWRShMTPtSaoRJehtJhiarloiaeicoaoelogoctmpslhdrmmrhbimaehiaiaouarecpnoeenrareeerkhdnensefsttll Alphabetical Lists of Names Aaron John A carp hl022 Main Aaron Lucy S phone opr rllO 3d Aaron Thos W r624 (616) Montpelier av Abbott Bros (Chas C, Wm B) tinners 521 Broadway Abbott Chas C (Ada; Abbott Bros) res Jeffersonville rd I- .Tfor lists of names |4Ary TRADE j^- ANY BUSINESS , -- ANY PROFESSION [^Detroit R. L. POLK & CO. Chicago 6 Irsl 16-1? fV' BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business 90 (1925) R. L. POLK & CO.'S Abbott Laura (wid Chas M) rl23 Violet av Abbott Virginia r976 Walnut Abbott Wm B (Leatha; Abbott Bros; Durden & Abbott) h466 Duncan av Abdoo Sadie restr 608-10 3d h do Abel see also Able Abel Albert K (Rosa) h422 Blackburn Aa 5b6el! Callie M(w(wMidFLreodvicTk) Ar)50h750D6uWncaalnnuatv Abel Ella F student r410 Blackburn Abel Ella M (wid M F) h410 Blackburn Abel Fred F (Alma) mach h620 (612) Montpelier av Abe Ida (wid L R) h630 (622) Montpelier av Abel Louis W mach r620 (612) Montpelier av Abel Lula sten Macon Orange & Banana Co r615 -Duncan ay Abel Mack H student r710 Blackburn Abe Martha J (wid Wm) h615 Duncan av Abel Mary (wid B E) r401 Walnut 11A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH *vLTM0uarn^d.umelsasQt'iTc. noItf athheeyaltbhlyeedpinokn SDhHeAEeeIALayLYolTu.tHrhYFdTeo. nrtTtvishsati"lseA'iaNsttDhayeoUduyaSrnE"gDaePrrrYuegsOiggRiUnsAtaN'Lls- Abel Mildred r506 Walnut AbelaviChlaS ^ ^Inez) mach r620 (612) Montpelier Abel Reba student r402 Montpelier av ^ Aabl6eel!! ^ Thenoe^G,CWr(lAw 0^5Bid9thJHelH azLee)nl rmy)eahtl0c5tr9 Hazel rl059 Hazel Abel Wm W (Mattie; Abel's Pharmacy) h402 Mont- pener ay Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet ibfrjo^erS!,^^400 " AtaCoGrS0Magnoilar L"thCr W1,1'amS Ba"k & Tr Abraham Abe (Pearl) slsmn h305 Buford pi Abrahams Geo R servicemn E T Watson rl07 High- land av Abraham Isaac carp h863 Ocmulgee Abraham Jos lab r636 Prince R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO aENGLAND ^ip THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 Vincent MACON CITY DIRECTORY (1925) 91 Abraham Melham (Charlotte; McCahill & Abraham) h2233 2d Abraham Sanford (Vinie) lab h636 Prince Abrahantis J Ramon bkpr Fourth Natl Bank r Y M C A Abram Bessie L bkpr Middle Ga Sav & Inv Co r234 Farguson Abram Geo elk rl03 Highland av Abram Geraldine lndrs h309 (130) Smith E M Abram Isaac lab r317 Hammond Abram John H lab r641 Hammond Abram Jos collr Macon Telegraph rl07 Highland av Log Cabin Hts Abram Louis lab r309 (130) Smith E M Abram Sami (Margt) chauf r328 2d av V Abrams Mary maid h248 2d av V Abrams Monroe (Bessie) porter Macon Shoe Co r213 (235) Fargason Abrams Sami (Daisy) cotton sampler h213 (235) Fargason Canipelli MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Abron Mamie lndrs h522 New Acme Investment Co E P Wilson mgr 574y2 Poplar Acme Mattress Co Maurice Hollaway prop 312 Main E M Acme Welding and Electric Co (E E Balkcom) 756 Broadway Acosta Chas J agt United Amer Ins Co r255 Hardeman av Acree Earl T (Evie) mach r500 Edgewood av Acree Maria r454 Edgewood av Acree Young D (Ada) mgr Sands & Co r207 Col- lege pi Acuff Hubert M (Mary) eng h230 Belmont av Adams Adele bkpr r657 College ADAMS ALBERT R (Emma; C. M Adams & Son), h 206 Buford pi, Phone 639 Adams Alice (wid Benj) r801 Clinton Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J, MOLTON LUMBER COMPANY o Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK 92 (1925) R. L. POLK & CO.'S Adams Anne W Mrs h322 College Adams Annie mill opr rl07 (2) Flanders Adams Annie sten Corbin Supply Co rl08 Lamar Adams Annie M cook rl34 Schofield Adams Bartow (Effie) mill opr hl07 (2) Flanders Adams Bartow jr mill opr rl07 (2) Flanders Adams Bernice cook r320 Ellis av Adams Berry (Minnie) lab h3 Harris row Adams Bobbie L cook rl90 W Boundary Adams Bros Co J W Roberts pres-treas J W Timmer- man v-pres J I Coke sec whol meats 105 Cherry A DA 11S-BCP IIA N A \ MOTOR CO (E M Adams, C W Buchanan Jr), Lincoln, Ford, Fordson 716-720 Broadway, Phones 3497-8498 Adams Caroline nurse r413 Duncan av Adams Carrie E (wid Geo C) h411 Ridge av Adams Chapel Bellevue rd . Adams Chas elk David Wachtel r226 Duncan Adams Chas (Cora) lab hl03 (101) Roberts Adams Chas D (Mattie) carp hl03 Cabaniss av Adams Chas L (Annie) mach h226 Duncan av ADAMS CHARLES M (Fannie; C M Adams & Son), h219 Yineville av, Phone 68 J Adams Chas S (Nellie Y) elk Macon Telegraph rl40 High Adams Chas T (Ida) carp hl02 Enterprise Adams Chas T jr msngr rl02 Enterprise Adams Clara cook r Hattie Robinson Adams Clarissa (wid Geo) r4 Ford la Adams Cleo mill opr r7 Lake City Adams Clyde plmbr r568 Walnut Adams Cora (wid J Q) h418 Duncan av Adams Crawford (Lenda) ironwkr hl34 Schofield ADAMS C M & SON (C M and A R Adams), Mgrs Prudential Ins Co of America 205-206 Citizens & Southern Bank Bldg, Phone 677 (See page 70) Adams Dana H agt h4, 930 College Adams Danl D (Hattie O) pres Adams-Richardson Lbr Co h456 College Adams Della cook rl34 Schofield Adams Duck Mills Calder B Willingham pres Frances D Kinney sec and treas Wm O Tallent supt Bellevue rd Adams D C lab r!34 Schofield &C0. Polk Directory Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Va% on Savings MACON CITY DIRECTORY (1925) 93 Adams Earl mech r418 Duncan av Adams Edith student r818 Oak Adams Edith C (wid Benj) h818 Oak Adams Edw (Katie) slsmn r Mrs Christine Cooper Adams Ella M cook rl34 Schofield Adams Elton M (Lula E; Adams-Buchanan Motor Co) res Route 1 Adams Emma Mrs r200 College Adams Enoch lab h96 Bay Adams Ernest R waiter r457 New Adams Ethel V phone opr r862 Orange Adams Eva C (wid Charlton B) h657 College Adams Flemming (Lizzie) lab hlOO Moore la Adams Frank electn rl50 Hydrola Adams Frank (Sarah) truck driver h539 Calhoun Adams Frank E (Ethel) sec-treas Taylor Iron Works h417 Adams Adams Geo (Adams & Poulos) r Edgerton Hotel Adams Geo (Ada) cond h817 Broad SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Adams Geo mill hd r4 Ford la Adams Geo C r409 College Adams Gertrude cook rl34 Schofield Adams Harriett r456 College Adams Harry P (Jennie) swtchmn h ws Parkwood av 5 s Forsyth rd Adams Hattie h709 3d av Adams Hattie lndrs r459 Army lot Adams Horace (Emma )lab hl025 Broad Adams Howard H (Grace) mgr Central City Broker- age Co rlOl Lamar Adams Ida opr r717 Broad Adams Ira lab rl34 Schofield Adams Irby H (Margt) phys 811 Ga Casualty bldg h 202 Buford pi Adams Isaac (Leila) grocer 257 Cowan h219 Fulton E M Adams Jas (Sophie) firemn hl324 1st v Jfor lists of names ANY TRADE ANY BUSINESS/ -- ANY PROFESSION DBraoiT R. Lf POLK & CO. CHICAGO FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L.. POLK & CO. CHICAGO 94 (1925) R. L. POLK & CO.'S Adams Jas lab rl34 Schofield Adams Jas mech rl50 Hydrola Adams Jas C (J'ulia C) carp hl914 Broadway Adams Jas D student r812 Napier av Adams Jennings T (Gladys) real est hill Buford pi Adams Jesse B (Annie L) eng hl536 3d Adams John B (Margt) elk Mitchell Williams & Mack h750 Pine Adams John H (Mammie) lab h309 Monroe Adams John I (Cleatie) mach hll28 College Adams John 0 lab rl90 W Boundary Adams John Q (Irene) h72-73 Davis Adams John S (Eleanor) lmbrmn h369 1st Adams John W (Martha) slsmn h ws Lang av 2 s Osborne pi Adams John W jr student r J W Adams Adams Julia A nurse r413 Duncan av Adams Julius lab h357 Maple Adams J Fred jr phys 1019 Ga Casualty bldg r218 Georgia av Adams Kink (Sussie) h7 Cheatham al Adams Laura rl50 Hydrola Adams Laura J (wid Frank) h862 Orange Adams Leona T (wid Horace D) h208 Vineville av Adams Lewis (Daisy) mill opr h7 Lake City Adams Lewis D (Clyde) ship elk hll2 Colquitt Adams Lillie B rl34 Schofield Adams Lois mill opr r7 Lake City Adams Louis cabtmkr rl914 Broadway Adams Loula sten Henry Whitehead r411 Ridge av Adams Ludie student r200 College Adams Lula elk McLellan Stores Co r3, 163 Spring Adams Lynn E student rl'536 3d Adams Mae Mrs slsldy Williams-Guttenberger r568 Walnut Adams Mamie (wid Wm A) rl05 1st Adams Mamie D (wid Benj G) h409 College Adams Mary sten Ga Loan & Trust Co r413 Dun- can av Adams Mary C (Walter F) r432 Carling av H H Adams Mattie r219 Fulton E M Adams Merritt mill opr rl07 (2) Flanders Adams Mildred tchr rl40 High Adams Mollie h623 3d av 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 95 Adams Nancy (wid Jas) r201 Simmons Adams Oscar C slsmn Sou States Fertilizer Co r418 Duncan av Adams Oscar M carp h201 Simmons Adams Paul G slsmn Macon Coca-Cola Bottling Co r411 Ridge av Adams Pearle r201 Simmons Adams Ralph (Eliz R) r656 College Adams-Richardson Lumber Co (Inc) D D Adams pres W R Richardson v-pres W C Williams sec-treas Poplar nr 12th Adams Rosco oiler rl50 Hydrola Adams Ruby F opr Sou Bell Tel Co r862 Orange Adams Sallie M cook r309 Monroe Adams Sami (Lizzie) hl68 Hazel Adams Sarah dom r310 Hazel Adams Sarah lndrs hl90 W Boundary Adams Sarah C student r J W Adams Adams Sophie Mrs groc 670 Hazel hl324 1st MACON OPTICAL Frank H. Johnson ; Opticians ,\ 468 CHERRY %*. COMPANY - w .' *0,ne,mta PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Adams Susie 0 (wid Mitchell) h413 Duncan av Adams S Russell (Lula) brick mason h.3, 163 Spring Adams Teff (Amanda L) lab h429 Chestnut Adams Thos (Ella) driver Parcel Delivery Co h929 Hazel Adams Walter (Annie) lab rlOO Moore la Adams Walter E (Mae) electn r216 2d Adams Wesley (Minnie) carp hl50 Hydrola Adams Willard E car inspr r H P Adams Adams Wm lab rl37 Bay Adams Wm (Virginia) mill wkr rl04 Vineville av Adams Wm P (Maxie) millwkr h7-8 Payne av Adams Wm T (Annie) mach h35 Manchester qtrs Adams W A Mrs smstrs J P Allen & Co rl05 1st Adams W J butler rl34 Schofield Adams Zellena lndrs r310 Hazel Adams & Poulos (Geo Adams, Angelo Poulos) fruits 319 Cherry Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 u 96 (1925) R. L. POLK & CO.'iS Adamson Clarence H (Sarah) carp h322 (248) Pio Nono ay Adamson Florence L r324 (196) Pio Nono av Adamson Henry L (Eliz) gro 324 (196) Pio Nono av h do Adamson Mary E (wid Sami T) h2401 2d Adamson Ogean elk r2401 2d Adamson Sarah Mrs millwkr r322 (248) Pio Nono av Addington Albert P (Pauline) tel opr hl05 Pierce av Addison Jas D frt agt r326 6th av S M Addison Mildred V (wid S Oliver) h326 6th av S M Addison Oliver L slsmn Coleman-Meadows-Pate Drug Co r326 6th av S M Addison Roger C elk C of G R R Co r326 6th av Addleton Horace (Mary) mech rlll6 Ash Addleton Horace B (Mattie) h251 Jeff Davis Addleton Lee (wid Jos) hl28 (4) Holt av N H Addleton Lucile textile r327 Dannenberg av Addleton Park M weaver h21 Holt av N H I ua Addleton Pearl M spooler rl28 (4) Holt av N H Addleton Robt E (Mary) h327 Dannenberg av Addleton Robt L (Lona) traffic officer h222 Ross Addleton Sami B baker r327 Dannenberg av Addleton S Jos elk Crumps Park Filling Station rl28 (4) Holt av N H Addy Wm J elk Capitol Hotel r560 Plum Adkins Edw (Lula) lab h223 Neal av Adkins Golden (Jennie) lab h309 Blount Adkins John (Fanny) janitor h4 Ross st pi Adkins John L (Alice) r212 Jackson Adkins Jos C (Margt) mech r343 Hydrola Adkins Luther lab rl09 Bowman Adkins Nellie dom rl09 Bowman Adkins Sally Indrs hl09 Bowman Agnew Mabel matron Ga Ind Home res Industrial Home rd Ahearn Harold F (Sarah) slsmn Dunlap-Huckabee Auto Co h501 Napier av Ahern Annie M (wid John J) hll7 Park pi Ahern A Monica sten F T Vincent Realty Co rll7 Park pi Ahern C Hugh trav slsmn rll7 Park pi Ahern J Frances cashr rll7 Park pi Aides Danl W (Minnie) farmer h218 Reid Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable THE MORE PRINTING YOU BUY OF US The Better We Will Both Be Satisfied THE J. W. BURKE COMPANY, MACON, GEORGIA "THE SOUTH'S MOST MODERN PRINT SHOP" MACON CITY DIRECTORY (1925) 97 Aides Minnie Mrs elk Central Ga Baking Co h218 Reid Aides Rebecca (wid Donie) r218 Reid Aids Frank R (Nancy) millwright h3803 Houston av Aids Julie (wid Henry) r205 Simmons Aids Robt F sten Ideal Supply Co r3803 Houston av Aids Wiley L (Bertha) mach r242 Jeff Davis Aiken Otis (Willie M) pipeftr hlpr h545 Grant Chapel al Ainsworth Malcolm D (Kate) rl09 Hines ter Ainsworth Optical Co (Wm N Ainsworth jr) 453 Cherry Ainsworth Wm M Rev (Mary) bishop hl09 Hines ter Ainsworth Wm M jr (Dorothy; Ainsworth Optical Co) rl'09 Hines ter Akerman Chas (Sarah) lawyer 211-13 Citizens & Sou Bank bldg hl06 Culver Akin Beulah (wid Jas T) r423 Log Cabin dr Akin Eug (Rosa) carp hl020 College Akin Ida M maid r533 Coleman al Akin Inez sten r423 Log Cabin dr Akin Ira P (Ola) ins agt h423 Log Cabin dr Akin Sallie M librarian r324 Forsyth Akin Wm M (Alice) slsmn Dunlap-Huckabee Auto Co h219 Lawton av Akins Robt (Bertha) lab h609 Gilmer Akins Thos B mgr Georgia Grocery Co No 8 r2920 Houston av Akridge Alex D (Alice) wtchmn h645 Ash Akridge Doss (Ora) opr r29 Clinton Akridge Laura (wid Newton C) r811 Clinton Akridge Richd J (S'usie) mill hd r39 Bibb av Akridge Robt A (Cleveland) h254 Hydrola Akridge Sami (Sissie) mill rd h34 Taylor av Akridge Sanders (Lula) h313 Nussbaum Akridge Wm (Della) lab h413 Thompson al Albany Pink (Laura) h925 Ocmulgee Albin Jas W (Anna) eng rill Newberry S M Albea Green (Eva) lab h436 Tindall av Albea Wm L slsmn Sou Bell Tel Co r319 Duncan av Albion Apt 920 College Albright Marie r468 Walnut Alderman Durwood B r619 2d Aldred Florence F (wid Aaron W) hl'14 Clayton ^ Pi6-i7S FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DUMB 98 (1925) R. L. POLK & CO.'S as a Alexander Amos (Pauline) h808 Edgewood av Alexander Annie lndrs r rear 157 1st MMEI Alexander Annie nurse r312 Craft la ALEXANDER CATHEY Y (Elizabeth), Asst Sec Wil- lingham Sash & Door Co, hl27 Boulevard av, N Ml H, Phone 8941 Alexander Chas B (Carolyne) formn Wade & Co h300 Hendley THE Alexander Colister L (Alda P) elk Central Shops h475 DIRECTORY Duncan av Alexander Eliz student rll3 Boulevard av N H IS THE Alexander Eulalia T Mrs slsldy Union Dry Goods Co r619 Forsyth GREATEST Alexander Frances Mrs smstrs r556 Pine Alexander Geo W (Joe) gen storekpr h696 Court- MARKET land av Alexander Green F mgr City Weighing & Insp Office PLACE h749 Anderson Alexander H Grady (Lillie) bkpr r863 American hlvd IN THE Alexander Jack (Ella) millwright h411 Ayers rd Alexander John A police rl56 Pine WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * Alexander John P (Myrtle) gro 228 Cotton av h512 Oak Alexander John H (Eliz) r221 Elliott E M Alexander Luther (Lillian) lab h334 Woodliff Alexander Mary J lndrs h rear 321 Hammond Alexander Mattie Mrs lndrs h26 7th Alexander Nathan (Sophie) gro 1201' Broadway h do Alexander Pauline r556 Pine Alexander School No 1 Mary E Hodgkins prin 670 2d Alexander School No 2 Mabel H Harris prin 836 Col- lege The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Alexander School No 3 Ruth C Mangum prin 117 North av N H Alexander Wm C eng r Y M C A Alexander Wm H (Lenora) carrier P O h264 4th av Alford Beulah M mach opr rl25 Willingham Alford Elijah F (Eliz) carp hl25 Willingham Alford Mattie lndrs r407 Chestnut Alford Richd lab r314 Ash Alford Ruby sten rl25 Willingham MkjGq Alford Tracy (Lucy) lab h314 Ash PUBLISHERS Alfriend Foster (Clifford) butcher h221 Ellis av PolkBiaWffi A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. v TELEPHONE 2391 MACON CITY DIRECTORY (1925) 99 Alfriend Jas W elk J B Riley Drug Co rl46 Magnolia Alfriend Lillie elk r221 Ellis av Aligod Walter carp r2224 2d Allen Alice maid h503 E 1st Allen Allen (Louisa) lab h204 (212) Farguson Allen Amos B (Lillie A) driver h467 Napier av Allen Anna (wid A J) h327 Columbus Allen Annie (wid Wm) r2008 3d Allen Annie Mrs h752 Edgewood av Allen Annie mach opr r258 Hydrola Allen Buford student r210 Park av C P Allen Carl mach rl'154 Edgewood av Allen Carlos (Carrie) reprmn hll54 Edgewood av Allen Chas hlpr Macon Cycle Co Allen Clara lndrs r649 Oglethorpe Allen Clarke r255 Walnut Allen Cornell lab r!68 Schofield Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Allen Custis A (Corinne) city firemn hl09 3d Allen Delia (wid Virgil) hl5 Wing's Hill Allen Dinah cook rl68 Schofield Allen Erma student r467 Napier av Allen Erie (Mary) swtchmn h813 Daisy Allen Ethel cashr S H Kress & Co r202 Hulburt S M Allen Etta (wid Chas W) hl94 English av Allen Eva r503 E 1st E M Allen Frank (Elnora) porter hl51 Park Hotel al Allen Frank M (Ellen) eng hl433 Broadway Allen Geo W auto mech r220 Cedar S M Allen G F (Rivoli Dairy) Forsyth rd Allen Harry baseball pitcher rll7 Maple Allen Harry (Florence) pntr r204 Church E M Allen Harry S Rev (Bertie) evangelist h730 Napier av Allen Harry T rl94 English av Allen Henry (Carrie) firemn h309 Crisp Vs | HAYS I rYLE I i/rl A U I TMEr CREDF1 406 THIRD ST. TEL. 3026 4) G O xUJ_1J JxI-dI < d 13 J *""> H VeJ S 0w t/> yj o 2 H MS jig 33 u> Q.S< 2 |2 HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART Oft 559 CHERRY ST. CLOTHING CO. PHONE 951 uni 114 (1925) R. L. POLK & CO.'S as a Artope Monumental Works (T E Artope) 617 Mul berry M1KET Artope Thos E (Bessie; Artope Monumental Wks) mgr Sou Building Supply Co h317 Orange Asbell Custis L (Ada) mtrmn h620 Oak ML Asbell Edw B (Martha) mgr Rogers Grocery No 176 hl28 Tenny av THE Asbell Francis E agt Metropolitan Insurance Co r62u Oak DIRECTORY Asbell Geo C (Mollie) carp hl56 Lee Asbell Gladys pupil nurse Oglethorpe Private In- IS THE firmary Asbell Harvey T aud Dannenberg Co rllO Mag- GREATEST nolia ASBELL JAMES A (Bessie L), Asst Treas J S Scho- MARKET field's Sons Co Inc, lil53 Pierce av, Phone 1851-J Asbell Seresa cook r203 W Boundary PLACE Asbul Hettie (wid Dennis) h211 Ocmulgee Ash B J (Anna B) slsmn Pan-American Sou Petro- IN THE leum Co r220 1st Ash Georgia r514 Ash WORLD Ash Lewis M (Effie) mach h514 Ash ASHCRAFT GARLAND, City Editor Macon Tele- Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had graph, r755 Cherry Ashley Annie (wid Harry) r H L Ashley Ashley Asa C (Ethel M) agt Pilgrim Health & Life Insurance Co hl23 Forest av Ashley Columbus H auto mech rl65 Lamont Ashley Florence lndrs h rear 257 Ocmulgee ASHLEY HENRY L (Pearl H), Mgr Day's, h ns Ingle- side 1 e Ridge av, Phone 1920-J Ashley Jennings B asst mgr Macon Cafeteria rl65 Lamont av The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Ashley John lab rl07 Elm Ashley John A (Fannie) hl65 Lamont Ashley Lawson usher rl65 Lamont Ashley Leon emp Dixie Ice Cream Co rl65 Lamont Ashley Marshall lab r420 3d av Ashley Murdock L (Sara E) auto mech r243 Ross Ashley Orpheus (Emma) porter rT53 Middle Ashley Pearl maid r320 Ward Ashley Rose L Mrs h413 Hawthorne RLPoiKiCo Ashley Steve doormn Rialto Theatre res R F D No - prams Ashmore Perryn r225 North av N H PoBcDuecbiyl DETROIT ^for lists of names ANY TRADE ANY BUSINESS -- ANY PROFESSION J DETROIT R. L. POI IV & CO. CHICAGO TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656J/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 115 Ashmore Walter L r225 North av N H Ashton Paul F (Daisy) mach hll5 Piedmont av Ashton Thelma student rll5 Piedmont av Ashton Rosa Mrs gro 102 Green r261 Madison Ashton Stella lndrs h212 Clark la Ashton Tink A Rev (Rosa) h261 Madison Askew Felix R (Sarah) cond h617 Oglethorpe Askew John H (Lucile) h Melrose Askew Newton G (Caroline) eng hl063 Walnut Askin Harry (Lula) gro Industrial Home rd h do Askin Harry jr elk H Askin r do Askin Mary r Olin Sappington ASKIN'S, G P Morgan Mgr, Clothing for the Family, Credit Clothiers 416 3d, Phone 2226 Askins Arth (Rosa) h556 Arch Askins David student r556 Arch Askins Hester student r556 Arch Astin Elmer E (Evelyn) cond h2001 Broadway Atchison Jas S (Lila) carp h704 Anderson Athon Dorothy student r329 Ridge av Athon Evelyn student r329 Ridge av Athon Jos D (Annie M) formn h329 Ridge av Athon Marjorie student r329 Ridge av Atkins Albert (Leona) carp r952 Oglethorpe Atkins Blanche Mrs slsldy Dannenberg Co r55 High- land av Atkins Carrie rl58 Hill Atkins Chas (Ruby) driver rlO Parker av Atkins Eliz cook r301 (609) Colquitt Atkins Emma r203 Hines ter V Atkins H Giles (Alice I) bkpr h202 Napier av Atkins Jas r rear 568 Monroe Atkins Jessie maid r4 (904) Clayton Atkins Jos C (Marjorie) hoxmkr r343 Hydrola Atkins Lee grocer 476 Clinton E M h do Atkins Lizzie lndrs h250 Park Hotel al Atkins Melvin (Mamie) carp h756 Center Atkins Paris S mgr r812 Spring Atkins Prince (Missouri) lab h457 Alabama Atkins Rachael hl58 Hill Atkinson Annie L Mrs cook r5 Lake Atkinson Eva (wid Lott) smstrs r757 Poplar Atkinson Everett B (Minnie) trav slsmn h207 Chero- kee av Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. 1. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 116 (1925) R. L. POLK & CO.'S Atkinson Harry J (Pearl) flagmn h5, 615 Walnut Atkinson Jas elk Terminal Tailors & Haberdashers r Belmont apts Atkinson John F (Ruth) mach hllO Dixie av Atkinson Lott road formn r207 Cherokee av Atkinson Mae Mrs slsldy Union Dry Goods Co r282 Main E M Atkinson M E slsmn r418 Forest av Atkinson Rose C music tchr h250 1st av V Atkinson Roy (Mae) mech r282 Main E M Atkinson Stanley mech r282 Main E M Atlanta Life Insurance Co C S Rogers mgr 556 New Atlantic Cotton Mills G W McCommon pres E B Mur- ray sec-treas 300 Oak Haven av ATLANTIC ICE & COAL CO, D I Lee Genl Mgr, Genl Office Waterville rd, Phones 8688-8636-8637, Branches 214 Walnut and Pio Nono av ATLANTIC MUTUAL FIRE INSURANCE CO, W I) Griffith Agt, 208-209 Macon Natl Bank Bldg, Phone 456 Atlantic & Pacific Tea Co The Great 207 Cotton av, 202 Forsyth, 320 Montpelier av, 505 and 940 E Napier av, 470 and 1997 2d and 575 (813) Vine-> ville av Atlantic & West Point Railroad Co F F Powers coml agt 209 Bibb bldg Attaway Cottage Mercer University 1127 College Atwater Arth lab rl20 Green Atwater Chas M (Savanah) elk h57 Marion pi H H Atwater Hilton lab rl20 Green Atwater Jas A (Ina M) bkpr Burden Smith & Co h424 Carling av Atwater Robt E formn r57 Marion pi H H Atwell Jas (Julia) driver r520 Telfair Atwell Mattie grocer 105 (99) Myrtle r do Atwell Mollie (wid Geo D) grocer 545 Telfair h do Atwell Wm elk Mrs Mollie Atwell r545 Telfair Atwood Avrill L photog E J Atwood r210% Cot- ton av Atwood Cora L maid rl32 Malloy's al Atwood E Jay (Lula M) photog 212% Cotton av h 210y2 do Atwood Gussie maid rl32 Malloy's al Atwood Lula M Mrs pleating 210% Cotton av r do FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 117 Atwood Rebecca lndrs hl32 Malloy's al Atwood Rosa lndrs rl32 Malloy's al Auborn Robt L mech rl29 Highland av Auburn Thos elk rlOl Myrtle Audley Mariah maid hl46 Middle V August Prank B (Bess) designer Idle Hour Nurseries h257 Hardeman av Aultman Jas W r322 Bond Aultman Matthew L (Eula) carp h773 Hawthorne Aultman Robt D steward Mercer University Aultman Robt E (Antoinette) elk J S Waldorf & Son h209 Clisby V Austin Clarence (Annie G) carp hl710 3d Austin Georgia cook r321 McLean al Austin Josephine lndrs r366 Flanders E M Austin J Wm (Jimmie) inspr Macon Ry & Light Co h619 Spring Austin Millie lndrs r321' McLean al Austin Odessa cook r321 McLean al p p H O w g- m z o H 52Q 4$ 3- n> >C*1 YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES . W> Austin Sylvester (Lena) rll22y2 Broadway Austin Sylvester lab r321 McLean al Autrey Wm H flagmn r201 Ridge av Avant Alma Mrs h2134 2d Avant Amanda h220 Pargason V Avant Arth driver r220 Fargason V Avant Chas A (Bernice) hostler rl24 Washington av Avant Earl (Gladys) driver r664 Elm Avant Geo (Ida) lab rl87 Gordon Avant Jesse E carp r2166 2d Avant Kate (wid Chas) h2166 2d Avant Lula h537 Cedar Avant Nola r220 Pargason V Avant Norman A (Helen C A) real est 1 Hardeman bldg h905 2d Avant Warren (Susie) ice ctr h224 Fargason V Avant Wm E (Gertrude) meat ctr r305 Jenkins Avant Wm T USN r2134 2d in r -i $ a- A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our HO aa * Free "List of Mailing Lists." r. l. POLK & CO., Detroit 210-212 MORRIS HARRIS INSURANCE SURETY BONDS Bibb Building Telephone 131 (1925) R. L. POLK & CO.'S Aven Alice tchr r461 Vineville av Aven Emrette sten Washington Dessau r461 Vineville av Aven Evelyn student r467 Spring Aven Roy E (Annie) barber R S Thorpe & Sons h467 Spring Aven Wm G (Pauline) barber R S Thorpe & Sons r 461 Vineville av Avent Albert S rl08 College pi Avent Jas E elk rl08 College pi + , Avent John T (Margt) lieut Police Dept hl08 Col- lege pi Avent Wm L film opr rl08 College pi Avera Addie slsldy J P Allen & Co r452 Spring Avera Annie T (wid Clayton J) r613 Arch o Avera Emmet C (Viola) cond h337 Hanson Avera Jas E (Bertha) agt Bankers Health & Lite in- surance Co h613 Arch Avera John lab rll4 Pierce E M Avera Leonard E flagmn r337 Hanson Avera Mattie smstrs rll4 Pierce EM Avera M Frances sten Ga-Carolina Lbr Co rll2 Lee Averett Annie h413 Lawton av Averett Chas hlpr r413 Lawton av Averett Ethel mach opr r413 Lawton av Averett Leila (wid Andrew B) hl064 Oglethorpe Averett Roberta mach opr r413 Lawton av Averett Vicie (wid Wm L) r268 Center Averhart Janie turn rms 355 Wall h do Avery Andy (Mamie) butler h218 North Avery Chas H (Ada) elk h rear 936 Columbus rd Avery Felix (Ollie) firemn hl330 3d Avery Gordon A (Avery & Patterson) rllO White- head Avery John S (Roxie) cond hl424 3d Avery Wm A (Mollie) slsmn hllO Whitehead Avery & Patterson (G A Avery, R A Patterson) auto pntrs 2310 2d Avrunin Anne student r54 Arlington pi Avrunin Hyman student r54 Arlington pi Avrunin Leah student r54 Arlington pi Avrunin Louis (Sarah) pawnbroker 560 Poplar h54 Arlington pi More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 119 Awtrey Hugh R asst tchr Mercer University r91 Coleman a v Axon Ellis lab r367 Monroe Axon Wm (Sussie) auto mech r367 Monroe Ayers Lucille asst aud Dempsey Hotel r869 Walnut Babb Chas H (Verley) carp h79 Wilder S M Babb Gladys L cashr J P Allen & Co rl32 Pied- mont av Babb Jas T (Ada) carp rll8 Crisp Babb Mary F (wid Chas H) r2454 2d Babb Mayme J elk W T Grant Go r714 Pine Babb Pearl tailoress r2454 2d Baber-Blackshear Birdie (Merrymakers Retreat) r856 Walnut Baber-Blackshear Mary (Merrymakers Retreat) r856 Walnut Bachis Jas (Ellis Cafe) r Capitol Hotel Backer Jacob (Flora) furn 460-462 Poplar h963 Cherry Backness Jas r560 Plum Backness John r560 Plum Bacon Vinyfield (Addie) car repr h Bellevue Baer Marvin R (Anna E) capt hl31 Napier av Bagey Eug lab r223 E 2d E N Baggarly Alf C (Verna) eng h5 Rose pi Baggarly Beulah opr Sou Bell Tel Co r.1'30 Williams Baggarly Ernest (Vivian) r250 Winship Baggerly Jas student rl25 Lawton av Baggerly Jas B (Mamie) formn hl25 Lawton av Baggerly Wm V (Florence) eng hl30 Williams Baggett Scholey A (Lois) pntr hl027 Clinton rd Baggett Scholey A jr student rl027 Clinton rd Bagley Dollie (wid Chas) r252 Oakland av BAGLEY, WILLET & PAINE (H C Bagley (Atlanta), H M Willet (Atlanta), G E Paine), Genl Agents Penn Mutual Life Insurance Co 1005-1006 Georgia Casualty Bldg, Plione 887 Bailey Adaline cook h320 (321) Boardman's al Bailey Albert (Sarah) lab h604 Center Bailey Anderson lab r604 Center Bailey Andrew porter College Hill Grocery r Green Bailey Ann cook h204 Douglas av Bailey A L lab rl55 Madison Bailey Bettie (wid Wm) cook h248 Morgan av W H The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually SMEPATRECMHBaEnRd by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains muck -valuable data. Ask for a copy R. IPOLK & CO., DETROIT, MICH. &C0. Polk DirectoryBldg. Detroit, Mieh. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit 120 (1925) R. L. POLK & CO.'S Bailey Beulah lndrs h539 Plant al Bailey Carrie lndrs h Barracks al "More Goods are Bought and Sold Through the Bailey Chas E (Mollie) flagmn hl31 Tenney av S M Bailey Chas E (Ladye K) trav slsmn hl50 Summit av N H Bailey Claudia M lino opr rl61 3d Bailey Clyde rl57 (163) Lynwood av Bailey Daisy lndrs h3 Plant al Bailey David O (Effie) hl327 2d Bailey Dorothy elk Coml Credit Co rl50 Summit av N H Bailey Earl (Eleanor) porter rl057 Oglethorpe Bailey Emma lndrs r312 Bright al Bailey Emma M student r210 Moughon V Bailey Ernest (Mattie) porter hl54 Lynwood av Bailey Estus lab r Henry Bailey Bailey Evelyn Mrs slsldy Union Dry Goods Co rll7 Virginia av Classified Business Lists of the Directory Bailey Fannie lndrs h429 Madison Bailey Fleming lab r208 2d Bailey Fred r659 Elm Bailey Fred (Florrie) r202 Tatnall Bailey Geo (Hattie) iiremn hl326 1st Bailey Geo jr driver rl326 1st Bailey Geo H mach r659 Elm Bailey Geo W (Callie) slsmn Bateman-Freeman Co h659 Elm Than Any Other Medium On Bailey Gussie rll3 Main Stinsonville Bailey Hattie dom hl8 Short st la E M Bailey Hazel sten Morris & Co rl02 Balkcom av Bailey Henrietta lndrs h609 Monroe Bailey Henry r Carrie Bailey Bailey Henry (Frankie) carp h Ernest Bailey Henry (Carrie) lab hl55 Madison Bailey Henry maintenancemn Rialto Theatre res R F D No 2 Earth" Bailey Henry M slsmn r J E Bailey . Bailey Henry W (Annie M) firemn hl514 3d Bailey Hilman (Lanra) lab hl40 Bay Bailey Holly (Mollie) lab hl57 (163) Lynwood av Bailey Iola r Henry Bailey Bailey Jackie R student r431 Ward V Bailey Jacob B (Suprenia) waiter h210 Moughon \ Bailey Jas T (Annie) opr r222 (6) Clinton Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4057 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 121 Bailey Janie lndrs h853 Ocmulgee Bailey Jerry (Irene) janitor h301 Gordon Bailey John E (Minnie) county tax assessor res R F D Bailey John D (Emily) sewing mach repr b.472 3d av V Bailey John I slsmn R S Thorpe & Sons r Y M C A Bailey Johnnie Mrs h462 Hazel Bailey Juanita Mrs slsldy L F M Store r209 Harde- man av Bailey Julia lndrs h437 Forest av V Bailey Julia mgr Douglass Hotel r do BAILEY JUNIUS H (Araminta; J H Bailey Coffee Co), also Postmaster, h690 Ridge av, Phone 1106 Bailey J Harris (Lillie) slsmn L L Daugherty Jr & Co h435 Winton av Bailey J H Coffee Co (J H Bailey) 503 5th Bailey Laura cook h401 Orchard av Bailey Lawrence F millwright h214 3d Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-669 THIRD ST. PHONE 4846 Bailey Leon lab r360 Hazel Bailey Lucile maid r808 Fort Hill Bailey Lucious (Bettie) lab r438 Bright al Bailey Luther A (Juanita) mech h209 Hardeman av Bailey Mabel dom r360 Hazel Bailey Marvin student rl327 2d Bailey Mary (wid Wm T) mill opr r222 (6) Clinton Bailey Mary r.101 Coleman av Bailey Mary J (wid John T) hl08 Magnolia Bailey Minnie cook r Henry Bailey Bailey Napoleon (Pearl) lab h615 Division Bailey Neal (Mary) lab h7 Parker av Bailey Reuben lab r853 Ocmulgee Bailey Robt C (Sara C) supt Pilgrim Health & Life Insurance Co h820 3d av Bailey Sami E (Carrie) pipeftr h401 Bailey av Bailey Sanford (Viola) car repr hl225 3d Bailey Sarah h356 Monroe - FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION petroit R. L. POLK & CO. Chicago You*; City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 122 (1925) R. L. POLK & CO.'iS Bailey Sarah cook h731 Campbell av Bailey Susie M lndrs r3 Plant al Bailey T Merritt fin sec rl08 Magnolia Bailey Walter E (Willamena) rl63 2d Bailey Wilber student rll62 Edgewood av Bailey Wm auto mech r209 Hardeman av Bailey Wm (Kitty) carp h431 Ward V Bailey Wm (Mary) carp h319 Coles al Bailey Wm (Sarah) driver h rear 556 Monroe Bailey Wm J (Irene) slsmn Cudahy.Packing Co r906 Napier av Bailey Wm S tchr Wesleyan College r411 Orange Baird J Elliott (Maybeth) tel opr h320 Cherry av C H Baird Lyman R (Laurie) dispr h789 Holt av Baird Robt T (Mattie) chf opr W U Tel Co h217 Vir- ginia av Baisden Emma S tchr rl024 Broad Baisden Lucious porter rl'43 1st av "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Baisden R Emory lab hl07 Crisp Baker Annie M student rl32% (132) Green Baker Arth (Annie) lab r303 Gilmer Baker Arth L (Margt) restr mgr Union News Co r Lanier Hotel Baker A Beverly reporter Maoon Telegraph r354 Spring Baker A Curtis Rev (Edna) pastor Baptist Tabernacle h4, 559 Orange Baker Collins (Mattie) lab hl69 Green Baker Dorothy student r T N Baker Baker Effie H (wid Jas L) rl56 Magnolia BAKER EMMETT H (Martha), Pres-Treas Yellow Cab Co of Macon, hll4 Lamar Baker Frank F (Ivanora) supt Pan-American Sou Petroleum Co and sec Grand Lodge of Ga F & A M hll3 Lamar Baker Geo F (Lizzie) eng h!517 Broadway R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L POLK & CO. CHICAGO Vincent 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 123 Baker Georgia r T N Baker Baker Grace M Mrs r554 Plum Baker Grover L (Belle) mldr r300 Ridge av Baker G Winter (Maynor) carp r551 Main E M Baker Isom F (Winnie) mach h338 Calhoun Baker Jas gdnr S E Patton r290 Masonic Home rd Baker Jas W (Mamie) mldr h300 Ridge av Baker Jefferson (Leola) tmstr h848 Hazel Baker John J (Eva) flagmn hlOO Kemper av Baker Leila r52 Schofield Baker Lois student r T N Baker Baker Mamie Indrs r513 Hazel Baker Margt Mrs cashr Union News Co restr r Lanier Hotel Baker Marjorie tchr r810 Napier av Baker Mary cook r71'4 Hazel Baker Mary maid r263 3d av Baker Nettie Mrs dept mgr L F M Store rl21 Academy Baker Ornell r52 Schofield Canipelli "hero-Cola MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIINSS Baker Ornex (Eddie) lab h52 Schofield Baker Pearce H student rll3 Lamar Baker Peter B (Ella) hl24 2d av V Baker Raymond (Sara) block str h 2d av Bellevue Baker Rosa h776 Nusbaum Baker Rose cook r52 Schofield Baker Sarah (wid W T) rl22 Emory av Baker Sarah Indrs r776 Nusbaum Baker Steph J Rev (Emma) pastor Second Baptist Church h810 Napier av Baker Thos hlpr Taylor Iron Works & Supply Co 1014-28 Broadway Baker Thos N (Georgia B) imbrmn h ss Forsyth rd V 1 w Belvedere dr Baker Wm shoe repr r212 Henrietta Baker Wm S (Nadine) bkpr rl34 Napier av BAKEWELL DEAN (Katherine C; Herbert Smart Clothing Co), res Rivoli, Ga Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens 00 O and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 124 (1925) R. L. POLK & CO.'S Bakewell Frank P (Melanie) dept mgr Union Dry Goods Co h804 Cherry Balcom Wm (Liza) lab hl38 (374) Neal av Baldwin Alice L elk Union Dry Goods Co r424 Cleve- land Baldwin Aline r231 Cedar S M Baldwin Andrew (Hattie) cook r204 Pear E M Baldwin Anna M (wid Benj A) h 900 Orange The most Baldwin Benj A agt Natl Life and Accident Insurance Co r900 Orange comprehen- Baldwin Cecil A collr Martin & Martin r900 Orange sive reference work on the banks of Baldwin Chas P (Evelyn) formn h239 Carling av H H Baldwin Chas W v-pres McClure Office Equipment Co r900 Orange Baldwin Corinne maid r220 Ellis av the world Baldwin Cornelia Indrs h616 Flanders E M Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Baldwin Fannie Indrs h653 Dunlap al Baldwin Fred O (Frances) auto mech r317 Ross Baldwin Henry J (Eloise) div supt C of Ga h270 Hardeman av Baldwin Henry W (Tullie) truck driver h424 Cleve- land Baldwin Heman R jr mech r806 Broad Baldwin Jas M (Ella) h3041 Houston av Baldwin John C (Hurley) woodwkr h314 Chappell Baldwin Jos blrmkr r806 Broad Baldwin Julia Indrs h647 Elm al Baldwin Kit (Roberta) rl53 (152) Lincoln av V Baldwin Lucile slsldy Union Dry Goods Co r424 Cleveland Banking Baldwin Mamie (wid Heman R) h806 Broad Baldwin Mary student r270 Hardeman av Price $20 Baldwin Minnie r296 Belmont av Published semi- annually Baldwin Nell r3041 Houston av Baldwin Powell H (Ida) carp h231 Cedar S M Baldwin Sami A (Dovie) chf inspr h766 Cherry Baldwin Sarah F r900 Orange MARCH and SEPTEMBER Baldwin Susie (wid J C) h317 Chappell Baldwin Wm carpet lyr r616 Flanders E M by Baldwin Wm L auto mech r424 Cleveland Baldwin Willie M maid r541 E 2d Balkcom seealso Baughcom R. L POLK Balkcom Amanda tchr r211 Applewood &C0. Polk Directory Bldg, r Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4x/a% on Savings MACON CITY DIRECTORY (1925) 125 Balkcom Beulah elk Kash & Karry Mkt r820 Walnut BALKCOM BRYANT J (Elizabeth), Mgr De Witt McCrary Drug Co, h450 Center, Phone 3689-W Balkcom Edw E (Acme Welding & Electric Co) r Cap- itol Hotel Balkcom Elder lab r351 (150) Hall Balkcom Eloise student r720 Broad Balkcom E E r560 Plum Balkcom Harry r820 Walnut Balkom Hayden elk Central Pharm rl22 Academy Balkcom Helen student r211 Applewod Balkcom Josephine student r450 Center Balkcom Leonard (Annie) mech rl4 Balkcom av Balkcom Marcus C slsmn T C Burke Inc res Forsyth rd Balkcom Martha student r211 Applewood Balkcom Nancy (wid Lafayette) r761 Mulberry Balkcom Nathaniel porter r351 (150) Hall Balkcom Peyton rl22 Academy CO SOUTH'S LEADING FLORISTS mFI Tl IDLE HOUR NURSERIES 3So3 Balkcom Robt P (Minnie) formn h211 Applewood Balkcm Robt P jr electn r211 Applewood Balkcom Sarah E (wid Chris C) 107 Applewood Balkcom Shepherd (Caroline) hl68 1st Balkcom Wm (Moliza) lab h325 Madison Balkcom Wm S h820 Walnut Balkcom Wm W (Lilia) blksmith h720 Broad Balkcom Wm W jr acct Coml Credit Co r720 Broad Ball Florence lndrs h.437 Gilmer Ball Hazer (Mary) lab h700 Williams Ball Josie (wid Sami) hl34 Comer ter Ball Ollie (Essie M) janitor h410 Monroe Ball Thos (Cath) lab hl07 Hazel Ballard Essie lndrs r59 Spring Ballard Eug lab r44 (45) 2d av V Ballard Felix (Sarah) lab hll2 Mosley Ballard Grady appr r820 Oak Ballard John student r519 Johnson av More goods are bought and sold through the Uassified Business Lists of the Directory than any other medium on earth. F f | $ r | B 9 TEUT" R. A. WILLIAMS, Realtor . FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 126 (1925) R. L. POLK & 'CO.'S Ballard Leroy lab r44 (45) 2dav V Ballard Minnie (wid Elijah) h820 Oak Ballard Normal School G VonTobel prin 50 Forest av V Ballard Ray tchr Wesleyan College r445 College Ballard Sadie r820 Oak Ballard Burn (Mary) street grader h.44 (45) 2d av V Ballot Lorenzo hlpr r208 Johnson av Balls Winnie mach opr r Ike Seay Balock Butler firemn r354 Pine Balser Wm T (Sarah) h252 Jeff Davis Banion Henry (Frances) scrap iron gang r534 Middle E M Banion Walter r534 Middle E M BANKERS FINANCE CORPORATION, T C Robert- son Pres, 469 2, Phone 2961 (See page 73) BANKERS HEALTH & LIFE INSURANCE CO THE, P L Hay Pres, J O Huey V-Pres, P W Jones SecTreas, N T Weaver Asst Treas, Bankers Ins Bldg 211 Cotton av, Phone 2440 Bankers Insurance Building 211 Cotton av Banks Ada prin Wheatley Sch r252 1st av V Banks Armand bursar Wesleyan College r66 Arling- ton pi Banks Arth (Hattie) hlpr h30 Woodliff Banks Bennie lab r934 (502) Columbus rd Banks Bessie tchr r701 Forsyth Banks Carrie r234 (231) Roosevelt V Banks Carrie cook r966 Ocmulgee Banks Cicero rl22 Hill Banks Emma cook r rear 430 Winship Banks Essie maid 113 Cleveland av Banks Felix clo clnr 314 Broadway r510 E Academy E M Banks Fletcher (Della) carp h330 (234) Pio Nono av Banks Frank (Leila) lab rlO Ross st pi Banks Frank lab r8 Buckner al Banks Geo (Beula) brick mason hl45 Prince Banks Geo (Lizzie) lab 301 (201) Charles S M Banks Geo lmbr jack r510 E Academy E M Banks Geo (Annie) pntr h301 Coles al Banks Geo T (Jessie) slsmn Burdin Smith & Co hl39 Highland av Banks Geo W (Aida J) carrier P O h255 1st av V 8 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 127 Banks Georgia maid hl24 Broad E M Banks Harry (Emma) brklyr h rear 430 Winship Banks Harry lab hl20 Kahn'sal Banks Henry (Myrtle) formn r629 Georgia av Banks Jerome (Sarah) truck driver h228 Plant Banks John (Ruth) mach h340 Dempseyav Banks Johnson news boy r206 Middle V Banks Jos P (Ophelia) chauf h2 Wise av Banks Jos P jr student r2 Wise av V Banks Lonnie (Leola) lab h606 Gillmer Banks Lucy Indrs r400 Rutherford av Banks Lulu maid rllO Concord Banks Lula A (wid Jas A) h701 Forsyth Banks Luther (Mildred) lab hlOO (140) Texas Banks Malinda cook h505 Monroe Banks Margt student r2 Wise av V Banks Mary Indrs h422 Elliott E M Banks Mattie L nurse r701 Forsyth Banks Milton bell boy rl330 1st MACON OPTICAL COMPANY Upticians 468 CHERRY Optometrists PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Banks Mollie Indrs r412 Peachtree Banks Nancy Indrs h219 1st av Y Banks Osborn lab r381 Melrose E M Banks Pleas (Valine) farmer h356 Patterson Banks Preston (Florine) Indrs h626 Gilmer Banks Reubin (Pearl) hlpr h28 Reid Banks Richd r701 Forsyth Banks Richd B (Obbie) wtchmkr 517 Cotton av r49 Orchard av Banks Russell (Mary) lab h503 (413) Crisp Banks Sallie M cook rl06 Rock av Banks Thelma Indrs r309 Womack Banks Virgin (Gertrude) car repr h275 3d av V Banks Walter lab r319i4 Broadway Banks Wni (Nettie) carp h200 Bell av Banks Wm (Fannie) lab r706 (442) Hall Banks Wm (Louise) mech h350 Log Cabin dr Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 (J 128 (1925) R. L. POLK & CO.'S Banks Wm (Frances) truck driver h362 (354) Spring la Banks Wm L (Leila) plstr hl31 (331) Neal av Banks Willie lndrs r319 Hazel Bankston Crecy lndrs h512 Fort Hill Bankston Curran E driver r867 2d Bankston Jas W elk C M Dumas r913 2d Bankston Kate slsldy Dannenberg Co r867 2d Bankston Lillian F tchr r505 Vineville av Bankston Mary L lndrs r512 Fort Hill Bankston Minnie (wid H A) h867 2d Bankston Robt E (Eva S) film opr Rialto Theatre h 901 Cherry Bankston Thos E (Marian) cook Union News Co hl97 Elliott E M Banner Mae M marker r319 Chappell Banton Wm A pkr r210 Moughon Barbee Chas W shoe' repr r510 Mulberry Barbee Jos carp rl98 Hightower Barbee Wm R ship elk rl98 Hightower Barber Claude W (Mary) sec-treas Florida Real Est Co hl33 Nottingham dr Barber Eliza (wid David) r4 Lake Barber Eva millwkr r29 Bellevue rd Barber John H tchr Mercer University hl63 Cherokee av Barber King (Katie) porter hl5 Magnolia la Barber Lizzie lndrs r408 E 2d Barber Lorena Mrs h Bellevue rd Barber Odessa mill wkr r29 Bellevue rd Barber Ollie mill opr rl4-16 Shell av Barber Turner W (Anna) h29 Bellevue rd Barber T F ship elk r Y M C A Barber Wm (Lizzie) lab hl26 Phillips la Barden Agnes tchr r354 College Barden Benj F (Nell C) bkpr S R Jaques & Tinsley Co h283 College Barden Michl tailor r619 2d Barden Susan r283 College Barentine Geo T (Ella) lab h234 Jackson Barentine Homer lab r234 Jackson Barentine Pearl M spinner r234 Jackson Barentine Walter W (Lila) carp h.716 Woolfolk Barfield Alf elk Ga Grocery res Lorain Ga Automobile owners are select prospects for many kinds of merchandise. Send to Headquar- U tCeartsalfoogr; aclolnktianindss omfuAchuto-vmaolubaibleleLdisattsa.. OAusrknfeowr o copy. R. I,. POI.K & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON CITY DIRECTORY (1925) 129 Barfield Andrew J elk Dannenberg Co r621 Duncan av Barfield A Clifford clkMD&SRR r567 1st Barfield Bennett W (Anna) slsmn I Kessler Commis- sion Co h654 New Barfield Bernice R driver rl27 Williams Barfield Chas elk rl6 Bellevue rd Barfield Chas W h Robt Barfield Barfield Edgar (Maud) mech hl025 Clinton rd Barfield Eli janitor r rear 856 Mulberry Barfield Eliz (wid Louis) hl017 Hazel Barfield Ena slsldy Union Dry Goods Co rl53 E Vine Barfield Ernest A (Hattie L) fndry 110 Peachtree h 220 Jones av Barfield Ernest M teller Cit & Sou Bank r Y M C A Barfield Floyd cond r2420 2d Barfield Geo R (Kate) mgr Ga Grocer No 3 res Lo- rain Ga Barfield Geo R jr slsmn Taylor Iron Wks & Supply Co rl053 Hazel Barfield H Lee (Minnie) whol gro 401 Poplar h550 College Barfield Jas student r220 Jones av Barfield Jas R elk J B Barnes rl27 Williams Barfield Lizzie (wid Wm) r Henry Moore Barfield Martha student rl025 Clinton rd Barfield Ridley student rl025 Clinton rd Barfieldj ?Suosbite B D ((Iwneidz)Assrao) 1r656B7el1lsetvue rd h do Barfield Tero (wid Jas R) hl27 Williams arThf]l2o5cT5C.OuSlvW er (Lena) dePt mgr Burden Smith & Co Barfield Toland (Louise) sten rl025 Clinton rd Barfield Walter lab rl22 Daly S M Barfield Waiter T appr Taylor Iron Wks & Supply Co rl22 Daly S M Barfield Willie Mrs smstrs rl27 Williams Barge Frank (Emma) firemn hl600 1st Barge Jas T (Louise) lab hill Crisp Barge John A (Alva) slsmn h715 Woolfolk Bargeron Wm (Mollie) elk hll9 Ells S M Bargeron W Heyward plmbr hlpr F X Daly Co rll9 Ells S M Barineaux Shelby J collr Globe Furn Co r440 Beech av . FOR lists of names -nNY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 El 130 (1925) R. L. POLK & CO.'S as a Barker Artmus (Leola) opr h230 Hydrola Barker Clifford C checker rlllO Florence S M MMLT Barker Edith nurse Macon Hosp Barker Essie cook h324 Dempsey av Barker Ethel A (wid John F) hi 45 Charles S M PLACE Barker Florrie (Lucy) sten hl809 2d Barker Geo M (Eliz) bkpr Sou Box & Basket Co hl93 THE Laurel av Barker Geo T (Ola) elk hllO Florence S M DIRECTORY Barker Henry T (Betty) car inspr hl43 Williams Barker Julius (Lois) mill hd hl9 Lake City IS THE Barker Mary E rl45 Charles Barker T F elk Am Bakeries Co r Y M C A GREATEST Barker Wm C bkpr J P Allen & Co rllO Florence av Barker's Bakery 205 Cotton av br 326 Main E M MARKET Barkhurst Carrie (wid W C) rlOl Edna pi Barkley Daisy r417 Oak PLACE Barkley Hattie (wid John) r270 Main E M Barkley Lorena Mrs h Bellevue nr C of Ga tracks IN THE Barkley Ophelia elk Central Ga Baking Co r Mrs Lorena Barkley WORLD Barkley Richd plmbr r270 Main E M Barkley Robt elk r270 Main E M Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Barksdale Byron B (Ettie) mech h467 Monroe Barksdale Edw (Hattie) lab r303 Elbert Barksdale Evelyn student r467 Monroe Barksdale Jenny cook 146 Georgia av Barksdale Julian elk Ridout Marshall Drug Co r467 Monroe Barksdale Margarette r467 Monroe Darksdale Richd (Jennie) brick str hll4 2d av V Barksdale Wm M (Gertrude) elk P O h414 Belmont av Barlow Alice mach opr rl20 Kates av E M The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Barlow Franklin F (Bessie L) keeper roundhouse h 346 Flanders EM i __ Barlow Harry E (Lois) mech Schwartz & Phaul rl20 Yates av Barlow Jacob (Naomi) mill opr hl8 Blosfield av Barlow Jas E (Minnie) carp h343 Flanders E M Barlow Lorenzo C (Mattie) carp h.109 Millingham Barlow Mattie L mach opr rl09 Willingham Barlow Morgan T (Josephine) auto mech h300 Flan- Mikifo ders EM P1MJM Barlow Tavotia mach opr r!20 Yates av E M PoIkDirecbiy] DETBOIT A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 131 Barlow Verlie elk Burden Smith & Co r343 Flanders Barlow Wm M (Annie) h351 Flanders B M Barnard Florence marker r Y M C A Barnes Abram C (Nellie D) chf elk h8, 213 Bond Barnes Albert driver Otto Isaacs Harness Co res R D Barnes Alice Mrs cashr Dempsey Hotel h3508 Hous- ton av Barnes Amanda lndrs hl436 Broadway Barnes Andrew J (Nora F) carp h236 Bacon S M Barnes Apartments 356 New Barnes Archie J elk r502 Duncan av Barnes Augustus (Helen) lab h456 Clinton Barnes Avery Mrs rooming 667 Mulberry h do Barnes A Emmett (Barnes & Barnes Inc) hll7 Bu- ford pi Barnes A Emmett jr (Sarah; Barnes & Barnes Inc) h 300 Hardeman av Barnes Bennett (Rosa) lab h498 Long Barnes Cora h93 Green Royal Corona Typewriters SC0TT-PARKERC0. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Barnes David A gro 318 Montpelier av rl05 9th av C H Barnes David A jr (Eva) elk D A Barnes hl05 9th av C H Barnes Edna maid r202 Pear E M Barnes Eliz sten O'Pry Plmbg & Htg Co r8, 213 Bond Barnes Elias L baker r609 Hawthorne Barnes Ernest V (Sophia) aud Dempsey Hotel r330 Beech av Barnes Estel lndrs r321 Hammond Barnes Ethel cook r498 Long Barnes Eva cook r726 Nesbuam T F Barnes Fannie cook hll4 Elliott E M Barnes Frank B (Ora) rd formn h873 Orange Barnes F Linton (Peggie) mgr Sands & Co 1602 Brodaway Barnes Geo r314 Forsyth Barnes Geo (Grace) lab hl008 College Barnes Geo A mach appr r236 Bacon S M DRESS IN STYLE DAYS USE YOUR CREDIT 406 THIRD ST. TEL. 3026 CD c o pS ^ OtJJdS OUJJS < d H o z H O 2* cti pI3 CL, w 140 (1925) R. L. POLK & CO/S Battle Thos (Cora L) trucker h222 Long la Battle Wm lab b227 Stewart Batton Hardy L (Bessie) mach hl37 Virginia av Batton Mary h535 Flanders E M Batton Robt F (Janie) asst eng City Water Wks h407 Forest av V Batts Henry L (Ferris) tchr Mercer University h517 (513) E Napier av H H Batts Ida A (wid Walker) r458 New Bauch Wilhelmnie bkpr C I Feb rl63 2d Baugh Mildred cashr r817 Mulberry Baugh Wm flremn r58 Spring Baughcum see also Balkcom Baughcum Charlotte cook h451 Elliott E M Baughcum Elisha J (Carolyn) jwlr Reis & Armstrong hl68 1st Baughcum John M (Thelma) pipeftr h821 Oak Baughcum Lovejoy D (Georgia; American Barber Shop) hll6 Academy Baughcum Ruth rll6 Academy Baughcum Wm L bkpr Clifford Walker rll6 Academy Baughcum Zeppa lab r220 Pear E M Bauell Hazel lab rll7 Sycamore Bauell Ida V lndrs rll7 Sycamore Bauell Jane rll7 Sycamore Baull Mary cook rll7 Sycamore' Baull Mattie rll7 Sycamore Baull Wm (Ida) car sealer hll7 Sycamore Bauman LeGree barber E E Bateman r765 Mulberry Baumgartner Alice r218 Cherokee av Baumgartner Chas F (Beulah) mech Jones Motor Co res R D 2 Baumgartner Clarence E (Isobel) lmbrmn h.218 Cherokee av Baumgartner Eug r218 Cherokee av Baumgartner Ida rC F Baumgartner Baxley John A (Pet) car repr r3024 Houston av Baxley John W bkpr r3024 Houston av Baxter John T lawyer r555 College Baxter Willie T (wid Tracy) r555 College Baynard Alice G (wid J S) rl97 Ridge av Baynard Geo A (Corrinne) slsmn Burden Smith & Co hl04 Culver Baynard Gladys student rl04 Culver More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 141 Baynard Jos F slsmn The' Texas Co rl04 Culver Baynard J Ernest tchr rl04 Culver Bayne Chas J (Mary) h6 Glynn av Bayne Dorothy student r S E Bayne Bayne Edith tchr r S E Bayne Bayne E Stuart jr elk Natl Highway Pharmacy rl701 Forsyth rd V Bayne Geo M (Katie) pharm hl26 Beech av Bayne Marmaduke G (Lessie L) clo prsr 574 Cherry h 302 Pierce av Bayne Miller G (Claire) bkpr Ellis Motor Co h207 Hines ter V Bayne Sami E (Sidney) slsmn Kenneth Odom Co h ns Lang av I Bayne Sydney R (Martha) elk Coleman-MeadowsPate Drug Co rl25 Rembert av Bayson Francis (wid Calton) hl5 Alabama Baywell Louisa rlO Tinsley la Bazemore Crowell O (Ella M) eng h869 New Bazemore Frank A (Muriel) inspr Macon Water Wks r2624 Houston av Bazemore Harold S student r855 New Bazemore Martha r2642 Houston av Bazemore Oscar C (Nettie) h2642 Houston av Bazemore Wallace L (Jessie D) phys 908-9 Ga Cas- ualty Bldg r306 Buford pi Beach Russell H (Lucy) carp hl07 Roff Home av V Beacham Wm E (Nannie) dentist h320 Coleman av Beagle Eliz r200 Elliott E M Beal Cornelius shoe repr h356 (355) Spring la Beal Remart r522 Oak Beal Thos P (Mollie) driver h522 Oak Beale J W elk r Y M C A Beale Kath hl70 College Beale Wm B (Julia) mech h508 Carling av H H Beall Addie slsldy Union Dry Gds Co r357 1st Beall Bertie mlnr r357 1st Beall Della dept mgr Dannenberg Co r357 1st Beall Henry A (Florence) driver hllS Dixie' av Beall Henry W (Lemma) cond h204 Maple Beall Holst C train dispr rl505 3d Beall Jas T elk J B Riley Drug Co r867 Mulberry Beall Katie rll6 Dixie' av FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 142 (1925) R. L. POLK & CO.'S POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. & Go. Publishers BEALL OLIN P (Annie), General Agent New England Mutual Life Insurance Co, 801-3 Ga Casualty Bldg, Phone 1950, h200 Hill Crest ay, Phone 3552-J Beall Rosa D (wid E H) h520 Edgewood av Beall Sarah slsldy Dannenberg Co r415 Forest av V Beall Trueser B (wid Sami) h357 1st Beard Core L bkpr Luther Williams Bank & Trust Co r267 Hillyer av Beard Thos firemn rl55 Broadway Bearing Supply Co Gus Wing pres 607 3d Beasley Alma Mrs h525 Jackson Beasley Bertha slsldy W T Grant Co r220 Calhoun Beasley Clifford P (Sarah) gro 670 Ash h do Beasley Emmett T (Lucile) mill hd h30 Bibb av Beasley Fannie M (wid Geo) r220 Calhoun Beasley Frances r217 Chappell Beasley Jas B r670 Ash Beasley Jas B (Clyde) gro 902 Hazel h do Beasley John Q (Mamie) h617 Plum Beasley Mariah lndrs h262 Singletons la Beasley Maude (wid Sami) winder h420 Hazel Beasley Oscar C (Lucy) slsmn Macon Coca-Cola Bot- tling Co hll32 College Beasley Oscar F (Lucile) elk h852 Ocmulgee Beaty Herchel F (Ada) cond hll6 Ponce de Leon av Becham Clarence student r O A Becham Becham Oscar A (Lula) h Forest Hill av Becham Oscar L (Dovie) auto mech r O A Becham Beck Alice millwkr r25 Blosfield av Beck Anna millwkr r503 Main E M Beck Annie opr rl05 LeeBeck Callie (wid Jas W) h404 Applewood Beck Eddie 0 (Ethel) millwkr hl79 Thomason Beck Gazelle millwkr r25 Blosfield av Beck Geo mill opr r30 (8) Bellevue rd Beck Harvey C millwkr r22 Brigham Beck John I (Reba) firemn hl67 Magnolia Beck Maggie opr 404 Applewood Beck Mary (wid Wm) h25 Blosfield av BeckL Mary L millwkr rPl0o5lkLee Beck Minnie (wid Chas) carder rl05 Lee Beck M Seaburn (Ella) h22 Brigham Beck Otis (Hattie) pntr r!05 Lee 536 S. Clark St. Chicago, 111. E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS -TRACTFOoRrSdsorvhIffoarvPietH'asOitN.aFEoFr1od5r,9d1woer JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 143 Beck Paul news dir r404 Applewood Beck Royce W r22 Brigham Beck Susie millwkr rll2 Gant Beck Willie (wid Edw) h440 Liberty Becker Fredk slsmn r907 Cherry Becker Simon L (Ida) mgr Union Furn Co hl06 Park pi Beckham Chas A (Lula) carp h317 Dannenberg av Beckham Laura rl08 Buford pi Beckham Naomi r317 Dannenberg av Beckham Susie millwkr r317 Dannenberg av Beckley Louie (wid Edgar H) r Hotel Arcadia Beckley Norman H elk r Hotel Arcadia Beckum Geo C (Ila) eng h220 Bacon Beda Etta College Minnie L Smith pres 100 Grant av V Bedding Wilson lab r414 Gilmer Beddingfield Allen (Claudia) plmbr hl67 4th av V Beddingfield Carlese- (wid Wm C) slsldy L F M Store r526 Montpelier av Beddingfield Geo (Eva C) cond h717 1st Beddingfield Josephine r3401 Houston av Beddingfield Louis farmer h3401 Houston av Beddingfield Susie (wid Wm) h3400 Houston av Beddingfield Wm A collr Luther Williams Bank & Trust Co r3401 Houston av Bedgood Cora (wid C A) rl21 Broadway Bedgood Hansell M (Hattie) eng hl05 St John Bedgood Hansel M jr hlpr Swift & Co rl05 St John Bedney Eyelsiel (Mattie) lab h811 Daisy Bedney Isaiah lab r528 Grand Chapel al Bedwell Chas M (Gertrude) pntr hl532 Broadway Beebe Gussie lndrs h211 Clark la Beeks Walter H (Raymond) sec-treas Dure & Beeks Co hll9 Oak Haven av BEELAND-CONKAD MOTOR CO, W J Beeland Pres, W P Conrad Y-Pres and Service Mgr, Ruth Beeland Sec-Treas, * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Bellevue Baptist Church (Colored) Rev L S Patterson pastor Industrial Home' rd Bellevue Drug Store (Geo C Willis prop) 399 American blvd Bellevue Public School Nora Edmondson prin American blvd Belleflower B T agt Carolina Life Ins Co h Walnut Belmont Apartments 615 Walnut Belmont Av Free Methodist Church Rev C E Withrow pastor 220 Belmont av Belmont Howard (Lucille) cook r852 Broadway Belote Jas H (Lidia) cond hl64 High Belote Jas H jr student rl64 High Belvin Jettie T agt Guaranty Life Ins Co h946 Pio Nono av Belmont Oscar B (Rosebud) slsmn Burden Smith & Co hll5 Newberg Bembig Ralph (Rosa) hlpr h308 Madison RLPolkaCo Bembri Nazread (Annie) mach hlpr h226 Orange PUBLISHERS Bend Frank (Georgia) opr h375 Davis al VolkdireclortjlM 9DETBOIT t \ -MICH- y More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656!/z CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 147 Bender Carlton C (Idella) slsmn Try Me Bottling Co h205 Simmons Benedetto Aristide A mgr Crescent Lndry Co h827 Orange Benedict Kate H (wid Sami) r221 Forsyth BENEFICIAL LOAN SOCIETY INC, C C Johnson Mgr, 103 da Casualty Bldg, Phone 356 (See page Benford Chas E (Carrie) ins agt h504 Maynard Benford Clarence porter r507 Maynard Benford Edw J Rev (Lula B) hl60 Broad E M Benford Elnora lndrs h507 Maynard Benford Eug G (Eliz) sten h701 Napier av Benford Geo W (Mattie) carp h215 Duval Benford Jas T (Mary) pntr hl21 Ritchey al Benford Oliver (Cora) lab h234 Jefferson Benford Ruby dom r234 Jefferson Benford Sami J (Pauline) slsmn Fuller Brush & Co h402 Ridge av Benford Thos L (Mary) contr h500 Maynard Benjamin Annie B barber M J Monzon r764 Broad- way Benjamin Emma lndrs h rear 3 Tracey's al Benjamin Wm formn r359 Elm Benn Mattie h460 Alabama Benn Peter (Essie) barber h.543 E 2d Benner Chas (Alice) supt Bibb bldg r do Benner G Henry r560 Plum Bennett Barney student rl29 Lawton av BENNETT CARL C (Naomi; Dixie Coal Co), hl004 Ridge av 2 w Auburn av, Ingleside, Phone 3823-W Bennett Cecil manicurist h551 Plum Bennett Eloise R (wid F S) h871 Mulberry Bennett Francis L routing aide W U Tel Co res R F D 2 Bennett Frank (Viola) truck driver hl623 Johnson's al Bennett Hazel bkpr W U Tel Co rl29 Lawton av Bennett Hyman (Rachael) gro 1540 Broadway h do Bennett H Luther (Minnie R) auto mech r534 Lin- den av Bennett Jack (Eloise) bkpr Fourth Natl Bank h5, 475 Orange Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Cists. Our new Catalog contains much valuable data. Ask for a copy K. C. POCK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 148 (1925) R. L. POLK & CO.'S POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L Polk & Co. Publishers Bennett Jas G mach Taylor Iron Wks & Supply Co res R F D 2 Bennett Jerry (Annie) swtchmn h603 Prince Bennett Julia (wid Chas H) hlOl Lamar Bennett Lee (Sue) lmbrmn h753 Ridge av Bennett Leon slsmn Fashion Shoe Store r5840 Broad- way Bennett Lloyd E (Kate) eng r869 2d Bennett Louise slsldy W T Grant Co rl29 Lawton av Bennett Mary lndrs r52 New Bennett Mary E elk r317 Reid Bennett Richmond harher 605 Linden av r412 Walnut Bennett Rosalie' M (wid Chas I) r5, 475 Orange Bennett Roy J h5, 475 Orange Bennett Ruth r753 Ridge av Bennett Thos A (Sallie) hlOO Forest av Bennett Timothy (Mattie) lab h378 Melrose Bennett Walter L elk r241 Winship Bennett Wm C (Ida) ptrnmkr hl29 Lawton av Bennett Wm C (Hanna) slsmn Macon Grocery Co r514 Oglethorpe Bennett Wm J (Eugenia) h715 Walnut Bennett Wm P (Alice C) plmbr h237 Washington av Bennett W Walter (Matilda) credit mgr Jones Motor Co h304 Hillyer av Bennor Jos blrmkr r903 Napier av Bennor Jos N mach h903 Napier av Bennor Rudolph D electn r903 Napier av Benns Chas (Mabel) shoemkr h620 4th av (V) Benson Chas (Claudia) mill opr h5 Lake City Benson Frank C (Lucy) pres F C Benson Inc r336 Napier av BENSON F C CO INC, F C Benson Pres, C M Bullard Y-Pres, Y H Roberts Sec-Treas, Clothing and Men's Furnishings 572 Cherry, Phone 4330 Benson Hugh H (Mary) lab h806 Broadway Benson P Berger (Susie) mech eng hl520 Broadway Benson Thos A (Lillie) agt Ind Life & Health Ins Co r44 Marion pi ( HH) Benson Wm (Mahalie) millhd h32 Taylor av Bentley Arley R formn Try Me Bottling Co r763 Cherry Bentley Andrew M (Mabel) eng h371 Spring Bentley Bora (Katie) hlpr h261 Gantt City rd 536 S. Clark St. Chicago, 111. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise* Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. 3L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) , 149 Bentley Charlotte maid r280 1st av (V) Bentley Cherry Indrs h407 Campbell av Bentley Earlie lab rl40 Jones Bentley Etta nurse rl40 Jones Bentley Fletcher lab rl40 Jones Bentley Herbert (Myrah) lab h625 4th av (U) Bentley Jeffery (Willie L) porter r341 3d av (V) Bentley Jesse L (Zona) weaver h38 Millrose Bentley John carp h303 Ellis av Bentley Josephine cook h330 Barfield al Bentley Josie rl22 Virginia la Bentley Louise (wid Jake) h Robinson rd nr Rock- ledge av Bentley Rebecca hl40 Jones Benton Cecil (Rosa) lab hl06 Mitchell Benton Charlotte' maid r280 1st av Benton Danl C musician r416 Ross Benton Danl M (Emma J) supt The J W Burke Co h 416 Ross YATES MOTOR GO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Benton Edw L musician r416 Ross Benton Ellen Indrs r404 Ward Benton Estelle elk N C Mut Life Ins Co r242 Middle Benton Frank E window trmr rl21 Magnolia Benton Gertrude L (wid Chas E) hl21 Magnolia Benton Henry P (Mary) eng hl09 Cabaniss av Benton Isabelle Indrs h510 E Academy (E M) Benton John C (Dollie) millwkr h80 Green (Payne Mill) Benton John S millwkr r80 Green (Payne Mill) Benton Jos M millwkr r80 Green (Payne Mill) Benton Leona tchr r242 Middle (V) Benton Lois h242 Middle (V) Benton Mary millwkr r80 Green (Payne' Mill) Benton Mattie tchr r226 (160) Green Benton Rogers lab rll42 Broadway Benton Zella prin Pleasant Hill Sch r241 Middle (V) Berckmans Mary r277 College A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 150 (1925) R. L. POLK '& CO.'iS Berckmans Robt C horticulturist h277 College Berg Chas elk The Buffeteria r449 Wall Berg Leonard (Willie L; The Buffeteria) hl27 Not- tingham dr Berg Nelson (Ida) porter r616 Fort Hill Beris Pauline nurse r757 Pine Berkner Alberta millwkr r3 Dannenberg av Berkner Eliz h3 Dannenberg av Berkner John fairmer hl75 Clinton rd Berkner Jos H (Pauline) prsmn h239 Edna pi Berkner Mary (wid John A) r Wm Berkner Berkner Wm P (Nellie) hlpr Swift & Co h Montpelier Berley Nellie L sec Mercer Univ rl301 Vineville av Berliner Emily Mrs sten Georgia Seed Store rlOl West End av Berliner Harold (Emily; Berliner Transfer Co) 101 West End av r do (HH) Bernal Vivian asst x-ray opr Middle Ga Sanatorium r307 Adams Bernd Aaron B v-pres-treas G Bernd Co r205 Clisby pi Bernd Arth P (Jessie B) sec-asst treas G Bernd Co hi49 Pierce av Bernd Ferd slsmn G Bernd Co r205 Clisby pi Bernd Florence tchr r554 Orange BERND G CO, L J Bernd Pres, A B Bernd V-Pres- Treas, Arthur Bernd Sec-Asst Treas, Leather, Shoe Findings, Shoes, Hides, Furs, Tallow and Wool Store and Office 468-470 Broadway, Phones 4226-185, Warehouse, Hide and Rendering Dept, 7th cor Ocmulgee, Phone 1624 Bernd Henrietta (wid Gustav) h205 Clisby Bernd Lawrence J (Eva) pres G Bernd Co hl07 Elizabeth pi Bernd Park Magnolia Spring and Cherry Berner Clifford (wid R L) h233 Bond Bernhardt Geo W (Mary) mach h3311 Houston av Bernice Myrah cook h541 Tinsley la Bernstein Perry interne Macon Hosp Berry Anna r3 Alabama Berry Chas B (Estell) undtkr h232 Grant av BERRY CLAIBORN B (Estella), Prop The Hubbard Undertaking Co, h232 Grant av, Phone 1495-J Berry Fannie cook h905 (911) Ocmulgee Berry Fayette r232 Grant av A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 151 Berry Henry P carp hl015 Hazel Berry Jack lab r331 Barfield al Berry Janie cook r212 Railroad av Berry J Mercer (Nettielee) hl02 Cleveland av Berry Kate' Mrs sten M D & S R R r520 Orange Berry Lillie cook r3 Alabama Berry Margt rl06 Appleton av Berry Mary C student rl06 Appleton av Berry Ola h340 Bookers al Berry Pearl (wid A B) rl06 Appleton av Berry R Russell (Kath) trmr hl02 Cleveland av Berry Sallie lndrs h219 Ellis av Berry Thos porter r296 1st av (V) Berry Wm lab h359 Bay Berryman Annie L (wid Church) r292 College Berryman Chas H asst tchr Mercer Univ Best Hazel student r268 Oakland av Best Hugh K (Mattie) blrmkr h307 American blvd Best Jas W (Jessie) pntr h268 Oakland av Best Jas W jr pntr r268 Oakland av Best Raymond C plmbr r268 Oakland av Bethea Clarence P (Fannie) garage 251 Wall h398 Belmont av Bethel C M E Church Rev W H Hall pastor 806 Pio Nono av Bethel Methodist Church Rev Jos H Mahogny pastor Industrial Home rd Bethlehem Primitive Baptist Church Valley nr Indus- trial Home rd Bethseda Baptist Church 423 Bright's al Bethume Carrie (wid Mae) weaver hl22 (l)xHolt av N H Bethume Jessie weaver rl22 (1) Holt av (NH) Bethune Benj T (Helen; Bethune & Stevens) h304 Hillcrest av Bethune Oteria asst Dr O R Thompson r313 Forsyth BETHUNE & STEVENS (Benjamin T Bethune, Wm 0 Stevens), Pure Drugs, Prescriptions Carefully Compounded, Toilet Articles, Cigars and Soda Fountain 656 Cherry cor Cotton, Phones 22002201 Betts Marion T (Blanche G) collr h240 S College Beverly Inez E pharm r520 Hawthorne Bevill Bessie supvr Middle Ga Sanatorium r do "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 152 (1925) R. L. POLK & CO.'iS Bevill Nellie nurse r907 Cherry Bewley Wm C sec-treas-mgr Peach Growers Ex- change r310 Broadway Bias Eug meat ctr rl02 Adams Bibb Bag Co (Ferdinand Block) 520 Broadway Bibb Basket Co W J Massey pres T D Massey v-pres A W Lane sec-treas Pine ne cor 10th Bibb Brick Co (Inc) W J Massee pres O J Massey v- pres-treas E S Fetner v-pres 10th cor Oak BIBB BROKERAGE CO, E M Usser'y Mgr, We Buy Salaries and Wages 562}4 Poplar, Phone 995 Bibb Building 403 Cherry BIBB COUNTY CITY COURT, R C Jordan Judge, Court House BIBB COUNTY COMMISSIONERS, W 0 Kinney, J H Heard, J T Moore, L M Happ, L A Mitchell Comrs J Ross Bowdre Clerk, Court House Bibb County Convict Camp 163 Roff Home av BIBB COUNTY COURT HOUSE, 2d nw cor Mulberry BIBB COUNTY COURT OF ORDINARY, C M Wiley Ordinary, W C Stevens Attorney and Clerk, Court House, Phone 2428 Bibb County Court Stenographer A E Barnes Court House Bibb County Engineer S R Shi 3d fl Court House BIBB COUNTY FARM BUREAU, J A Johnson Dist Agt, D Frank Bruce County Agt, 419 Broadway Bibb County Jail T J McCommon jailor 350 Mulberry BIBB COUNTY JUVENILE COURT, Bridges Smith Judge, Court House BIBB COUNTY MUNICIPAL COURT, Hon Hugh Chambers Judge, Court House Bibb County Prohibition Officer J A Davis Court House BIBB COUNTY SHERIFF, J R Hicks Jr, Court House Phone 449 BIBB COUNTY SOLICITORS, C H Garrett Solicitor General, R W Moore Solicitor, P H Lamb Asst Solicitor, Court House, Phone 390 BIBB COUNTY SUPERIOR COURT, Hons H A Mathews and M D Jones, Judges Yivian H Roberts Clerk, Court House Bibb County Surveyor Robt Hall Court House R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 15o Bibb County Tax Assessors I C Holt chairmn, W J Heard, J E Bailey BIBB COUNTY TAX COLLECTOR, U T Winslett Collr, Court House, Plione 1089 BIBB COUNTY TAX RECEIVER, D D Dunwody, Court House, Phone 1084 Bibb Grocery Co J W Daniel v-pres-genl mgr F M Daniel sec-treas 306-10 Oglethorpe Bibb Jos (Daisy) lab rl315 1st Bibb Lumber Co R H Hillman mgr 709 Ga Casualty bldg Bibb Mfg Co W D Anderson pres J H Porter v-pres A A Drake jr treas C C Hertwig asst treas Cotton mfrs 235-265 Main (E M) branches 671 Hawthorne and 688 Oglethorpe Bibb Mfg Co Auditorium 66 Clinton Bibb Mfg Co Baseball Park 1 Clinton Bibb Mfg Co Clinic No 1 210 Clinton Bibb Mfg Co Community House 226 (26) Clinton and 706 Oglethorpe Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Bibb Mfg Co Day Nursery No 2, 227 Clinton Bibb Mfg Co Gymnasium 213 Clinton BIBB NATIONAL BANK OF MACON THE, T R Turner Pres, T M Taul Cashier, L F Graddy Asst Cashier, 576 Cherry, Phones 161-162 (See right top lines) Bibb News Co Lena Moran mgr 355 5th Bibb Printing Co (H PI Myers, J W Hancock) 258-60 2d Bibb Realty Building see Bibb bldg Bible Harry B (Tennie) elk hllO Charles (SM) Bickens Wm (Mary) lab h236 (232) Lynwood av Biddy Chas P formn r307 Fairmont av Bellevue Biddy Jos L (Mary) track supvr h307 Fairmont av Bellevue Biddy Mary r307 Fairmont av Bellevue Bidez Earl F (Thelma C) div acct C of Ga h215 Clishy FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 154 (1925) R. L. POLK & CO.'S Bigalsky Anna student r220 1st Bigby Fannie (wid Wm T) h802 Mulberry Bigby Felix student r802 Mulberry Bigby Jas (Rosa) lab rlOO Smith (EM) Biggens Mimo (Fannie) lab r227 Elliot (EM) Biggerstaff Edgar C ship elk rll50 Napier av Bigerstaff Elijah L (Alice) collr Snyder Ready-to- Wear rll59 Napier av Biggs Ferris (Martha K) lab hl54 Broad (EM) Bigham Harriet E tchr rl76 College Bigham Mary cook r222 Lynwood av Bigham Robt lab r520 Northern Bigler Ernest L slsmn The J W Burke Co r618 Tel- fair Bigler Geo A (Hattie) carp h618 Telfair Bigler Pearl A tchr r618 Telfair Bigler Raymond M Rev r618 Telfair Bihas Pete Y waiter r Y M C A Bijo Bros (Isaac and Morris Bijo) gro 432 Flanders (EM) WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of A1I Kindc of Merchandise and Service Meet "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHiflreiAEmgeyAIho,LytLuoYarTpu.nHrrgdouYdFvmeoeo. nlcsraTatsiasthstiarioticelsne.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbrRhrYulyEegsOeigpdgRUiinsAnNatok'Llns-., Bijo Isaac (Bijo Bros) h428 Flanders (EM) Bijo Morris (Bijo Bros) h428 Flanders (EM) Billinger Fannie lndrs r330 Barfield al Billings Alice (wid Rylander) r303 Pio Nono av Billings Ami lab Enterprise Packing Co Billings Carrie r541 Georgia av Billings Chas (Viney) lab h444 Bright al Billings Henry W mach r306 (304) Pio Nono av Billings Jas (Lendie) firemn h5 Shoals al Billings May sten Atlantic Cotton Mills r541 Georgia av Billings Roberta maid rl51 E Academy (EM) Billings Sami (Georgia) lab h725 Daisy Billings Thos E (Lillian) printer h541 Georgia av Billings Wm H (Laura) mach h306 (304) Pio Nono av Blilingslea Abr (Ella) lab h759 Fort Hill Billingslea Alvin truck driver rl24 (112) Roosevelt R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND tJJ5 the chiropractor Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 155 Billingslea Bertha cook r215 Elliott (EM) Billingslea Ceabon B (Rosa) porter rl24 (112) Roose- velt (V) Billingslea Clifford M (Susie) slsmn Armour & Co r817 New Billingslea Fannie (wid Jos) Indrs h243 Jackson Billingslea Fred (Willie) driver h714 Daisy Billingslea Harry (Lillian) lab h222 Calhoun Billingslea Hattie hl24 (112) Roosevelt (V) Billingslea Hurdie (Carrie) lab h430 Cowan Billingslea Jacob lab r203 Coles al Billingslea Julian lab r51'2 (240) Hall Billingslea Leona M h412 Walnut Billingslea Leonard (Alice) lab h610 (136) Hall Billingslea Mamie cook h203 Coles al Billingslea Mamie Indrs h512 (240) Hall Billingslea Richd (Eva) firemn hi Tatnall la Billingslea Rose r!30 2d av iero-Cola MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIINSS Billingslea Sami F (Ethel) slsmn Ellis Motor Co h 517 Montpelier av Billingslea Sarah J Indrs rl Tatnall la Billingslea Victoria Mrs h820 New Billingslea Walter (Mazie) lab h319 Short (EM) Billingslea Wm (Mattie) carp h612 Gilmer Billingslea Wm (Rosa) frt mkr li412 E 2d (EM) Billingslea Wm (Ada) tmstr h925 (953) Hazel Billingsley Alma cook r352 Monroe Billingsley Frank porter The Hanover Shoe Billingsley Josh bellboy r352 Monroe Billingsley Laura cook r352 Monroe Billingsley Minnie cook h352 Monroe Billingsley Thos E (Ella) farmer h8 (145) White al Bills E M ship elk Dunlap Hdw Co Billuiplu Sol (Janie) firemn rll2 Collins la Billupps Wesley (Ida) lab r301 Short (EM) Biltmore Apartments 811' Poplar Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 156 (1925) R. L. POLK & CO.'S The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK Bines Henry lab r615 Hazel Binford J Brie (Myrtle) collr Reliable Outfitters h318 Johnson av (HH) Bingham Wm M soapmkr r7, 472 College Binion Annie (wid Frank) hl30 Charles (SM) Binion A Laura phone opr Union Dry Goods Co r768 Oak Binns Earl ship elk rll3 Stonewall pi (V) Binns Georgia Mrs hlpr W A & J A Spiller r375 Davis la Binns Peter (Essie B) barber h543 E 2d Binson Jack (Mary) plstr h410 E 2d Birch Celia lndrs h53 Virginia la Birch Frank N (Rosa) mech h618 (610) Montpeiler av BIRCH INSURANCE AGENCY, C M Powell Jr Pres, H L Francis Sec-Treas 557 Mulberry, Phone 150 Birch John N (Leila C; Juliette Milling Co) h235 High Birch John N jr (Ruth M) aud Juliette Milling Co h ns Albemarle pi 2 n Ridge av Birch Lois student r511 Napier av Birch Sami (Marian) mech h4 Woodliff BIRCH WM B (Ada), Genl Counsel Ga Casualty Co, h511 Napier av, Phone 2783 Birch Willie M sten Ga Casualty Co r511 Napier av Bird see also Byrd BIRD ANGUS E JR (Cora), Cashier Citizens & Southern Bank, h201 Oak Haven av, Phone 1222 Bird Wm (Ella) lab h809 Fort Hill Birdsey Angus B v-pres Birdsey Flour Mills r379 Col- lege Birdsey Flour Mills (Inc) J S Birdsey pres A B Bird- sey v-pres R T Birdsey sec-treas Poplar nr 8th Birdsey Herbert r507 (611) Vineville av Birdsey John S (Helen) pres Birdsey Flour Mills h304 Vineville av Birdsey Kitty S (wid Sami R) r341 Hardeman av Birdsey Myra H elk U S District Court r379 College Birdsey Ralph T (Emily) sec-treas Birdsey Flo'ur Mills h507 (611) Vineville av Birdsey Sami R slsmn Birdsey Flour Mills h643 For- syth Birdsong B Emory appr rll8 Emory &C0. Polk Directory Bldg, r Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 157 Birdsong Carrie student r503 Campbell av Birdsong E Milton blrmkr hlpr rll8 Emory Birdsong Lafford B (Beula) agt Am Natl Ins Co h707 Broad. Birdsong Malinda h503 Campbell av Birdsong Richd E (Nannaline) drftsmn h640 Ridge av Birdsong Willis pdlr h4 Church al Birrick Ellis J (Fannie) gro 203 5th h203y2 do Birrick Jos elk E J Birrick r203y2 5th Bishop Alice (wid Wyley) rl240 College Bishop Cary W meat ctr r253 Broadway Bishop Dreyfus dist mgr Macon News r616 Johnson av Bishop F Jos (Mary E) contr 501 Grand bldg h311 Napier av Bishop Henry C (Virginia R) typewriters 501 Grand bldg r322 Linden av Bishop Jas P contr 616 Johnson av h do CO SOUTH'S LEADING FLORISTS F3 CH IDLE HOUR NURSERIES So Bishop Jas T r311 Napier av Bishop Jas T jr student r311 Napier av Bishop John H (Clara) chauf h602 Main Bishop John T (Hassie G; Liberty Pressing Club) h 870 1st Bishop J B (Willie M) lab hl220 3d Bishop Robt E (Mildred) carp r311 Napier av Bishop Shirley student r220 1st Bishop Walter barbecuer r253 Broadway Bishop Wyley D (Blanche) prsmn Lyon Harris & Brooks hl240 College Bithwood Edw cook hl8 Cheatham al Bittick W Rollie (A Estelle) eng h420 Jackson Bivens Emmett Rev (Roxie) pastor Missionary Baptist Church h795 Cedar Bivins Arth (Maggie) lab r215 Jefferson Bivins Bessie r608 Montpelier av pa 5 fu- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. ll v o" 3. / FIRE INSURANCE INVESTMENTS rr* R. A. WILLIAMS, Realtor SH . FOR LISTS OF NAMES ANY TRADE ^-- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO 158 (1925) R. L. POLK & CO.'S Bivins Emanuel (Mary) lab h8y2 Short (EM) Bivins Emma cook r Shamrock Bivins Henry C (Carrie) firemn h420 Hall Bivins Henry C jr lab r420 Hall Bivins Ida cook rl23 Ash Bivins Jas lab rl36 Bay Bivins Jas (Inell) plstr h301 Ward Bivins Jesse (Della) lab h8 Spring Bivins John J (Ollie) rug clnr h851 Elm Bivins Lillie janitress r Annie Boden Bivins Minnie (wid Steven F) r502 Duncan Bivins Nettie lndrs hl23 Ash Bivins Perry porter r728 Nussbaum ' Bivins Thos barber r452 New Bivins Thos V (Mamie) firemn h200 (100) Charles (SM) Bivins Walter (Julia) lab h5 Middle (EM) Bivins Wm (Sallie) h708 Campbell av Bivins Wm (Archie Lee) lab r217 Jefferson Bivins Wm (Emma) lab hl25 Shamrock Bivins Wm porter rS Short Bizzell Henry D (Christina) mech r619 Oglethorpe Bizzell Mary r401 Hillyer av B'Jork Carl G (Frances) air brake inspr rl31 High B'Jork Frances Mrs supvr Sou Bell Tel Co rl31 High Black Benj B (Sarah E) agt Carolina Life Ins Co h Forest Hill av Black Ernest D (Harriet B) v-pres and treas Central Cotton Oil Co and v-pres Macon Fertilizer Co h 121 Buford pi Black Eva tchr r20 Spring Black Julia R (wid Alex) hl29 Appleton av Black Lonnie lab rl05 Bay Black Mary E rl064 Elm Black Nancy lndrs hl59 Grant av Black Raburn r763 Poplar Black Sami (Sarah) grave digger h403 Monroe Black Sami M (Ruth) r2.18 Chestnut Black Virginia nurse City Health Dept rl59 Grant a1 Black Virginia student r745 Ridge av Black Wm F (Jessie M) eng h745 Ridge av Blackledge Katie nurse Macon Hosp Blackman Dorothy student r400 Forsyth FARMS HOMES 0 Di JAM ES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 159 Blackman Emma M (wid John P) sec Boy Scouts of America r400 Forsyth Blackman Hattie lndrs h432 Coles al Blackshear Albert opr h218 Hydrola Blackshear Eleanor (wid Wm I) h460 New Blackshear Geo mill wkr Dixie Roll & Cot Co Blackshear Jas R opr r327 Clinton Blackshear Julia maid rlOl Cedar Blackshear Loranza (Mattie) farmer h998 Cowan Blackshear Lula M cook 719 Pear (EM) Blackshear Thos E (Hattie) phys 811 Ga Casualty bldg h210 Cherokee av Blackshear Janet r210 Cherokee Blackshear Wm lab r998 Cowan Blackstone Frank (Mildred) slsmn Wilson & Co h473 Orange MACON OPTICAL COMPANY Upticians 468 CHERRY Optometrists PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA Blackstone Maggie rl531 1st Blackstone Wm (Roberta) hrklyr r444 Ballard Blackwelder Raleigh (Eliza) local agt Otis Elevator Co hll6 Magnolia Blackwell Alma student rl7 Hill Park av Blackwell Chas lab h213 Elliott (EM) Blackwell Emil H mech rl7 Hill Park av Blackwell Geo A (Marion) slsmn h2, 559 Orange Blackwell John P (Leila) slsmn hl7 Hill Park av BLAIR ALEXANDER (Madge R), Architect 401 Ga Casualty Bldg, Phone 71, li516 Napier av, Phone 1479 Blair Anna (wid R Frank) rl237 2d Blair Benj F (Ada) millwkr hl3 Dannenberg av Blair Florence tchr r516 Napier av Blair Georgia h2026 Broadway Blair John D (Lucile) instr h207 Boulevard (NH) Blair Lester L millwkr rl3 Dannenberg av Blair Margt tchr r516 Napier av 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk &Co. Publishers 536 S. Clark St. Drink in Bottles TELEPHONE 287 Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. TeL 2813 160 11925) R. L. POLK & CO.'S Blalock Floyd E (Nellie) h476 Ash Blanchard Hardin M (Cora) mach hl09 Richmond Blanchett Pennie Mrs h303 Flanders (EM) Bland Cleveland (Fannie) lab h402 Applewood Bland David (Claudie) lab h2 Mitchell la Bland John C (Fannie) dist pass agt Sou Ry r304 Hillyer av Bland Julian T (Juanita) br mgr A & P Tea Co h459 Carling av Bland Langston (Emma) carp h856 Broad Bland Mary dom h545 Mitchell Bland Mary lndrs r409 Applewood Bland Robt rll2 Spring Bland Thos (Mary) lab hl74 W Boundary Blanford Jesse (Bennie) lab h317 Ash Blanks Edith sten Methodist Orphans Home r do Blanks Otis L (Norine) elk h206 Ridge av Blanton Chas E (Frances) linemn r817 New Blanton Nellie (wid W H) rl'18 Forsyth Blash Courtney (Ella) lab h.334 Madison Blasingame Dosia (wid Lloyd) h Industrial Home rd Blasingame G W elk r517 Georgia av Blasingame John lab Ideal Creamery r Bloomsfield Bleakley Marion E (Neal) special agt h3, 305 Col- lege Bliss Dwight L (Hallie M) cond h ss Log Cabin dr 1 w Habersham av Bliss Dwight L elk r250 Winship Bliss Eliz E r250 Winship Bliss Lucile sten r D L Bliss Bliss Oliver R (Birdie) cond h250 Winship BLOCH CARL, Real Estate, Insurance, Rentals and Loans 310-311 Citizens & Southern Bank Bldg, Phone 1267, hl305 Yineville av, Phone 490 (See page 80) Bloch Chas J (Marie; Hall, Grice & Bloch) h303 Hill Crest av Bloch Hide Co (Michl Bloch) 610-12 Broadway Bloch Michl (Lena; Bloch Hide Co) hl40 Appleton av Block Alec (Nonie) pres Empire Candy Co and Natl Milling Co h810 Mulberry Block Chester B (Pearl) mach h9 Holt av (NH) Block Earl H slsmgr Massee-Felton Lbr Co r Hotel Dempsey Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeoHwr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON CITY DIRECTORY (1925) 161 Block Ferdinand (Bibb Bag Co) rl305 Vineville~av (V) Block Flora (wid Jos) hl305 Vineville av (V) Block Frank E Co H D Parks mgr whol confrs 253- 55 5th BLOCK HERBERT M, Mgr Hotel Dempsey, r do Block Jas porter r861 Ocmulgee Block Mary maid r861 Ocmulgee Block Mattie cook r403 Monroe Block Nicholas M (Hattie) pres Massee-Felton Lmbr Co r Hotel Dempsey Bloodworth Augustus E h254 School Bloodworth Chas P (Eliz) cond h261 Orange Bloodworth Curtis baker r42 Holt av (NH) Bloodworth Geo T elk P O r221 Jones av Bloodworth G Albert bkpr Happ Bros Co r724 Ander- son Bloodworth Harvey B mgr Palm Purchasing Co r 123% Cotton av Bloodworth John M (Sallie) elk h2162 2d Bloodworth Julius L student r724 Anderson Bloodworth Leona r254 School Bloodworth Lillian tchr r718 Anderson Bloodworth Lillie (wid Geo Ei) h724 Anderson Bloodworth Lizzie Mrs winder r411 Jackson Bloodworth Lonie student r718 Anderson BLOODWORTH LUTHER U (Rachel A), Attorneyat-Law 3-4 Hardeman Bldg, Phone 5, h281 Hillyer av, Phone 4410-W Bloodworth Mamie (wid Archie) rll8 Tenny Bloodworth Martha E (wid Augustus R) r424 Cal- houn Bloodworth Mary (wid Henry W) h221 Jones av Bloodworth Minnie millwkr r225 Knott Bloodworth Prentice E student r2162 2d Bloodworth Robt D student r254 School Bloodworth Robt H (Sarah) carp h718 Anderson Bloodworth Wm mech r319 Chappell Bloodworth Wm D (Eliz) firemn rl061 Ash Bloodworth Wm G (Marie' G) elk Dunlap Hdw Co h Columbus rd Bloodworth Willis H (Blanche) carp h216 Shamrock Bloodworth Winton E elk r718 Anderson for lists of names any TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CQ. CHICAGO Durilap-Hiickabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 bmig 162 (1925) R. L. POLK & CO.'S as a Blosfeld Wm M (Mattie) acct h5 Fredonia apts Blossom Geo L (Helen) acct h5 1 redonia apts MMEI Blount Annie K lndrs h637 Fort Hill , Blount Clara Mrs slsldy Leis Dept Store h210 Ruther- PUCE THE DIRECTORY IS THE GREATEST MARKET PLACE Blount Clarence (Ida B) butler r224 Georgia av Blount Emily lndrs hl46 New St la Blount Eugenia W (wid Jas H) h364 Orange Blount Eunice (wid John E) bkpr Snyder Ready-to- Wear rl20 Knott Blount Frances r364 Orange Blount Geo (Mary) lab h611 Shoals al (E M) Blount Geo W elk Rogers Gro h812 Main Blount Grover C mech r412 Walnut . Blount Irene slswmn Barker Bakery r360 Fairview Blount Jane (wid Morris) h.282 Amos Blount Julia (wid John M) hl20 Knott Blount Markie dom h248 5th Blount Margie dom h248 5th IN THE WORLD Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job'' 365 Days Every Year Blount Mattie (wid Griffin B) h360 Fairview Blount Mattie P see r608 1st Blount Roger D (Annie M) news agt rl68 Spring Blount Sarah lndrs r282 Amos Blount Wm C (Bula D slsmn hl303 Vineville av Blount Wm H (Frances) reprmn Scott-Parker Co r 3805 Houston av BLOWERS ALBERT C, V-Pres Marion County Chamber of Commerce, res 2 miles n of Ocala Blue Edw (Hattie) shoe shop 822 Columbus rd hl54 Cedar Unionville Blue Front Lunch Room (Jas Cassidy) 416 Mulberry Blum Arie I (Madeline) pres Central Bedding Co h 810 Spring Blum Clarence S (Royal Shoe Store) rll8 (198) Buckingham pi Blum Leo J (Freda; Royal Shoe Store) hll8 (198) Buckingham pi Blum Marks Y (Claudia) billiards h869 Cherry Blum Moies A (Stella) billiards 551 Cherry h808 do Blum Sol T appr r869 Cherry PUBLISHERS Blunt Belcha (Ruth) lab r rear 356 Spring la Blunt Clara elk r210 Rutherford av Blunt Emily hl46 New St la Board of Health Dr C L Ridley health officer City Hall PotkDuscbm] DETROIT MICH A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 163 BOARD OF PUBLIC EDUCATION, C H Bruce Supt, Court House, Plione 247 BOARD OF WATER COMMISSIONERS, City Hall, Phone 1880 Boatman Wm (Sallie) teleg opr rll2 Stonewall pi (V) Boatright Gordon M (Edna B) brkmn h2224 2d Boatright Homer elk Dinty Moore's r2224 2d Boatright Inez r2224 2d Boatwright Albert flagmn r204 College pi Boatwright Bennie truck driver r520 E 2d (E M) Boatwright Essie Indrs h519 Maynard Boatwright F G U S Dist Atty res Cordele Ga Boatwright Jefferson D gro 328 Dannenberg av h do Boatwright Jennie smstrs hl02 Yates av (E M) Boatwright Mollie rl02 Yates av (EM) Boatwright Robt lab r438 Bright al Bobbitt Wm C (Emma) carp h321 Shamrock Bobo Davis gro 301 Turpin r do Boden Annie (wid John) h Forest av (Bellevue) Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Boedecker Hilmer P (Ruby) formn h247 Boulevard (NH) Boggs Lucy M opr Sou Bell Tel Co r756 Spring Boggs Wm A (Eliz) solr Macon News h756 Spring Boland Andrew D r211 Mikado av Boland Florence r211 Mikado av Boland J Lee auto mech r211 Mikado av Boland J Walter (Minnie) formn Taylor Iron Works & Supply Co h211 Mikado av Boland Louise r211 Mikado av Boland Mary r211 Mikado av Boland Walter (Fannie) boilermkr Taylor Works & Supply Co h521 Elm Bolden Chas (Annie B) miner rl206 Broadway Bolden David (Ida) lab h802 Hazel Bolden Lawson lab r83 Bay Bolden Mack (Marie) lab r315 Division DRESS IN STYLE DAY JL S b*J II CYROEUD*IR1 406 THIRD ST. TEL. 3026 o fi o 0IJdJ2 0IJJd2 cu= < O 1) H efcsl 8 (A o z a H < Kd eLaJ OeZrj X Q |< Z |z < 2 o z IS 3 8 3 u Sa JihZ 3 Ou Acs TS O o z H o z H 2Id 5 = a*^ soWHoS*c>o scHido E" --i o cT TERMINAL TRANSFER COMPANY TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 180 (1925) R. L. POLK & CO.'S Broach Altoff C (Biddie) blksmith hll6 Garden Broach Edna cashr Union Dry Goods Co rll6 Garden Broach Hilda opr rll6 Garden Broadnax Manda (Corinne) brkmn h350 Hawthorne Broadus Leonard lab r519 Maynard Broad'us Willie F lndrs r519 Maynard Broadway Garage W W Brown mgr 506 Broadway Broadway Ohie G opr The Wm Carter Co rl61 Cotton Broadway Trading Co (0 C Henden) salaries bought 4 Jacques bldg Broady Arth (Fannie) bill poster h4 Wise av (V) Brock Alton G mach hd rl812 3d Brock Chas Z (Amanda) hl812 3d Brock Elgie J rl812 3d Brock Emory W (Gladys) swtchmn rl!3 Crisp Brock Howard W sawfiler rl812 3d Brock Leila r Sara Latham Brock Leon C (Dora) stocks and bonds 202-3 Bibb bldg r313 Orange Brock Pope F (Alice; Brock Sparks & Russell) h Sun- set dr 5 e Nottingham dr Brock Richd eng r211 Broadway Brock Robt J lab rl812 3d BROCK, SPARKS & RUSSELL (P F Brock, A 0 B Sparks, H D Russell, Edward Miraglia), Attorneys-at-law 214-218 Ga Cacualty Bldg, Phones 4806-4807 Brockman Fredk (Cinthie) farmer r201 St John Brockman John D (Smithie) barber S O Brockman r404 Fort Hill Brockman Katie mach opr r201 St John Brockman Mattie student r404 Fort Hill Brockman Susie M student r404 Fort Hill Brockman Swep O (Mattie) barber 400 2d h404 Fort Hill Brockman Willie (wid Fredk) h201 St John Brogsdale Chas (Julia) cook h3 Ross St pi Brogsdale Nellie cook rl430 Broadway Bronson Cath tchr rl38 Rembert av Bronson Henry lab r414 (314) Womack Bronson Horace W (Mary C) slsmn Jas N Neil Co r 400 Forest av Bronson Sidney C (Dellie) elk C of Ga R R Co hl38 Rembert av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 181 Bronson Pauline tchr rl38 Rembert av Bronson Wm (Leila) carp h305 Cowan Bronson Wm (Annie) lab hl88 Tindall av Bronson Wm M (Elsie) lab h414 (314) Womack Brookins Corrine nurse h rear 607 4th av (U) Brookins David lab r454 Pine Brookins Fred lab r443 Alabama Brookins Ruby r207 Holt av (NH) Brookins Terry (Alice) lab hl42 (112) 1st av (V) Brooks Adam porter r341 4th av (V) Brooks Addie (wid B R) rl35 Academy Brooks Annie B nurse r341 4th av (V) Brooks Camilla cook hl29 Jones Brooks Candler A (Cornelia) mgr Credit Dept Fourth National Bank h Ingleside av (I) Brooks Cecil slslmn rl47 Charles (SM) Brooks Chas r630 (930) Vineville av Brooks Chas (Mattiejjab h533 Coleman al YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Brooks Chas H (Ruby; Dixie Dental Laboratory) h Log Cabin dr Brooks Chas W (Viola) wtchmn h970 Hazel Brooks Claude (Daisy) firemn h854 Ash Brooks Cora hlOl Green Brooks Eliz Mrs bkpr Dannenberg Co r2, 853 Cherry Brooks Eliz rl22 Lamar Brooks Emmett M rl05 Main (Stinsonville) Brooks Emmie Mrs r863 2d Brooks Essie M cook rl29 Jones Brooks Estella dom r2 Turpin Brooks Fannie Indrs hl06 Ruby Brooks Floyd (Lyndie) soft drinks h209 Elliott (EM) Brooks Frank elk G R Kinney Co Inc r81 iy2 2d Brooks Frank G asst stereotyper Macon Telegraph r 269 Maple Brooks Fred (Ida) janitor h379 Monroe Brooks Geneva r341 4th av (V) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 182 (1925) R. L. POLK & CO.'S Brooks Geo (Mary) lab hll9 Edgewood av Brooks Geo lab h rear 23 White Brooks Geo E pntr r203 Fairview Brooks Harold lab r708 Crisp Brooks Harvey mill hd r242 Roff Home rd Brooks Hattie Indrs r714 Hawthorne Brooks Hattie maid r708 Crisp Brooks Irene Indrs r49 White Brooks Jas lab r341 4th av (V) Brooks Jas D (Beulah) collr Coml Loan & Inv Co r 424 Johnson av Brooks Jas E Rev r310 Middle Brooks Jas H (Bessie) mill opr hlO Shell av Brooks Jas L (Mary C) chf elk hl29 Magnolia Brooks Jerry C (Chanie) lab rl012 Main Brooks Jesse B wtchmn Macon Milling Co Brooks Jesse C (Alpine) asst stero Macon Telegraph r269 Maple Brooks John (Mary) lab h411 Hall Brooks John B (Princie) solr Barnes & Barnes Inc hl22 Lamar Brooks Jos A prin Stinsonville Sch h!05 Main (S) Brooks Jos D rl05 Main (Stinsonville) Brooks Lewis B (Hattie B) mgr Cudahy Packing Co h 108 Magnolia Brooks Lillie P Indrs r515 Johnson's al Brooks Lorena cake baker r401 Virginia av Brooks Louise mill wkr r437 Alabama Brooks Lucy (wid Nelson) Indry wkr h224 Green Brooks Mary C (wid Marvin K) h427 Forsyth Brooks Mary C bkpr United Credit Co r427 Forsyth Brooks M Lula (wid Beverly) h269 Maple Brooks 0 Linwood (Laura B) cond h822 1st Brooks Paul W (Alma) and Massee-Felton Lmbr Co rl25 Oakland av Brooks Rena rl2 Balkcom av BROOKS ROBERT P (Undine), V-Pres and Genl Mgr Ellis Motor Co, li301 Carling av, Phone 5353 Brooks Ruby slsldy Burtons Inc r203 Fairview Brooks R Frank (Mamie; Lyon, Harris & Brooks) h 863 2d Brooks Sami (Rebecca) porter h341 4th av (V) Brooks Sarah matron Macon Hospital A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 183 Brooks Thos J lab rll9 Edgewood av Brooks Tillman (Rody) barber h317 Norris Brooks Wm (Luejean) baker h203 Fairview Brooks Wm B (Alice L) garage 215-219 3d h 16i Mag- nolia Brooks Wm B (Jessie L) slsmn Dunlap Huckabee Auto Co rl61 Magnolia Broome Christine tchr Wesleyan College hl06 Holt av Broome Christopher C (Willie) slsmn hl06 Holt av Broome Dallas elk r Y M C A Broome J M (Allene) flagmn r452 Edgewood av Broome Rufus P (Lillian) flagmn r301 Mikado av Broomfield Geo elev opr r408 Monroe Broomfield Julia lndrs h205 Woodliff Broughton Alberta maid rl53 Park Hotel al Broughton Amelia maid rl53 Park Hotel al Broughton Chas wtchmn Sou Ry Co Brougfhton Lula lndrs hlo3 Park Hotel al Broughton Viola maid rl53 Park Hotel al Browder Timothy slsmn rl31 Clisby BROWDER T J, Asst Traffic Manager Chamber of Commerce, rl25 Clisby Brower Willie opr (wid Wm M) h228 Hydrola Brown Aaron (Mercedes) lab hl4 Harris al Brown Abr bellmn r809 Edgewood av Brown Abram (Lessie) lab hll8 Rock Hill la Brown Ada lndrs rl05 Gustin av (V) Brown Addie M Cook rl60 Academy (E) Brown Adelle maid Frank Lane Brown Agnes maid r918 Atlantic av (SM) Brown Albert (Susie) firemn r300 (104) Colquett Brown Alex (Mary) cemetery kpr hll5 Enterprise Brown Alex prsr hll7 Williams la Brown Alford L (Lilia) mach hl03 Capital av Brown Alger J (Clifford) lab h232 Powell (EM) Brown Alice student r C T Brown Brown Alice M r690 College Brown Anderson (Mary) lab h809 Elbert Brown Andrew W (Annie) barber 319 Broadway h504 Broad Brown Annabelle H (wid Reeves) h314 College Brown Annie cook h578 Monroe Brown Annie lndrs hl23 Virginia la Brown Annie L lndrs r202 Edgewood av "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R* L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 184 (1925) R. L. POLK & CO.'S Brown Annie M lndrs rl23 Ash Brown Arline rl713 2d Brown Arth (Malissa) carp hl40 (375) Neal av Brown Arth F bkpr Steven M Solomon jr r604 1st Brown A Sidney archt 361% Cotton av r711 Forsyth Brown Benj chauf r379 Middle Brown Benj O (Bessie) farmer hl028 Clinton rd. Brown Bernard H (Nellie) ship elk rl32 Ellis (SM) Brown Berry (Ella) lab hl36 Cowan Brown Berry jr janitor rl36 Cowan Brown Bertha h607 Ernest Brown Bertha cook hll Cheatham al Brown Bessie cook hl4 Magnolia la Brown Bessie dom r365 Hawthorne Brown Buster lab r811 Elbert Brown Carl H (Gwendolin) dentist 601 Bibb bldg rl< Arlington pi Brown Carlton (Mary) elk Crumps Pk P O r525 Georgia av Brown Carrie h222 Madison Brown Carrie cook h264 Singleton la Brown Carrie L tchr r822 Orange Brown Carribell r238 Roye Brown Cath Mrs bkpr A G Rhodes & Son rl06 Rogers av Brown Catholine cook rl44 Sycamore Brown Chas (Mary) driver h205 Wood al Brown Chas lab rll29 Broad Brown Chas (Celia) lab r314 Edgewood av Brown Chas (Annie) lab h3 Wutenville rd Brown Chas mach r526 Edgewood av Brown Chas porter rl67 Aster Brown Chas jr waiter r859 Cherry Brown Chas D (Mattie) wtchmn h612 Main (EM) Brown Chas F (Supsie) formn h ws Parkwood av 3 s Forsyth rd Brown Chas N elk r612 Main (EM) Brown Chas M (Juanita) elk h5 Dessau pi Brown Chas T (Carrie) jwlr h Log Cabin blvd Brown Charlton draymn h9 Bright al Brown Clarence (Josephine) lab h240 Gilmer Brown Clarence B (Sarah) pntr hl04 Cedar (SM) Brown Claud (Sally) firemn h979 Short (EM) Brown Claud (Mary) janitor h276 4th av R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 185 Brown Claude J repr rl73 Virginia av Brown Cleveland (Pauline) truck driver h811 Elbert Brown Cora smstrs r421 Oak Brown C M slsmn Peeler Hardware Co r5 Dessau pi Brown C P carp r603 Plum Brown Daisy dom hlOl Division St la Brown Dalton T (Diamond Market Co) r235 Washington Brown David mill hd r27 Bibb av Brown Delores rl811 Broadway Brown Dock (Rilla) lab h201 (114) Toombs (SM) Brown Doris dom rl028 Clinton rd Brown Dorothy smstrs r612 Main Brown Douglas elk rl028 Clinton rd Brown Drewry (Lenora) mill hd r20 Bibb av Brown Duncan (Ruby) lab h905 Fort Hill Brown Edgar (Pearl) truck driver h203 Bartlett Brown Edgar G elk r51 Arlington pi Brown Edna elk McLellan Stores Co r310 Giles Trucks and Auto Repairing Authorized for White Motor Trucks N. L PACE 657-659 THIRD ST. PHONE 4846 Brown Edna lndrs r88 Bay Brown Edw (Lillie) lab hl26 Waterville rd Brown Edw pntr r421 Oak Brown Edw porter r566 Poplar Brown Edw C (Estelle) mtrmn h911 Elm Brown Edw D barber r504 Broad Brown Eliz Mrs hl531 2d Brown Eliz rl37 2d av Brown Eliz sten rl028 Clinton rd Brown Ella maid hll63 Oglethorpe Brown Ellen (wid Henry) hllO College pi Brown Elmer (Rosa) lab h312 Burnett (EM) Brown Elmore (Beatrice) mach h605 1st Brown Emma lndrs r220 Dempsey Brown Emma J (wid Seymor M) h822 Orange Brown Ernest pntr rll6 Enterprise Brown Essie P lndrs r274 Davis al Brown Ethel mach opr r601 Main (EM) , . FOR LISTS OF NAMES ANY TRADE ANY BUSINESS-- ANY PROFESSION IjDBTRoyr R. I- POLK & CO. Chicago City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 3 86 (1925) R. L. POLK & CO.'S Brown Ethel lndrs hl9 Kahn's al Brown Eug C cigars 422 2d r431 Carling av (HH) Brown Eug D (Cora) cond h208 Ridge av Brown Eugenia lndrs h25 Wall st la Brown Evelyn lndrs r650 (1280) Elbert Brown Evelyn sten rl028 Clinton rd Brown Fannie (wid Emory) r.149 Williams Brown Fannie rl531 2d Brown Fannie lndrs hl67 Astor Brown Felix gro 313 Curd (SM) h do Brown Fleetwood M r822 Orange Brown Frances r5-6 Payne av Brown Frances r208 Ridge av Brown Frances lndrs r48 Schofield Brown Frank bell boy rl60 E Academy (EM) Brown Frank (Easter) lab h933 (904) Fort Hill Brown Frank lab r48 Schofield Brown Frank lab h367 Virginia la Brown Frank msngr rl02 Cedar (SM) "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuYoarTpu.nHrrgdouYdFvmeooe. nlcrsaTtasisathstiaritoiclesne.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbrRrhYulyEegsOeigpgdRUiinsnANatok'Llns-., Brown Frank C lab h4 Spring Brown Fred r208 Ridge av Brown Garfield (Leila) lab hl05 Gustin av (V) Brown Geo lab r935 Broad Brown Geo lab rl50 Roye Brown Geo (Mollie) lab h494 Virgin Brown Geo pntr rl713 2d Brown Geo T elk Fourth Natl Bank rll9 Lamar Brown Geo T (Jannie) flagmn hll'9 Daly Brown Geo T (Valentine) mach r412 Walnut Brown Georgia (wid Edw) rll8 Tenny Brown Georgia h375 Plummer's al Brown Georgia cook r614 Ross Brown Georgia lndrs h435 North Brown Gertrude spinner r28 Bibb av Brown Glynn sten The Letter Shop r763 2d Brown Grocery L D Brown prop ne cor Forsyth rd and McGhee R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR BLDG. PHONE Will Remove the CAUSE of Your Disease 4557 MACON CITY DIRECTORY (1925) 187 Brown Gussie lndrs r935 Broad Brown Hager L r379 Middle (V) Brown Hal lab r494 Virgin Brown Hardy K (Laura B) elk Georgia Grocery Co No 9 h320 Spring Brown Harry B (Pay; Brown Sign Co) h700 Spring Brown Harry E (Della) formn h5 Bellevue rd Brown Harry G (Della) millwright h5-6 Payne av Brown Hartridge B (Katie) carp h224 Log Cabin dr Brown Hattie lndrs hl3 Prank's al Brown Hattie lndrs hl73 (152) 1st av Brown Hattie nurse Macon Hosp Brown Hazel cashr r224 Log Cabin dr Brown Henry (Bertha) lab h313 Madison Brown Henry (Mamie) lab h406 (238) Roye Brown Henry (Susie) lab rll4 Garden Brown Henry L (Clara) electn hl03 Balkcom av Brown Herbert R (Emma C) r310 Washington av Brown Homer P elk rll'9 Lamar MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Brown Homer L (Florence) mtrmn hl021 3d Brown Hoyt slsmn J W Burke Co rl78 Magnolia Brown Ida M prin Cressville School rl49 2d av (V) Brown Ina student r315 Bond Brown Irene Mrs slsldy Danenberg Co r307 Forsyth Brown Isabelle r212 Elliott (EM) Brown Ivory dom r25 Wall st la Brown Jack T trav slsmn r320 College Brown Jas (Ella) lab h621 Peeble Brown Jas (Eliza) lab hl41 Sycamore Brown Jas (Ada) lab h237 Wing's Hill Brown Jas lab r611-15 2d Brown Jas (Sarah) porter r209 Ocmulgee Brown Jas (Gertrude) truck driver h464 E 2d (EM) Brown Jas B mach r241 Jeff Davis Brown Jas F (Mary W) hlpr h!19 Middle (V) BROWN JAMES F JR (Emily), Asst to Y-Pres Citi- zens & Southern Bank, h563 College Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1S8 (1925) R. L. POLK & CO.'S The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK Brown Jas K (Pell; Diamond Market Co) h235 Washington av Brown Jas L (Mabel) slsmn r321 1st Brown Jas 0 farmer rl028 Clinton rd Brown Jennie h718 3d Brown Jesse (Katie) lab hl40 Division Brown Jesse (Irene) slsmn hl04 Emerald (EM) Brown Joel A slsmn McCommon Bros r412 Walnut Brown John (Annie) blksmith h916 (316) Cowan Brown John lab r215 Elliott (EM) Brown John (Clora) lab h rear 509 Monroe Brown John (Hattie) lab hl20 (17) Smith Brown John (Pauline) lab h21 Park Hotel al Brown John (Pearl) lab h802 (403) Charles (SM) Brown John trucker r215 Elliott Brown John D (Mamie) mgr Nash Sausage Co hl02 A Cedar (SM) Brown John F (Rachel) auto mech hl03 Oakland av Brown John F jr slsmn rl03 Oakland av Brown John G (Catherine) cashr Wilson & Co rl06 Rogers av Brown John G tchr Ga-Ala Business College r Y M C A Brown John J (Carrie L) elk Atlantic Ice & Coal Corp hl535 2d Brown John W (Maggie) inspr hl'47 Ells (SM) Brown Jordan (Mary) driver hl02 Rock av Brown Jos lab r811 Elbert Brown Jos (Pearl) lab h8 Harris row Brown Jos (Alberta) lab hl28 Jones Brown Jos (Emma) lab h232 4th av Brown Jos lab rll64 Ocmulgee Brown Jos lab r541 E 2d (EM) Brown Jos lather hl47 Neal av Brown Jos (Pearl) restr 219 5th h251 5th Brown Jos H (Maud) pntr hl36 Piedmont av Brown Jos W (Dora) asst eng City Water Wks h91 Clayton (V) Brown Julia (wid F L) h526 Edgewood av Brown Julia lndrs rll3 PoWell (EM) Brown Juliette tchr rl73 (152) 1st av (V) Brown J Henry (Martha) boilermkr h613 Georgia av Brown J Henry soft drinks r324 Jenkins Brown J Holland dist mgr Piggly Wiggly r613 Geor- gia av &C0. Polk Directory Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2 % on Savings MACON CITY DIRECTORY (1925) 189 Brown J Luther student rl36 Piedmont av Brown J Thos r814 Napier av Brown Kate lndrs hl272 Cheatham al Brown Kath cook r rear 7 St Paul Brown Kenneth L elk L W Rogers Gro Co rl02 Cedar (SM) Brown Lacey (Lessie) lab hl037 Broadway Brown Lamar M electn H E Lowe Electric Co h Fair- view Brown Laura cook h48 Schofield Brown Lawrence (Lena) lab r324 1st av (V) Brown Lawrence jr news dir rl65 2d Brown Lee A lens grinder rll5 Florence av (SM) Brown Lee C mach opr rll4 Garden Brown Lena h529 Forsyth Brown Leola student r232 Powell (EM) Brown Leon shoe repr rllO Linwood av Brown Leon C elk Birdsey Flour Mills rlOO Ingleside av SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Brown Leon D (Minnie L) prop Brown Grocery hl02 Marshall av Brown Leora cook r6 Boundary (SM) Brown Lester A student h809 Edgewood av Brown Lewis lab r611-15 2d Brown Lila sten rll9 Lamar Brown Lizzie lndrs h203 Edgewood av Brown Lizzie maid r rear 225 Academy (EM) Brown Lizzie mill opr h213 Fanders Brown Lizzie nurse r494 Virgin Brown Lonzo lab r379 Middle (V) Brown Louis lab r718 Hazel Brown Louise (wid Richd) r22 Elizabeth Brown Louise N (wid 0 Allen) r G F Green Brown Lucile r244 1st av (V) Brown Lucile cook r518 New Brown Luella tchr r822 Orange Brown Lula (wid Harry) h640 Hicks al CO M Si s5Q? is0(fl . Jfor lists of names n JiNY TRADE ( ANY BUSINESS r j- ANY PROFESSION nttraiOT R. L POLK & CO. Chicago. E FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 190 (1925) R. L. PORK & CO.'S Brown Lula cook hl26 Jones Brown Lula cook r208 Yates av (EM) Brown Maggie Indrs r204 Grant City rd Brown Maggie Indrs r204 Grantt City rd Brown Maggie Indrs h473 Hazel Brown Malcolm appr T L Wood r New (SM) Brown Mamie r565 Elizabeth Brown Mamie h6 Orchard av Brown Margt cashr Bethune & Stevens rl68 Spring Brown Marie cook r429 Chestnut Brown Marie P (wid Duncan) h53 Arlington pi Brown Martha (wid Jos A) rl36 Piedmont av Brown Martha r5T Arlington pi Brown Martha Indr hll29 Broad Brown Marvin L pntr r216 American blvd Brown Mary (wid J H) h9 Dessau pi Brown Mary rl03 Oakland av Brown Mary r869 2d Brown Mary dom r331 Gilmer Brown Mary dom r426 (1323) Steins al Brown Mary nurse r200 Clinton Brown Mary I (wid Prank M) hll9 Lamar Brown Mary J Indrs r48 Schofield Brown Mary L Indrs r25 Wall st la Brown Mary L slsldy Burden Smith & Co r C F Brown Brown Mattie Indrs r208 Elliott (EM) Brown Maud indrs r208 Elliott (EM) Brown Maud tchr rl40 (375) Neal av Brown Maynard elk Natl Highway Pharmacy r5-6 Bellevue rd Brown Mildred dom rl028 Clinton rd Brown Mingel B Rev h935 Broad Brown Milton (Nannie) lab h215 Roosevelt (V) Brown Minnie r548 Ocmulgee Brown Minnie Indrs r649 Oglethorpe Brown Missouri cook hl50 (147) Sycamore Brown Mittie (wid Abr) h818 Ash Brown Monroe (Fannie) lab h21'7 Calhoun Brown Morris orderly hll5 Linden av Brown Mose (Fannie) lab h608 Mitchell Brown M C cond r548 Ocmulgee Brown Naomi (wid Wm N) r77 Dempsey av Brown Narcissus Indrs h274 Davis al 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 191 Brown Neal H (Kate) meats 803i/2 Broadway hll8 Rutherford av Brown Nellie elk Sadie Abdoo r718 3d Brown Nettie cook r638 4th av (U) Brown Ohie D (Maude) cond h507 Calhoun Brown Ola lndrs r507 Plummer's al Brown Olin driver r244 1st av (V) Brown Oscar (Alma) lab h917 (317) Cowan Brown Oscar (Rosa L) lab hl06 May av (U) Brown Oscar M bell boy rl33 (111) Mutual av Brown Osia lndrs hl27 Virginia la Brown Patiency cook h228 Madison Brown Pauline lndrs h855 (856) 3d av (V) Brown Pearl cook r318 Walnut Brown Pearl lndrs rll5 Linden av Brown Phyllis dom r233 Gilmer Brown Pitt M (Ina) h315 Bond Brown Pope M mach Taylor Iron Works & Supply Co r C T Brown MACON OPTICAL COMPANY Frank H. Johnson X'/'~X Optometrists Opticians -X 468 CHERRY X,*- >- PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Brown Princess r77 Dempsey av Brown Ralph farmer rl028 Clinton rd Brown Randall (Roberta) lab hl06 Gustin av Brown Raymond (Gladys) lab rl34 Green Brown Reeves student r314 College Brown Richd (Mary) frame opr h28 Bibb av Brown Richd (Minnie) truck driver h48 New St la Brown Rivers H driver rl65 2d Brown Robt candy mkr r305 Womack Brown Robt (Mary) carrier P O h605 Port Hill Brown Robt lab h324 (121) Boardsmans al Brown Robt lab rl206 3d Brown Robt H (Albina E) wtchmn h310 Giles Brown Robt M plmbr rl04 Cedar (SM) Brown Robt P br mgr Ga Grocery Co r307 Forsyth Brown Rosa r.102 Rock av Brown Rosa dom r707 Maynard Brown Rosa mach opr rll Lake City Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. t WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 192 (1925) R. L. POLK & CO.'S Brown Rosa maid rl37 2d av Brown Rosa L lndrs hl75 Hazel Brown Rosalie lndrs rl04 Smith (EM) Brown Roscoe hlpr r507 Telfair Brown Roy elk M C Few r321 1st Brown Rufus (Mary) lab hl8 Williams la Brown R A (Irene) signalmn r307 Forsyth Brown R Marvin solr Ideal Lndry Co r722 Walnut Brown Sallie maid E E Jones Brown Sami (Eva) rll2 Academy Brown Sami (Rebecca) h959 Oglethorpe Brown Sara sten r9 Dessau pi Brown Sarah lndrs h271 Chestnut Brown Sarah lndrs h233 Gilmer Brown Sarah sten Piggly Wiggly r9 Dessau pi Brown Scott bkpr r604 1st Brown Sign Co (W H Brown, H B Brown) 23^ Wall Brown Sol (Bertha) janitor hill (6) Braswell la Brown Sol (Bertha) lab h6 Cherokee av (SH) Brown Susie cook h265 Chestnut Brown Susie lndrs rll7 Williams la Brown Sylvester (Geneva) lab h!16 5th Brown Sylvia h379 Middle (V) Brown Thos E (Maud) mach h3038 Houston av Brown Thos (Martha) draymn h830 (826) 3d av (V) Brown Thos E (Nola) pntr h216 American blvd Brown Tobias (Minnie) lab h24 Siam Brown T Brunson carp rll6 5th av (SM) Brown Ulysses I (Effie) opr r57 Clinton Brown Undine elk Ga Loan & Trust Co rl219 Vine- ville av (V) Brown Virginia (wid Thos J) rll5 Cedar (SM) Brown Vranes (Southland Cafe) r Edgerton Hotel Brown Waddell (wid Herbert) rl31 Knott Brown Walter driver hl37 2d av (V) Brown Walter (Pearl) lab hl238 Broadway Brown Walter (Ollie) lab hll9 Rock Hill la Brown Walter B mgr Piggly Wiggly r9 Dessau pi Brown Walter G slsmgr r241 Jeff Davis Brown Washington lab h529y2 Cotton av Brown Wm (Addie) blksmith 1235 3d hl'233 do Brown Wm carp r335 Maple Brown Wm carp h407 May av Brown Wm chauf r379 Middle (V) n Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St. MACON CITY DIRECTORY (1925) 193 Brown Wm (Prances) driver h244 1st av (V) Brown Wm (Idella) lab h854 Cowan Brown Wm lab r811 Elbert Brown Wm (Mattie) lab h38 Gas House al Brown Wm (Lizzie) lab hll9 Moore la Brown Wm (Eula) lab hl72 Mosley Brown Wm lab rl6 Orchard av Brown Wm lab r318 Wall Brown Wm (Georgia) lather r614 Ross Brown Wm (Emecie) porter h217 Madison Brown Wm (Pearly) porter h616 Chapman al Brown Wm A (Bessie) h241 Jeff Davis Brown Wm A (Myrtle) pdlr h Church Brown Wm A (Annie) twister h726 Oglethorpe Brown Wm E lab rl36 Cowan Brown Wm E (Lizzie) mach hlpr hl020 Main Brown Wm H (Brown Sign Co) h869 2d Brown Wm J (Bessie) plmbr 219 Coleman h do Brown Wm L (Mary) inspr hl'811 Broadway Brown Wm M (Jennie) janitor hll3 Jones Brown Wm N (Zudie) blrmkr r77 Dempsey av Brown Wm R (Ethel) elk P O r321 1st Brown Wm R (Margt) elk P O hl09 St John Brown Wm W (Pearl) carp hl21 Nottingham dr Brown Wm W mgr Broadway Garage hl05 Appleton av Brown Willie r204 Douglas av Brown W Floyd appr mech r507 Calhoun Brown W Morris (Sarah) agt U S Internal Revenue Auditing Dept h214 Corbin av Brown W W Bryant (Maud) optometrist hlOl Pied- mont av Browning Emma (wid Charlton) rlOO 2d Browning Mary A (wid Thos) r716 2d Browning Virgil waiter r525 Edgewood av Browning Walter flagmn r716 2d Broxton Linnie G (wid J J) hl2 Stonewall pi (V) Broyles Ben (Lavinia) elk Jos Gren r390 Cowan Broyles Sami agt r211 Broadway Brozill Judson (Ada) la bh425 Peacock Bruce Chas H (Leila) supt Board of Public Education h696 Ridge av Bruce Clarence E mech rl30 Appleton av Bruce Edgar B (Harriette) r268 Hardeman av FOR LISTS OF NAMES ANY TRADE A-- ANY BUSINESS -- ANY PROFESSION DETROIT R. L, POLK & CO. CHICAGO Dunlap-Huckabee Auto Go. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 am 194 (1925) R. L. POLK & CO.'S as a BRUCE D FRANK (Hattie R), County Agt Bibb Coun- ty Farm Bureau, li705 Holt ay MARKET Brumback J Frank (Frances) mgr C D Kenny Co h3, 920 College Brundage Jessie L (Maude) eng h618 Elm PUCE THE Brundage Pearl rl63 2d Brundage S C (Hattie) fnshr r78 Smith (SM) Brundridge Jas A hlpr Central Ga Automotive Co r613 Plum DIRECTORY Brundridge Kath cook h24 Williams la Bruner Clyde M (Jeannette) eng r866 1st IS THE Bruner Geo H caller r2129 Broadway Bruner Jas (Stella) lab h96 Harris GREATEST Bruner Edw elk M Kessler r2129 Broadway Bruner Jos B r2129 Broadway MARKET Bruner Mary L r2129 Broadway Brunette Lewis M (Nora) farmer hl74 Lymoore av PLACE Brunson Emmerson F (Susie) flagmn hl50 Tenny av Brunson Hattie tchr r543 (541) 3d av (V) i THE Brunson Horace B Carrie) blksmith h303 Cutters Green Brunson Pearl r543 (541) 3d av (V) Brunson Sarah h220 Ellis av Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Brunson Stella lndrs rl23 Jones Brunson Wesley (Della) brkmn h763 Ash Brunson Zack (Hattie) cooper h541 (535) 3d av (V) Br'uskie Jos B sten Gulf Ref Co r2210 2d Bryan Eliz Mrs sec Consolidated Natl Detective Agcy r800 Cherry Bryan Henry (Sarah) lndrs h623 Gilmer Bryan Herbert C (Florine) h573 Orange Bryan Jas B (Grace) supt h312 Buford pi Bryan Jas E (Leila) carp hl82 Palace av The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Bryan Jas R (Eliz) state supt Consolidated Natl Detective Agency r800 Cherry Bryan J Scott (Eunice G) elk hl56 Oakland av Bryant Alice A bkpr C E Newton & Bro rl26 Napier av Bryant Anderson (Rebecca) lab r402 Crisp Bryant Andrew (Ada) lab h725 (118) Cowan Bryant Andrew N (Lula) blksmith h708 (705) Guern- sey la &V Bryant Anna Mrs tchr Mount de Sales Academy r211 PUBLISHERS Corbin av PolicDirGcbruli DETROIT, A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 % CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 195 Bryant Bessie cook r280 1st av (V) Bryant Buford C (Martha D) mach r203 New Bryant Carl A (Annie) agt h435 Duncan av Bryant Carlton mech rl34 Virginia av Bryant Chas lab h237 Kahn's al Bryant Chas porter r207 Ward (PH) Bryant Claudie r242 Thompsons al Bryant Clayborn cook h306 Ward Bryant Corinne cook r222 Jordans al Bryant Danl lab r708 (705) Guernsey la Bryant Dolly lndrs h5 Wall St la Bryant Edw firemn r437 (441) Elbert Bryant Edw (Eva) firemn h817 3d Bryant Eliz (wid DLH) hl05 Emory Bryant Eliz bkpr C E Newton & Bro rl26 Napier av Bryant Eliz cook hl50 Magnolia la Bryant Elbe cook h497 Ward (V) Bryant Ethel (wid Huton) sten Macon Credit Bureau r752 Mulberry Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Bryant Eugenia maid r5 Wall St la Bryant Eva Mrs smstrs Lee's Dept Store rll2 Acad- emy Bryant Evelyn student rl82 Palace av Bryant Fannie dom r456 Bay Bryant Felder L auto mech rl05 Emory Bryant Felix lab r713 Campbell av Bryant Geo (Easter) lab hl6 Frank al Bryant Geo (Lizzie) lab h703 (445) Charles (SM) Bryant Gordon lab rl232 3d Bryant Green (Naomi) prsr h624 Monroe Bryant Hager lndrs h800 Maynard Bryant Hodge lab h526 Maynard Bryant Homer S millwkr r90-91 Green (Payne Mill) Bryant Isaac (Lora) rll6 Academy Bryant Isaiah (Maggie) lab h503 Gilmer Bryant Jas (Ruth) gro h965 Walnut Bryant Jas lab r242 Thompsons al I DAY'S I PYLE | M^rJTTL 1 I CREDIT 406 THIRD ST. TEL. 3026 G O A ^ Du_jJSj jijOdi a,= < O' J --> O 5 Z B gw S 3 s0 Zrj U> Q %< Z Is < o z a O 03 s--.isg'-1 3OhE18 jas 3 o Oz zO 2Id H H id s ^y tsn 33 ^ itHd/j e*>oHcido HuH JOO en WQZ5 tn < < DS Cd < K More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 196 (1925) R. L. POLK & CO.'S Bryant Jas A (Ginna C) farmer hl21 Culver Bryant Jas E elk J W Bryant r965 Walnut Bryant Jas W (Ruth) gro 159 Franklin h965 do Bryant John H (Mattie) mill wkr h90-91 Green (Payne Mill) Bryant John H jr mill wkr r90-91 Green (Payne Mill) Bryant Jos (Louise) hll Malloy's al Bryant Jos (Georgia) lab r701 (362) Charles (SM) Bryant Jos lab hl54 Madison Bryant Julia dom r5 Plant al Bryant J Kenneth (Anna) teller Macon Natl Bank also treas Junior Chamber of Commerce r211 Corbin av Bryant Laura lndrs r525 Craft la Bryant Leola h522 Ocmulgee Bryant Lewis H waiter rl05 Emory Bryant Lillian r435 Duncan av Bryant Lizzie lndrs r708 Guernsey la Bryant Lottie (wid Z T) rl325 Broadway Bryant Maggie lndrs hl232 3d Bryant Maggie L Mrs rl02 2d Bryant Marie maid hl05 2d av (V) Bryant Mary lndrs rll (401) Crisp Bryant Mary E bkpr rl26 Napeer av Bryant Mary L lndr hl05 Bonair Bryant Mattie maid hl2 Malloy's al Bryant Nancy (wid John) h713 Campbell av Bryant Needham R (Sallie) r435 Duncan av Bryant N C lab r559 Cheatham al Bryant Oscar D waiter rl05 Emory Bryant Pauline sten rl21 Culver Bryant Pollie smstrs rll4 Green Bryant Rosamond sten rl82 Palace av Bryant Ruth S Mrs sec Trust Co of Ga r965 Walnut Bryant Sami flgmn r616 2d Bryant Sandy (Alberta) pdlr h269i/2 4th av (V) Bryant Umpster (Mattie) lab hl2 Bay Bryant Vallie cook r497 Ward Bryant Viola lndrs h5 Plant al Bryant Walter F lens grinder rlOl Piedmont av Bryant Wm (Lillie) firemn h611 Gilmer Bryant Wm E (Mamie) slsmn Macon Coca Cola Bottling Co h397 Belmont av Bryant Willie cook r218 Elizabeth Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 197 Bryant Wilson (Harriett) firemn h701 (362) Charles (SM) Bryson Corinne lndrs h518 (18) Short (EM) Bryson Rilla (wid Coleman) h718 Campbell av Buchanan Andrew (Malena) trav slsmn rl02 Rogers Buchanan Clayton W jr (Mattie H; Adams-Buchanan Motor Co) r208 Vineville av Buchanan Frances student rl02 Rogers av Buchanan Harris C (Selma) carp hl22 Grady Buchanan Jas E mach rl22 Grady Buchanan John trav slsmn r863 Cherry Buchanan Mary elk Metropolitan Ins Co rl89 Mag- nolia Buchanan Wm h Bartletts la Buck Mary cook h6 (506) Clayton Buck Willie L cook r6 (506) Clayton Buckeye Cotton Oil Co F E Williams plant mgr ft of Division Buckholts John Y r232 Lynwood av & o CO YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Buckholts Thos (Mattie) lab h232 Lynwood av Buckholts Walter lab r232 Lynwood av Buckle Albert porter r84 (130) Forest av (V) Buckner Earl L mgr L W Rogers Grocery r763 Cherry Buckner Emma pdlr h.238 Wings Hill Buckner Fannie lndrs r218 Lee Buckner Hugh waiter J D Carr Buckner Ida lndrs hlOl Telfair Budd Chas farmer r53 Virgins la Budd Wm H Rev field sec Methodist Centenary Head- quarters r Arcadia Hotel Buff Ada (wid Jos) slsldy Union Dry Goods Co r678 Courtland av Buff Augusta E teller Fourth National Bank r678 Courtland Buff Felton film opr h678 Courtland av Buffer Chas (Louise) lab hl61 Coles al Buffeteria The (Leonard Berg) restr 449 Wall o co k o FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION w DETROIT R. L. POLK & CO. CHICAGO 210-212 NORRIS HARRIS INSURANCE SURETY BONDS Bibb Building Telephone 131 198 (1925) R. L. POLK & CO/S Buffett Chas (Louise) pdlr r714 Hawthorne Buffing Carrie cook r626 4th av (U) Buford H Milton (Rosa) slsmn r424 American blvd Buford Mary nurse Metropolitan Ins Co r C O Pratt Buggs Henrietta lndrs h227 Norris Buggs John (Mattie) h319 E 2d (EM) Buhler Geo T student r309 Georgia av BUICK AUTOMOBILES, Dunlap-Huckabee Auto Co Distributors 082-690 8d, Phones 5100-5101 BUILDERS' LUMBER CO, W H Baskin Pres, H B Erminger Jr (Havana, Cuba) Y-Pres, W R Clay Sec-Treas, Lumber and Building Supplies 6th se cor Cherry, Phones 220 and 3136 (See page 74) Bulcken John B gro 1302 Broadway r421 Jackson Bull W F asst mgr W T Grant Co r752 Spring Bullard Benj M flagmn r616 2d Bullard Chas sten r843 Courtland av Bullard Chas M (Mae) v-pres C F Benson Co Inc h843 Courtland av Bullard Danl jr (Mary D) slsmn r281 Orange Bullard Evans E (Grace) mach r519 Walnut Bullard Ira (Elvinie) carp h458 Chestnut Bullard Maude Mrs slsldy Union Dry Goods Co r519 Walnut Bullard Miles F (Mary) bailer mkr hl20 Colquitt Bullington Alex S (Alma) mtrmn hl29 Winship Bullington Jessie J (Edna) firemn h968 Elm Bullington Wm E (Sallie) inspr Macon Ry & Light Co h664 Walnut Bullington Wm E jr student r664 Walnut Bullock Birdie lndrs r663 Hall Bullock Frances lndrs h232 Plant al Bullock Jas farmer rl227 2d Bullock Ola Mrs hsekpr r253 Broadway Bullock Richd L (Clara) acct hll3 Habersham av Bullock Wm (Clara) lab hllO Division St la Bullock Wm B (Fritji) lunch 2 Spring h457 Oak Bullock Willie sten r230 Jefferson Bunch Amanada (wid Jas) r27 Hill Park av Bunch Jamie sten r27 Hill Park av Bunch Jerry V (Minnie) hl012 Hazel Bunch J Elmore h22)/2 Wall Bunch Mamie rl012 Hazel Buneal Clyde porter r!2 Wise av A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 199 Btinn Wm M (Jessie M) mgr Atlantic & Pacific Tea Co h es American blvd 1 n Grand Bunns Murry (Winnie) lab hllO Whitlock Buntin Chas M student rl04 Magnolia Bunting Chambers L (Fannie K) coml agt Sou Ry Systems h238 Hardeman av Buntley Wesley (Leola) lab hl02 Gantt City rd Burch Emma maid r256 Middle (V) Burch John W (Sallie C) dept supt h716 Mulberry Burch Ralph (Cora) mech rlOl St John Burch Sallie Mrs bkpr David Wachtel r716 Mulberry Burch Thos E (Jessie) supt Construction of All Kinds of Building h247 Oakland av Burch W Edwin mech Yates Motor Co r818 Walnut Burdell Maryland M prin h900 Fort Hill Burden Chas G (Anna) cond hl32 Virginia av Burden David (Tiny) lab h711 (708) 3d av (V) Burden Eug B (Jane) dept mgr Burden Smith & Co hl45 Hines ter Burden Fannie cook h800 (107) Charles (SM) Burden Georganna lndrs r442 Flanders (EM) Burden Hubert mech rl34 Virginia av Burden Jas W (Capitola) police hl34 Virginia av Burden Matilda hl52 Hill BURDEN RICHARD F (Minnie), Pres Burden, Smith & Co Inc, h651 (1009) Vineville av, Phone 1836 BURDEN, SMITH & CO (INC), R F Burden Pres, C S Cason V-Pres, T J Stewart Sec-Treas, Dry Goods, Etc, 350-356 3d and 459 Cherry, Phones 3441- 3442-2486, Second Floor 690-804-2496, Third Floor 709-3722 (See page 64) Burden Thos J rl32 Virginia av Burden Wesley lab h442 Flanders (EM) Burdette Clarence H (Elma) mgr Underwood Type- writer Co r440 New Burdge Claude Mrs marker r454 JNew Burdge Eliz cashr Union Dry Goods Co r454 New Burdge Minnie E (wid W R) rl24 Merritt av (MA) Burdge Wm R elk Bibb Bag Co r454 New Burg Esy Z dry goods 1200 Broadway h do Burg Michl R (Fannie) dry gds 308 3d h851 Walnut Burgamy Edw M (Evvie) pntr h217 Bacon Burgamy Frank (Lucile) wtchmn rl26 Washington FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. Tv. POLK. & CO. CHICAGO "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 200 (1925) R. L. POLK & CO.'S Burgamy Hardy W (Bertha) elk Mollie Burgamy r 754 Broadway Burgamy Mollie gro 803 Broadway h754 do Burgay J Henry (Retta) eng r620 Pine Burgay Leroy (Ella) lab hl37 Hazel Burgdorff Geo P (Janie) slsmn R S Thorpe & Sons h438 Carling av (HH) Burge Laurine Mrs r203 New Burgess Avory V rural carrier P O res R F D 1 Burgess Geo M dep sheriff Municipal Court r715 2d Burgess Geo W (Minnie) r3508 Houston av Burgess Jackson B (Sylvia) cooper h Industrial Home rd nr American blvd Burgess John W (Inez) mtrmn h231 Ells (SM) Burghard Annie tchr h658 (1018) Vineville av Burghard Aug (Frances M) h431 Johnson av Burghard Aug jr r431 Johnson av Burghard Cora J student r431 Johnson av Burghard Frances M sten r431 Johnson av BURGHARD LOUIS H (Lucia E), Funeral Director and MgT Harrison Mutual Burial Assn 718 Cherry, Phone 6, hll5 Hines ter (V), Phone 62 (See page 66) Burghard Margt M tchr r431 Johnson av Burghard Martin C tkt agt Terminal Ticket Office r 431 Johnson av Burghard Minnie R prin Clisby School r658 (1018) Vineville av Burgtorf Edw A (Mildred) slsmgr Ga-Carolina Lum- ber Co h515 Ridge av Burke Allen lab h207 Elm Burke Annie A (wid Horace) hl507 3d Burke A Read (Eunice) swtchmn rl507 3d Burke Cynthia rl709 3d Burke Dennis (Christine) teleg opr hllO Madden av Burke Dora (wid Hardy) rl518 Napier av Burke Edw J rl24 Appleton av BURKE EDWARD W (Effie), Mgr J W Burke Co, h Forsyth rd Burke Edw W jr (Lora) slsmn The J W Burke Co r 411 Orange Burke Ethel Mrs musician Rialto Theatre h!709 3d Burke Estelle cook rl08 Lamar Burke Eug L (Beulah) mech hl02 Nelson --- Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 Improved Service tine of business requires im- provements in machinery and equipment more frequently than ! that of Printing, and unless a printsa ' keeps up with such improve- meats, inot render the service due its customers. Not only have we a model 14 Lino- type, with latest improvements, carry- ing many type faces, but we have re- cently installed a complete Monotype equipment, which is really a type foundry, giving us new type for all work. The most rapid printing machine is the Kelly Automatic Press, turning out high-class, accurately registered work at 4,500 impressions an hour-- three times as fast as ordinary press, which makes it possible for us to make quick deliveries at lower prices. Our plant is modern in every particular, and the rapidly increasing busi- ness indicates that our customers ap- preciate real service. Ihe J. W. Burke Company Printers, Stationers, Office Outfitters Macon, Georgia -X- -X- -X- -X. -X- X. tailonery * Office Supplies* Sports T is gratifying to know there is a ^ general stationery store in a community which caters only to the best lines of everything usually found m a store of this kind. Lady shoppers find it a pleasure to shop here, as we are constantly in search of merchandise which would appeal to their good judgment all the year around. Then, too, this is a man's store. Office men representing every branch of business can always find that their wants can be best taken care of from our large stock of office stationery and filing cabinet equipment. After work comes play, and we otter the best line of athletic goods to be found in this section, which includes Tennis, Golf, Basket Ball, Volley Ball, and all kinds of Baseball supplies. We are therefore pleased to offer our services, our store and our stock at your command. r t The J. W. Burke Company Printers, Stationers, Office Outfitters MACON. GEORGIA ao The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 201 Burke Frank T br mgr Jones Motor Co hl24 Appleton av Burke F Eug (Estelle) slsmn r418 Walnut Burke G C h216 Belmont av Burke Hugh A (Mamie) autos 713-715 3d h757 Pine Burke John ice ctr rl36 North Burke John W printer The J W Burke Co r411 Orange Burke John W School Mrs M A Weir prin 2133 2d Burke J Gordon teleg opr rllO Madden av BURKE J W CO THE, W R Holmes Pres, W F Walton Sec, E W Burke Mgr, Books, Stationery and Office Supplies, Lithographing, Printing, Binding 406 Cherry, Phones 74-758 (See right top lines, page 84 and opp) Burke Lindsey bellboy r314 Brights la Burke Martina L tchr r265 Georgia av Burke Mary H sten r265 Georgia av Burke Mary S (wid Thos C) h265 Georgia av Burke Pearl cook r234 Orange Burke Raymond elk Yellow Cab Co rl02 Nelson Burke Robt (Mollie) gardener h245 Ellis av Burke Roy plmbr rl02 Nelson Burke Thos (Mollie) driver hl38 North BURKE T C (INC), R E Sheridan Pres, E C McMillan Y-Pres-Treas, L D Sheridan Sec-Asst Treas, Painters' and Builders' Supplies 358-360 3d, Phones 4386-4387-3957 (See front cover) Burke Walter student r518 Napier av Burke Wm lab h207 Elm Burke Wm M (Susie) formn hl528 3d Burke Wm T (Alice) gro 1106 Main r do Burkett Claire tchr rl24 Laura Burkett Clancy (Susie) r413 (12) May av Burkett Eug (Augustus) lab hl26 Glen Burkett Ira E (Addie M) pres Schofield-Burkett Construction Co hl34 Summit av (NH) Burkett Jos S eng rl34 Summit av (NH) Burkett J Brown (Lillian) r220 1st Burkett Katie tchr rl24 Lamar Burkett Laura student rl34 Summit av (NH) Burkett Lillian rms 220 1st h do Burkett Linton reporter Macon Telegraph r756 Mul- berry CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable en pi A natural by-product of the Directory) Business is the compilation of Mailing Lists* If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit 3 r " u> We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 202 (1925) R. L. POLK & CO.'S Burkett Nelle student rl34 Summit av (NH) Burkett Oscar lab rl5 Alabama Burkett Robt lab hl5 Buckner al Burkett Susie maid r220 Elliott Burkett Valley maid h6 Alabama Burkholder Chas (Lula) r541 Georgia av Burks Jos farmer h Columbus rd Burks Thelma Mrs r240 Ells (SM) Burks Wilburn T (Mamie) cond rll7 Latta Place Burks Zenobie cook h329 9th av Burleigh Robt (Hattie) farmer hl07 Dempsey av Burley Nellie rl601 Forsyth rd (V) Burnell Fred (Henrietta) waiter r217 Broadway Burnell Henrietta Mrs cook r217 Broadway Burner Julius C lab rl23 Grant av Burnes Estella r246 Dempsey av Burner Jas C (Lizzie) eng h438 Ross Burnes John C (Marie) mach r7 Myrtle Burnes Jesse (Roxie) lab h.246 Dempsey av M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmgeyAIho,LytLuoYarTpun. HrrgdouYdFvmeeoo. nlcsraTtasiasthstiaritoicelsen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbRrhrYulyEegsOeigpdgRUiinsnANatok'Lln-s,. 1 H Burnes Minnie r246 Dempsey av L E Burnett Arth L (Anna L) coml agt L & N R R h597 College Burnett Chas I (Mollie V) gro 3200 Houston av hllO L A Heard av Burnett Chas M (Alice) slsmn Macon Coca Cola Bott- ling Co h320 Giles I T Burnett Earl W (Evelyn) slsmn Union Dry Goods Co rll7 Summit av (NH) R I Burnett Erastus D (Bessie) barber Palm Barber Shop h709 Main (EM) Burnett Eunice tchr r643 4th av (U) 0 N Burnett Geo S (Clyde) slsmn Ellis Motor Co h802 Napier av N G Burnett Hennie G Mrs drsmkr 261 Maple r do Burnett Henry C (Vallie) eng hl673 3d Burnett Ira lab r699 (131) Hall S Burnett John farmer r512 Church 415 Third Phone 5113 FOR LISTS, OF NAMES ANY TRADE -- ANY BUSINESS --- ANY PROFESSIOfN DETROIT R. L. POLK & CO. CHICAGO a ENGLAND lriD To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 263 Burnett John R (Hennie G) sewing machines 529 Cotton av h261 Maple Burnett Josephine lndrs r699 (131) Hall Burnett J Pelham lawyer 14 Washington bldg r512 Church Burnett Louis J sten r261 Maple Burnett Luke (Luella) h.460 (260) Bowman Burnett Mamie lndrs hl25 Waterville rd Burnett Margt student rl06 Log Cabin dr Burnett Mary (wid Reuben) h643 4th av (U) Burnett Nathaniel (Mamie) lab h315 Hammond Burnett Otis (Rosa) lab hl33 Woodliff Burnett Sallie maid r9 Smith (SM) Burnett Virgil M (Mary) collr T J Harris & Co h746 Walnut Burnett Wm D (Hallie M) driver hl670 3d Burnett Wm T (Anna) mech hl06 Log Cabin dr Burnette Ben F cotton broker r784 Holt av MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Burnette Chester A (Eliz) slsmn Wright & Reeves h! 1419 3d Burnette Jas C slsmn Burden Smith & Co Burnette Mary L cook hl32 4th av (WH) Burney Andrew (Estella) lab concrete h20 Tinsley la Burney A Eugene (Nell) sec-treas Burney Bros Co r 133 Summit av Burney Bros Co (Inc) E M Burney pres J E Burney v-pres A E Burney sec-treas produce 313 Poplar Burney Clarence G lab rl23 Grant av Burney Claude (Flossie) barber A J Brown h2 Woodliff Burney Crawford (Pleasant) carp hl23 Grant av Burney Edw H lab r206 (276) Astor (EM) Burney Elgin M pres Burney Bros Co rl45 North av Burney Ella M (wid Robt) hl45 North av (NH) Burney Emma dom rl23 Grant av Burney Hennie cook r96 (118) Forest av (V) Burney Jas lab rl23 Grant av Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work R. L. POLK & Company 0) Q) ;S CM >cn U OlT c 06 o < ac H fl) * o3 ^ CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 204 (1925) R. L. POLK & CO.'S Burney Jas (Savannah) lab h704 Gurnsey la Burney Jerome E v-pres Burney Bros Co rl45 North av (NH) Burney John (Bertha) lab h554 Smith row Burney Jos (Lucinda) lab hll63 (326) Woolfolk Burney Louie P slsmn Burney Bros Co rl45 North av Burney Lather (Lillian E) supt Standard Handle Co r339 Ross Burney Martha C (wid Jos H) hlOl Highland av (NH) Burney Velmar lnds r206 (276) Astor (EM) Burnham Jas W (Myrtie) mgr Am Optical Co hl06 Madden av Burnham Myrtice Mrs sten American Optical Co rl06 Madden av Burnham Richd E C (Corrie) mach h3034 Houston av Burnhardt Harry (Missouri) piano tuner r737 College Burns Alma rl807 3d Burns Amanda sten Superior Court r704 Main Burns B B lab r558 Fulton al Burns Dollie (wid H Jackson) hl32 Highland av Burns Fannie B (wid John L) smstrs h7 Myrtle Burns Florence student r409 Forest av (V) Burns Harry C (Dorothy) bkpr r7 Rose pi Burns Henry K (Ruth) mgr Ga Investment & Trust Co res Lorain Ga Burns H Clay (Gladys) police h357 Hydrola Burns J Harry (Mary) dep elk City Court hl21 Fort Hill BURNS KENMORE (Florence), Pres and Genl Mgr Kenmore Burns Inc, h409 Forest av, Phone 80 Burns Kenmore jr student r409 Forest av (V) BURNS KENMORE INC, Kenmore Burns Pres and Mgr, Insurance, Loans, Rentals 157 Cotton av, Phone 89 (See left bottom lines and page 80) Burns Margt (wid Michl) r203 Clisby Burns Marie Indrs rl Damour la Burns Mercer (Clara) elk Brad Wall Inc hl38 Will- iam Burns Monroe (Anna) lab h500 Campbell av Burns Robt L mgr Georgia Grocery r664 Plum Burns Rose beauty opr rl32 Highland av BURNS SIDNEY L, Mgr Parcel Delivery Co, li621 Orange Burns Wm C (Mamie) cond h820 1st | FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION I DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4 %% on Savings MACON CITY DIRECTORY (1925) 205 Burnside S V agt Carolina Life Ins Co Burr Cora r307 Orange Burr Geo W cigar lobby Hotel Lanier r307 Orange Burr Nellie C (wid Geo W) h307 Orange Burrell Clyde (Marian) porter hl2 Wise av (V) Burrough Jose lab hl2 King Burrough Vernon (Ethel) chauf r231 4th av (V) Burroughs Adding Machine Co C L Bradford mgr 654 Mulberry Burroughs Asa B (Mollie) baggage mstr hl38 Knott Burroughs Geo (Claudia) rll20 Walnut Burrow Almetta elk Chatham Mut Life & Health Ins Co rl34 Grant av Burruss Francis E (Gertrude) carp h331 Carling av (HH) Burruss Geo L (Claudia) mgr Standard Oil Co rll20 Walnut Burruss Pearl lndrs h Barracks al Burson Homer E (Irene) mgr Vineville Drug Co h 379, 405 College Burson WmH (Frankie) mgr h458 Spring Burt Dowell barber rl03 Franklin Burt Oscar H hlpr Schwartz & Phaul Burton Arth lab r525 Waterville rd Burton Benj B (Irene) mgr Nash Meat Market rl04 Magnolia Burton Fannie (wid Eddie) lndrs h330 (603) Crisp Eurton Jas lab r300 (603) Crisp Burton Lou cook h7 Magnolia la Burton Rachael dom rl59 Thomas Burton Robt E (Allie) formn r606 Forsyth BURTONS INC, H H Hester Mgr, Clothing 352 2d, Phone 1806 Burts Milton E (Viola) broker 116 Lamar h do Burts Milton E jr student rll6 Lamar Burts L Ransom student rll6 Lamar Busbee Addie P r2635 2d Busbee Allen C (Sallie L) police h2635 2d Busbee Arie r2635 2d Busbee Benjamin O (Mae) mill opr h209 (31) Holt av (NH) Busbee Kline B (Ada) asst yd mstr h2838 Houston ay Busbee Kline B jr baggage mstr r2838 Houston av Bush Albert car repr r225 Reid Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog' contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICII. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 206 (1925) R. L. POLK & CO.'S Bush Alice r225 Reid Bush Chas R (Eunice) slsmn G A Furn Co hill High- land av Bush Clara maid h426 North Bush Della B student r440 Calhoun Bush Derwood H (Phyllis) slsmn Ga Furn Co hl017 Elm Bush Dessie mill hd r2166 2d Bush Earle student r225 Reid Bush Eddie porter rl54 Madison Bush Edgar (Eva) flagmn rl02 Daisy Park Bush Edw D (Mary) carp h93 Violet av Bush Ella (wid Jos) h357 E 2d (EM) Bush Geo T firemn h225 Reid Bush Henry C (Janette) elk rl03 Montpelier av Bush Howard Y (Essie) formn r359 Fairview Bush H Grady mech r225 Reid Bush Jesse J carp r359 Fairview Bush Jesse J (Mattie L) formn h814!/2 2<1 Bush John T elk r Y M C A Bush Laverne rl36 Hines ter V Bush Lizzie Mrs smstrs h357 Fairview av Bush Lula lndrs r301 Curds al Bush Lula M r449 E Academy (EM) Bush Margarette sten r225 Reid Bush Mary (wid Thos) r357 Fairview Bush Mattie L elk Volunteer Pharmacy h814i/2 2d Bush Myrtle B r225 Reid Bush Nellie A (wid J Henry) h440 Calhoun Bush Osie butler rl37 (139) 4th av Bush Pearl smstrs r93 Violet av Bush Ruby (wid Beecher) smstrs r621 Montpelier av Bush Squire truck driver h449 E Academy Bush Thos J (Kye O ) h816 3d Bush Thos S (Norma) prop hl36 Hines ter v Bush Tonnie (Lizzie) police h357 Fairview Bush Wm r225 Reid Bussell Benj (Mary) mach hll58 Edgewod av Bussey Alice rl21 Buford pi Bussey Geo P jr (Coralie) sec-treas Macon Shoe Co h732 Ridge av ,, ,, . - Bussey Harlan E slsmn Macon Shoe Co r Lanier Hotel Bussey Nancy Mrs smstrs r541 Georgia av Butler Adelina dom r24 Magnolia la E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS-TRUCKS-TRACTORS JONES MOTOR COMPANY hIffoavrIet'asit.aFoFrodr,d woer PHONE 1591 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 207 Butler Alice nurse Middle Georgia Sanitorium r do Butler Allie dom r232 Calhoun Butler Amanda lndrs r362 Pine Butler Anna lndrs rll29 Broad Butler Anna B prsmn r511 Maynard Butler Chas (Mamie) brick mkr h612 Shoals al Butler Chas S soft drinks 151 5th h.409 Applewood Butler Daniel F ship elk Dunlap Hdwe Co r715 College Butler David r662 Hawthorne Butler Denver mech rill Lee Butler Earl L (Bertha) pntr 746 Walnut BUTLER EARL W (Mary), Attorney-at-Law 314-316 Citizens & Southern Bank Bldg, Phone 4307, hl90 English av Phone 607-J Butler Edgar (Fannie) lab h300 Hanson Butler Edw barber 650 Poplar r872!/2 Hazel Butler Ellen cook hl015 Elbert Butler Ellen lndrs h535 Maynard Butler Emmett E (Minnie) prin Hazel St Sch h326 E 2d Butler Emmett E jr student r326 E 2d Butler Esie sten E W Butler r715 College Butler Ethel lndrs h451 Alabama Butler Florence (wid Beckum C) h620 Walnut Butler Frank (Celia) lab hl42 Bay Butler Frank porter hll44 Broadway Butler Gibson car repr r555 2d Butler Harry elk rill Lee Butler Hattie r306 (206) Charles Butler Hugh (Ferrell) elk 0 R Tharpe r722 Main E M Butler Ivy (Olive) carrier P O hl55 Grant av Butler Iza col r704 (204) Colquitt Butler Jack (Emma) mill hd h94 Green Butler Jas (Beula) farmer hl28 Fort Hill Butler Jas M (Katheryn) planer hllO Piedmont av Butler Jas W sub regional mgr U S Veterans Bureau rYMCA Butler Janie rl51 Franklin Butler John A (Annie B) lab h528 E 2d Butler Julia lndrs h507 Plummer's al Butler Lewis (Rosa) lab rl52 5th Butler Mamie E drsmkr 20 Spring h do Butler Marie dom rll9 Edgewood av Butler Martha (wid Sami L) r715 College More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 208 (1925) R. L. POLK & CO.'S Butler Mary L maid h6 Harris al Butler Mitchell (Love) lab h757 Fort Hill Butler Morris (Mamie) lab r402 (521) Colquitt Butler Norman lab h521 Gilmer Butler Ollie B slsmn Macon Chero Cola Bottling Co rl03 Daisy pk Butler Orrie slswmn Jacob Areson rill Lee Butler Phillip waiter r607 Fort Hill Butler Pies (Ruth W) carp hl014 Hazel Butler Ranee (Mary) lab h704 (204) Colquitt Butler Ricbd r808(202) Pio Nono Butler Ruff carp r405 Main (EM) Butler R Lynwood (Mary) flagmn h405 Main (EM) Butler Sami L asst prsmn Macon Telegraph r715 Col- lege Butler S Park elk M D & S R R r484 Orange Butler Timothy (Martha) hl30 Adams Butler Walter C (Ruth, Butler & Smith) h2931 Houston Butler Wm (Susie) driver h271 Tindall av Butler Wm (Rosa) lab r612 Shoals al Butler Wm (Addie) lab h5 3d St la Butler Wm R (Frances) pntr hill Lee Butler Wm R jr elk rill Lee Butler & Smith (W C Butler, W E Smith) gro 3011- Houston Butt Moses D mach hl09 Davis (S M) Butt Richd F (Florence) asst frt agt Sou Ry System hl09 Davis S M Butterworth Eliz r465(523) Vineville av Butterworth Herbert S (Alice) h465(523) Vineville av Butterworth Herbert S jr student r465 (523) Vineville av Buts Alma (wid D L) rl38 Lymoore av Buts Amanda Indrs rl02(488) Short al Buts Andw (Luvinia) grocer 455 Clinton h542 2d Buts Benj (Mary) carp h234 (238) Fargason Butts C B dentist 253 Broad (E M) h do Butts David M elk hl38 McGee Butts Ernest C (Mamie) elk East Macon Packing Co r 347 Hydrola Butts Eug (Lillie) lab h212 Yates al Butts Geneva Indrs rl60 Elm Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartcCeoarpstya.lfoogr aclolRnkt.ianiLnd.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeHowr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable MACON CITY DIRECTORY (1925) 209 Butts Harper (Anna) lab r231 Turpin Butts Harry (Eula) lab h639 4th av (U) Butts H A mech rl64 High Butts Isaac lab r318 Wall Butts Jessie CCS practitioner 308 Grand bldg r525 College Butts John (Rosa) lab rl215 3d Butts Jos butcher r542 E 2d Butts Jos N lab rl52 Elm Butts Lilie lndrs h.212y2 Yates av (EM) Butts Margt rl52 Elm Butts Marsenia cook hl04 (489) Short al Butts Napoleon B lab r507 Fort Hill Butts Nathan (Lois) lab hl52 Elm Butts Olivia lndrs r957 Osmulgee la Butts Robt L millwkr rl08 Pierce (EM) Butts Rosa tchr r507 Fort Hill Butts Sallie E (wid Thos) r513 Arch Butts Thos porter r220 Sycamore Butts Thos H (Savannah) lab h507 Fort Hill Butts Wm (Cornelia) carp hl02 (488) Short al Butts Wm (Pearl) lab r419 Elbert Buxton John M (Annie L) slsmn J B Riley Drug Co h 133 Rogers av Buxton Raiford A (Lucile) elk Coleman Meadows Pate Drug Co r325 Vineville av Buyer Gus (Mollie) lab h80 Wilder Byars Jos (Irene) lab hl60 5th Byas Beatrice Mrs hlpr P A Callianos rl03 Moughon Byas Elbert (Beatrice) lab hl5 Elbert la Byas Marie nurse r482 Chestnut Byas Mary lndrs h269 Cowan Byas Sherman porter Roughton-Halliburton Co r Ella Kendrick Byas Thos (Stella) lab h531 Railroad av Byass Lula lndrs h230 (235) Roosevelt (V) Byers Elbert (Mattie) lab h631 Fort Hill Byington Carl H elk Macon Ice & Cold Storage Co r 311 Jeff Davis Byington Oscar F (Lula) cond h311 Jeff Davis Byington Robt M appr r416 Elm Byington Wm C (Laura) mech h Log Cabin Hts Bynes Henry S (Sarah) blksmith 813 Broadway hll2 Bowman FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAQO HERBERT SMART WALTEWRALPT, ECRLAPREKA, RSChEoe Dept, DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIMM as a MWI MI THE DIRECTORY IS THE GREATEST MARKET PUCE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year 2io (1925) R. L. POLK & CO.'S Bynes Henry S jr blksmith rll2 Bowman Bynes Louise' beauty opr r762 2d Bynes Mamie dom rll2 Bowman Bynum D G r Y M C A Bynum G Natt eng r560 Plum Bynum Joel C (Anabelle) cond rl416 Oglethorpe Bynum Lizzie r226 Elliott (EM) Byrd see also Bird Byrd Annie millwkr rl54 Comer ter Byrd Chas (Nellie) lab r7 Bay Byrd Chas L (Genopia) cond h528 Montpelier av Byrd Clayton (Lilia) car repr hll2 Rutherford av Byrd Clyde F printer rl44 Williams Byrd Dock (Lonnie) lab h7. Bay Byrd Eduard D (Jennie) slsmn Singer Sewing Mach Co h Lake (Bellevue) Byrd Ellice nurse hll4 Collins la Byrd Elsie rll2 Rutherford av Byrd Essie sten rl33 Maynard Byrd Fannie Indrs rl008 Main Byrd Ferdinand E (Carrie) formn hll7 Yates av (EM) Byrd Florence cook h223 Jordans al Byrd Foy A student r528 Montpelier av Byrd Helen phone opr r224 (300) Reid Byrd Henry (Josephine) lab hl56 Bay Byrd Hiram B (Bessie) mach h301 Main (EM) Byrd H Paul (Nora) car repr h Grand av (Bellevue) Byrd Ida r718 3d Byrd Ida Indrs r505 (192) Lexington av Byrd Jennie Mrs gro Lake (B) h do Byrd John driver r763 Cherry Byrd John lab r505 (192) Lexington av Byrd John lab r528 Middle (EM) Byrd John F (Minnie) carp hl44 Williams Byrd John M (Georgia) mill hd r21 Lake City Byrd John W (Ida) trav h877 Orange Byrd Jos (Eliz) lab hl35 Hazel Byrd Julius (Roxie) mech Solomon Motor Co r227 Cedar Byrd Mary (wid Walter C) rll61 Elm Byrd Michl (Ethel) county warden r390 Clinton (EM) Byrd Michigan A (Ida) formn h428 Main (EM) Byrd Milton (Lilly M) firemn r428 Main (EM) .FOR LISTS OF NAMES ANY TRADEA--J, ANY BUSINESS -- ANY PROFESSION DETROIT R. L. lALJIAv & CO. CHICAGO Southern Business College E. L. RAY, President DAY AND NIGHT B65TM6Kz TCHh7EpRRrYV "TSHT.OROUGHNESS"PHONE 3041WHITE for inMfAoCrmONa, tiGoAn. MACON CITY DIRECTORY (1925) 211 Byrd Nelson (Ida) porter h499 (151) Bowman Byrd Oscar (Zellmer) mill hd hl6 Lake City Byrd Richd (Ethel) gro 312 Patterson h do Byrd Robt lab r242 Harris al Byrd Robt (Ada) truck driver h386 Melrose (EM) Byrd Robt T (Mary) car repr hl33 Maynard Byrd Sadie casbr McCommon Bros rl33 Oakland Byrd Sami C (Allice) h224 (300) Reid Byrd Thos butcher r269 White al Byrd Thos millwkr r Edw Byrd Byrd Virginia cashr rl33 Oakland av Byrd Walter C (Gladys) blrmkr hll61 Elm Byrd Wm lab r269 White al Byrom Silas lab h264 Division st la Byrom Wm (Neally) lab h231 Division Byron Ada dom h338 Hammond Byron Albert dom r338 Hammond Byron Cepora dom r338 Hammond Byron Edw (Susie) hlpr h357 Elm Byron Henry L (Emma) ship elk Cudahy Packing Co h306 Hillyer av (A) S Byron Jeff lab r338 Hammond Byron Supora maid r338 Hammond Cabaniss Emory W (Zeta) elk h200 College Cabaniss Lila P r313 Orange CABLE PIANO CO, C R VanSant Mgr, 155 Cotton av, Phone 2231 CADILLAC AUTOMOBILES, Dunlap-Huckabee Auto Co Distributors, 682-690 3d, Phone 5100-5101 Caesar Mattie' lndrs hl04 Smith row Cager Thos J lab r2 Turpin Cagle I Marion (Etta) millwkr h70-71 Davis Cain see also Kane Cain Albert D top trimmer A S Hatcher Co rll6 Park Cai. npAl rth R auto mech S M Solomon jr h203 Duncan av Cain Beatrice hl95 Belmont av Cain Carl G (Reta D) elk Kingman & Everett hll9 Holt Cain Carrie Belle bkpr rl95 Belmont av Cain Chas T (Emmie) track formn r438 Vineville av Cain Charlie M r438 Vineville av Cain Cicero S (Josephine) eng h8 Myrtle (EM) Automobile owners are select prospects tor many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog- contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. 1 LJ O* ^ >* 2 >1 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 212 (1925) R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L Polk & Co. Publishers Cain Cicero S jr plmbr r8 Myrtle (EM) Cain Eug (Beatrice) h824 Edgewood av Cain General (Claudie) switchmn h815 Elbert Cain Hal C elk Am Ry Exp Co r220 1st Cain Hozzie B meat ctr rl95 Belmont av Cain Lucile h749 Ash Cain Mae' rl95 Belmont av Cain Robt (Rosa) r817 New Cain Robt L (Jessie) formn A S Hatcher Co hll6 Park pi Cain Robt L jr top trimmer A S Hatcher Co rll6 Park Pi Cain Rose M Mrs sten R S Thorpe & Sons r817 New Cain Ruth student r438 Vineville Av Cain Wm (Minnie) lab h222 Whitelock Cain Wm M sergt in charge USA Recruiting Station r715 2d av Calahan Geo (Viola) lab h503)/2 East 1st (EM) Calaway John W (Annie) elk Mansfield Dray Line Co hl34 Napier av Caldwell Chas B (Helen) h310 College Caldwell Eva Indrs h633 Peeble Caldwell Frank B barber Haverfield Smith & Wood h 252 Washington av Caldwell Harlon T elk E T Parker r418 Calhoun Caldwell Jas L (Mary) gro 35 Bellevue rd r do Caldwell Julian baler rll9 Pio Nono av Caldwell Kittie' (wid Andrew) rll9 Pio Nono av Caldwell Lora Mrs opr The Wm Carter Co hl020 Hazel Caldwell R Frank (Sulinda) contr h.2129 Broadway Caldwell Sami C (Lora) wtchmn hl020 Hazel Caldwell Sarah Indrs h608 Hammond Caldwell Wm lab rl02 Massee' la Caldwell W Jeff mach opr h733 Hawthorne CALEDONIA INSURANCE CO OF SCOTLAND, John E Wilson Agent, 207 Citizens & Southern Bank Bldg, Phone 214 Calhoun Annie M dom r333 Bowman Calhoun Appleton wtchmn hl402y2 Broadway Calhoun Beatrice r606 (321) Charles (SM) Calhoun Belle cook hl052 Watson al Calhoun Berry r764 Ash Calhoun Bertha cook r666 Napier av 536 S. Clark St. Chicago, 111. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 213 Calhoun Chas porter Stewart Oil Co Calhoun Clifford firemn r358 Ash Calhoun Earlie (Ella) blrmkr hlpr h992 Columbus rd Calhoun Eddie gro h802 Waterville rd Calhoun Edna rll3 Plant Calhoun Edw rll3 Plant Calhoun Edw (Janie) attdt r236 Orange Calhoun Emma (wid Jack) hll3 Plant Calhoun Emory (Frankie) lab rll7 Williams la Calhoun Eug (Bertha) hl29 Adams Calhoun Florrie tchr rl018 Main Calhoun Geo (Ida) lab h414 Curd (SM) Calhoun Hollis (Gustava) flagmn r513 Ridge av Calhoun Horace lab r447 Gilmore CALHOUN HORACE C (Anne; Calhoun & Thomas), h743 Ridge av, Phone 3173-J Calhoun Irene Indrs r333 Bowman Calhoun Jennie Indrs h5 Parker av Calhoun Jessie (Ozie) lab h922 Atlantic av YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Calhoun John (Mary) mill opr hi Bellevue rd Calhoun John C farmer h3145 Houston av Calhoun John C jr student r3145 Houston av Calhoun John M (Mary) mill wkr hl-2 Payne av Calhoun Josephine cook h310 Madison Calhoun J G r Y M C A Calhoun Lonnie D (Cora) firemn h306 Woolfolk Calhoun Lula maid r310 Madison Calhoun Lymon h764 Ash Calhoun L B student r440 New Calhoun Obie D (Louise) electn r318 New Calhoun Ralph B appr r3145 Houston av Calhoun Richmond (Julia) lab hl018 Main Calhoun Sallie' Indrs h606 (321) Charles (SM) Calhoun Sarah R (wid Geo E) sten hl29 Culver Calhoun Sim r234 Waterville rd Calhoun Thomie student r248 Plum Calhoun Walter (Sally) lab h333 Bowman A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 214 (1925) R. L. POLK & CO.'S Calhoun Wm (Bell) lab h321 Morris CALHOUN & THOMAS (Horace C Calhoun, Robert 0 Thomas), Real Estate, Insurance and Mortgage Loans, Building Homes a Specialty 569% Cherry, Phone 2391 (See right top lines and page 81) Califf Eleanor rl37 (121) Mutual av Califf Gussie rl37 (121) Mutual av Califf Louise (wid Taylor) hl37 (121) Mutual av Califf Washington deliverynm rl37 (121) Mutual av Calill Relford barber American Barber Shop r Haddock Ga Callaghan Eliz r821 New Callaghan Martin J (Mamie) slsmn h821 New Callahan Durham lab hl05 Elm Callahan Leonard (Winnie) auto mech r6 Harris al Callaway Beatrice lndrs r216 Jefferson Callaway Clark lab r240 Ellis av Callaway Claud N (Nimie) lmbr inspr hlOO 1st av (C P) Callaway Eliz sten rl47 (115) Vineville av Callaway Ida lndrs r260 2d av (V) Callaway Ivory (Louise) swtchmn h715 3d av (V) Callaway Mary H student rll2 Clayton Callaway Max student rl605 Forsyth rd (V) Callaway Moses porter Reis & Armstrong r421 Ward Callaway Nannie toll supvr Sou Bell Tel Co r202 Newberg av Callaway Robt correspondent Coml Credit Co r Mrs Lula Pattillo . Callaway Timothy F Rev (Lula) evangelist hll2 Clayton , , , Callaway Wm A (Ida) formn hl605 Forsyth rd (V) Callender John H (Bertie G) mgr B S Person Inc r Southern Hotel Callianos Peter A (Stella) restr 310 2d h340 Duncan Callihan Rosa M r208 Pear (EM) Calloway Alice cook r259 Curd (Unionville) Calloway Annie h539 (707) Vineville av Calloway Handy truck driver r926 (870) Columbus rd Calloway Henry (Leila) sheet metal wkr h926 (870) Columbus rd . Calloway Jason (Emma) lab r259 Curd (Unionville) Calloway John (Malissa) draymn h2 Cedar (Union- ville) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth* CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St, Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 215 Calloway John (Madrid) lab r311 Division Calloway Jos (Annie) waiter h854 Ocmulgee Calloway Julia cook rl70 Roye Calloway Minnie maid r2 Cedar (Unionville) Calloway Sami (Eunice) r228 Cedar (Unionville) Calloway Wm H Rev (Nancy) pastor circuit h 5th av (Bellvue) Gaily Harry (Jennie) prop Harry's Cafe hl61 Cotton av Calvert Mortgage Co S E Patton rep 565 Mulberry Calvin Flemming r Lula Calvin Calvin Lula (wid Joe) cook h Bartletts la The most comprehen- Calvin Printist ice wagon r Lula Calvin sive refer- Cameriero Nicholas (Frances) gro 418 Mulberry h401 ence work Walnut Cameron Alex B slsmn The Hanover Shoe r220 1st Cameron Chas L (Gladys) pntr h338y2 Main (EM) Camp Clyde H (Inez) formn hl58 Huguenin av on the banks of the world Camp Daisy r962 Oglethorpe Camp Ethel r962 Oglethorpe Camp Geo W (Sarah E) h962 Oglethorpe Camp Jas A (Ora) carp r962 Oglethorpe Camp Mack knitter r962 Oglethorpe Contains Condensed Statements of AH Banks, Campbell Addie' dom rl52 Thomas Lists of Campbell Albert (Addie) blrmkr hl724 2d Officers of Campbell Alex lab hl52 Thomas All Banks, Campbell Alma nurse Macon Hosp Digest of Campbell Aubert V (Alice) ry transfer elk r2 Macon State Banking av Campbell Belle housekpr Ga Academy for the Blind r Laws and Muck do Other Data Campbell Benj H (Mary L) h2177 2d Campbell Carrie (wid John T) hl28 Grady Campbell Chas cabtmkr Macon Lmbr & Mf- Co CAMPBELL CHARLES H (Kate), Snpt Independent related to Banking Price $20 Laundry Co, lil02 Kemper av, Phone 2717-W Campbell Chas H student rl02 Kemper av Campbell Chas R (Della) storekpr hl74 Cedar (SM) Campbell C Belvin (Mollie) air hammer h614 Tel- Published semi- annually fair Campbell Edw (Josephine) brklyr h68 (102) Forest civ (V) Campbeil Enoch B (Josephine) inspr Macon Water Wks hl28 Highland av MABOH and SEPTEMBER by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy B. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Udg. I Detroit, Mich. I .. / A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit 216 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Campbell Enoch W (Bivie) grading contr h501 Mikado Campbell Essie lndrs r754 Center Campbell Etta elk Taylor Furn Co r415 Elm Campbell Evelyn Mrs tchr Ga-Ala Business College r Vineville av Campbell Fannie maid r624 Flanders (EM) Campbell Geo (Martha) lab h321 North Campbell Harvey L overseer r301 Mikado Campbell Henry rll3 Main (Stinsonville) Campbell Ida rl3 Dannenberg av Campbell Isaac J (Emma) truck driver r501 Mikado Campbell John (Ruby) millhd h2 Ford la Campbell John (Cleo) porter h237 Middle V Campbell Kath dormitory matron Appleton Church Home' r do Campbell Lewis (Lizzie) lab h800 Maynard Campbell Loy L (Ethel) bill elk rl31 Ells (SM) Campbell Lucile student rl74 Cedar (SM) Campbell Margarette (wid M W) r2 Macon av Campbell Mary matron Oglethorpe' Private Infirmary r204 Tatnall Campbell Mattie mill opr r231 Flanders Campbell Maud tchr r225 Chestnut Campbell Mildred student rl02 Kemper av Campbell Milledge (Willie M) car clnr h522 E 2d (E M) Campbell Mollie Mrs gro and meats 614 Telfair h do Campbell Ola dom r428 (1322) Steins al Campbell Paul porter r800 Maynard Campbell Richd W (Emily) h415 Elm Campbell R Danl C (Evelyn) driver Yellow Cab Co h 1603 Vineville rd (V) Campbell Sami (Janie) soft drinks 235i/2 Middle (V) h do Campbell Susie h624 Flanders (EM) Campbell Wm lab r800 Maynard Campbell Wm (Leslie) lab r560 Smith row Campbell Wm (Annie) lab h428 (1322) Stein s al Campbell Wm (Annie) mech hll5 Garden Campbell Wm H (Lillie May) elk h346 S College Canady Roosevelt (Carrie) lab h505 Prince Canfield Sidney F (May) mech h408 Church CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 - MACON CITY DIRECTORY (1925) 217 Canipelli Frances student rl24 Washington av CANIPELLI VINCENT (Theresa), Maker of Fine Clothes, Imported and Domestic Woolens 320}6 2d, Phone 1130, hl24 Washington, Phone 1360-J (See right side lines and page 84) Canipelli Vincent jr student rl24 Washington Cannida Green (Bessie) farmer h217 Jefferson Cannon see also Kannon Cannon Arth lab r638 Prince Cannon Benj W (Sallie) carp hl922 Broadway Cannon Bessie cook r638 Prince Cannon Bessie spooler rl6 Holt av (NH) Cannon B Hubert (Julia) trainmn Macon Ry & Light Co h2007 Broadway Cannon Chas L (Esther B) store kpr r220 Magnolia Cannon Clara B nurse Macon Hosp Cannon Clarence E (Annie L) pipeftr h2231 2d Cannon Delma r!534 Broadway Trucks and Auto Repairing N. E. PACE Authorized for White Motor Trucks 657-669 THIRD ST. PHONE 4846 Cannon Homer O (Bertha) mach hd Macon Lmbr & Mfg Co hl534 Broadway Cannon Jas P (Lillian) weaver hl6 Holt av (NH) Cannon Jos (Edna) elk Jake's Shoe Store rl525 Broadway CANNON JOSEPH W (Mildred), V-Pres Macon Sav- ings Bank, h220 Magnolia, Phone 5445 Cannon Louis H cotton buyer 608 Broadway r Macon Hotel Cannon Marietta Indrs hl024 College Cannon Martha r415 Hawthorne Cannon Pearl Mrs rl534 Broadway Cannon Pies (Minnie) lab h526 Ross Cannon Quida opr Sou Bell Tel Co r758 2d Cannon Rufus O (Quida) pharm Coleman Pharm r 758 2d Cannon Thos (Susie) opr r605 Main (EM) Cannon Verna M (wid Geo) r Thomas nr Log Cabin dr (LC Hts) 55 i ^ FOR LISTS OF NAMES ANY TRADE ANY BUSINESS - ANY PROFESSION DETROIT R. L. POLK & CO. Chicago Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 218 (1925) R. L. POLK & CO.'S Cannon Wm C (Viola) appr Taylor Iron Works & Supply Co r835 Main (EM) Cannon Wm H (Mazzie) butcher r553 Main (EM) Cantrell Hoke S (Minnie) slsmn h ss Forsyth rd (V) 2 w Riley av Capel Walter (Bessie) gremn h239 (230) 1st av (V) Capitol Hotel Bettina Starr mgr 560 Plum Capitol Theatre Montague Salmon mgr 368 2d Capps Blanche F student r2001 3d Capps Pauline rl924 2d Capps Wm P (Ethel) eng h2001 3d Capton Berry (Nellie) tile wkr r309 Georgia av Caraker Minnie (wid Thos) h352 Pierce av (V) Caraway Rosa (wid Jas) hl706 3d Card Andrew (Fannie) lab h512 Mitchell's la Card Ida nurse rl60 Brief Card Lewis lab r303 Womack Carl Lillie mill wkr rl36 Culver Card Mahaley (wid Rube) cook h402 (258) Kaye "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmgeyAIho,LytuLoYarTpu.nHrrgdouYdFvmeeoo. nlcsraTtasiasthstiaritoicelsne.A,niNasoTtIDtfaHyaEUtodhhuYaSeenrEyagDAletPbRhrrYulyEesgOeigpdgRUiinsnANatok'Lln-s,. Card Mahalia lndrs hi 3 6 Culver Card Pleasant smstrs hl53 Green Card Sally lndrs r602 Fort Hill Card Vennie lndrs h405 Mitchell Cardell Alma opr r59 Clinton Cardell Carrie opr r58 Clinton Cardell Jas msngr P O r401 Walnut Cardell John (Lillie) mill wkr h29 Brigham Cardell Jos B (Virginia) opr r59 Clinton Cardell Mavis opr r59 Clinton Cardell Minnie opr r59 Clinton Cardell Wm, C opr r59 Clinton Carden W F r Y M C A Carlock J Henry (Mattie B) mgr Piggly Wiggly h32 Marion pi Carey see also Cary Carey Effie (wid Chas A) h613 Duncan av Carey Ernest L mech Jones Motor Co r613 Duncan^av R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO | 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 219 Carey Lila slsldy Lee's Dept Store r613 Duncan av Carey Robt elk r634 Duncan av Carey's Hall 451% Cotton av Cargile Edwin S (Lovie) hl03 Lamont Cargile John F (Mattie) tchr hl35 Park pi Cargile Ruth C elk J B Riley Drug Co r Magnolia Hall Cargill Edw S (Louie B) slsmn A Y Rhodes Son h ws Lamont 1 s Log Cahin blvd Cargill Louie B Mrs sten Hatcher & Smith h ws La- mont 1 s Log Cabin blvd Cargle Mary L cook h653 Oglethorpe Cargo John H lab r807 Ellert Carithers Clara (wid Arch) r864 Mulberry Carithers Emma lndrs r300 Penn Carithers Geo W (Sara) trainmn Macon Ry & Light Co hl30 Piedmont av Carling -Thos J (Ella) capitalist h702 Mulberry Carlisle Andy L (Mamie; Carlisle Bros) rl-2 Payne av MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIISNS Carlisle Barnie R stock elk rl65 Virginia av Carlisle Bros (Lewis W and Andy L) garage Forsyth rd (V) Carlisle Essie cook r200 W Boundary Carlisle Joe Y (Maude) slsmn hl65 Virginia av Carlisle Joe Y jr elk C of G R R Co rl65 Virginia av CARLISLE J DOUGLAS, Attorney-at-Law, 417 Georgia Casualty Bldg, Phone 2061, rYICA Carlisle Lewis W (Nellie; Carlisle Bros) h ss Forsyth rd (V) Carlisle Roy M trav A S Hatcher Co rl65 Virginia av Carlisle Ruth stock elk Danneberg Co rl65 Virginia av Carlisle Thos H (Jessie L) mach h518 (519) Montpelier av Carlos Lucy J (wid Wm P) r227 Ross Carlos Wm S (Nora B) mgr check stand h227 Ross Carlyle Henry lab r497 Gilmer Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 220 (1925) R. L. POLK & CO.'S The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of AH Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK Carmichael Ella smstrs ri08 Cabaniss av Carmichael Henry H (Ruby) mgr A & P Tea Co r451 Center Carmichael Janet cashr Union Dry Goods Co rl08 Ca- baniss av Carmichael Jos r2314 2d Carmichael Jos elk rl08 Cabaniss av Carmichael Leonard N (Mary) gro 901 (903) Walnut hl08 Cabaniss av Carmichael L N Mrs slsldy Lee's Dept Store rl08 Cabaniss av CARMICHAEL ROBERT J, Mgr Georgia Grocery, r Massee Apts, College dr Carmichael Wm flagmn rl08 Cabaniss av Carmichael Wm C elk L N Carmichael rl08 Cabaniss Carmichael Wm W (Georgia) mach h ws Parkwood av 4 s Forsyth rd Carnegie David baker r800 Daisy Carner Wm (Lena) lab h310 Hazel Carner Wm jr lab r310 Hazel Carnes Cornelius gro rl32 Holt Carnes Frank (Alberta) pntr h242 Roye Carnes Kath P librarian r576 College Carney Felix A (Blanche) mech h304 Cleveland Carney Jas H (Rowena) ship elk Armour & Co r864 Mulberry Carney Milton F br mgr Sou Loan & Real Est Corp r805 Cherry Carolina Life Ins Co Fred W Solomon mgr 504-5 Grand bldg Caroline Lula maid Central City Hotel r305 Martha (E M) Carpenter Andrew (Stella) lab hll30 Ocmulgee Carpenter B Franklin (Eliz) r2515 2d Carpenter Clyde 0 (Beulah) asst to v-pres Fourth Natl Bank hlOl Laurel av (N H) Carpenter Clyde O jr elk Fourth Natl Bank rlOl Laurel av (N H) Carpenter Grace L nurse r628 Orange Carpenter Marvin Q (Lillie) car inspr h552 Giles Carpenter Minnie L (wid Jas W) hll4 (631) Holt av (N H) Carr Arth F (Anna) baker Am Bakeries Co h308 Jones av &C0. Polk Directory Bldg, f Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vsj % on Savings MACON CITY DIRECTORY (1925) 221 Carr Betsie lndrs hl44 Bowman Carr Buford lab r357 Flanders (E M) Carr Carrie lndrs h806 (116) Cowan Carr David carp rl44 Bowman Carr Don lab r614 Division Carr Doris lndrs r806 (116) Cowan Carr Edgar R (Amonite) mgr Wilson & Co h301 Corbin av Carr Edw mech r614 Division Carr Edw S (Florence) wtchmn h614 Division Carr Emma (wid Thos) r220 Ayers rd Carr Eug (Mabel) baker r308 Jones av Carr Geo M (Riscoe) contr hill Stonewall pi (V) Carr Homer H (Livonia) pntr h Grand av (Bellevue) Carr Jas D (Margt) restr 865 Broadway h525 Ogle- thorpe Carr John L elk City & Sou Bank rl018 Elm Carr Laura (wid Walter L) h Grand av (Bellevue) SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Carr Mabel boxmkr Tomlinson Paper Box Co r308 Jones av Carr Mary spinner r357 Flanders (E M) Carr Rich (Leila) carp h7%- Short (EM) Carr Robt I (Gertrude) baker Am Bakeries Co h256 Hydrola Carr Thos lab r614 Division Carr T Patk pntr r Laura Carr Carr Uuilan V (Pearl) oiler r233 Ayers rd Carr Walter L (Lee A) opr h224 Clinton Carr Wilbur carp r308 Jones av Carrington Louis L (Kath) mgr Sou State Life Ins Co h683 College Carroll Cath E sten Natl Life & Accident Ins Co r210 Buford pi Carroll Chas E (Mattie L) pntr rl336 2d Carroll Cora tchr hl56 4th av (V) Carroll Ella (wid Thos H) rl052 Oglethorpe Carroll Fannie (wid Dr W L) h3, 415 New *"0 > 4 2 Qi *-< More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FOR LISTS OF NAMES ANY TRADE ^ -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 222 (1925) R. L. POLK & CO.'S Carroll Henry (Lora) opr r208 Hydrola Carroll Ira L (Fannie F) trmr J D Shadburn Top Co hl052 Oglethorpe Carroll Jack flagmn rl442 2d Carroll Jefferson D lab hl034V2 Broadway Carroll John J elk A & P Tea Co r210 Buford pi Carroll Jos S (Mattie) carp h458 Hazel Carroll J D (Aline) hardwood flooring r514 Pine Carroll Marie L r210 Buford pi (V) Carroll Mary C rill Capital av Carroll Mattie (wid Bennie) r48-49 Davis Carroll Mattie (wid T Jefferson) rl034!/^ Broadway Carroll Mattie Lou opr The Wm Carter Co r458 Hazel Carroll Michl J mach h210 Buford pi (V) Carroll M Jas bkpr Macon Natl Bank r210 Buford pi Carroll Oviedo r552 Ocmulgee Carroll Patk D elk R W Hurley r210 Buford pi Carroll Pennie carp h363 Clinton Carroll Sami pntr r421 Oak Carroll Sudie (wid Andrew) r760 Cherry Carroll Walter A traffic officer Police Dept r554 1st Carroll Wm P (Althea) hill Capital av Carson Carvel H (Clare S) elk h402 Forest av (V) Carson Dovie cook rl2 Spring Carson Frances cook rl409 Broadway Carson Ida lndrs h230 Ellis av Carson Jas brkmn rl409 Broadway Carson Jas (Eva) carp h303 (304) Spring la Carson Jos porter r230 Ellis av Carstarphen Mamie T (wid Thos J) r727 College Carstarphen Orriff H '(Mary) V-pres Carstarphen Whse Co r Jas L Caldwell Carstarphen Taylor T (Essie) sec-treas Carstarphen Whse Co res Augusta Ga Carstarphen Thos J pres Carstarphen Whse Co res Augusta Ga Carstarphen Warehouse Co T J Carstarphen pres D H Carstarphen v-pres T T Carstarphen sec-treas whol cigars 612 Poplar Carswell see also Carwell Carswell Anderson (Nannie) blrmkr h424 Flanders (EM) Carswell Benj (Mattie) hlpr r297 1st av (V) 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 223 Carswell Carrie (wid Walter C) h207 Washington av Carswell Carrie r314 Elm Carswell Chas (Louise) bellmn r314 4th av (V) Carswell Dessie r480 (226) Bowman Carswell Ellis lab rl36 Middle Carswell Fannie cook r298 Croft la Carswell Franklin L (Minnie) trav r769 Mulberry Carswell Henrietta lndrs hl215 3d Carswell Jas (Maggie) cook r518 New Carswell Jesse lab r480 (226) Bowman Carswell Jim (Julia) rl22 Hill Carswell John lab h.7 Clara (EM) Carswell John G (Gertrude) sis agt Fleischmann Yeast Co rl03 Washington av Carswell John'W (Pauline) br mgr Ga Grocery Co r629 Forsyth Carswell Jos (Minnie) farmer h701 Maynard Carswell Kenneth E (Mary) bkpr Stewart Oil Co r7 Rose pi MACON OPTICAL COMPANY POLK'S Dental Register OF THE UNITED STATES AND CANADA Opticians 468 CHERRY , \ Optometrists PHONE 3213 1925 Carswell Lena M dom r480 (226) Bowman Carswell Lindsey (Clara) uphol hl72 (142) Green Carswell Lucile tchr rll6 Clayton Carswell Mamie L lndrs h434 Hammond Carswell Mattie lndrs hl36 Middle Carswell Minnie Mrs chf elk trainmstr Sou Ry r769 Mulberry Carswell Nathaniel T (Hattie) phys 604 Grand bldg h421 Forest av Carswell Nelson S elk M D & S R R Co r865 Orange Carswell Peyton C (Mary L) trav hll6 Clayton Carswell Ralph pntr hl22 Hill Carswell Rosa rl226 1st Carswell Sallie lndrs h235 Elliott (E M) Carswell Sanders (Mary) porter h250 Ellis av Carswell Stewart (Sarah) trav rllO Buford pi Carswell Webster (Cora) lab h533 Cedar Carswell Wm (Docia) lab h447 Gilmer The Splendid Features of 5ast Editions are retained, with much New, Useful and nteresting lata added. R. 1. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 u 224 (1925) R. L. POLK & CO.'S Carswell W Peyton bkpr Bibb Natl Bank hll6 Clay- ton Carter Alma opr Sou Bell Tel Co r850 2d Carter Andrew (Mary) lab r819 3d o a Carter Andrew J (Lillie) weaver h42 Holt av (NH) Carter Anna Indrs hlO Parker av Carter Annie (wid Mike) r532 Campbell av Carter Augusta B (wid Cbas H) r2 Jordan apts m Carter Beulah Indrs rl09 Edgewood av Carter Booker (Nancie) lab h528 Middle (EM) Carter Charity Indrs hl211 3d Carter Chas (Johnnie W) porter h20 Woodliff Carter Clara (wid Richd) h Robinson rd nr Bond Hi Carter Claude (Louise) lab hl25 Virgins la Carter Cleveland eng r726 Walnut Carter Clifford driver Dixie Ice Cream Co r213 Ellis Carter Curtis rl004 Hazel Carter C C baker Am Bakeries Co rll Holt av Carter David A r361 1st Carter D Roy butcher r406 Ridge av Carter Earl F (Pauline) claim agt h407 Carling av (HH) Carter Edw B (Annie) blrmkr hl28 Concord Carter Eliza millwkr h528 Railroad av Carter Emaline cook h35 Cheatham al Carter Emmie (wid Wm J) h457 New Carter Ernest M driver rl46 Debord Carter Ethel student r213 Ellis av Carter Everett R meat ct A D Sowell r406 Ridge av Carter E Horace (Sallie) h.1004 Hazel Carter Frank (Charlotte) lab hl04 Adams Carter Frank (Minnie) lab h417 Elizabeth Carter Frank W egg candler Armour & Co rl65 2d Carter Fredk W dist mgr Macon News r Ellis Howard rd Carter Geo lab rl Plant al Carter Geo (Fannie) lab h716 Hazel Carter Geo L (Willie) slsmn r323 Jeff Davis Carter Grocie r305 Hanson Carter Hardware & Supply Co Inc Ray Carter pres Durwood Yates v-pes J H Timberlake sec-treas 553-55 Poplar Carter Henry cook r606 New Carter Henry r243 Jackson u u mAuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeactdsqufaorrtCceoarpstya.lfoogr aclolRnkt.ainiLnd.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, uMsrkInCfeoHwr. GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON CITY DIRECTORY (1925) 225 Carter Holland ydmn hll20 College Carter Homer bell boy r221 (2) Hendrix la Carter H Gray (Irvine B) rdmstr hi Jordan apts Carter Inez cook h221 (2) Hendrix la Carter Jas rl25 Virgins la Carter Jas S student rl43 Magnolia Carter Jas W (Sarah) mech hl08 Enterprise Carter Jennie Mrs slsldy Lee's Dept Store r759 Cherry Carter John C (Lola) wtchmn hll Manchester qtrs Carter John H lab h504 Plummer's al Carter John J auto electn r715 Pine Carter John M (Eliz) carp hl07 Lee Carter Kelso (Leotis) firemn r461 New Carter Lawton (Annette) pntr h2 Hendrix al Carter Leonard W (Pearle) teller Fourth Natl Bank hll7 Edna pi Carter Leroy r Adams Bdg House Carter Lizzie r607 Railroad av Carter Louise asst sec-treas Otto Isaacs Harness Co r416 Montpelier av Carter Lucy cigarmkr Cowart Cigar Factory r850 2d Carter Lula rll7 Wyche Carter Mabel Indrs hl29 (133) Forest av Carter Maggie millwkr rll Manchester qtrs Carter Martha cook rl08 Concord Carter Maxie Indrs hlO Harris al Carter Oscar (Bertha) lab h635 Elm al Carter Otis lab r460 (260) Bowman Carter Phoebe Indrs r719 Fort Hill Carter Ray (Lena) pres Carter Hdw & Supply Co h 205 Katherine ct Carter Roscoe (Etta) barber T J Hunt h241 4th av (V) Carter Ruth maid r803 Elbert Carter Sallie r309 Middle (V) Carter Sallie r401 Franklin (SM) Carter Sami L (Eula) slsmn Union Dry Gds Co M43 Magnolia Carter Sion W bkpr Fourth Natl Bank r571 Orange Carter Wm stmftr r457 New Carter Wm C (Carrie) h369 2d av (V) Carter Wm Co The J B Jeffries mgr clo mfrs 423 Plum Carter Zeater Indrs h213 Ellis av Carther Ella cook rl61 Green FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 Dim 226 (1925) R. L. POLK & CO.'S as a CARTHRON GLEN T (Emma), Attorney-at-Law 314 Citizens & Sou Bank Bldg, li452 Cherry av WEI Pin Cartledge Danl N (Cartledge Lmbr Co) 9 Jaques bldg Cartledge Geo W electn Wade & Co r715 Pme Cartledge Jas r620 2d Cartledge' Lamar cement contr 620 2d h do Cartledge Lumber Co (D N Cartledge) 9 Jaques bldg I THE DIRECTORY Carver Chas H (Nell) car repr hl85 Cedar (SM) Carver Clarence (Smithie) lab hl2 Bright Carver Fort (Hattie) porter h341 Maple Carver Gail L tchr Mercer Univ hi, 613 Orange IS THE GREATEST Carvest Edgar C (Willie) gro 620 Hazel h618 do Carvest Green (Annie) draymn h710 Ash Carwell Julian lab rll9 Pio Nono Carwin Basil A tchr h231 3d av (V) MARKET PUCE Cary see also Carey Cary Bessie elk J F Alexander r512 Oak Cary Effie (wid Chas) h613 Duncan av Cary Emory P mgr F B West r406 Napier av IN THE Cary Jas driver r330 3d av (V) Cary Jesse H (Mamie) cond h406 Napier av (NH) WORLD * Every Day in the Year the Directory Tells Where All Kinds Cary John L porter r330 3d av (V) Cary Julia lndrs h330 3d av (V) Cary Leon batterymn r613 Duncan av Cary Lila M elk r613 Duncan av Cary Louise maid r330 3d av (V) Cary Robt student r406 Napier av Cary Robt (Luetta) lab h615 Monroe Case-Fowler Lumber Co H C Fowler pres and treas of Goods and Service Can Be Had * Wm Fowler v-pres H L MacEwen sec Forsyth rd i/2 mi w Pio Nono av Case J D v-pres Case-Fowler Lmbr Co h Rushville Ind The Directory is the Natural Source of Information and is "On the Job* 365 Days Every Year RLPoiKiEo Caserio John gro 251 Washington av h253 do Caserio Leo elk r253 Washington av Caserio Lucretia elk r2 5 3 Washington av Casey John W (Madge) chf dispr C of Ga h611 (590) Hillyer av Casey John W jr r611 (590) Hillyer av Casey Lizzie maid h.702 Hazel Cash Fannie' (wid Benj) hl26 Broad (EM) Cash Frank C (Ethel) tchr r220 Jones Cash Geo (Lucy) porter h302 Curd PUBLBHEDS Cash Sami truck driver rl26 Broad (EM) PolltDirecbryHiDfi , DETROIT MICH- J A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 227 Cash Wm (Mary Lee) lab hl09 Rock Hill la Cash Wm (Ella) porter hl6 Wise av (V) Cash Wm lab hl53 Clara (EM) Caslin Chas (Nora L) pntr h234 Telfair Cason see also Casson CASON CLAUDE S (Loulie), Y-Pres Burden- Smith & Co Inc, hi72 High, Phone 3288 Cason D V asst tchr Mercer Univ Cason Edw B flagmn rl02 Coleman av Cason Edw J (Mamie) slsmn hl02 Coleman av Cason Florence tchr rl02 Coleman av Cason Frank student r220 1st Cason Georgia Mrs slsldy Lee's Dept Store r2831 Houston av Cason Louise student rl02 Coleman av Cason Mose (Leveta) lab h920 Atlantic av (SM) Cason Rosa Mae bkpr Ga Banking Co rl02 Coleman Cass Emmett carp r206 Hartley av (CP) Cass Thos (Mary) carp h206 Hartley av (CP) Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Cassidy Aloysius sten r712 1st C/5 Cassidy Bridget (wid Edw) r658 New n Cassidy Cecilia tchr r712 1st Cassidy Dennis (Maggie) city firemn Fire Dept r237 Washington av Cassidy Dennis (Hannah) restr 601 Broadway h658 P0 m m 1st 2 Cassidy Francis elk r712 1st C/5 Cassidy Jas (Letitia; Blue Front Lunch Room) restr 407 Mulberry h668 1st Cassidy John msngr Bibb Natl Bank r712 1st Cassidy Michl student r658 1st Cassidy Patk J (Mary) elk Dennis Cassidy h712 1st Cassidy Wm J (Cecile; Cassidy Garage) r258 Colum- bus Cassidy's Garage W J Cassidy 401 Mulberry Cassini Columbus student r620 Carling av (HH) Cassini John (Mary) contr h255 Winship DRESS IN STYLE DATS USE YOUR CREDIT 406 THIRD ST. TEL. 3026 o 3 o ujc_cj jjuce d) " < d 13 H eaa g t/> 0 5 2m4 H .S3 - id 31k 1 4ifSI44 Q a< 2 Z C wp h O 2 B Q 53 9W U s IS 3QuE1,3 s oz oz H P ^W X C[i/3]sS^^Cs/3 Hcn c;>/3 Hco s u 5= W^co SH MACON CITY DIRECTORY (1925) 231 00 HEAVY HAULING CENTRAL PHARMACY, B J Balkcom Prop, Drugs, Toilet Articles and Prescriptions 402 Cherry, scu Phones 4446-4447 s> CENTRAL SASH & DOOR CO, W C Marshall Pres, T M Willingham Sec-Treas, Lumber, Sash, Doors and Blinds, Interior Finish, Screens and Mill Work, Waterville rd cor Steele, Phone 5011 (See right side lines and page 74) Chadwick Helen A sten E B Weatherby r3, 415 New Chaffin Morris B (Hardy) barber Flynt & Genone' rll5 Latta pi Chaffin S Thos (Fannie) elk C of G R R Co h477 Blackburn Chailan Chas P (Jeffie) city electn h348 S College Chainey Angeline lab r248 Morgan av (W H) Chainey Eva cook r370 Monroe Chalker B Howard (Thelma) elk Dempsey Hotel rl9 Nevaro flats Chalmers Eliz bkpr A G Rhodes & Son rl21 Beech av Chalmers Israel B (Avey) bkpr rl21 Beech av MOVING CHAMBER OF COMMERCE, P T Anderson Pres, Lincoln McConnell Mgr-Sec, J 0 Cromwell Traffic Mgr, T J Browder Asst Traffic Mgr, D F Bruce Agricultural Agt, 419 Broadway, Phone 1387 Chamberlin Sami (Blanche) r221 Bond Chambers Avner (Anna) pres-mgr Chambers Lmbr Co Inc h210 Clisby Chambers A Iverson (Ernestine) elk Southland Hotel hl05 Edna pi Chambers Cynthia E student r577 Orange Chambers Edw (Mary) meat pdlr r218 American blvd Chambers Edw R meat ctr r218 American blvd Chambers Elmina rl406 Vineville av (V) Chambers Frank hl56 Magnolia Chambers Fred E (Emmeline) real est h577 Orange STORAGE CHAMBERS HUGH HON (Elizabeth), Judge Bibb County Municipal Court, hl406 Yineville av (Y) Chambers Jas J (Julia) supt h465 Napier av Chambers John (Lillie) lab r404 Crisp Chambers J Clarence mgr Rogers Grocery No 177 rll7 2d av Chambers Lillie hl054 Ocmulgee Chambers Lucinda dom h420 Bay ET m Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ctCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, uMsrkInCfeHowr. WoL W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 232 (19251 R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Chambers Lumber Co Inc Avner Chambers pres and mgr Osborn Chambers v-pres W L Fuller supt Vineville Sta 2 w of Linden av Chambers Osborn v-pres Chambers Lmbr Co Inc res Atlanta Ga Chambers Oscar (Mary) trav h213 Buford pi (V) Chambers Sarah r539 (707) Vineville av Chambers Sue rl406 Vineville av (V) Chambers Thos E (Verdie) elk Fourth Natl Bank h 115 Ninadell av Chambers Woodfin C slsmn r218 American blvd Chambers W Ross (Mary) lmbr hl72 North av (NH) Chambers W D wtchmn r217 Broadway .Chambliss Anna P Mrs r426 Calhoun Chambliss Arline slsldy Fashion Shoe' Store rll9 Plant Chambliss Autra eshr Burden Smith & Co rll9 Plant Chambliss Benj Z sten Kenmore Burns Inc r494 Orange Chambliss Christopher E (Annie L) Ibr h552 Pine Chambliss Claude (Alice) porter h217 Elliott (EM) Chambliss, Clifford prsmn r813 Main (EM) Chambliss Earl S chf elk M D & S R R Co r475 Orange Chambliss Gussie L cook r303 (116) Roosevelt (V) Chambliss Helen mach opr r728 Oglethorpe Chambliss Homer C (Lillie) prsmn Macon News h 813 Main (EM) Chambliss Jas tchr r436 Lawton av Chambliss John r3 3d st la Chambliss John W (Sallie T) h401 Bailey av (CH) Chambliss Julia cook r303 (116) Roosevelt (V) Chambliss Loris C solr Macon Credit Guarantee Co r401 Bailey av Chambliss L A Mrs slsldy L F M Store r3041 Houston Chambliss L Green (Lula) carp r216 American blvd Chambliss Mamie Mrs elk r3041 Houston av Chambliss Mary M (wid A C) hl06 Montpelier av Chambliss Martha (wid Z D) r230 Chappell Chambliss Martha millwkr r5 Bear's al Chambliss Mattie C sten Fourth Natl Bank r404 Orange Chambliss Nancy (wid Benj F) r494 Orange Chambliss Oscar L (Maggie) carp hll9 School 536 S. Clark St. Chicago, 111. Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable MACON CITY DIRECTORY (1925) 233 Chambliss Patk D mgr Sou Loan & Real Est Corp r401 Bailey av Chambliss Paul C collr T I Harris & Co r401 Bailey av Chambliss Pearl (wid Edw T) hll9 Plant Chambliss Robt (Ella) lab h488 Virgin Chambliss Ruby nurse r205 Amos Chambliss Sami E prsmn r552 Pine Chambliss T E police rll9 Plant Chambliss Wayne student r813 Main (EM) Chambliss Wm (Lucile) brick mason r229 Cedar (SM) Champion Geo H mech G H Parrish r552 Oak Champion Harroll student r306 Center Champion Irving elk United Barber Supply Co r467 Monroe Champion Isaac N (Beatrice) agt Bankers Health & Life Ins Co h'306 Center Champion J C student r467 Monroe Champion Lonnie (Eliz)) lab r467 Monroe Champion Lucile opr Sou Bell Tel Co r467 Monroe Champion Melton mech r467 Monroe Champion T G flagmn r467 Monroe Chance Albert R (Lillie M) flagmn hll6 Rutherford Chance Annie (wid J F) r757 Poplar Chance Dewitt W (Lula B) cond h402 Cleveland Chance Erin E Mrs slsldy Union Dry Gds Co r763 2d Chance1 Jas E (Ethel) eng hl541 3d Chancellor Alton appr rl37 Cole Chancellor Claudia opr Sou Bell Tel Co r281 Wash- ington av Chancellor Elmore H (Sallie) car repr hlll2 Elm Chancellor Floyd H (Julia) elk Ga Seed Store rl37 Cole Chancellor Jewett plmbr r267 Washington av Chancellor Josie (wid Wm F) rl37 Cole Chancellor J A truck driver Plummers Creamery res R F D 1 Chancellor Lucile r281 Washington av Chancellor Wm A (Mina) appr Roller & Millison r718 Oak Chandler Alva R (Willie' M) sergt Sou Ry System hll04 Vineville av Chandler Beatrice student r2 Albion apts Chandler Carter E chf opr W U Tel Co h!08 Madden 2 P LISTS of names ANY TRADE - ANY BUSINESS - ANY PROFESSION DETROIT R. L.. POLK & CO. CHICAGO 91 o to 3 q aCs>O a- -$ in BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 234 (1925) R. L. POLK & CO.'S Chandler Chas (Addle) genl supt Sou Ry System h2 Albion apts _ , Chandler Cornelius B (Helen) asst mgr Red Star Filling Sta h800 Cherry Chandler Emory lab rll8 Moore la Chandler Helen Mrs sten Jones Park & Johnston r 871 Cherry Chandler Henry H jr (Margt) bkpr Wade & Co hl7 Arlington pi Chandler Ina P rl08 Madden av Chandler Jas E pres Dixie Ice Cream Co res Browns Crossing Ga Chandler Jesse lab rl528 1st Chandler John hrklyr rll3 Forest av (V) Chandler Mamie H Mrs hl7 Arlington pi Chandler Myrtie (wid A D) rl08 Madden av Chandler Robt E r343 Carling av (HH) Chandler Ruben lab rll8 Moore la "A 75c Bottle Makes a Quart" PYORAL the best mouth wash IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lscaTasathtirioicesn. ,riisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Chandler Sami S (Hattie H; Sam S Chandler & Co) hll2 Summit CHANDLER SAM S & CO (Samuel S Chandler), General Insurance 102 Ga Casualty Bldg, Phone 426 Chandler Sol (Emma) brick mason h766 Ocmulgee Chandler Walter (Louisa) lab hll8 Moore la Chandler Walter H (Laura) slsmn Liggett & Myers h564 Boulevard av (NH) Chandler Wm L (Maude) chf dispr C of Ga h722 Na- pier av I Chaney Annie dom hl64 Sycamore Chaney Ella cook r514 Napier av Chaney Henry (Mary) carp h599 Norris N Chaney Homer r599 Norris Chaney Manton (Mamie) waiter hl35 Roosevelt (V) Chaney Maybell lndrs rl60 Virgin Chaney Preston (Johnnie) driver h408 Craft la Chaney Simon barber Budrow Thompson Chaney Thos (Mattie) mtrmn h!60 Virgin 415 Third Phone 5113 FOR LISTS OF MASSES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L- POLK & CO. CHICAGO a ENGLAND 70P THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 235 Chaney Wm (Morsey) gro 303 Forest av (V) h do Chaney Wm A (Zeadean) elk h412 Forest av Chanin Bennett (Ida) gro and meats 770 Hazel h do Chanin Sami (Eva) dry gds 564 Poplar h653 Plum Chaple Delia r522 New Chaplin Arth W (Rosa L) osteo 1012 Ga Casualty bldg h451 Georgia av Chaplin Maude F tchr Wesleyan College r66 Arling- ton pi Chapman Amos lab r340 Tindall av Chapman Annie B cook h602 4th av (U) Chapman Annie C r305 Adams Chapman Bettie (wid Henry) r35 Mellon Chapman Carl F (Vincent) log purchaser Massee- Felton Lmhr Co h301 Hightower Chapman Carrie h315 Norris Chapman Clarence (Elsie) slsmn r313 Forsyth Chapman Clarence L (Alba) frt agt C of G R R Co h506 Hillyer av Your City Directory Answers All Questions as to WHOM You Are Looking For MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Chapman C A mech D M Kessler r419 Mulberry Chapman C L (Martha) acct h5 Barnes apts Chapman Danl (Bessie) taxi driver h324 Ward Chapman Eliz cook r710 Hawthorne Chapman Elsie sten W F Thames r313 Forsyth Chapman General farmer h406 E 1st (EM) Chapman Georgia (wid Robt M) rl021 Clinton rd Chapman Harrie D (Annie C; H D Chapman & Co) h305 Adams Chapman Henry W student r2440 Broadway Chapman Holt (Anne T) prop Chapman's Pharmacy h204 Clisby Chapman Hubert E (Ester) bge elk r246 Jeff Davis Chapman H D Lumber Co (H D Chapman, H M Reid) 708-10 Citizens & Sou Bank bldg Chapman Ida Indrs r232 Powell (EM) Chapman Jackson r403 Croft la Chapman Jas T (Beatrice) formn hl634 3d Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company j LUMBER, SHINGLES, LATH Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 236 (1925) R. L. POLK & CO.'S Chapman John lab r210 Fretwell al Chapman John A (Minnie) carp r317 Morgan av Chapman John A mgr Macon Co-operative Store rl08 Newberg av Chapman Jos hl70 Hazel Chapman Laura rl68 Schofield Chapman Lee M (Luella) h2106 Broadway Chapman LeRoy H (Annie) mgr D M Kessler Garage r260 Washington av Chapman Lewis H mech D M Kessler r419 Mulberry Chapman Lizzie lndrs r rear 356 Spring la Chapman L Howard (Willie) r270 Maple Chapman Martha cook h2 Stewarts la Chapman Misha cook rl62 Cheatham al Chapman Ollie lab r rear 356 Spring la Chapman Pearl lndrs hl68 Schofield Chapman Philip (Mamie) carp h820 Columbus rd Chapman Philip jr elev opr r820 Columbus rd Chapman Robt porter h217 Linden av Chapman Robt tchr Beda Etta College r441 Tindall av Chapman Rosalie cashr L F M Store r2440 Broadway Chapman Sarah hl70 Hazel Chapman S Margt asst librarian r370 College Chapman Walter B (Lillie) formn hl08 Newberg Chapman Wesley C (Georgia) rl28 Williams Chapman Wm (Alma) mill hd hl8 Lake City Chapman Wm porter r820 Columbus rd Chapman Wm H (Liza) pipeftr h2440 Broadway Chapman Wm R (Nannie) mtrmn hl920 2d Chapman Willie Mrs slsldy Union Dry Gds Co r270 Maple Chapman Willie porter X V Clothes Shop r820 Montpelier av CHAPMAN'S PHARMACY, Holt Chapman Prop, Drugs, Etc 574 Mulberry cor 2d, Phones 18601861-1862 Chappell Allen E (Nora A) h ss Forsyth rd (V) 2 w Albemarle pi Chappell Bell lndrs rl22 Phillips la Chappell Cecil C elk Massee-Felton Lmbr Co rl55 2d Chappell Clarence J bkpr r716 Forsyth Chappell Clifton T (Margt) elk Sou Ry System hl55 2d Chappell Essie M cook r!12 Long More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. '`FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY (1925) Chappell Henry lab rll2 Long Chappell Irvin lab h Log Cabin blvd Chappell Isaac H elk G G Hardeman Co r716 For- syth Chappell John (Iona) lab h203 Boundary Chappell Lou E cook r923 Ocmulgee Chappell Mary E student r807 2d Chappell Mattie Indrs h rear 603 4th av (U) Chappell Robt T (Lucy M) mach h807 2d Chappell Rubin (Annie M) lab hl4 Clara (EM) Chappell Sam (Bessie) plstr h4 Mitchells la Chappell Sarah rl315 1st Chappell Sherwood S mfg jwlr 410 2d rl55 do Chappell Walter hlpr Dunlap Huckabee Auto Co rl05 Randall av Chappell Willie B lab r203 W Boundary Chappell Willie T (Alma) hlpr r621 Pine Chappell W Allen slsmn r A E Chappell Charles Missouri G Mrs tchr VanHoose School of Music r525 College Charlon Chas linemn City Elec Dept Charlston Eva nurse r243 Jones Chase Dora B Mrs housekpr 702 Mulberry Chason Jas H (Rosa) train dispr h458 New Chastain Jas A shop formn Otto-Isaacs Harness Co r358 Fairview Chatfield Belle (wid John P) h742 College Chatfield J?M TMrarsyhL bum rnaeclhk r518 L W R<5o1g9e)rsMCoonrt7p4e2lieCroallvege Chatfield Pearl H r742 College Chatham Mutual Life & Health Insurance Co J H Minor mgr 556 New Chatman Albert B (Ada) hlO Holt av (NH) Chatman Ida M r204 Pear (EM) Chatman Julia dom h227 Hendrix al Cheatham Arch (May) U S N recruiting officer r754 Cherry Cheatham Clement A (Sadie) mgr Triangle Service Co res R F D 1 Cheatham C A (Margt) collr Federal Clo Store r976 Walnut Cheatham Fannie' dom h.334 Hammond Cheatham Guy C (Margie) prop North Side Filling Sta o r207 Forsyth FOR LISTS OF NAMES 4A Y TRADE ANY BUSINESS -- ANY PROFESSION [DETROIT II. L. POLK & CO. CHICAGO V) 2. sf-SS Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 238 (1925) R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Cheatham Iola (wid Wm) h21 (1421) Lawton av Cheatham J C (Margt) r976 Walnut Cheatham Oscar (Schelly) firemn h477 Chestnut Cheatham Rufus S (Bertie M) lino opr Macon News h341 S College Cheatham Rufus S (Grace) interior decorator hll3 Ponce de Leon av Cheatham Russell C jr (Melissa) mgr Fidelity Mutual Life Ins Co h ws Parkwood av 2 s Forsyth Cheatham Thos A (Mattie P) h212 Washington av Cheatham Walter L (Shirley) v-pres hl37 North av (NH) Cheek Aldine L slsmn W R Finch Motor Co rl97 Oakland av Cheek Jas E (Rena) h216 College. Cheek Paul B collr r Hotel Arcadia Cheese Andrew (Viola) lab hll7 Telfair Cheeves see also Cheves Cheeves Albert (Leila) uphol h209 Woodliff Cheeves Anderson student r209 Woodliff Cheeves Robt carp hl32 Log Cabin dr Cheley Susie cook r230 Ellis av Cheney Chas B (Beatrice) tel opr h459 Carling av (HH) Cheney Jas (Ella) lab h720 Hawthorne Cheney John J (Georgia) lino opr h526 Montpelier av Cheney Julius P (Renea) elk r501 Carling av (HH) Cheney Simon Rev barber r421 2d (EM) Cherokee Baptist Church Rev J H Barber pastor ws Courtland av 1 s Napier av Cherokee Brick Co S T Coleman pres W E Dunwoody v-pres-sec-treas Waterville rd % mi s S Ry Shops Cherokee Filling Station (W E and H W Dozier) 113 Napier av Cherokee Heights Methodist Church Rev L A Harrell pastor 670 Napier av Cherokee Pharmacy C F Dye mgr 701 Columbus rd Cherry Andrew J (Mary J) hl331 Broadway Cherry Beauty Shoppe Mrs Rose M Bradford 506 Cherry Cherry Boyce H (Susie) slsmn Central Ga Baking Co rl811 3d Cherry Brigham appr rl331 Broadway Cherry Chas pntr hl539 1st 536 S. Clark St. Chicago, 111. E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS -TRACTORS JONES MOTOR COMPANY hIffoarrIet'asit.aFoFrodr,d woer PHONE 1591 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 239 Cherry Dock lab hlO Gas House al Cherry Georgia (wid T M) r776 Walnut Cherry Hat Shoppe Mrs Rose M Bradford mgr 506 Cherry Cherry Henry T (Nettie) slsmn Batemn Freeman Co h771 Oak Cherry Irvin lab h234 Johnson's al Cherry John A butcher r421 Calhoun Cherry Joshua (Ruth) mill hd h33 Bibb av Cherry Maude rl331 Broadway Cherry Nannie H sten Jackson Wynn Co r557 1st Cherry Sami J butcher r421 Calhoun Cherry Wm (Mattie) lab h704 Hazel Cherry Wm F (Grace) pipeftr rl331 Broadway Cherry Wm H slsmn r214 Crescent av Cherrydale Apartments 818 Cherry Cheshire Bertha r770 Oglethorpe Cheshire Danl P (Mary) wtchmn h770 Oglethorpe Cheshire Mae r770 Oglethorpe Cheshire Myrtle r770 Oglethorpe Cheshire Sarah r770 Oglethorpe Chester Alice L Mrs rl025 3d Chester Idus (Mary) hlpr hl207 1st Chester J E mech rl08 Heard Chestney Browne Ruffin (Ruth) chf eng hill Jeffer- son Chestney Piercy M (M Jemison) supt of mails P O h 128 2d Chestney Ruffin sten rill Jefferson Chestney Theo O (Kate) hl22 2d Cheves see' also Cheeves "Cheves Jesse R (Florence) attdt Gulf Refg Co h502 Duncan av Cheves John L (Minnie) contr h307 Center Cheves Jos P sta mgr Gulf Refg Co r307 Center Cheves Mary P (wid Roswell S) h258 College Cheves Robt B (Ida) h Log Cabin dr nr Highland av Chichester Helen L (Jeanett) prop College Hill Pharmacy r304 Corbin av Chichester Kate rll05 Oglethorpe Child Welfare' Council (Maternity Clinic) Giles cor 3d Childers Golden dom r5 Myrtle (EM) Childers Lonnie pntr r5 Myrtle (EM) The most comprehensive reference work on tne banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. , & CO. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 240 (1925) R. L. POLK & CO.'S __ Childers Mattie (wid Chas) h5 Myrtle (EM) Childress M Virginia sten rl35 Park pi Childs Chas C (Mamie) driver G Bernd Co rl04 Smith. (EM) Childs Claudius C (Mamie) bkpr Empire Candy Co rl03 Coleman Childs Cora B mech h242 White Childs Ellie mill hd r34 Bibb av Childs Green (Mabel) lab hl021 Ocmulgee Childs John A (Jewell) trav Standard Brick & Tile Co r438 Carling av (HH) Childs John D (Cordelia) gro 1303 3d h319 Ross Childs Mary (wid J Leon) rl432 3d Childs Ponder F (Lillie W) hl52 Oakland av Childs Sami (Roady) farmer h897 (979) Maynard Childs Symore (Sadie) lab hl72 Collins la Childs Thos J h204 Williams Childs Wilburn R (Ella) hll5 Nelson CHILDS WYATT B (Lillian), Orthodontist 704 Ha Casualty Bldg, Phone 4841, hlOO Corhin ar, Phone 4690 Chiles Benj F rll5 Nelson Chiles Georgie (wid Henry) h334 Dempsey av Chiles Lloyd firemn r514 Pine Chiles Mack S (Clem) cond hl02 Daisy Pk Chiles Sankey Q (wid Sami) bdg 821 Mulberry h do Chilious Edgar lab r701 Norris Chilious Lewis (Carrie) porter h701 Norris Chilious Robt chauf r701 Norris Chilious Wm L lab r701 Norris Chillers Walker lab r701 Maynard Chirbar Chas (Hattie; Phila Hat Clng'Co) hl24 Academy Chism David (Eva) mech h224i/2 Powell (EM) Choats Essie M cook r411 Thompsons al Choats Inez cook r411 Thmpson's al Choney John (Mary) farmer h Burton av Christ Church Parish House 211 3d Christ Episcopal Church Rev O J Hart rector 520 Walnut Christian Alma Mrs priv sec Mercer Univ res Oglesby Pi Christian Bertha cook r955 Hazel Christian Bertha Mrs elk r3800 Houston av Cl AmtCceouaarpsttnyaoy.lfmookgoribnacidlloelsRnkot.iaofnLiwndm.snsPeeorOmrcsfLhuAKacahnu. rdt&eovismaeClso.uOeba.li,beSleclDeetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtsMsrkqInuCffeaooHwrrr-. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE MACON CITY DIRECTORY (1925) 241 Christian Curtis T (Leila) drug elk h3303 Houston av Christian C Terry student r3303 Houston av Christian Daisy I r321 (327) Reid Christian Ella M (wid J B) h326 (327) Reid Christian Genie (wid F R) gro 308 Pio Nono av h do Christian Helen cook rl04 Empire av Christian Howard R mgr S H Kress & Co Christian Jos G jr multi opr Fourth Natl Bank r YM CA Christian Mamie slsldy Union Dry Gds Co r401 Fort Hill Christian Percy elk Dixie Cafe & Commissary r Church (EM) Christian Pharmacy J H Settle' 1444 Broadway Christian R M rl07 9th av Christian Sami P (Alma) agt Interstate Life & Acc Ins Co hl06 Church (EM) Christian Sami P jr elk rl06 Church (EM) Christian Science Reading Room Laura Mvers lib 410 Grand bldg Christian Sollie B r321 (327) Reid Christian Wm J student r321 (317) Reid Christie Wm A (Sarah) mill hd rl08 Gant Christophulos Helen r766 Poplar Christophulos Nicholas (Ella) pres U-Eat-A-Lunch Corp genl mgr Melts Sanitary Baking Co h766 Poplar Church of the Living God Rev Jas Bivins pastor 675 Jordan Church of the Redeemer Rev L W Strickler pastor 723 Holt av (NH) Churchill Bernice' student r401 Duncan av Churchill Ella (wid Robt L) h401 Duncan av Churchill John R (Fannie) formn h304 Jones av Churchwell Daisy L (Katie; Gillon & Churchwell) h515 Vineville av Churchwell Edith sten r702 Broad Chute A emp Massee-Felton Lmbr Co r860 2d Cismoski Val slsmn Edgar Morgan Co r304 Bond CITIZENS INSURANCE CO OF MISSOURI, Morgan & Morgan Insurance Agency Agts, 606 Georgia Casualty Bldg, Phone 4147 DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 Dim 242 (1925) R. L. POLK & CO.'S as a CITIZENS & SOUTHERN BANK THE, M B Lane Pres, G B Clarke and E C Scott Y-Prests, A E MMLT Bird Jr Cashr, J H Lucas Asst Caslir, J F Brown Jr Asst to Y-Pres, 3d se cor Cherry, Phone 4671 PLACE THE DIRECTORY (See front coyer and page 54) Citizens & Southern Bank Building 461 Cherry CITIZENS & SOUTHERN CO, J F Brown Jr Res Mgr, Investment Securities 366-870 3d, Phone 4671 City Auditorium 712 Cherry CITY BOARD OF WATER COMMISSIONERS, J L Anderson Chairman, R E Findlay Sec-Treas, W IS THE H Shepard Supt, City Hall CITY BUILDING INSPECTOR, W J Beeland City GREATEST Hall CITY CLERK, David S Jones, City Hall MARKET PLACE CITY COUNCIL CHAMBER, City Hall City Court R C Jordan judge Court House CITY DIRECTORY CO, Publishers 431 Howard, De- troit, Mich, Library Chamber of Commerce IN THE CITY ELECTRICAL ENGINEER, C H Humphreys, City Hall ,. , WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had > * CITY ELECTRICAL INSPECTOR, G P Rankin Jr, City Hall CITY ENGINEER, E L Gostin, City Hall CITY EIRE DEPARTMENT, See Fire Department CITY HALL, Poplar bet Cotton av and 1st City Health Department Dr C L Ridley health officer City Hall City Investment Co J Clay Murphy pres real est 470 Cherry CITY LICENSE INSPECTOR, D C Glendennmg, City Hall City Market Poplar bet 1st and 2d The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year CITY MARSHALL, W P Gaillard, City Hall CITY MAYOR, Hon Luther Williams, City Hall CITY PLAY GROUND SUPERINTENDENT, Gnssie Riley, City Hall CITY POLICE DEPARTMENT, See Police Dept CITY PURCHASING AGENT, D S Jones City Hall CITY REALTY CO, S E Patton Pres, W C Watts Sec, Real Estate, Rentals, Insurance 565 Mulberry, Phones 1561-1562 (See page 81) CITY RECORDERS COURT, Y M Lane Recorder, Paul Stanfield Clerk, City Hall More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUH MOTTO: '`THOROUGHNESS" WRITE FOR INFORMATION 656!/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 243 City Refuse Dump J A Mettes fomn se cor Poplar and 9th CITY SCAVENGER DEPARTMENT, J F Holley Supt, Poplar at 9th City Stables J L Dent foremn se cor Poplar and 9th City Stockade W R Rogers formn se cor Poplar and 9th CJTY STREET SWEEPING DEPARTMENT, J F Holley Supt, Poplar at 9th CITY TAX ASSESSORS, E B Harrold Chairman, Morris Harris, W J Beeland Assessors, City Hall CITY TREASURER, Osgood Clark, City Hall City Weighing & Inspection Office G P Alexander mgr 3d and Oglethorpe Clance Carol plmbr rl800 3d Clance Ethel smstrs rl800 3d Clance Eunice elk McLellan Stores Co r2011 Broad- way Clance Jas M (Thelma) slsmn R S Thorpe & Sons h 120 Inverness av Clance John T (Annie) detective Police Dept h815 Main (EM) Clance Missouri S (wid Wm C) hl800 3d Clance Robt L (I J) Indrymn r815 Main (EM) Clance Rufus W rl800 3d Clapp Dorland L wtchmkr Matthews Jwlry Co rl33 Oakland av Clare Mackie J (wid Wm) h Forest Hill av Clarence Allice cook h496 Hill Crest av Clarence Jas r496 Hill Crest av Clarence Mary maid r496 Hill Crest av Clarice Wm A (Effie) carp h215 Applewood Clark Abbie opr Sou Bell Tel Co 317 Cleveland Clark Alice cook r224 Woodliff Clark Amanda lndrs h315 Burnett (EM) Clark Andrew slsmn Lowry & Lowry r76 Arlington pi Clark Annie tchr r215 Spring Clark Augustus H (Thos J) cond hl07 Hill Crest av (CH) Clark Augustus H J mech rl07 Hill Crest av (CH) Clark Badie T student r266 Columbus Clark Beal rl48 Elizabeth Clark Berry (Druie) switchtndr h35 Woodliff Clary Calprey bkpr r863 Cherry Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 244 (1925) R. L. POLK & CO.'S POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Clark Carswell (Lillie) lab h509 (312) Charles (SM) Clark Charlie C (Fronnie)) lab h422 Long Clark Chester rl40 (143) 1st av (V) Clark Cliff (Ella) bkpr hl85 Hendley Clark Edgar (Ophelia) lab hl21 Edgewood av Clark Eleanor student r613 Johnson av Clark Eleanor A student rll4 (194) Buckingham pi Clark Eliz sec Junior Chamber of Com r613 Johnson av Clark Ellen (wid Joe) h332 Waterville rd Clark Emma A (wid Herschel V) h759 Poplar Clark Emmett E (Lillie) slsmn Johnson Bros h Li- zella rd Clark Ernest (Sallie) lab Cherokee Brick Co h5 Dempsey av Clark Ethel nurse R L Cater jr res Monroe Hill Clark Etta lndrs h412 Gilmer Clark Etta A (wid Joa) rl25 Washington av Clark Erwin steward rl48 Elizabeth Clark Eva cook r332 Waterville rd Clark Geo (Lillie May) lab h418 Hammond Clark Geo (Manda) lab h227 Hendrix la Clark Harry (Ruth) mach Fuller's Garage hl02 Heard Clark Harry E lab r75 Schofield Clark Harvey lab r75 Schofield Clark Henry V (Reba) bkpr Sou States Fertilizer Co h 117 Ninadell dr The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. Clark H Edwin (Hattie) cond hll8 Ponce de Leon av Clark Jas (Sophie) driver hl48 Elizabeth Clark Jas lab r332 Waterville rd Clark Jas D (Mollie) lmbr buyer h215 1st Clark Jerome C presser Fred Sanders r854 Foster's al Clark Jesse B mgr W T Tharpe hl4 Nevaro apts Clark Johnnie mill wkr r271 Tindall av Clark Jos h76 Arlington pi Clark Laura sten rll4 (194) Buckingham pi Clark Leila A agt Bagley Willett & Paine r76 Ar- lington pi R. L. Polk Clark Lena cook h rear 611 4th av (U) Clark Leon P (Laura) solr Crescent Laundry Co h816 New Clark Lester C (Hattie) blksmith hl25 Tenney & Go. Publishers Clark Lillie rll51 Napier av Clark Lillie maid r75 Schofield 536 S. Clark St. Chicago, III. I FOR LISTS OF NAMES ANa Y TRADE -- ANY BUSINESS -- ANY PROFESSIO( N DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY _ MACON CITY DIRECTORY (1925) 245 Clark Lou cook G G Hardeman r75 Schofield Clark Lucy r657i/2 Plum Clark Lula cook h75 Schofield Clark Lulu Mrs opr h654 Hawthorne Clark Lyander D (Lillian) r560 Plum Clark Madison A (Eliza) plmbr h209 4th av (V) CLARK MALLIE A (Irma M), Physician, Hours 12 to 1:30 and 4:30 to 6, 805-806 Georgia Casualty Bldg, Phone 496, h301 Hardeman ay, Phone 902 Clark Marrell mach r654 Hawthorne Clark Mary Indrs r805 (115) Cowan Clark Milam inspr Macon News r266 Columbus Clark M Radley dept mgr L K Liggett Co r266 Colum- bus Clark Nancy hl06 (7) Richard Clark Neva E (wid Jesse S) rl4 Nevaro apts Clark Odessa Indrs hll2 Magnolia la Clark Oscar collr Sou Investment Co r201 Hendley Clark Osgood (Ida S) treas hll4 (194) Buckingham Pi YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Clark Osgood jr student rll4 (194) Buckingham pi C ark Overton P (Stella) h Log Cabin Hts Clark Patrick formn W S Dickey Clay Mfg Co r726 Pine Clark Perry (Lizzie) truck driver hl019 Elbert Clark Perry jr rl019 Elbert Clark Ralph B (Clara) h613 Johnson av Clark Robt (Frances) chauf h392 2d av V Clark Robert (Grace) lab hlOO Telfair Clar^B0bt Rev (Estella) pastor h411 Peachtree (E Clark Robt jr meat ctr Enterprise Packing Co r411 Peachtree (EM) CLARK ROBERT E (Margt E), Ornamental Cement W*i?d"owBSoilrlesh,anLdawBnoxeasnd11C50emNeatepriyerAadvoRrnmF eDnts2,, h do, Phone 3844-W (See page 57) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit cn MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 246 (1925) R. L. POLK & CO.'S Clark Robt L (Mary) hardwood dir h202 Montpelier av Clark Roht L lab rl07 Moore la Clark Robt W (Christine) chief elk Willingham Sash & Door Co h358 Spring Clark Rose sten r215 Spring Clark Ruel lab r430 Cowan Clark Ruth tchr r76 Arlington pi Clark Sallie r437 Middle (EM) Clark Seth E (Dora) trainmn Macon Ry & Light Co h 266 Columbus Clark Thos D sten rl07 Hill Crest av (CH) Clark Walter B (Effie' Mae) constr formn h711 Adams CLARK WALTER F (Minnie L), Mgr Shoe Dept Herbert Smart Clothing Co, rl09 Appleton Clark Wendell H dist mgr Macon News r266 Columbus Clark Wilburn lab r255 Elliott (EM) Clark Wm E mech W B Brooks r217 3d Clark Wm L lab rl07 Moore la Clark Willie r332 Waterville rd Clark Winnie rl35 Adams Clarke Alice r512 Walnut Clarke Clifford E (Ella) chf elk Sou Ry hl85 Hend- ley (NH) Clarke Etta slsldy J P Allen & Co rl25 Washington av Clarke Eug O tchr r517 Georgia av Clarke' Florida rl09 Appleton CLARKE GEORGE B, Y-Pres Citizens & Southern Bank, r411 College Clarke G Clisby (Erin; Macon Bearing & Parts Co) h 211 Clayton (V) Clark Harry H (Lena) mech hl7 Nevaro apts Clark Henry D (Mary) trainmn Macon Ry & Light Co h2036 2d Clarke Ida M r509 (312) Charles (SM) Clarke Jesse lab r360 Oak Clarke John lab r509 (312) Charles (SM) Clarke Lena Mrs sten W T Grant Co rl7- Nevaro apts Clarke Leonard D (Ida) city firemn h766 New Clarke Lewis r611-15 2d Clarke L Milan student r266 Columbus Clarke Mary lndrs hl55 Bright al Clarke Maybelle lndrs Gee Yin r967 Qcmulgee A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & GO.. Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 247 Clarke Milledge A auto livery 453 2d h301 Hardman av CLARKE MILTOlf H, Embalmer Louis H Burgliard 718 Cherry e Clarke Nancy (wid Danl S) rl421 2d Clarke Paul V (Mable) whsemn Birdsey Flour Mills r 1541 2d Clarke Rose elk Cit & Sou Bank r215 Spring Clarke R O mech Dunlap-Huckabee Auto Co r905 Cherry Clarke Sarah C (wid Anderson Q) r427 Forsyth Clarke Thos lab rl55 Bright al Clarke Walter F (Minnie L) slsmn Herbert Smart hi 09 Appleton av Clarke Wm E (Willie B) slsmn Texas Co h2023 2d Clarke Windall H student r266 Columbus Claud Mollie r207 Rogers av Clay Alberta r561 Monroe Clay Alex collr E T Napier rl030 Clinton rd Clay Arth (Lucy) lab h402 (521) Colquitt Clay Berry Rev (Alberta) pastor h561 Monroe Clay Calder B (Emma S) treas Cotton States Ferti- lizer Co pres General Sprayer Co r365 Cherokee av Clay Carrie (wid Alonzo) hll3 (175) Bell av Clay Edw (Ella) shade mkr Union Dry Goods Co res RD 5 Clay Elmo electn rl030 Clinton rd Clay Elnore student r583 Boulevard (NH) Clay Emory J phys 567 Walnut r do Clay Geo carp r305 Forsyth Clay Haley student r305 Forsyth Clay Henry gro 546 3d av (V) r Monroe Hill Clay Henry (Ardalia) icemn h318 Maple Clay Jacob P (Alene) mech Yates Motor Co h503 Bailey av Clay Jas O r561 Monroe Clay Jennie (wid Mallie) h Bartletts la Clay Jennings student rl030 Clinton rd Clay John elk A S Hatcher Co rl030 Clinton rd Clay Jos elk F A Guttenberger rl030 Clinton rd Clay Julian carp r305 Forsyth Clay J Emory phys r365 Cherokee av Clay Lamar (Sami E) farmer h!030 Clinton rd "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth " Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Dists. Our new Catalog contains muck valuable data. Ask for a copy R, L. POI.K & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 248 (1925) R. L. POLK & CO.'S Clay Lamar jr (Christine) slsmn A S Hatcher Co r 1130 Clinton rd Clay Levey (Mary) lab h706 Elbert (SM) Clay Mary sten rl030 Clinton rd Clay Nicholas H (Georgia) carp h305 Forsyth Clay Robt draymn h Industrial Home rd Clary Ruby M slsldy J P Allen & Co r305 Forsyth Clay Valeria (wid Jennings) h583 Boulevard (NH) CLAY WALTER R (Margaret), Sec-Treas Builders Lumber Co, h cor Parkwood av, Forsyth Road, Phone 1066-J Clay Wm blrmkr r305 Forsyth Clay Wm (Sarah) section wkr h Bailey Crossing Clay Zettler C (Alva) ins agt h284 1st av (V) Clayborn Camilla (wid Fate) h301 Nusbaum Clayhorn Carrie lndrs hl5 Bay Clayborn Julia lndrs r560 Broad Clayborn Sami lab rl5 Bay Clayton Agnes lab hl3 Turpin la Clayton Beulah maid r302 Tindall av Clayton Emanuel (Katie) cold drinks 531 Campbell av h do Clayton Gertrude lndrs h5 Alabama Clayton Hattie cook h408 Monroe Clayton Manuel (Katie) lab r528 Calhoun Clayton Marie rl09 Hazel Clayton Rosa r314 Elm Clayton Thos (Willie) elk r270 Campbell av Clayton Wm (Bulah) lab h305 Tindall av Clearly Bertha lndrs r555 Singletons la Clemence Jesse C (Mamie) elk Sou Bell Tel Co h765 New Clemence Wm (Evelyn) real est h537 Boulevard (NH) Clemence Willie J (Evelyn P) slsmn City Realty Co r637 Boulevard Clemens Wm (Julia) firemn hl74 College Clements Allen C (Mamie; Clements & Clements) h 207 Beech av Clements Bessie L rl825 Broadway Clements Chas (Daisey) r830 Edgewood av Clements Chas E (Bessie E) solicitor Crescent Lndry Co h40 S College Clements Delmos F hlpr Jones & Coney rl825 Broad- way R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 15S Bibb County Tax Assessors I C Holt chairmn, W J Heard, J E Bailey BIBB COUNTY TAX COLLECTOR, U T Winslett Collr, Court House, Phone 1089 BIBB COUNTY TAX RECEIVER, D D Dunwody, Court House, Phone 1084 Bibb Grocery Co J W Daniel v-pres-genl mgr F M Daniel sec-treas 306-10 Oglethorpe Bibb Jos (Daisy) lab rl315 1st Bibb Lumber Co R H Hillman mgr 709 Ga Casualty bldg Bibb Mfg Co W D Anderson pres J H Porter v-pres A A Drake jr treas C C Hertwig asst treas Cotton mfrs 235-265 Main (E M) branches 671 Hawthorne and 688 Oglethorpe Bibb Mfg Co Auditorium 66 Clinton Bibb Mfg Co Baseball Park 1 Clinton Bibb Mfg Co Clinic No 1 210 Clinton Bibb Mfg Co Community House 226 (26) Clinton and 706 Oglethorpe Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Bibb Mfg Co Day Nursery No 2, 227 Clinton Bibb Mfg Co Gymnasium 213 Clinton BIBB NATIONAL BANK OF MACON THE, T R Turner Pres, T M Taul Cashier, L F Graddy Asst Cashier, 576 Cherryv Phones 161-162 (See right top lines) Bibb News Co Lena Moran mgr 355 5th Bibb Printing Co (H H Myers, J W Hancock) 258-60 2d Bibb Realty Building see Bibb bldg Bible Harry B (Tennie) elk hllO Charles (SM) Bickens Wm (Mary) lab h236 (232) Lynwood av Biddy Chas P formn r307 Fairmont av Bellevue Biddy Jos L (Mary) track supvr h307 Fairmont av Bellevue Biddy Mary r307 Fairmont av Bellevue Bidez Earl F (Thelma C) div acct C of Ga h215 Clisby FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. TL. POLK & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 154 (1925) R. L. POLK & CO.'S _____ Bigalsky Anna student r220 1st Bigby Fannie (wid Wm T) h802 Mulberry Bigby Felix student r802 Mulberry Bigby Jas (Rosa) lab rlOO Smith (EM) Biggens Mimo (Fannie) lab r227 Elliot (EM) Biggerstaff Edgar C ship elk rll50 Napier av Bigerstaff Elijah L (Alice) collr Snyder Ready-to- Wear rll59 Napier av Biggs Ferris (Martha K) lab hl54 Broad (EM) Bigham Harriet E tchr rl76 College Bigham Mary cook r222 Lynwood av Bigham Robt lab r520 Northern Bigler Ernest L slsmn The J W Burke Co r618 Tel- fair Bigler Geo A (Hattie) carp h618 Telfair Bigler Pearl A tchr r618 Telfair Bigler Raymond M Rev r618 Telfair Bihas Pete Y waiter r Y M C A Bijo Bros (Isaac and Morris Bijo) gro 432 Flanders (EM) WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kindc of Merchandise and Service Meet "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IAsHflriEmgyAho, tLuarTpnHrgdouYvmoe. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILvoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Bijo Isaac (Bijo Bros) h428 Flanders (EM) Bijo Morris (Bijo Bros) h428 Flanders (EM) Billinger Fannie lndrs r330 Barfield al Billings Alice (wid Rylander) r303 Pio Nono av Billings Ami lab Enterprise Packing Co Billings Carrie r541 Georgia av Billings Chas (Viney) lab h444 Bright al Billings Henry W mach r306 (304) Pio Nono av Billings Jas (Lendie) firemn h5 Shoals al Billings May sten Atlantic Cotton Mills r541 Georgia av Billings Roberta maid rl51 E Academy (EM) Billings Sami (Georgia) lab h725 Daisy Billings Thos E (Lillian) printer h541 Georgia av Billings Wm H (Laura) mach h306 (304) Pio Nono av Blilingslea Abr (Ella) lab h759 Fort Hill Billingslea Alvin truck driver rl24 (112) Roosevelt R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 155 Billingslea Bertha cook r215 Elliott (EM) Billingslea Ceabon B (Rosa) porter rl24 (112) Roose- velt (V) Billingslea Clifford M (Susie) slsmn Armour & Co r817 New Billingslea Fannie (wid Jos) Indrs h243 Jackson Billingslea Fred (Willie) driver h714 Daisy Billingslea Harry (Lillian) lab h222 Calhoun Billingslea Hattie hl24 (112) Roosevelt (V) Billingslea Hurdie (Carrie) lab h430 Cowan Billingslea Jacob lab r203 Coles al Billingslea Julian lab r51'2 (240) Hall Billingslea Leona M h412 Walnut Billingslea Leonard (Alice) lab h610 (136) Hall Billingslea Mamie cook h203 Coles al Billingslea Mamie Indrs h512 (240) Hall Billingslea Richd (Eva) firemn hi Tatnall la Billingslea Rose rl30 2d av Chero'Cola MACON Chero-Cola Bottling Co. WJ. . AJ. . HWAWILKLIINS S Billingslea Sami F (Ethel) slsmn Ellis Motor Co h 517 Montpelier av Billingslea Sarah J Indrs rl Tatnall la Billingslea Victoria Mrs h820 New Billingslea Waiter (Mazie) lab h319 Short (EM) Billingslea Wm (Mattie) carp h612 Gilmer Billingslea Wm (Rosa) frt mkr h412 E 2d (EM) Billingslea Wm (Ada) tmstr h925 (953) Hazel Billingsley Alma cook r352 Monroe Billingsley Frank porter The Hanover Shoe Billingsley Josh bellboy r352 Monroe Billingsley Laura cook r352 Monroe Billingsley Minnie cook h352 Monroe Billingsley Thos E (Ella) farmer h8 (145) White al Bills E M ship elk Dunlap Hdw Co Billuiplu Sol (Janie) firemn rll2 Collins la Billupps Wesley (Ida) lab r301 Short (EM) Biltmore Apartments 811' Poplar Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 156 (1925) R. L. POLK & CO.'S Bines Henry lab r615 Hazel Binford J Brie (Myrtle) collr Reliable Outfitters h318 Johnson av (HH) Bingham Wm M soapmkr r7, 472 College Binion Annie (wid Prank) hl30 Charles (SM) Binion A Laura phone opr Union Dry Goods Co r768 Oak Binns Earl ship elk rll3 Stonewall pi (V) Binns Georgia Mrs hlpr W A & J A Spiller r375 Davis The most la comprehensive reference work on the banks of Binns Peter (Essie B) barber h543 E 2d Binson Jack (Mary) plstr h410 E 2d Birch Celia lndrs h53 Virginia la Birch Prank N (Rosa) mech h618 (610) Montpeiler av BIRCH INSURANCE AGENCY, C M Powell Jr Pres, the world H L Francis See-Treas 557 Mulberry, Phone 150 Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Birch John N (Leila C; Juliette Milling Co) h235 High Birch John N jr (Ruth M) aud Juliette Milling Co h ns Albemarle pi 2 n Ridge av Birch Lois student r511 Napier av Birch Sami (Marian) mech h4 Woodliff BIRCH WM B (Ada), Genl Counsel Ga Casualty Co, li511 Napier av, Phone 2783 Birch Willie M sten Ga Casualty Co r511 Napier av Bird see also Byrd BIRD ANGUS E JR (Cora), Cashier Citizens & Southern Bank, h201 Oak Haven av, Phone 1222 Bird Wm (Ella) lab h809 Port Hill Birdsey Angus B v-pres Birdsey Flour Mills r379 Col- lege Birdsey Flour Mills (Inc) J S Birdsey pres A B Bird- Price $20 sey v-pres R T Birdsey sec-treas Poplar nr 8th Published semi- annually Birdsey Herbert r507 (611) Vineville av Birdsey John S (Helen) pres Birdsey Flour Mills h304 Vineville av Birdsey Kitty S (wid Sami R) r341 Hardeman av MARCH and SEPTEMBER Birdsey Myra H elk U S District Court r379 College Birdsey Ralph T (Emily) sec-treas Birdsey Flour hy Mills h507 (611) Vineville av Birdsey Sami R slsmn Birdsey Flour Mills h643 For- syth R. L POLK Birdsong B Emory appr rll8 Emory &C0. Polk Directory Bldg. r Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Va% on Savings MACON CITY DIRECTORY (1925) 157 Birdsong Carrie student r503 Campbell av Birdsong E Milton blrmkr hlpr rll8 Emory Birdsong Lafford B (Beula) agt Am Natl Ins Co h707 Broad Birdsong Malinda h503 Campbell av Birdsong Richd E (Nannaline) drftsmn h640 Ridge av Birdsong Willis pdlr h4 Church al Birrick Ellis J (Fannie) gro 203 5th h203i/2 do Birrick Jos elk E J Birrick r203y2 5th Bishop Alice (wid Wyley) rl240 College Bishop Cary W meat ctr r253 Broadway Bishop Dreyfus dist mgr Macon News r616 Johnson av Bishop F Jos (Mary E) contr 501 Grand bldg h311 Napier av Bishop Henry C (Virginia R) typewriters 501 Grand bldg r322 Linden av Bishop Jas P contr 616 Johnson av h do SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Bishop Jas T r311 Napier av Bishop Jas T jr student r311 Napier av Bishop John H (Clara) chauf h602 Main Bishop John T (Hassie G; Liberty Pressing Club) h 870 1st . Bishop J B (Willie M) lab hl220 3d Bishop Robt E (Mildred) carp r311 Napier av Bishop Shirley student r220 1st Bishop Walter barbecuer r253 Broadway Bishop Wyley D (Blanche) prsmn Lyon Harris & Brooks hl240 College Bithwood Edw cook hl8 Cheatham al Bittick W Rollie (A Estelle) eng h420 Jackson Bivens Emmett Rev (Roxie) pastor Missionary Baptist Church h795 Cedar Bivins Arth (Maggie) lab r215 Jefferson Bivins Bessie r608 Montpelier av AUTHORIZED DEALERS More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. T Jj ^ ^ .. FOR LISTS OF NAMES ANY TRADE ^ -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 158 (1925) R. L. POLK & 'CO.'S lO s Q |(S2 i--k * c/5 CO Lg Bivins Emanuel (Mary) lab 118(4 Short (EM) Bivins Emma cook r Shamrock Bivins Henry C (Carrie) firemn h420 Hall Bivins Henry C jr lab r420 Hall Bivins Ida cook rl23 Ash Bivins Jas lab rl36 Bay Bivins Jas (Inell) plstr h301 Ward Bivins Jesse (Della) lab h8 Spring Bivins John J (Ollie) rug clnr h851 Elm Bivins Lillie janitress r Annie Boden Bivins Minnie (wid Steven F) r502 Duncan Bivins Nettie lndrs hl23 Ash Bivins Perry porter r728 Nussbaum Bivins Thos barber r452 New Bivins Thos V (Mamie) firemn h200 (100) Charles (SM) Bivins Walter (J'ulia) lab h5 Middle (EM) Bivins Wm (Sallie) h708 Campbell av Bivins Wm (Archie Lee) lab r217 Jefferson Bivins Wm (Emma) lab hl25 Shamrock Bivins Wm porter r8 Short Bizzell Henry D (Christina) mech r619 Oglethorpe Bizzell Mary r401 Hillyer av B'Jork Carl G (Frances) air brake inspr rl31 High B'Jork Frances Mrs supvr Sou Bell Tel Co rl31 High Black Benj B (Sarah E) agt Carolina Life Ins Co h Forest Hill av Black Ernest D (Harriet B) v-pres and treas Central Cotton Oil Co and v-pres Macon Fertilizer Co h 121 Buford pi Black Eva tchr r20 Spring Black Julia R (wid Alex) hl29 Appleton av Black Lonnie lab rl05 Bay Black Mary E rl064 Elm Black Nancy lndrs hl59 Grant av Black Raburn r763 Poplar Black Sami (Sarah) grave digger h403 Monroe Black Sami M (Ruth) r218 Chestnut Black Virginia nurse City Health Dept rl59 Grant at Black Virginia student r745 Ridge av Black Wm F (Jessie M) eng h745 Ridge av Blackledge Katie nurse Macon Hosp Blackman Dorothy student r400 Forsyth j O ud X H X 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 159 Blackman Emma M (wid John P) sec Boy Scouts ot America r400 Forsyth Blackman Hattie lndrs h432 Coles al Blackshear Albert opr h218 Hydrola Blackshear Eleanor (wid Wm I) h460 New Blackshear Geo mill wkr Dixie Roll & Cot Co Blackshear Jas R opr r327 Clinton Blackshear Julia maid rlOl Cedar Blackshear Loranza (Mattie) farmer h998 Cowan Blackshear Lula M cook 719 Pear (EM) Blackshear Thos E (Hattie) phys 811 Ga Casualty bldg h210 Cherokee av Blackshear Janet r210 Cherokee Blackshear Wm lab r998 Cowan Blackstone Frank (Mildred) slsmn Wilson & Co h473 Orange MACON OPTICAL COMPANY Frank H. Johnson Opticians 468 CHERRY QfrS&S Optometrists PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA Blackstone Maggie rl531 1st Blackstone Wm (Roberta) brklyr r444 Ballard Blackwelder Raleigh (Eliza) local agt Otis Elevator Co hll6 Magnolia Blackwell Alma student rl7 Hill Park av Blackwell Chas lab h213 Elliott (EM) Blackwell Emil H mech r.17 Hill Park av Blackwell Geo A (Marion) slsmn h2, 559 Orange Blackwell John P (Leila) slsmn hl7 Hill Park av BLAIR ALEXANDER (Madge R), Architect 401 Ga Casualty Bldg, Phone 71, h516 Napier av, Phone 1479 Blair Anna (wid R Frank) rl237 2d Blair Benj F (Ada) millwkr hl3 Dannenberg av Blair Florence tchr r516 Napier av Blair Georgia h2026 Broadway Blair John D (Lucile) instr h207 Boulevard (NH) Blair Lester L millwkr rl3 Dannenberg av Blair Margt tchr r516 Napier av 1925 The Splendid 7eatures of Sast Editions are retained, with much New, Useful and nteresting 5ata added. n. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. TeL 2813 160 (1925) R. L. POLK & CO.'S Blalock Floyd E (Nellie) h476 Ash Blanchard Hardin M (Cora) mach hl09 Richmond Blanchett Pennie Mrs h303 Flanders (EM) Bland Cleveland (Fannie) lab h402 Applewood Bland David (Claudie) lab h2 Mitchell la Bland John C (Fannie) dist pass agt Sou Ry r304 Hillyer av Bland Julian T (Juanita) br mgr A & P Tea Co h459 Carling av Bland Langston (Emma) carp h856 Broad Bland Mary dom h545 Mitchell Bland Mary lndrs r409 Applewood Bland Robt rll2 Spring Bland Thos (Mary) lab hl74 W Boundary Blanford Jesse (Bennie) lab h317 Ash Blanks Edith sten Methodist Orphans Home r do Blanks Otis L (Norine) elk h206 Ridge av Blanton Chas E (Frances) linemn r817 New Blanton Nellie (wid W H) rl'18 Forsyth Blash Courtney (Ella) lab h334 Madison Blasingame Dosia (wid Lloyd) h Industrial Home rd Blasingame G W elk r517 Georgia av Blasingame John lab Ideal Creamery r Bloomsfield Bleakley Marion E (Neal) special agt h3, 305 College Bliss Dwight L (Hallie M) cond h ss Log Cabin dr 1 w Habersham av Bliss Dwight L elk r250 Winship Bliss Eliz E r250 Winship Bliss Lucile sten r D L Bliss Bliss Oliver R (Birdie) cond h250 Winship BLOCH CARL, Real Estate, Insurance, Rentals and Loans 810-311 Citizens & Southern Bank Bldg, Phone 1267, hl305 Vineville av, Phone 490 (See BlodmChas^J (Marie; Hall, Grice & Bloch) h303 Hill Crest av Bloch Hide Co (Michl Bloch) 610-12 Broadway Bloch Michl (Lena; Bloch Hide Co) hl40 Appleton av Block Alec (Nonie) pres Empire Candy Co and Natl Milling Co h810 Mulberry Block Chester B (Pearl) mach h9 Holt av (NH) Block Earl H slsmgr Massee-Felton Lbr Co r Hotel Dempsey Automobile owners are select prospects tor mtearsnyfokrinadllskoifndmseorcfhAanudtoismeo. biSleenLdisttos.HeOaudrqunaewr- Catalog contains much valuable data. Ask for CJ copy. R. L. POLK & CO.. DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON CITY DIRECTORY (1925) 161 BlockFerdinand (Bibb Bag Co) rl305 Vineville av Block Flora (wid Jos) hl305 Vineville av (V) Block Frank E Co H D Parks mgr whol confrs 25355 5th BLOCK HERBERT M, Mgr Hotel Dempsey, r do Block Jas porter r861 Ocmulgee Block Mary maid r861 Ocmulgee Block Mattie cook r403 Monroe Block Nicholas M (Hattie) pres Massee-Felton Lmbr Co r Hotel Dempsey Bloodworth Augustus E h254 School Bloodworth Chas P (Eliz) cond h261 Orange Bloodworth Curtis baker r42 Holt av (NH) Bloodworth Geo T elk P O r221 Jones av Bloodworth G Albert bkpr Happ Bros Co r724 Ander- son Bloodworth Harvey B 12314 Cotton av mgr Palm Purchasing Co r Bloodworth John M (Sallie) elk h2162 2d Bloodworth Julius L student r724 Anderson Bloodworth Leona r254 School Bloodworth Lillian tchr r718 Anderson Bloodworth Lillie (wid Geo E).h724 Anderson Bloodworth Lizzie Mrs winder r411 Jackson Bloodworth Lonie student r718 Anderson BLOODWORTH LUTHER U (Rachel A), Attorneyat-Law 3-4 Hardeman Bldg, Phone 5, h281 Hill- yer av, Phone 4410-W Bloodworth Mamie (wid Archie) rll8 Tenny Bloodworth Martha E (wid Augustus R) r424 Cal- houn Bloodworth Mary (wid Henry W) h221 Jones av Bloodworth Minnie millwkr r225 Knott Bloodworth Prentice E student r2162 2d Bloodworth Robt D student r254 School Bloodworth Robt H (Sarah) carp h718 Anderson Bloodworth Wm mech r319 Chappell Bloodworth Wm D (Eliz) firemn rl061 Ash Bloodworth Wm G (Marie G) elk Dunlap Hdw Co Columbus rd Bloodworth Willis H (Blanche) carp h216 Sham- rock Bloodworth Winton E elk r718 Anderson FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION c2n P 90 to 05 sr 2 M EZ s * (A rg 2 DETROIT R. L.. POLK & CO. CHTCACn Duiilap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 52 (1925) R. L. POLK & CO.'S as a Kr PLACE THE DIRECTORY IS THE GREATEST MARKET PLAGE Blosfeld Wm M (Mattie) acct h5 Fredonia apts Blossom Geo L (Helen) acct h5 Fredonia apts Blount Annie K lndrs h637 Fort Hill Blount Clara Mrs slsldy Leis Dept Store h210 Rutherford av Blount Clarence (Ida B) butler r224 Georgia av Blount Emily lndrs hl46 New St la Blount Eugenia W(wid Jas H) h364 Orange Blount Eunice (wid John E) bkpr Snyder Ready-to- Wear rl20 Knott Blount Frances r364 Orange / Blount Geo (Mary) lab h611 Shoals al (E M) Blount Geo W elk Rogers Gro h812 Main Blount Grover C mech r412 Walnut Blount Irene slswmn Barker Bakery r360 Fairview Blount Jane (wid Morris) h282 Amos Blount Julia (wid John M) hl20 Knott Blount Markie dom h248 5th Blount Margie dom h248 5th IN THE Blount Mattie (wid Griffin B) h360 Fairview Blount Mattie P sec r608 1st WORLD Blount Roger D (Annie M) news agt rl68 Spring * Blount Sarah lndrs r282 Amos Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * Blount Wm C (Eula L) slsmn hl303 Vineville av Blount Wm H (Frances) reprmn Scott-Parker Co r 3805 Houston av BLOWERS ALBERT C, V-Pres Marion County Chamber of Commerce, res 2 miles n of Ocala Blue Edw (Hattie) shoe shop 822 Columbus rd hl54 Cedar Unionville Blue Front Lunch Room (Jas Cassidy) 416 Mulberry Blum Arie I (Madeline) pres Central Bedding Co h 810 Spring The Directory is the Natural I Blum Clarence S (Royal Shoe Store) rll8 (198) Buckingham pi Source of Blum Leo J (Freda; Royal Shoe Store) hll8 (198) Information and is "On the Job'* Buckingham pi Blum Marks Y (Claudia) billiards h869 Cherry 365 Days Blum Moies A (Stella) billiards 551 Cherry h808 do Every Year Blum Sol T appr r869 Cherry MJkiGc PUBLBHEBS Blunt Belcha (Ruth) lab r rear 356 Spring la Blunt Clara elk r210 Rutherford av Blunt Emily hl46 New St la Board of Health Dr C L Ridley health officer City Hall PoIltDirecbmSW DETROIT V -MICH- j A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 M CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 163 BOARD OF PUBLIC EDUCATION, C H Bruce Supt, Court House, Phone 247 BOARD OF WATER COMMISSIONERS, City Hall, Phone 1880 Boatman Wm (Sallie) teleg opr rll2 Stonewall pi Boatright Gordon M (Edna B) brkmn h2224 2d Boatright Homer elk Dinty Moore's r2224 2d Boatright Inez r2224 2d Boatwright Albert flagmn r204 College pi Boatwright Bennie truck driver r520 E 2d (E M) Boatwright Essie lndrs h519 Maynard Boatwright F G U S Dist Atty res Cordele Ga Boatwright Jefferson D gro 328 Dannenberg av h do Boatwright Jennie smstrs hl02 Yates av (E M) Boatwright Mollie rl02 Yates av (EM) Boatwright Robt lab r438 Bright al Bobbitt Wm C (Emma) carp h321 Shamrock Bobo Davis gro 301 Turpin r do Boden Annie (wid John) h Forest av (Bellevue) r* C - ->S 03 m in X a o o Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Boedecker Hilmer P (Ruby) formn h247 Boulevard (N H) Boggs Lucy M opr Sou Bell Tel Co r756 Spring Boggs Wm A (Eliz) solr Macon News h756 Spring Boland Andrew D r211 Mikado av Boland Florence r211 Mikado av Boland J Lee auto mech r211 Mikado av Boland J Walter (Minnie) formn Taylor Iron Works & Supply Co h211 Mikado av Boland Louise r211 Mikado av Boland Mary r211 Mikado av Boland Walter (Fannie) boilermkr Taylor Works & Supply Co h521 Elm Bolden Chas (Annie B) miner rl206 Broadway Bolden David (Ida) lab h802 Hazel Bolden Lawson lab r83 Bay Bolden Mack (Marie) lab r315 Division in n g cn 2 CD cn dress IN STYLE DAYS USE YOUR CREDIT 406 THIRD ST. TEL. 3026 4> G O J3 aujj: ubjj: a 4) " 5 s s < d 15 H CS g m if w u o 2 H co Hcn ED JOU co W&Q co < >. H. k POLK & CO., DETROIT, MICH. W. R. Finch Motor Co. Nash Leads the World in Motor Car yalue Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 168 (19251 R. Li, POLK & CO.'S Boterweg Conrad collr Macon News r8, 559 Orange Boterweg Cora C (wid Conrad) reporter Macon News h8, 559 Orange Bott June (wid John) h690 Arch Bourne Edwin T (Gladys) r513 (623) Vmeville av Bourne Geo (Margt) h6, 615 Walnut Bourne Margt sten rl24 Cleveland av Bouten Bertie (wid Henry) hl09 Patterson POLK'S Boutwell Agnes elk rl064 Oglethorpe Boutwell Anna L textile wkr r614 Telfair Boutwell Benj P (Louise) elk r307 Church (E M) Dental Boutwell Benj F jr elk Coleman Meadows Pate Drug Co r307 Church (E M) Register OP THE Boutwell Clarence stmftr r614 Telfair Boutwell Clayton textile' wkr r741 Hawthorne Boutwell Geo B (Lizzie) mech h2105 Broadway UNITED STATES AND CANADA Boutwell Geo C (Hattie) rl38 Concord Boutwell Jas H (Alice) mech h307 Church (E M) Boutwell John B (Elsie) textile wkr h741 Hawthorne Boutwell Louise h4, 813 Poplar Boutwell Mary J smstrs r614 Telfair Boutwell Odessa smstrs h224 Chappell 1925 Boutwell Randall rl064 Oglethorpe Boutwell Roht E (Oshia) mldr hlOO Enterprise (S M) Boutwell Rosa B sten r307 Church (E M) Bouyer Annie r357 Elm The Splendid Features of Past Editions are retained, with much New, Useful Bouyer Clifford r357 Elm Bouver Frances cook r226 Roosevelt Bouyer Geo B (Maud) slsmn r204 Williams Bouyer Hattie lndrs h226 Roosevelt Bowden Alvi L (Mollie) h Mercer (Bellevue) Bowden Ben farmer r306 Jones av Bowden Bertie (wid Henry C) h314 (219) Pl Nno av and Interesting Data added. Bowden Chas L (Pearl) slsmgr Wofford Oil Co h2603 2d Bowden Clifford (Malissa) bottler hl39 Cedar (U) Bowden Danl lab h530 Sparks al ,, Bowden Eug (Mamie) oiler h2 Holt av (N H) Bowden Henry (Louise) carp Houlevard (N H) R. L. Polk Bowden Henry (Annie L) section hd hlOO Adams &Co. Bowden Homer J (Iva) traffic officer Police' Dept h306 Jones av Publishers Bowden Jas (Aurila) lab h230 Plant al 536 S. Clark St. Chicago, 111. Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK ST TELEPHONE 4166 MACON CITY DIRECTORY (1925) 169 Bowden Jas H (Laura) lather h444 Cedar (Union- ville) Bowden John O porter h424 Ward Bowden Lillian opr Sou Bell Tel Co r863 American blvd Bowden Marie C (wid Thos) hl21 Willingham Bowden Mary lndrs h225 7th Bowden Ralph (Minnie) lab h416 Gilmer Bowden Rosa lndrs r444 Cedar (Unionville) Bowden Thos (Lizzie) janitor h931 Hazel Bowden Verna sten rl21 Willingham Bowdoin Chas C (Minnie) carp hl02 Highland av (NH) Bowdre Benj T jr (Eliz B) cotton buyer Juliette Milling Co hl008 Ridge av BOSS, Clerk Bibb County Commissioners, h846 College Bowen Carles (Ida) gardnr hl08 Amos Bowen Emma L lndrs r327 Clark la Bowen Henry lab r327 Clark la Bowen Jesse J (Nelle) boilermkr r219 Carling av (HH) Bowen Loy J asst tchr Mercer University r Y M C A Bowen Lula lndrs h327 Clark la Bowen Mack lab r327 Clark la Bowen Margt elk Sou Bell Tel Co rl24 Cleveland av Bowen Robt A (Lottie F) archt rl20 Hines ter Bowen Robt L r818 Walnut Bowen Simon (Ola) lab r509 Lexington av Bowers Benj H (Fannie) pntr h608 1st Bowers Bose (Dora) mech hl23 Peachtree Bowers Frances opr Sou Bell Tel Co r608 1st Bowers Freeman B mech r311 Giles Bowers Jeff (Dorthula) pdlr r311 Giles Bowers John E (Mary) shoe repr Jake's Shoe Store r 123 Peachtree Bowers John M (Kathleen) whse mgr Adams-Buchan- an Motor Co rl51 2d Bowers Nellie (wid Alf) opr r204 Church (EM) a Bowles A Mae Mrs matron Travelers Aid rl04 West End av 2 p Bowles John R (Dollie) barber hl20 Grace pi (SM) Bowles Mary A (wid Jerry D) hl04 West End av (H) H- 2 ,, FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO w Ui > r Z We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 ^ (1925) R. L. POLK & CO.'S Bowman Addie r216 Pond Bowman Addie lndrs h315 2d av (V) Bowman Albert (Elnora) lab h218 Pond Bowman Albert C h205 Cowan (EM) Bowman Alf (Mamie) carp h364 2d av (V) Bowman Alice (wid Jas A) h868 1st Bowman Danl G (Thelma) linemn h608 Oglethorpe Bowman Eug (Mamie) driver h222 Farguson Bowman Henry (Eva) lab hl03 Texas Bowman Jas elk John C Ellis Co 512 3d Bowman Jas (Annie) lab r222 Farguson Bowman Jas T (Roberta Mae) linemn hl057 Walnut Bowman Lucy lndrs r993 Cowan Bowman Mack (Jimmie) lab r306 Craft la Bowman Monroe (Willie) porter r299 Craft la Bowman Robt H (Carrie) carp h933 Cowan Bowman Thos (Martha) pdlr h Rockledge av nr Rob- inson rd Bowman Wm (Roberta) lab h875 (575) Maynaid M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnrHgdouYvmeo.lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls 1 H Bowman Willie rill (409) Richard L E Bownes Annie iK cook r505 Long Boxx Nancy A (wid Geo T) h.318 Spring L A Boxx Wm A elk Coml Credit Co r318 Spring BOY SCOUTS OF AMERICA, Millard Westcoit Scout Executive, John Haddock Asst, 46034 Broadway, I T Phone 2581 Boyce Eliz (wid Wm) drsmkr hl613 Broadway R I Boyce L C inspr Massee-Felton Lmbr Co rl613 Boyce Arth C asst mgr S R Jaques & Tinsley Co r453 0 N New Boyd Conrad D (Alma) slsmn hl37 Culver N G Boyd Danl (Kizzie) lab h338 May av Boyd Eldor lab r338 May Boyd Frank G whse mgr S R Jaques & Tinsley Co r S 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND jjf THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 171 Boyd John E (May) inspr Natl Hardwood Lmbr hl30 Cleveland Boyd Lee (Mary) flremn hl3 Elbert la Boyd Maggie cook hl47 Woodliff Boydkins Wm (Addie) lab hll05 (805) Woolfolk Boyer Baxter C (Ola M) mtrmn r2301 2d Boyer Geo (Rebecca) lab rl07 Elm Boykin Chas (Sylvia) mill wkr h651 Ross Boykin Sami (Leanna) lab h602 Gilmer Boyles J Sanford (Mary) auto pntr r817 New Boyles Raymond E (Susie) printer Jones & Coney h Lanier pi Boynton Arth S (Mary) sign pntr hlOO Crisp Boynton Chas (Sylvia) lab h651 Ross Boynton Ella B (wid Sidney H) h65 Arlington pi Boynton Willard (Lucy) lab h98 (116) Forest av (V) Boynton Wm (Sallie) lab rll8 Powell (EM) Boys' High School Paul R Anderson prin Holt av bet Lawton and Napier avs Your City Directory Answers All Questions as to ( WHOM You Are Looking For MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIISNS Bozeman Celia L r88 Arlington pi Bozeman Chas H (Henie) mill opr h8 Shell av Bozeman Clara mill opr r6 Shell av Bozeman Howard (Kempie) mill opr rl2 Shell av Bozeman Jas lab h22 Malloy's al Bozeman Jas L appr r431 Calhoun Bozeman Julia mill opr h6 Shell av Bozeman Mildred r431 Calhoun Bozeman Mildred L tchr r88 Arlington pi Bozeman Nina r657!/2 Plum Bozeman Robt L (Nancy) eng h431 Calhoun Bozeman Sallie A (wid John W) r657i/2 Plum Bozeman Thos P (Mattie L) yd mstr h657y2 Plum Bozeman Wm C mill opr r6 Shell av Bozeman Wm E (Mildred K) cashr Ga Banking Co h88 Arlington pi Brabham Jas cond r871 2d Bradbury Minnie tchr r461 Boulevard (NH) Telephone 2687 J. T. MOLTON, Mgr., 348 Oak WHERE They Can Be (Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work # m e\ & cd LUMBER, SHINGLES, LATH Willingham Sash Ik Door Co. Office, 457 Third St. Telephones 278 & 3976 172 (1925) R. L. POLK & CO.'S Braddy John M gro 553 Pine r do Braddy John T lab rl74 Palace av Braddy Jos B (Mollie) gro 14 Bellevue rd r do Braddy J Elton elk Fourth Natl Bank r Y M C A Braddy Mary sten r759 Cherry Braddy Walter E (Maggie) chauf hl74 Palace av Bradfield Eva r412 Montpelier av Bradfield Francis mgr Bradfield Gro Store r412 Montpelier av Bradfield Geo elk r412 Montpelier av Bradfield Grocery Store Francis Bradfield mgr 412% Montpelier av Bradfield Martha student r412 Montpelier av Bradfield Robt L (Frances) h412 Montpelier av Bradfield Robt J jr agt Carolina Life Ins Co r412 Montpelier av Bradford Carl L (Gladys) mgr Burroughs Adding Mach Co hill 9th av (CH) Bradford Edw janitor r425 Madison Bradford Edwin F slsmn Macon Telegraph r754 Cherry Bradford Frank S (Rose M) slsmn Cherry Hat Shoppe h4, 811 Poplar Bradford Isaac (Pinkie) lab rl313 1st Bradford Jas h2, 853 Cherry Bradford Jas S (Mattie) lab rl4 Elm Bradford Mattie elk rl20 Edgewood av Bradford Nathaniel J (Jeannette) h523 Linden av Bradford Rose M Mrs mgr Cherry Hat Shoppe r4, 811 Poplar Bradley Fostine lndrs r562 Dunlap al Bradley John B (Annie Mae) cond r407 Virginia av Bradley Lawrence W (Mattie) brkmn h705 (110) Crisp Bradley Mary bkpr Oscar Bradley rll8 Forsyth Bradley Mattie cook h205 Magnolia la Bradley Oscar (Mary) gro 466 1st hll8 Forsyth Bradley Oscar jr elk Oscar Bradley rll8 Forsyth. Bradley Theo H (Cynthia) supt Natl Life & Accident Ins Co h203 Edna pi Bradley Thurston B (Laura) hll9 Tatnall Bradley Wm E r Adams Hotel Bradley Wm J (Blanche) tchr Mercer University h 1219 Oglethorpe -- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4^/2% on Savings MACON CITY DIRECTORY (1925) 173 Bradley Wm J jr student rl219 Oglethorpe Bradnex Corene maid 350 Haythorne BRADSTREET CO THE, H F Martin Supt, 208-210 Citizens & Southern Bank Bldg, Phone 843 Bradwell Jack mech Solomon Motor Co r501 Giles Brady Bonnie r448 Vine Brady Booker T (Dora) lab h414 E 2d (EM) Brady Jas E (Della) mgr Vineville Packing Co h22 Progress BRADY JOHN D (Estelle), Mgr Phoenix Hotel, r201 Oakland ay, Phone 1095 Brady Louis (Lena) slsmn hl316 Broadway Brady Thos E (Carrie) butcher h421 Calhoun Brady Wm auto mech r23 Spring Bragg Carlton C student r224 Adams Bragg Edgar A (Mary) driver h3810 Houston av Bragg Joel S soft drinks 2142 2d r2017 do Bragg J Robt (Ola J) gro 704 Hawthorne h503 Dun- can av Bragg Louis E (Berta) slsmn Royal Shoe Store h514 Pine Bragg Walter T (Nina) dept mgr The J W Burke Co h224 Adams Bragg Walter T jr (Aileen) elk r412 Forest av (V) Bragg Wm M (Ellen) slsmn h242 Washington av Brake Blannie Mrs sten E T Napier r450 Virginia Brake Henry T (Bessie) slsmn r654 Plum Brake Ida M elk r450 Virginia av Brake Jas elk r450 Virginia av Brake John W (Smithie) mill opr hl8 Shell av Brake Luther E (Blonnie) carp h450 Virginia av Bramblett Hewlett M barber r765 Mulberry Branam Wm T (Lula) elk C M Dumas h860 New Branan see also Brannon and Brannen Branan Alva L (Alice) formn h528 Forsyth Branan Bessie Indrs r305 Womack Branan Edw W (Ruby) cond h769 Oak Branan Emma r474 (174) Ballard BRANAN FRANK, Asst Cashr Fourth National Bank, r702 1st Branan Gary (Thelma) flagmn r659 1st Branan Helen A (wid Columbus M) h702 1st Branan Irene cashr Rialto Theatre r528 Forsyth Branan Jennings elk Fourth Natl Bank r528 Forsyth r FOR LISTS OF NAMES ANY TRADE - ANY BUSINESS - ANY PROFESSION t>ktroit R. 1,. POLK & CO. Chicago POLK'S dental! UrHerTCAEgDNiASsDTtAAeTErS edition L1PO9LK245CO. precious m".eveerytafolrms fRiUeCAnTtaIOlN POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendic Features of Past Editions are retained with much New, Useful and Interesting Data added R. L. Polk &C0. Publishers Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 174 (1925) R. L. POLK & CO.'S Branan Louise elk McLellan Stores Co r528 Forsyth Branan Lucile elk r528 Forsyth Branan Margt rl82 English av Branan Marie bkpr Union Dry Gds Co r252 Columbus Branan Mattie r702 1st , Branan Mildred slsldy Lee's Dept Store r528 Forsyth Branan Oma F student rl42 Laurel av (NH) Branan Oscar S (Emma) eng hl26 Laurel av (NH) Branan Robt r474 (174) Ballard Branan Wiley M (Mary) cond h610 2d Branan Wm jr student rl82 English av Branan Wm (Allene) dep sheriff hl82 English av Branan Wm (Gertrude) lab h305 Womack Branch Eliz student r772 Walnut Branch Jos M asst paymstr Bibb Mfg Co No 2 r Y M C A Branch Patti W h772 Walnut Brandt Danl W (Jennie) telep opr h656 Pine Branford Lucy cook r215 Jenkins Branham Alberta r715 Campbell av Brannon A L (Berenda) mech rl39 Lymoore av Brannon Ellis W (Jewell) elk Wofford Oil Co h2723 Houston av Brannon Jas (Emma) lab h325 Long Brannon Jos J h769 Mulberry Brannon Wm elk r304 Corbin av Brannon Wm N bkpr Bibb Natl Bank Bransford Ethel M cook r302 (262) Crisp Bransford Josephine (wid John) h302 (262) Crisp Brantley Acquila C elk rll3 Stonewall pi (V) Brantley Addie r300 Penn Brantley Alford (Mary) lab h312 Corbin av Brantley Annie bottler rl06 Powell (EM) Brantley Belton N bottler h Bellevue rd at Daisy Brantley Ben (Zollie) h Simmons av nr Bond Brantley Chas (Fosten) lab h360 (61) Boardsman al Brantley Chas (Mary) lab hl06 Powell (EM) Brantley Clara dom h700 Clinton (EM) Brantley Clinton barber 410 Poplar h551 4th ay (PH) Brantley Cora mill hd rl06 Powell (EM) Brantley Dewry (Haley) mill opr h28 Shell av Brantley Edw (Nellie) lab h540 E 2d (EM) Brantley Edw F (Anne) broker h4 Ellisonian apts Brantley Edw R (Addie) meat ctr h413 Jackson Brantley Elijah (Nettie) slsmn r540 E 2d 536 S. Clark St. Chicago, 111. E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 " _ AUTHORIZED LJiOncNCoEAlnSRS-M TROUTCOKSR'TRCAOCM TFOPoRArSdNsoYrvih5ff5oa7rvP-ie5?H5asO9iEttN.PFLELoFS Ur1odM5r,9d1SwoTer. MACON CITY DIRECTORY (1925) 175 Brantley Emma cook rl06 Powell (EM) Brantley Eunice M slsldy S H Kress & Co r657 Pine Brantley Henry (Dora) barber r303 Hines Brantley Hessie mill hd r20 Lake City Brantley Isaac (Carrie) lab hl34 Moughon Brantley Jas M (Mattie) rooms 50iy2 Poplar h do Brantley John D (Ena M) lab hl80 Cedar Brantley John G (Inez) slsmn The Texas Co hll56 Milledgeville rd Brantley Jordan (Mary) lab h63 Plummers al Brantley Jos S mech r3 Union av Brantley Julian E (Anna) slsmn The Texas Co res RFD 4 Brantley Louella (wid Jerry J) h3 Union av Brantley Louie tchr r700 Clinton (EM) Brantley Louie B baker r3 Union av Brantley Lucile tchr r429 Ward (V) Brantley Marshall lab rll6 Cowan Brantley Mary Mrs r411 Avers rd Brantley Mary cook r286 Roff Home av (V) i Brantley Mary E (wid Jas L) hll3 Stonewall pi (V) Brantley Massey J (Lula) mill hd h21 Lake City Brantley Nettie mill hd h20 Lake City Brantley Oliver (Mary) lab hl02 Holmes av Brantley Robt lab r!34 Moughon Brantley Ross (Addie) meat mkt r23 Bibb av Brantley Ruby G r657 Pine Brantley R H student r220 1st Brantley Sol (Mattie M) elk rl924 Broadway Brantley Wm T (Bertha) barber h657 Pine Braswell Ann h554 Magnolia la Braswell Benj (Pearl) lab h560 Smith row Braswell Dolly lndrs r200 Coles al Braswell D C r811 Ocmulgee Braswell Edith caterer r280 Orange Braswell Eliz lndrs b.209 Coles al Braswell Esko dyer r385 Merose (EM) Braswell Eug (Bertha) firemn rl713 2d Braswell Jas A (Theodosia) barber 507 Broadway h 214 (410) Pio Nono av Braswell Jas H (Lizzie) wtchmn h236 (138) Mutual av Braswell John O hlpr h852 Hazel Braswell Johnie lab r202 (4) Smith The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. , &C0. Polk Directory Bldg. Detroit, Mich. cl m KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 176 (1925) R. L. POLK & CO.'S Braswell Josephine r418 (220) Pio Nono av Braswell J Danl (Latha A) sec Ga-Ala Business Col- lege h Ayers rd Braswell J Green (Polly) h3, 501 Giles Braswell J Jackson (Anna) auto mech r3, 501 Giles Braswell Landis E (Ophelia) solr Independent Lndry Co r319 Columbus Braswell Lawrence (Lou) driver rl54 Sycamore Braswell Lizzie lndrs r378 Melrose (EM) Braswell Luther r501 Mikado av Braswell Luther (Rosa) baker r852 Elm Braswell Mamie lndrs r385 Melrose (EM) Braswell Minnie cook h202 (4) Smith Braswell Otis lab r385 Melrose (EM) Braswell Rosalie lab r560 Smith row Brasswell Reuben (Mary) firemn h705 Campbell av Braswell Reuben jr (Marguerite) baker hill Tindall av Braswell Walter student r811 Ocmulgee Braswell West (Mandy) h rear 837 Main (EM) Braswell Wm restr 105 Hardeman av r349 Middle (V) Braswell Willie chauf r236 (138) Mutual av Bray Chas (Dora) firemn h409 May av Bray Clayton C (Hattie) bkpr Jacob Hirsch Poplar Bray Danl M (Minnie) blksmith hl022 2d Bray Edw (Ellen) mill hd h244 Roff Home av h820 Bray Elnora (wid Dan) lndrs h501 (212) Chappell Bray Harmon lab rl006 Broad Bray Henry (Leila) mill hd h30 Taylor av Bray Neta mill hd r30 Taylor av Bray Rachael r36 Woodliff Bray Zed A (Kate) carp h215 Jeff Davis Brazer Wm lab rl47 (150) 1st av (V) Brazill Roxie Mrs lndrs h476 Jones St la Brazzeal Chas D (Hennie) agt Bakers Health & Life Ins Co h204 Spring Breedlove Aurelia (wid W B) h407 Napier av BREEDLOVE JOSIE, Sec and Treas Williams-Gut- tenberger Music Co, h407 Napier av, Phone 754-J Breedlove Lin (Nettie) lab h3 Malloy's al Breedlove Lula dom rl33 Wilder (SM) Breedlove Mattie lndrs hl33 Wilder (SM) Breedlove Mayble student rl33 Wilder (SM) AmtcCeouaarpsttnyaoy.lfmookgoribnacidlloelsRnkto.aiofnLiwndm.snsPeeormOrcfsLuhAKcaahnu. rdt&eovismaeClso.uOeba.l,ibeSleclDeetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtsMsrkqInuCffeaooHwrrr-. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) P* Breen John L (Eliz) trav aud MD&SRRCo hl23 Magnolia Brevard Betty cashr Dannenberg Co r859 2d Brevard Mary r859 2d Brevard Wm M (Addie) electn h859 2d Brewer Albert r rear 3 Waterville rd Brewer A V (Ruby) firemn r2605 Broadway Brewer Cora (wid H D) r811 Walnut Brewer C E r560 Plum Brewer Geo (Carrie) lab r rear 3 Waterville rd Brewer Ison lab r rear 3 Waterville rd Brewe Jack (Mary) carp h203 Peachtree Brewer Katie L (wid Wm O) r592 Duncan av Brewer Leola r rear 3 Waterville rd Brewer Maria Mrs elk Burtons Inc rl41 Academy Brewer Mary spinner r5 Bibb av Brewer Mildred sten Dixie Roll & Cot Co r203 Peach- tree Brewer Nathan (Ola) mill hd h26 Bibb av Brewer Wm B bkpr Am Bakeries Co r768 Mulberry Brewer Wm J (Ethel) barber 426 Main r903 Napier av Brewmgton Louis (Eugenia) dyer hl23 Washington Brice Chester A (Louise) firemn h2309 Broadway Brice Coleman J (Gladys) blksmith hl519 3d Brice Eula M rllO Concord Brice Frances student r407 American blvd Brice Geo W r2321 Broadway Brice Harry M city firemn r2309 Broadway Brice Jas W (Minnie) h2321 Broadway Brice Jos F (Laura) blrmkr h559 Ash Brice Maggie Mrs h202 Grand av (B) rlfoT OgtetSorTe Sleth0rpe PriTate Brice Oswald blksmith r202 Grand av (B) Brice Reuben (Mary) lab hllO Concord BRHripcpe RroSbt W 4% (NaoCr0aI)J brI'lOrW mekIrShulp9p2l5y)2dh2309 Broadway Brice Wm H (Emma) blksmith h407 American blvd Bricketson J R barber rl20 Washington av M) mach r509 Main (EM) Bros & Bndgers, h626 1(sM t, ePlhisosna)e 1876-JMaxwell Bridges Cleo (wid Clarence C) r!22 Fort Hill FOR. LISTS OF NAMES ANY TRADE - ANY BUSINESS - ANY PROFESSION uetroit R. L. polk & co. CHICAOO A 2 r*1 o nj 2 H I ol$ oS * r 25 HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL as ct mm Pin THE DIRECTORY IS THE GREATEST MARKET HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 178 (1925) R. L. POLK & CO.'S Bridges Cora r450 Alabama Bridges Edw H meat ctr r630 Forsyth Bridges Elmo chauf Fort Hill Bridges Evelyn student r630 Forsyth Bridges Howard student r630 Forsyth Bridges Jas A (Effie L; Dixie Cash Market) h630 Forsyth Bridges Jas T meat ctr r630 Forsyth Bridges John W Rev (Anna F) h716 2d Bridges Mattie (wid Thos) h218 Shamrock Bridges Mattie B r218 Shamrock Bridges Wesley clo prsr r454 Pine Bridges Wm C (Tommie) sten r718 2d Bridgett Mary rlOO Rebecca `Rriesers Wm C (Ida) sng h.717 Oak Briggs A Raymond drftsmn C W Shelverton r Hous- PLACE IN THE Briggs Clara nurse rl09 (110) Robers Briggs Harry (Lillie) watchmkr hl33A Oakland av Brigls Paul dept mgr Kenmore Burns Inc rl33A Oak WORLD Briggs Russell F (Florence) sec McClure Office Equipment Co h415 Belmont av Every Day in the Year the Directory Briggs Sami (Emma) draymn hl09 (110) Robers vtrio-hnm Aldrich driver rl36 Neal av Brigham Ernest T (Gladys) slsmn Dunlap Huckabee Tells Where Auto Co rllO Buford pi All Kinds Brigham Estella maid rl36 Neal av of Goods Brigham Paul (Annie G) slsmn h747 Ridge av and Service Brigham Virginia maid hl36 Neal av Can Be Had Bright Ernest (Fannie M) flremn h46 Bookers al I * Bright Harry wtchmn r421 Edgewood av Bright Jack sec r421 Edgewood av The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Bright Jesse (Pearl) lab hl09 Long la Bright Lena S cashr R S Thorpe & Sons r922 Walnut Bright Louise (wid L L) slsldy Dannenberg Co hll78 Elm Bright Lucille sten S W Hatcher r421 Edgewood av Bright Martha student rll78 Elm Bright Mary nurse rl.178 Elm Bright Richd L (Josephine) wtchmn h252 Broadway ULftffiJSo Bright T Judson (Margt) carp h421 Edgewood av Briley Arlena lndrs r458 Hawthorne PUBLISHERS Briley Jos A (Evelyn) agt Life Ins Co of Va h519 Pme More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President 5* DAY AND NIGHT 6O5U61R/2 MCOHTETROR:Y "TSHT.OROUGHNESS"PHONE 3041WRITE FOR INMFAOCROMNA,TIGOAN. 9 L MACON CITY DIRECTORY (1925) Brimberry Mary lndrs r7 Jordan 179 to rStT* Brimmer Lewis (Julia) lab h314 Norris Brinen Isidore (Fannie) dry gds 556 Poplar h670 Col- s* lege Brinkley Zena Mrs r563 Hawthorne Brinson Cora L nurse r322 Monroe Brison Grover (Lillian) chauf r211 (177) Lincoln av (V) Brinson Judson (Fearbie) lab h Industrial Home rd Brinson Wesley N (Erie) slsmn Macon Supply Co h 168 Spring Brisby Danl (Anna) porter h527 Gilmer TERMINAL TRANSFER COMPANY Briscoe Agnes hll8 Wyche Briscoe David (Annie) hll3 Spring Briscoe Eddie lab rl08 Wyche O i a s Briscoe Jos lab hl2 Gas House al Briscoe Mary h404 (256) Pio Nono av o M Briscoe Nettie r S B Briscoe Briscoe Sami B (Josie) formn Macon Gas Co h ss Log Cabin dr 1 w Carlisle av Brisendine I D (Sarah) r560 Plum Britt Doris (wid Jas T) h ws Park 1 s Forsyth rd Britt Geo C (Nora) driver h825 Orange Britt Jas M (Nannie) mgr hl005 Napier av Britt Jas M (Irene) printer h325 Reid 3 -- * -- Britt Jas W r325 Reid i Britt Jerry N pntr r552 Oak j-i :'*t!;TT!**l|g Britt John T (Louella) plmbr h815 American blvd w , Britt Lonnie T pntr r9 60 Hazel Britt Louis rl005 Napier av Britt Marie r611 Bailey av ; ^ ~ Q [ > Britt Martha Mrs bkpr T M Donnelly Co r918 Ogle- thorpe Britt Mary (wid John T) r815 American blvd Britt Paul T r325 Reid Britt Wm E (Ina) pntr h Forest av (Bellevue) o Britt Wm H (Annie) pntr 918 Oglethorpe h do Britt Wrigley F (Annie) pntr h611 Bailey av Britt Zollie M (Mamie) carp r946 (595) Columbus rd Britton Allie M sten rl923 2d > Britton Ida M sten Dunlap Hdwe Co rl923 2d Britton Madison H (Maggie) hl923 2d O Broach Alex H (Mattie) lieut Fire Dept h621 Duncan av H m Automobile owners are select prosjiects for Tcr3er Cl many kinds of merchandise. Send to Headquarters for all kinds of Automobile I,ists. Onr new Catalog contains much valuable data. Ask for a copy R. Ij. POCK & CO., DETROIT, MICH. ro9e w00 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 180 (1925) R. L. POLK & CO.'S Broach Altoff C (Biddie) blksmith hll6 Garden Broach Edna cashr Union Dry Goods Co rll6 Garden Broach Hilda opr rll6 Garden Broadnax Manda (Corinne). brkmn h350 Hawthorne Broadus Leonard lab r519 Maynard Broad'us Willie F lndrs r519 Maynard Broadway Garage W W Brown mgr 506 Broadway Broadway Obie G opr The Wm Carter Co rl61 Cotton Broadway Trading Co (O C Henden) salaries bought 4 Jacques bldg Broady Arth (Fannie) bill poster h4 Wise av (V) Brock Alton G mach hd rl812 3d Brock Chas Z (Amanda) hl812 3d Brock Elgie J rl812 3d Brock Emory W (Gladys) swtchmn rll3 Crisp Brock Howard W sawfiler rl812 3d Brock Leila r Sara Latham Brock Leon C (Dora) stocks and bonds 202-3 Bibb bldg r313 Orange Brock Pope F (Alice; Brock Sparks & Russell) h Sun- set dr 5 e Nottingham dr Brock Richd eng r211 Broadway Brock Robt J lab rl812 3d BROCK, SPARKS & RUSSELL (P F Brock, A 0 B Sparks, H D Rassell, Edward Miraglia), Attorneys-at-law 214-218 Ga Cacualty Bldg, Phones 4806-4807 Brockman Fredk (Cinthie) farmer r201 St John Brockman John D (Smithie) barber S O Brockman r404 Fort Hill Brockman Katie mach opr r201 St John Brockman Mattie student r404 Fort Hill Brockman Susie M student r404 Fort Hill Brockman Swep O (Mattie) barber 400 2d h404 Fort Hill Brockman Willie (wid Fredk) h201 St John Brogsdale Chas (Julia) cook h3 Ross St pi Brogsdale Nellie cook rl430 Broadway Bronson Cath tchr rl38 Rembert av Bronson Henry lab r414 (314) Womack Bronson Horace W (Mary C) slsmn Jas N Neil Co r 400 Forest av Bronson Sidney C (Dellie) elk C of Ga R R Co hl38 Rembert av FOR LISTS OF NAMES AN-V Y TRADE -- ANY BUSINESS -- ANY PROFESSIO( N DETROIT R. L- POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) Bronson Pauline tchr rl38 Rembert av Bronson Wm (Leila) carp h305 Cowan Bronson Wm (Annie) lab hl88 Tindall av Bronson Wm M (Elsie) lab h414 (314) Womack Brookins Corrine nurse h rear 607 4th av (U) Brookins David lab r454 Pine Brookins Fred lab r443 Alabama Brookins Ruby r207 Holt av (NH) Brookins Terry (Alice) lab hl42 (112) 1st av (V) Brooks Adam porter r341 4th av (V) Brooks Addie (wid B R) r135 Academy Brooks Annie B nurse r341 4th av (V) Brooks Camilla cook hl29 Jones Brooks Candler A (Cornelia) mgr Credit Dept Fourth National Bank h Ingleside av (I) Brooks Cecil slslmn rl47 Charles (SM) Brooks Chas r630 (930) Vineville av Brooks Chas (Mattie) lab h533 Coleman al YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Br0LoSg?aabinidrRUby: ^ Dental Laboratory) h Brooks Chas W (Viola) wtchmn h970 Hazel Brooks Claude (Daisy) firemn h854 Ash Brooks Cora hlOl Green Brooks Eliz Mrs bkpr Dannenberg Co r2, 853 Cherrv Brooks Eliz rl22 Lamar Brooks Emmett M rl05 Main (Stinsonville) Brooks Emmie Mrs r863 2d Brooks Essie M cook rl29 Jone& Brooks Estella dom r2 Turpin Brooks Fannie lndrs hl06 Ruby Brooks Floyd (Lyndie) soft drinks h209 Elliott (EM) Brooks Frank elk G R Kinney Co Inc r814i/2 2d Br92k6|9a G Maple aSSt stereotyPer Macon Telegrap^ h r Brooks Fred (Ida) janitor h379 Monroe Brooks Geneva r341 4th av (V) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & C0., Detroit go zH 2zC >^1n>n rS| "22 m >m m 3 cn 210-212 MORRIS HARRIS INSURANCE SURETY BONDS Bibb Building Telephone 131 (1925) R. L. POLK & CO.'S Brooks Geo (Mary) lab hll9 Edgewood av Brooks Geo lab h rear 23 White Brooks Geo E pntr r203 Fairview Brooks Harold lab r708 Crisp Brooks Harvey mill hd r242 Roff Home rd Brooks Hattie lndrs r714 Hawthorne Brooks Hattie maid r708 Crisp Brooks Irene lndrs r49 White Brooks Jas lab r341 4th av (V) Brooks Jas D (Beulah) collr Coml Loan & Inv Co r 424 Johnson av Brooks Jas E Rev r310 Middle Brooks Jas H (Bessie) mill opr hlO Shell av Brooks Jas L (Mary C) chf elk hl29 Magnolia Brooks Jerry C (Chanie) lab rl012 Main Brooks Jesse B wtchmn Macon Milling Co Brooks Jesse C (Alpine) asst stero Macon Telegraph r269 Maple Brooks John (Mary) lab h411 Hall Brooks John B (Princie) solr Barnes & Barnes Inc hl22 Lamar Brooks Jos A prin Stinsonville Sch hl05 Main (S) Brooks Jos D rl05 Main (Stinsonville) Brooks Lewis B (Hattie B) mgr Cudahy Packing Co h 108 Magnolia Brooks Lillie P lndrs r515 Johnson's al Brooks Lorena cake baker r401 Virginia av Brooks Louise mill wkr r437 Alabama Brooks Lucy (wid Nelson) lndry wkr h224 Green Brooks Mary C (wid Marvin K) h427 Forsyth Brooks Mary C bkpr United Credit Co r427 Forsyth Brooks M Lula (wid Beverly) h269 Maple Brooks O Linwood (Laura B) cond h822 1st Brooks Paul W (Alma) and Massee-Felton Lmbr Co rl25 Oakland av Brooks Rena rl2 Balkcom av BROOKS ROBERT P (Undine), V-Pres and Genl Mgr Ellis Motor Co, hBOl Carling av, Phone 5353 Brooks Ruby slsldy Burtons Inc r203 Fairview Brooks R Frank (Mamie; Lyon, Harris & Brooks) h 863 2d Brooks Sami (Rebecca) porter h341 4th av (V) Brooks Sarah matron Macon Hospital __ A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 183 Brooks Thos J lab rll9 Edgewood av Brooks Tillman (Rody) barber h317 Norris Brooks Wm (Luejean) baker h203 Fairview Brooks Wm B (Alice L) garage 215-219 3d h 161 Mag nolia Brooks Wm B (Jessie L) slsmn Dunlap Huckabee Auto Co rl61 Magnolia Broome Christine tchr Wesleyan College I1IO6 Holt av Broome Christopher C (Willie) slsmn hl06 Holt av Broome Dallas elk r Y M C A Broome J M (Allene) flagmn r452 Edgewood av Broome Rufus P (Lillian) flagmn r301 Mikado av Broomfield Geo elev opr r408 Monroe Broomfield Julia lndrs h205 Woodliff Broughton Alberta maid rl53 Park Hotel al Broughton Amelia maid rl53 Park Hotel al Broughton Chas wtchmn Sou Ry Co Brougfhton Lula lndrs hl53 Park Hotel al Broughton Viola maid rl53 Park Hotel al Browder Timothy slsmn rl31 Clisby BROWDER T J, Asst Traffic Manager Chamber of Commerce, rl25 Clisby Brower Willie opr (wid Wm M) h228 Hydrola Brown Aaron (Mercedes) lab hl4 Harris al Brown Abr bellmn r809 Edgewood av Brown Abram (Lessie) lab hll8 Rock Hill la Brown Ada lndrs rl05 Gustin av (V) Brown Addie M Cook rl60 Academy (E) Brown Adelle maid Frank Lane Brown Agnes maid r918 Atlantic av (SM) Brown Albert (Susie) firemn r300 (104) Colquett Brown Alex (Mary) cemetery kpr hll5 Enterprise Brown Alex prsr hll7 Williams la Brown Alford L (Lilia) mach hl03 Capital av Brown Alger J (Clifford) lab h232 Powell (EM) Brown Alice student r C T Brown Brown Alice M r690 College Brown Anderson (Mary) lab h809 Elbert Brown Andrew W (Annie) barber 319 Broadway h504 Broad Brown Annabelle H (wid Reeves) h314 College Brown Annie cook h578 Monroe Brown Annie lndrs hl23 Virginia la Brown Annie L lndrs r202 Edgewood av it More are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 184 (1925) R. L. POLK & CO.'S Brown Annie M lndrs rl23 Ash Brown Arline rl713 2d Brown Arth (Malissa) carp hl40 (375) Neal av Brown Arth F bkpr Steven M Solomon jr r604 1st Brown A Sidney archt 361^2 Cotton av r711 Forsyth Brown Benj chauf r379 Middle ' Brown Beni O (Bessie) farmer hl028 Clinton rd Brown Bernard H (Nellie) ship elk rl32 Ellis (SM) Brown Berry (Ella) lab hl36 Cowan Brown Berry jr janitor rl36 Cowan Brown Bertha h607 Ernest Brown Bertha cook hll Cheatham al Brown Bessie cook hl4 Magnolia la Brown Bessie dom r365 Hawthorne Brown Buster lab r811 Elbert 1f7 Brown Carl H (Gwendolin) dentist 601 Bibb bldg rl7 Arlington pi Brown Carlton (Mary) elk Crumps Pk P 0 ro25 Georgia av Brown Carrie h222 Madison Brown Carrie cook h264 Singleton la Brown Carrie L tchr r822 Orange Brown Carribell r238 Roye Brown Cath Mrs bkpr A G Rhodes & Son rl06 Rogers av Brown Catholine cook rl44 Sycamore Brown Chas (Mary) driver h205 Wood al Brown Chas lab rll29 Broad Brown Chas (Celia) lab r314 Edgewood av Brown Chas (Annie) lab h3 Wutenville rd Brown Chas mach r526 Edgewood av Brown Chas porter rl67 Aster Brown Chas jr waiter r859 Cherry Brown Chas D (Mattie) wtchmn h612 Main (EM) Brown Chas F (Supsie) formn h ws Parkwood av 3 s Forsyth rd Brown Chas N elk r612 Main (EM) Brown Chas M (Juanita) elk h5 Dessau pi Brown Chas T (Carrie) jwlr h Log Cabin blvd Brown Charlton draymn h9 Bright al Brown Clarence (Josephine) lab h240 Gilmer Brown Clarence B (Sarah) pntr hl04 Cedar (SM) Brown Claud (Sally) firemn h979 Short (EM) Brown Claud (Mary) janitor h276 4th av R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 281 Crossley Julian M (Saxon E) mach rll34 College Crossley Margt sten John E Wilson rl66 Magnolia Crossley Philip M (Julia) hl66 Magnolia Crow Aaron C (Ruth; Terminal Tailors & Haber- dashers) hll6 Boulevard (N H) Crow Andrew lab rll6 Moore la Crow Clinton M (Fannie) slsmn h509 American blvd Crow Jas L (Mattie) r509 American blvd Crow Merk r509 American blvd Crowder Auretta student rl82 Grants Crowder Benj (Nancy) lab hl82 Grants Crowder Geo (Elnora) lab hl34 Phillips la Crowder Theo lab rl82 Grants Crowder Thos 0 (Anna M) mgr Georgia Investment Co r267 Orange Crowell Frank (Minnie) barber Haverfield Smith & Wood h256 Church (E M) Crowell Jos (Julia) firemn h!127 Walnut Trucks and Auto Repairing N. L PAH Authorized for White Motor Trucks 657-659 THIRD ST. PHONE 4846 Crowley Thos J (Mary) v-pres Corbin Supply Co hl09 Elizabeth pi (V) Crumbie Abbott (Laura M) r852 Hazel Crumbley Viola dressmkr 223 5th h do Crumley LaFayette H (Ruth) mgr Swift & Co h301 Hillyer av (C H) Crumley Rebecca cook h225 Hendrix la Crump John D (Jennie) v-pres J B Riley Drug Co h 364 Cherokee av Crump Kate P r325 Forsyth Crump Lewis N student r325 Forsyth Crump Stephen A (Leila) lawyer h325 Forsyth Crump's Park A M E Church Stinsonville Crump's Park Filling Station E F Monsees prop Park av and Forsyth rd (V) Crump's Park Grocery (Mrs L M Johnston) Forsyth rd (V) Crump s Park Post Office Luther A Jenkins postmas- ter Forsyth rd (V) . FOR LISTS OF NAMES ` ANY TRADE -- ANY BUSINESS -- ANY PROFESSION ^DETROIT R. L. POLK & CO. CHICAGO City Directory Answers AO Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 282 (1925) R. L. POLK & CO.'S Crumpton Leroy (Clara) flagmn rll5 School Crumpton Wm R (Bertha) electn hl315 Broadway Crushwheel Wm (Viola) brakemn r608 Flanders (E M) Crutchfield Edw (Olive) flagmn hll71 Oglethorpe Crutchfield J Roscoe (Lena) flagmn r562 Edgewood av Crutchfield Leon (Lucile) mill hd r7 Randolph pi Crutchfield Wm A h201 High Crute W Frank pressmn Macon Telegraph res Bloom- field rd Crystal Market (J T Hamlin) meats 662 Poplar Cubbedge Lawrence L (Alice) and r62 Arlington pi Cubie Frank (Annie) driver h302 Curd's al Cudahy Packing Co L B Brooks mgr 336 Poplar Culbert Swinson condr r871 2d Culbreth Louise r J J McMorris Cullen Madison lab rl05 Dempsey Cullen Ruby r!05 Dempsey "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH fsSDIHiflerAiEmegyIAho,LytLuYoaTrup.nHrrgdouYFdvmeooe. nrlcsaTtasisathstairitoilcesen.A,niNasoTtIDtafHyaEoUtdhuhYaSerneEyagDAlePtbrRrhYulyEegsOeigpgdRUinisAnNato'kLlns-. Cullen Thos (Amy) brickmason hl05 Dempsey av Cullens Anne Indrs r514 Mitchell la Cullens Lum (Lennie) chauf h514 Mitchell la Cullers Dallas (Stella) hlpr 323 3d av Culley Amy rl05 Dempsey Cullins Jas lab r3 Alabama Cullins Josephine cook h3 Alabama Cullins Louise nurse Macon Hospital Cullins Maggie maid E G Tzimka r318 Wall Cullins Wm (Willie) carp h802 Fort Hill Cullins Willie r3 Alabama Cullins Willie M nurse Macon Hospital Cullum Connie lab r463 Alabama Culp Early lab r633 Fort Hill Culp Elber lab r633 Fort Hill Culp Jos (Rosa) car hlpr hl03% Elliott (EM) Culp Wm (Lillie) lab h.633 Fort Hill Culpepper Arie (Minnie) carp h208 North R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY CtoO THE CHIROPRACTOR BLDG. PHONE in Will Remove the CAUSE of Your Disease 4557 MACON CITY DIRECTORY (1925) 283 Culpepper Clara tchr r4l6 American blvd Culpepper Clara C elk Brown Grocery hl05 Stonewall Pi (V) Culpepper Eunice nurse Middle Georgia Sanatorium r do Culpepper John A (Julia) mach hll2 Emory Culpepper John C (Dona) truck driver h512 E 2d (E M) Culpepper John W (Annie G) car repr h2080 3d Culpepper J W Edw (Nellie) wdwkr h414 Clinton (E M) Culpepper LeRoy (Gladys) condr h659 1st Culpepper Lillian slsldy S H Kress & Co r416 Ameri- can blvd Culpepper Louise or Sou Bell Tel Co r416 American blvd Culpepper Minnie (wid Sami E) h416 American blvd Culpepper Sami (Ruby) driver Willingham Sash & Door Co h321 Jackson in sa r re E3 O CD S3 * Pi 73 MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Culpepper Sami C (Ruby) elk h314 Winship Culpepper Savannah nurse h250 (190) Lincoln av Culpepper Walter T (Sadie) filtermn City Water Wks1 h202 Long Cabin dr Culver Chas (Gertrude) driver hll9 Forest av (V) Culver Chas (Annie) lab r210 Fargason Culver Douglas (Frances) slsmn rl31 Clisby Culver Ella r90 (124) Forest av (V) Culver Eula rl62 Magnolia Culver Harriet nurse rl02 Rembert Culver Jas M (Nannie) auto mech h568 1st Culver Mabel sten H M Smith & Co rl62 Magnolia Culver Mary E (wid Zack) hl62 Magnolia Culver Mauvone slsldyd S H Kress & Co r568 1st Culver Mildred nurse Middle Georgia Sanatorium r do Culver Price (Emma) plstr h90 (124) Forest av (V) Culverhouse Geo M mgr Ga Grocery res Lorain Ga Telephone 2687 J. T. MOLTON, Mgr., 348 Oak CO o G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muoh Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &CQ. Polk Directory Bldg. Detroit, Mich. 284 (1925) R, L. POLK & CO.'S Cumbie Lorendo A (Leroy) cond hl08 Ponce DeLeon av Cummings Alpheus (Nora) transfer hl531 Broadway Cummings Annie B nurse r414 Lawton av Cummings Bessie maid r284 Orchard av Cummings Chas porter Stewart Oil Co Cummings Chas T (Mary) foremn h706 1st Cummings D hlpr Taylor Iron Works & Supply Co r 616 Ross Cummings D C cashr r YM C A Cummings Edw D (Alice) hl4 Wise av (V) Cummings Eliz h813 Ocmulgee Cummings Fannie maid r284 Orchard av Cummings Frank (Ella) lab r231 Turpin Cummings Harris (Josephine) lab h4 Bright al Cummings Jas (Liza) lab h241 Church la Cummings Jesse (Laura) lab h231 Turpin Cummings Johanna cook r211 Middle (V) Cummings John (Mary) lab hl41 4th av (V) Cummings John lab hl74 Hazel Cummings John lab r454 Pine Cummings J Marshall mech Adams-Richardson Lum- ber Co r706 1st Cummings Lynwood r816 Edgewood av Cummings Mack (Nissie) h742 Oglethorpe Cummings Margt student nurse r706 1st Cummings Martha maid r275 4th av (V) Cummings Mary h816 Edgewood av Cummings Nellie lndrs h275 4th av (V) Cummings Raymond student r706 1st Cummings Sallie slswmn W T Grant Co r706 1st Cummings Uriah r816 Edgewood av Cummings York lab hl52 Park Hotel al Cummins Davis (Mamie) baker h439 Alabama Cummins Robt R div rd mstr C of Ga R R Cummins Sign Co (T E Cummins) 671 Cherry Cunningham Celeste rl505 3d CUNNINGHAM CHARLES C (Lucy), Cashr Macon Savings Bank, r308 Hines ter Cunningham C Clifford (Lila) traf mgr h761 Pine Cunningham Danl (Annie) h655 Arch Cunningham Emily C (wid Frank M) h313 Orange Cunningham Emily F student r313 Orange KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4y2% on Savings MACON CITY DIRECTORY (1925) 285 Cunningham Ernestine bkpr rl505 3d Cunningham Geo E wtchmn W E Dickey Clay Mfg Co hl505 3d Cunningham Joel E (Rebecca) auto mech hll3 Crisp Cunningham Lawrence E (Dorothy) switchmn hl08 St James av Cunningham Louis D (Bertie) foremn h41 Pio Nono av Cunningham Marguerite Mrs beauty culturist r3, 415 New Cunningham Musa Mrs hl02 2d Cunningham Nora lndrs r379 Monroe Cunningham Plez (Ida) carp h229A Jefferson Cunningham Stewart O (Virginia) mgr Red Star Fill- ing Sta r778 Walnut Cureton Chas H (Patricia) cashr Ga Peach Growers Exch rl26 High Curington Jack G (Annie) service mgr Yates Motor Co r655 1st SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Curl John A (Sallie) pntr hl48 Deborde av Curl John B pntr rl48 Deborde av Curlette LaVada Mrs waitress r477 Spring Curry Albert chauf h616 Dunlap al Curry Annie M mach opr hll3 Yates av (E M) Curry Chas R slswmn Ga Furn Co h2324 2d Curry Dorsey (Carrie) lab h51 Chestnut la Curry Edmond (Liza) lab h9 Short st la (E M) Curry Edw lab r765 Glen Curry Essie M maid 125 Hazel Curry Geo (Lillie) chauf h Industrial Home rd Curry Henrietta lndrs r24 Magnolia la Curry Henry (Bertha) lab h357 Hazel Curry Henry (Rosa) presser Martin Cleaning Co hi W Boundary Curry Isabelle rl04 Pio Nono av Curry Jennie dom r24 Magnolia la Curry Lizzie cook h24 Magnolia la FOR LISTS OF NAMES .JRADE^-- ANY BUSINESS - -- ANY PROFESSION PigmoiT R. L. POLK & CO. Chicago FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 286 (1925) R. L. POLK & CO.'S Curry Manly L student rl37 North av (N H) Curry Margt lndrs r311 Bdgewood av Curry Minnie r816 Edgewood av Curry Narcissus (wid Marion G) r711 (710) Woolfolk Curry Richd (Liza) lab h237 Jones Curry Rosa L nurse r216 Fretwell Curry Sherman lab r765 Glen Curry Sidney lab rl21 Boardsman al Curry S T lmbr stacker rl04 Roye Curry Taylor (Mary) carp hl04 Pio Nono av Curry Thos (Ethel) lab rl234 1st Curry Thos (Minnie) lab h843 (844) Fort Hill (E M) Curry Wm (Alice) plstr h861 Edgewood av Curtis Annie r910 Hazel Curtis Bessie cook h318 1st av (V) Curtis Carrie lndrs r619 (622) Maynard Curtis Geo (Lula) lab hl22 Strayers al Curtis Georgia lndrs rl226 Broad Curtis Jas (Sarah) h Industrial Home rd Curtis Jas rl06 Rock av Curtis Jas iron wkr r542 Jackson Curtis Jennie Mrs hl310 2d Curtis John H (Nancy) farmer rl226 Broad Curtis Jos C (Jennie) elk C of G R R Co rll4 Forsyth Curtis Lawson (Lizzie) lab h619 (622) Maynard Curtis Louise lndrs rl226 Broad Curtis L Otis (Tressie) elk hl02 Riley av ( CP) Curtis Mary A pupil nurse Oglethorpe Private Infirm- ary r204 Tatnall Curtis Nettie dom r619 (622) Maynard Curtis Obie (Carrie) deliverymn h314 2d av (V) Curtis Sylvia lndrs h706 (442) Hall Curtis Wm (Martha) lab r455 Barracks al Curtis Wm (Nettie) lab h414 Gilmer Curtis Wm C lab r414 Gilmer Curtis Wm M (Janie) elk C of G R R Co hll9 Ayers rd Curtis Wm N (Polly) tmstr h310 Calhoun Cushman A P rooming 758 Cherry h do Cusson Charlotte M sten The Burke Inc rll4 Magno- lia Cusson Eliz M tchr rll4 Magnolia Cusson Julia rll4 Magnolia Cusson Larkin G (Julia) elk W S Dickey Clay Mfg Co h!14 Magnolia 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 287 Cutler John M (Willie B) div frt agt Sou Ry System r317 Orange CUTLER JOHN M JR (Louise), Loans on Real Estate, Farm Lands and Mortgage Bonds, 908 Ga Casualty Bldg, Phone 863, r53 Arlington pi, Phone 3151 (See front edge and page 73) Cutro Antonio (Mattie) h617 Arch Cutter Howard D (Callie) civ eng 563 Mulberry hl29 Summit av (N H) Cutter Margt tchr Wesleyan College r318 Cutter's Green Cutter Wm H (Belle) carp h318 Cutter's Green Cutto Geo porter r342 Hammond Cynthia Holiday Hall 517 Adams Dago Elnora drsmkr h204 Lynwood av Dailey see also Daley and Daly Dailey Jas (Lena) lab h351 Church al Dailey Sallie r351 Church al Dallas Investment Co G W Wheeler mgr 721 Broad- way MACON OPTICAL COMPANY Frank H. Johnson . Opticians feA Optometrists 468 CHERRY LA > - PHONE 3213 Dallas Lucy Indrs hl68 Coles al Dalton Adding Machine Co R C Taylor mgr 419 2d Dalton Fanny emp Dr C A Yarbrough r254 Madison Daly see also Daley Daly Adele M (wid Francis J) r570 College Daly Augustin (Hunter & Daly) h Curry dr N H Daly Augustus lawyer rl38 Curry dr Daly Christoper B (Edwina) gro 2314 2d h do Daly Eloise student r2314 2d Daly Francis X (Lucile; F X Daly Co) hl04 Boule- vard (N H) Daly F X Co (F X Daly) plmbr r613 Poplar Daly Henry trav slsmn r771 Oak Daly Jas porter Gulf Ref Co Daly Jas J (Murray) bkpr P E Hertz h318 New Daly Janie (wid Ignatius) r771 Oak Daly Jos K (Leta) slsmn rl23 Highland av TELEPHONE 287 Bottles POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 (r The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. c/5 SS DS M S WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 288 (1925) R. L. POLK & CO.'S Daly J Vance pharm Vineville Drug Co r560 Plum Dame Aubrey J (Gladys) service stock Adams Buchanan Motor Co h2504 2d Dame Mattie (wid Thos J) h2601 2d Dame Reva B (Gertrude) pres Macon Milling Co h400 Hillyer av Dame Sami J (Louise) opr Yellow Cab Co h618 New Dame T J (Pauline) asst chf elk r407 Carling av Dameron Iris student r2165 2d Damour Edw A real estate r202 High Damour Hypolite h421 Walnut Damour Hypolite jr r421 Walnut Damour Laura S (wid Chas E) h202 High Damour Paul r421 Walnut Dampier Chas B (Madie) mech S M Solomon jr h520 Mikado av Danford Ella lndrs hl63 (149) Lynwood av Danforth Josephine lndr h626 Gresham la Danforth Metta T prin Green St School r205 College Danforth Ollie lndrs r536 Ocmulgee la Danforth Remus (Metta) shoe repr 24 Wall h205 College Daniel Arth mech rl05 Forest av (V) Daniel Chas (Elnora) lab r5555 Fulton al Daniel Clara dom r608 Hammond Daniel Clarence R collr r2909 Houston av DANIEL CLYDE, Mgr Macon Orange Crush Bottling Co, r604 1st, Phone 3805 Daniel Ella hlOl Cheatham al Daniel Floyd lab r356 Church al Daniel Frank (Hattie) lab h257 Garden Daniel Fred M (Mary L) sec-treas Bibb Grocery Co h34 Arlington pi Daniel Geo (Jessie M) lab h315 Coles al Daniel Henrietta lndrs rl208 3d Daniel Jas mech hlpr r216 Hawkins av Daniel Jas W tchr Wesleyan College h403 Orange Daniel John (Mary) farmer r507 Norris Daniel John (Fannie) lab h29 Dixie row Daniel John (Margie A) lab h503 Plumtree Daniel Jos W (Bonnylin) v-pres-genl mgr Bibb Gro- cery Co h492 Hillyer av Daniel Judson J (Maggie) slsmn r2909 Houston av Daniel Leola maid r714 (701) Elbert Automobile owners are select prospects for o many kinds of merchandise. Send to Headquar* ters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 289 Daniel Liza rl6 Spring Daniel Lizzie lndrs r507 Norris Daniel Mansfield r830 Edgewood av Daniel Mary r830 Edgewood av Daniel Mary lndrs r651 Ross Daniel Mattie nurse Macon Hosp Daniel Minnie (wid Jas) h215 Powell (EM) Daniel Orman phys 509 Citizens & Sou Bank bldg rl8 Nevarro apts Daniel Rethabell cook rlOl Cheatham al Daniel Rhelia maid r454 Pine Daniel Robt rlOO Blount Daniel Robt butler rl217 3d Daniel Sherman (Emma) lab hl307 1st Daniel Sherman jr lab rl307 1st Daniel Stella tchr rl03 Academy Daniel Walter (Annie M) hl'00 Blount Daniel Walter jr rlOO Blount Daniel Wm (Anna) hlpr h201 Wood al Daniel Wm jr (Mattie) hlpr h203 Wood al Daniel Wm (Ella) lab h201 Long la Daniel Wm (Hannah) lab r251 Whitlock Daniel Wm B (Urquhart) chemist hl03 Academy Daniel Wm L (Marie K) mgr Fit Right Tailors M59 Oak Daniel Wilson (Georgia) chauf h206 (276) Astor (EM) Daniels Annie (wid Thos) maid hl36 Wing's Hill Daniels Clyde r604 1st Daniels Edw A student rl045 College Daniels Emmett (Alice) millwkr h23 Brigham Daniels Eulysees del boy Daniels Henry (Bertha) expressmn h460 E Academy (EM) Daniels John lab h306 Ash Daniels John H (Arizona) porter h rear 618 Oak Daniels Jos mill hd rl037 1st Daniels Jos orderly r321 3d av (V) Daniels J J collr Empire Furn Co h Houston av Daniels Kit (Hattie) lab r214 Division Daniels Lois ins agt r455 4th av (V) Daniels Margt Mrs elk W T Grant Co rll20 Ash Daniels Mary lndrs r65T Ross for lists of names ANY TRADE ANY BUSINESS ^ -- ANY PROFESSION DETROIT R. L. POLK & CO. CHTOAQO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 290 (1925) R. L. POLK & CO.'S THE DIRECTORY IS THE GREATEST MARKET PLACE SN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Gan Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MJkiCo PUBLISHERS Daniels Nelson A (Willie) waiter Union News Co hl98 Washington (EM) Daniels Simon (Rachel) service boy h326 (227) Roye (V) Daniels Wm (Lena) lah h471 Hazel Daniels Wm (Lola) lah h509 Flanders (EM) Danley John (Louise) farmer h305 E 2d (EM) DANNENBERG COMPANY THE, W F Dannenberg Pres, R N Nussbaum Y-Pres, W M Collins SecTreas, Department Store 462-464-466-468-4:70 8d, Phone 600 (See page 63) Dannenberg Dorothy student r804 Mulberry Dannenberg Jos W (Clarice) dept mgr Dannenberg Co hl500 Forsyth rd (V) DANNENBERG WALTER F (Lillie), Pres The Dannenberg Co, h804 Mulberry Danneman Aaron (Jennie) meats 478 Cotton av h273 Washington av Darby Annie M r527 Linden av Darby Harry H (Annie) plmbr h527 Linden av Darby John elk r527 Linden av Darby Malissa (wid Henry) h234 Plant Darby Missie (wid Luther) h203 Campbell av Darby Pearl Indrs r203 Campbell av Darden Douglas (Sarah) driver h336 (335) Boards- man al Darden Fred (Estella) truck driver rl226 1st Darden Robt (Smithy) eng rl43 Cole Dare Anna dom rl307 Vineville av Dargan John I (Lon) h264 Forsyth la Danty Carlton C (Elmer) h909 Walnut Danty Hilton r909 Walnut Danty Wm (Lizzie L) mech r909 Walnut Darling Sami C mgr r573 Orange Darnell Chas T (Minnie) cond h461 Napier av Darnell Lillian student r461 Napier av Darsey see also Dorsey Darsey Della millwkr r Minnie Freeman Darsey Edna companion r207 Oak Haven av Dasher Benj J (Odille K; Dasher & Mann) pres Se- curity Loan & Abstract Co h517 Napier av Dasher John M (Bertie; J M Dasher Lbr Co) h371 Orange PoltDiiecbBiM A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 291 Dasher J M Lumber Co yds (J M Dasher) Poplar nr 12th Dasher R Earl elk L W Rogers Co r611 2d Dasher & Mann (B J Dasher, W A Mann) lawyers 5th fl Macon Sav Bk bldg Dashier Annie L Mrs smstrs Union Dry Goods Co h 754 Cherry Daugherty Anna M lndrs rl33 Bay Daugherty Harrison (Susie) supt Methodist Orphans Home and South Ga Conference Orphans Home hl'21 Pierce av Daugherty J H mach W E Dickey Clay Mfg Co h.801 Main Daugherty Lucius L jr (Hallie; L L Daugherty Jr & Co) res Daytona Fla Daugherty L L Jr Co (L L Daugherty jr, A C Soule jr) lmbr 413 Bibb bldg Daugherty Maria (wid Jas) r509 Hawthorne Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Daugherty Susie Mrs matron Methodist Home r do Daugherty Thos (Ruby) blrmkr r509 Hawthorne Daugherty Dylie (Carrie) mech Dixie Ice Cream Co hl33 Bay Daughtery Jos carp rlOll Elbert Daughtery Jos jr carp rlOll Elbert Daughtery Ruth bkpr Dunlap-Huckabee Auto Co Daughtry Emma (wid Jacob E) 99 Green (Payne Mill) Daughtry Gertrude r99 Green (Payne Mill) Daughtry Katie millwkr h99 Green (Payne Mill) Daughtry Oscar mech r202 Reid Daughtry Ruth bkpr Dunlap-Huckabee Auto Co res R D 4 Dauwaltus Mary Mrs sten Cit & Sou Bank r243 Winship Dauwaltus Raymond R (Mary) asst supt W S Dickey Clay Mfg Co h243 Winship Davenport T F elk S of Ga R R Co r Central Hotel DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 TM s More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 292 (1925) R. L. POLK & CO.'S Davenport Wm A (Louise) swtchmn r2604 Broadway Davenport W H elk C of G R R Co res Rutland Ga Davidson Alf R collr P T Vincent Realty Co r R P D No 1 Davidson Alura entry elk Dannenberg Co r712 Pine Davidson Anna L (wid Wm) r212 Pierce av Davidson Annie Mrs opr Sou Bell Tel Co rl35 Stratton Davidson Chas (Ada; Davidson Service Station) hl36 Colquitt (SM) Davidson Dorothy tchr r W E Davidson Davidson Edw elk Jones Park & Johnston r Cherry av Davidson Ernest auto mech r John Davidson Davidson Hiram rl985 3d Davidson Homer C h912 Ash Davidson Isaac L (Nina) car repr hl42 Ella (SM) Davidson John (Ada) carp h Burton av Davidson John L (Sallie) inspr City Water Wks h464 Beech av Davidson John L pipeftr Macon Water Works r Cherry av Davidson John W (Ada) h Bailey av Davidson Kath student r464 Beech av Davidson Lewis E (Lillian) carp h77 Dempsey av Davidson Lon D (Anna) pntr hl35 Stratton Davidson Lula elk r712 Pine Davidson Lula student r464 Beech av Davidson Maria L (wid Jas I) smstrs Electric Dry C Co r712 Pine Davidson Mariah (wid Jas) h712 Pine Davidson Mary student r464 Beech av Davidson Sallie opr Sou Bell Tel Co rl47 Rose Park Davidson Sarah P elk City Water Wks r464 Beech av Davidson Service Station (Chas Davidson) ss Forsyth rd (V) 2 w Park av Davidson Sophie (wid Elbert) smstrs Bibb Mfg Co r 233 Telfair Davidson Wm lab r349 Hawthorne Davidson Wm E (Maude) coal h Forest Hill av Davidson Wm E jr student r W E Davidson Davis Abram J student r J A Davis Davis Ada (wid John W) h!15 Madden av Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 293 Davis Addie nurse h231 4th av Davis Adolphus J (Cath) supt hl26 High Davis Agile slsldy S H Kress & Co rl28 Violet av Davis Alex (Carrie) pntr h209 Lynwood av Davis Alice (wid Malcolm) hl28 Violet av Davis Alton bkpr rl26 High Davis Ambrose S elk Macon Co-operative Store r!21 Williams Davis Anna (wid Bennie) Indrs h405 (520) Colquitt Davis Annie marker Independent Lndry Co r267 Washington av Davis Annie L cook h.58 Schofield Davis Annie M Indrs r2 Harris al Davis Anthony (Marie) porter hl30 Cedar Davis Arth (Mattie) lab r439y2 4th av (V) Davis Asalee Indrs r693 Hall Davis Asberry barber r202 Lexington (EM) Davis Augustus (Lillie M) tailor M L Fleming r833 W 3d av (PH) YATES MOTOR GO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Davis R Jos (Annie) elk h606 Carling av (HH) Davis A J (Ruby) slsmn Jones Motor Co r322 Cherry av Davis Bartow (Ollie) lab r310 Railroad av Davis Beatrice nurse r414 Lawton av Davis Beauty Shop Mrs E B Davis mgr 405 Cherry Davis Benj (Irene) carp h328 Elizabeth Davis Benj (Lula) driver H'ubbard Undertaking Co h610 New Davis Benj (Lena) lab h752 Stein's al Davis Bertha cook E H Middlebrook rl Davis Davis Bessie r522 Ocmulgee Davis Beulah Indrs hl39 Ellis av Davis Bonnie S tchr rll2 Rogers av Davis Bright (Annie) hl72 Bartletts Davis Camille student rl03 Pierce av Davis Carl J (Ruby) credit mgr Happ Bros Co h ws Land av (I) o FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION W DETROIT R. L. POLK & CO. CHICAGO 210-212 MORRIS HARRIS Bibb Building til J 294 INSURANCE SURETY BONDS Telephone 131 (1925) R. L. POLK & CO.'S p Davis Carlos R agt Life Casualty Insurance Co r280 z>-- Orange Davis Carrie cook hl08 (120) Richard 2 Davis Carrie lab hll7 Elliot (EM) Davis Celia (wid John) h626 Prince Davis Chas (Dollie) carp h207 Chestnut Davis Chas (Fannie) lab h322 Burnett (EM) Davis Chas lab r210 Clara (EM) Davis Chas (Millie) lab h79 Croft la Davis Chas lab h502 East Academy (EM) Davis Chas (O May) lab r314 Norris Davis Chas porter Peeler Hardware Co r Clara (EM) Davis Chas C lab r429 E 2d (EM) DAVIS CHARLES H (Odessa D), Cashier Northwestern Mutual Life Insurance Co, hl43 Rose Park, Phone 3030-W Davis Chas W (Rebecca) slsmn Morris & Co r653 Forsyth Davis Chester porter L & N Drug Co rl54 Paradise al Davis Clara S Mrs hll2 Rogers av Davis Clarence B lab r698 Williams Davis Clifford W (Alice) porter h319 Patterson Davis Collis R (Lillian) agt h280 Orange Davis C Ferrell lino appr rl28 Ells (SM) Davis Daisy lndrs h414 Lawton av Davis Dewey H (Lula) section boss h841 Hazel Davis Dollie lndrs rl44 Bay Davis Dora sten r224 Jefferson Davis Durward plmbr 25 Wall r859 Cherry Davis Edw (Sally) farmer h734 (134) Maynard Davis Edw mach Willingham Sash & Door Co r207 Fairview Davis Edw (Sidney) slsmn h217 Applewood Davis Edw J (Mary) lab r5 Spring Davis Edw L (Rosalind C) investments 910 Ga Cas- ualty bldg hl07 Corbin av Davis Edwin rl543 Broadway Davis Edwin S (Camille J) life insurance rl03 Pierce av Davis Edwin S jr paymstr rl03 Pierce av Davis Effie tchr r207 Chestnut Davis Elijah W (Mollie) h!015 Edgewood av Davis Eliz (wid Richd) h37 Mellrose Davis Ella cook r609 Hazel A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. 0*4 HEAVY HAULING MACON CITY DIRECTORY (1925) Davis Ella G r820 Poplar 295 03 Davis Ellen (wid Lee) h651 Ash 8CL Davis Ellis (Azilee) carp h308 Ernest Davis Emma marker Independent Lndry Co r267 1 Washington av Davis Emma spinner r8 Bibb av Davis Emma L cook r321 McLean al Davis Ernest lab hl04 (122) Richard Davis Ethel (wid Gardner L) r615 Duncan av Davis Ethel (wid Wm) hlO Bibb av Davis Ethel cook r784 Nussbaum Davis Ethel B Mrs mgr Davis Beauty Shop r201 Katherine Ct apts Davis Eug (Lou) lab h309 Tindall av Davis Eulos lab r310 Croft la Davis Eutau cook hl23 Williams la Davis E Cliff (Lucile) slsmn h415 American blvd Davis E Mack v-pres Davis Richardson Lbr Co res Wayside Ga Davis Fannie Indrs h226 (160) Green Davis Fannie L Indrs h312 Bright al Davis Feltz student rll2 Rogers av Davis Ferrell appr Macon News rl28 Ell Davis Florence slsldy Union Dry Goods Co r R F D No 4 Davis Frances opr Sou Bell Tel Co r.1'25 Charles (SM) Davis Frank (Annie) lab r210 Lee Davis Franklin A (Alice) contr bldg h749 Ridge av Davis Franklin F (Kath) h803 Walnut Davis F Clark (Susie) phys 504 Mulberry hll2 Rogers av MOVING STORAGE Davis Gaston L bkpr Swift & Co r Y M C A Davis Geo h8 Duncan av Davis Geo (Julia) firemn h220 Gilmer Davis Geo (Sallie) lab r855 Smith row Davis Geo lab r355 Wall Davis Geo (Estella) ydmn h325 Jackson Davis Geo R lab r421 Gilmer Davis Gertrude rll5 Madden av Davis Gladys cook r603 9th av Davis Gladys mlnr Union Dry Goods Co r R F D No 4 Davis Green (Georgia) lab h421 Gilmer Davis Guilford lab hl55 Chestney -0 Davis Harold r213 Reid Er In> FOR LISTS OF NAMES w o ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L, POLK & CO. CHICAGO W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 296 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Davis Harry electn Morris Putzel Davis Hartley musician r362 Ridge av Davis Hattie lndrs hlOl Mutual av Davis Henry chauf r836 Port Hill Davis Henry (Rosetta) lab h358 Booker's al Davis Henry (Laura) lab hl66 Hazel Davis Henry (Ida) lab h778 Nussbaum Davis Henry (Janie) lab h857 (8658) 3d av (V) Davis Henry (Matilda) mill hd h8 Bibb av Davis Henry porter Oscar Bradley rllO Franklin DAVIS HENRY C (Willie), Mgr W S Dickey Clay Mfg Co, h223 Buford pi, Phone 4043 Davis Herman (Martha) lab Gibson Vinegar Wks h 222 Jefferson. Davis Herschel elk Union News Co r Academy Davis Hinton student rl'03 Pierce av Davis Hugh mach rl03 (123) Mutual av Davis Ike (Bliz) draymn h328 Monroe Davis Ike (Emma) lab h58 Dempsey av Davis Isaac porter Peeler Hardware Co r328 Monroe Davis Isaac restr h267 Ocmulgee Davis Izetta tchr rll55 Ash Davis Jack (Letha) lab rl05 Bay Davis Jack mill hd r8 Bibb av Davis Jack taxi driver rl08 (120) Richard Davis Jacob (Willie) lab h38 Woodliff Davis Jake (Dorcas) mech hl40 Cowan Davis Jas barber Union News Co Davis Jas (Georgia) carrier P O h246 Plant Davis Jas (Mamie) formn h4 Astor pi Davis Jas (Gertrude) lab r508 Elbert Davis Jas (Joulizzie) lab h223 Elliot (EM) Davis Jas (Mary) lab h203 Hazel Davis Jas lab rl05 Moore la Davis Jas (Lessie) lab rl232i4 Broadway Davis Jas (Mary) tmstr r320 Jackson Davis Jas (Lillian) transfer driver h2 n of Roye bet Roye and Pio Nono av Davis Jas T (Gertrude) brklyr h239 Bartlett Davis Jas W (Sallie) carp hl28 Ellis (SM) Davis Jerry (Harriet) pdlr h240 Ellis av Davis Jesse (Sallie) lab h213% Elliot (EM) Davis John (wid Sallie) lab r710 Campbell av Davis John lab r!52 5th Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 297 Davis John lab r219 North Davis John loader r720 Hazel ' Davis John (Kate) h332 (258) Pio Nono av Davis John (Ella) mach hlpr h352 Cherry Davis John A (Pauline) county probation officer h Forest Hill av Davis John L (Mamie) car bldr hl25 Charles (SM) Davis John M wearer r37 Melrose Davis John M (Sophie) lab h698 Williams Davis Johnnie L lndrs r301 Blount Davis Jos (Mellie) fruits 3061/2 3d 11304% do Davis Jos (Susie) opr h600 Main (EM) Davis Jos B barber r819 Ocmulgee Davis Jos W (Nettie) lunches 320 Dannenberg av hl4 Randolph pi Davis Josephine maid r280 1st av (V) Davis Julia lndrs h538 Army Lot Davis Julia lndrs hll3 Peacock Davis J B porter Ga Peach Growers Ex r209 Lin- wood av Davis J Darwin (Lucile) garage 310 Cedar (SM) h do Davis J E cabtmkr Macon Lumber & Mfg Co Davis J Frank (Nannie) signalmn hl522 Broadway Davis J Lafayette (Mabel) slsmn r208 Vineville av Davis J Thos (Ethel B) dep sheriff Municipal Court hll6 Stonewall pi (V) Davis Katie dom r224 Jefferson Davis Katie lndrs r321 E 2d (EM) Davis Lafayette (Mary) lab r220 Gilmer Davis Laura lndrs hl6 Gas House al Davis Laura maid 554 Plum rl66 Hazel Davis Lee (Nannie) judge h362 Ridge av / Davis Leila cook rll2 Ruby Davis Leila waitress Emmett Winkfield r Fort Hill (EM) Davis Lena (wid Robt L) h267 Washington av Davis Leneva lndrs r695 Hall Davis Leroy pntr r325 Madison Davis Lige (Gertrude) lab h200 Church al Davis Lillian r476 Jones st la Davis Lillian nurse r414 Lawton av Davis Lillie lndrs h5 Jordan Davis Lillie B cook h!08 Jones st la A natural by-product of die Directory Business is die compilation of Mauling Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 298 (1925) R. L. POLK & CO.'S Davis Lindsey lab h602 Mitchell Davis Liza rl23 Bartlett Davis Lizzie lndrs h720 Hazel Davis Lon (Annie) firemn r437 (441) Elbert Davis Lonnie J (Helen) elk W U Tel Co h205 Cen- tral av Davis Lonnie J jr carp r205 Central av Davis Lonnie (Nora) pntr h530 (541) 3d av (V) Davis Louise cook rll6 (16) Reid Davis Louise student r207 Fairview Davis Louise M student rl26 High Davis Loura rl08 (120 Richard Davis Lovie L cook r8 Clara (EM) Davis Lucile lndrs rl Booker's al Davis Lucile sten Yates Motor Co rllO Log Cabin way Davis Lucinda tchr r309 Tindall av Davis Lucious plstr r603 9th av Davis Lucius (Martha) lab hl315 1st M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuoYarTpu.nHrrgdouYdFvmeoeo. nlcrsaTtasisathstiaritoicelsen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbRrhrYulyEegsOeigpdgRUiinsnANatok'Lln-s., 1 H Davis Luke (Fannie B) pntr r361 Bay Davis Lula h554 Tinsley la L E Davis Lula (wid Zack) h Log Cabin Hts Davis Lula cook F M Pair r Grant rd L A Davis Mamie cook r427 Ridge av Davis Mamie tchr h330 Ward Davis Manda cook hl40 (138) Sycamore I T Davis Mansfield lab rl03 Tindell av Davis Manuel lab rl40 (138) Sycamore R I Davis Margt sten r205 Central av Davis Martha r615 Duncan av Davis Mary rl07 Corbin av 0 N Davis Mary rl2 (654) Tatnall la Davis Mary cafe 103 Division r220 Gilmore N G Davis Mary A sten Swift & Co rl248 Edgewood av Davis Mary C sten Christ Church Parish rl07 Cabin S av Davis Mary L h819 Ocmulgee 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSIOvN DETROIT R. L- POLK & CO. CHICAGO aENGLAND Tj THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 299 Davis Mary S maid Hotel Lanier r412 Ward Davis Mattie (wid J H) rl20 Inverness av Davis Mattie rl56 Phillips Datvis Mattie cook r308 Ernest Davis Mattie nurse h455 Martha (EM) Davis Ma'ude (wid Jas M) ftr Union Dry Goods Co h501 Carling av Davis Mayberta lndrs r693 Hall Davis Millie smstrs r280 1st av (V) Davis Minzer (Estella) lab h220 Jones Davis Mollie cook r520 E 2d (EM) Davis Napoleon butler rl05 Vineville av Davis Napoleon V rep U S Vet Bureau Davis Nel lab r205 Central av Davis Nellie lndrs h563 Henrietta Davis Nina opr Sou Bell Tel Co rl25 Charles (SM) Davis Nora lndrs r210 Wood al Davis Orbon (Annie) truck driver hl70 Astor (EM) MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Davis Oscar (Minnie) porter Maxwell Bros & Bridgers h81 Long la Davis O N Mrs slsldy Union Dry Goods Co h553 Orange Davis Park porter McManus Furn Exch Davis Pauline hl98 Virginia Davis Pearle (wid Frank) cook h603 9th av Davis Pearle cook h308 Ernest Davis Perlila lndrs rl40 Cowan Davis Perry (Willie M) cook h233 Morgan av (WH) Davis Putnam (Susie) porter Scott-Parker Co rl05 (107) Mutual av Davis Ralph porter College Hill Grocery r Cedar Davis Ralph F (Cath) cashr Am Ry Exp Co hl35 Oakland av Davis Reuben carp h2.1'3 Roosevelt (V) Davis-Richardson Lumber Co Inc W R Richardson pres E M Davis v-pres E P Stone sec-treas 307 Citizens and Sou Bank bldg Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Anssears All Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet R. L. POLK & Company Tharp's Pharmacy ton av S< Dunbar Sarah H nurse r61 Spring I2 Duncan Angeline cook r211 W Boundary Duncan Arth (Willie) lab h305 Gilmer Ssoi Duncan Basil (Mildred) lumber 722 Citizens & Sou Bank bldg h8E Massee apts w Duncan Bessie cook r3 Orchard av 3 S ^ Duncan Carrie cook hl39 Jones Duncan Carrie T (wid Geo W) r290 College Duncan Chas (Ella) lab r348 Turpin .2S Duncan Clifford (wid Seaborn) lndrs h538 Henrietta Duncan Emmitt lab r211 W Boundary Duncan Jessie janitor h203 Ward (V) Duncan Jos (Ida B) lab b.211 W Boundary Duncan Lee (Arizona) carp h201 Ward 3 Duncan Levi (Annie) chauf hl25 Ward (V) Duncan Lillie r211 W Boundary Duncan Lizzie lndrs h523 Hazel Duncan Lou L cook r211 W Boundary Duncan Mary baker Central Ga Baking Co r223 Ellis av (PH) Duncan Mattie asst matron Masonic Home Duncan Mattie B cook r211 W Boundary Duncan Mag nurse r211 W Boundary Duncan Maud lndrs hllO Bay Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 325 Duncan Robt lab r311 Elbert Duncan Robt lab r538 Henrietta Duncan Thos (Kattie) carp h400 (164) Royl Duncan Wm P (Lelia) real est hill Rogers av Dunham Alvin student r268 1st av (V) Dunham Chas L (Evelyn) mach h721 Plum Dunham Peter (Dennie) cook Loh's Cafe h268 1st av (V) Dunklin Wm F (Wilma) slsmn Coleman-Meadows- Pate Drug Co r869 Orange Dunlap Eliz student r R C Dunlap DUNLAP HARDWARE CO, S S Dunlap Pres, J L Watson V-Pres, J W C Mathews Sec-Treas, Hardware, Cutlery, Stoves, Tinware, Mechanics' Tools, Etc, 456 3d, Phones 26-27 Dunlap Hill Filling Station (R L Kitchens) 1028 Main DUNLAP-HUCKABEE AUTO CO, R C Dunlap Pres, L B Huckabee Y-Pres, R F Zeigler Sec-Treas, Buick and Cadillac Motor Cars, 682-690 3d, Phones 5100-5101 (See left top lines and page 52) YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES DUNLAP KINLOCH F (Marie; Macon Supply Co), Pres Macon Lumber & Mfg Co, hl04 Marshall av C P, Phone 2612-W Dunlap Kinloch F jr ship elk Macon Supply Co rl04 Marshall av (CP) Dunlap Mary cook h Bartletts la DUNLAP ROBERT C (Annie W), Pres Dunlap-Huck- abee Auto Co, h Shirley Hills, Phone 129 Dunlap Sami S pres Dunlap Hdw Co h367 College Dunn Carl elk r409 Spring Dunn Cornelius (Annie) gro 119 Elliott hl09 do Dunn Elery (Bernice) h736 Oglethorpe Dunn Ellis H h409 Spring Dunn Emma lndrs hll9 Elliott (EM) Dunn Geo r311 Corbin av Dunn Horace rll6 Tenny av Dunn John (Sally) h513 Fort Hill 317-319 Third St. Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 326 (1925) R. L. POLK & CO.'S Dunn John (Susie) lab h612 May av Dunn John jr firemn r612 May av Dunn John H (Annie L) carp hll6 Tenny av Dunn Jos (Luella) porter Roughton Halliburton Co h911 Ash Dunn Julia r311 Corbin av Dunn Mary r409 Spring Dunn Missouri Indrs h417 Bright al Dunn Robt D (Lottie) carp hl58 Jeff Davis Dunn Roy lab r265 Chestnut Dunn Roy L (Helen) collr Empire Furn Co r619 Montpelier av Dunn Soloman lab h511 E 1st Dunn Thos (Georgia) lab hl05 Forest av (V) Dunn Wm( Hattie) lab hl4 Bright al Dunn Wm plstr h543 Elizabeth Dunnaway John (Rosa) porter r361 Elm Dunnman Marie slsldy Southern Dry Goods Co r310 Reid (SM) DUNWODY DANIEL D (Mary), County Tax Receiver, Office Court House, Phone 1084, h535 Vineville av Dunwody Felix L (Kate) supt h.212 Spring Dunwody Isaac L real est r212 Spring Dunwody Robt R (Bessie) hl55 English av Dunwody Robt R jr student rl55 English av DUNWODY R RALPH (Bessie), Sec and Treas Macon Daily Telegraph Publishing Co, hl55 English av (Y), Phone 3160 DUNWODY WM E (Bessie), Pres Standard Brick & Tile Co and Y-Pres-Sec-Treas Cherokee Brick Co, h Rivoli RED, Phone 526-W Dunwody Wm E jr (Dunwody & Oliphant) Rivoli Ga Dunwody & Oliphant (W E Dunwody jr, W F Oli- phant) archts 460% Broadway Dunwoody Dora A (wid J A) r L W McManus Dunwoody John A jr asst mgr Dempsey Hotel r do Dupree Angeline nurse r616 Rosa Dupree Augustus r554 1st Dupree Dollie maid h616 Ross Dupree Eliz cashr r3809 Houston av Dupree Emmitt J (Doris) tele dept r679 Courtland av More goods are bought and sold through the Classified Business Lists of the Directory thar any other medium on earth. Macon Transfer & Storage Company HEAVY HAULING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) DuPree Ernest L cashr United Am Ins Co rl46 Ma nolia Dupree Eula Mrs gro rl21 Broadway Dupree Jas T (Fannie) creeler hl3 Holt av (NH) DuPree Jesse F (Bessie) blrmkr h3026 Houston av DuPree Jesse F jr blrmkr r3026 Houston av Dupree Lillian Mrs cashr r274 Ellis (SM) Dupree Luther carp r254 Railroad av Dupree L D cashr Steward Oil Co r3809 Houston av DuPree Prentice (Madie) r2405 2d Dupree Rufus J (Eliza) farmer h3809 Houston av Dupree Welton D slsmn Carter Hdw & Supply Co Suwanee av (CH) Dupreis Carrie r619 2d Dupreis Eliz r619 2d Dupriest Hiram H (Myrtle) agt Bankers Health & Life Ins Co h203 New DURANT MOTOR CARS, Beeland-Conrad Motor Co Distributors, 560 2d, Phone 2813 Durden Alsey F (Minnie) yd cond h424 Mikado av Durden Andrew B (Pearl; Durden & Abbott) h913 2d Durden Andrew C (Ruth) bkpr h624 1st Durden Annie M (wid Arth) rl318 3d Durden Augustus lab r502 Chappell Durden Benj W (Neallie) truck farmer h Mellrose Durden Carrie slsldy Union Dry Goods Co r754 Cherry Durden Cora L maid r454 Pine Durden C E appr rYMCA Durden Danl B (Mattie; Durden & Mathews) hl23 Piedmont av Durden Danl B jr presser rl23 Piedmont av Durden Eldora (wid Jas D) rl29 Knott Durden Georgia A (wid D M) hl421 3d Durden Inez mach opr Otto-Isaacs Harness Co rl30 Willingham Durden Jas J (Martha) hl801 3d Durden John M (Jennie) mach hd Macon Lumber & Mfg Co h7 Randolph pi Durden John R (Emma) apiarist h501 Fort Will Durden John R (Ella) cutter r221 Ross Durden Laura r209 Williams Durden Leon F (Irene) switchmn h422 Mikado av Durden Lula (wid Thos) r413 Ross MOVING STORAGE Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r LI ccteoarptsayl.foogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOOA, uuMsrrkInnCfeeHowwr. | W. R. Finch Motor Co. Nash Leads the World in Motor Car yalue Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 328 (19251 R. L. POLK & CO.'S Durden Martha (wid Frank) h209 Williams Durden Mattie M cook r502 Chappell Durden May rl801 3d Durden Myrah cook r342 Madison Durden M Morgan formn Dunlap-Huckabee Auto Co r411 Montpelier av Durden Richd student r501 Fort Hill Durden Rosa L opr Sou Bell Tel Co r502 Fort Hill POLK'S Durden Ruth cotton mill wkr r Benjamin Durden Durden Spencer (Carrie) lab h.20 Hall Durden Susie h502 Fort Hill Dental Durden Tillman (Ester) lab r552 Waterville rd Durden Wiley pntr rl421 3d Register Durden Wm lab h504 (502) Chappell Durden Wm 0 (Gertrude) mech h Log Cabin blvd OP THE Durden Wm O (Josie) plmbr T L Wood r2106 Broad- UNITED STATES way Durden W Morgan (Odessa) formn h411 Montpelier av AND CANADA Durden & Abbott (A B Durden, Wm Abbott) gro 1156 Edgewood av Durden & Mathews (D B Durden, T T Mathews) clo clnr 2657 2d 1925 Dure Julia (wid Geo A) rl Nevaro apts Dure Leon S pres Dure & Beeks Co v-pres Macon Ry & Light Co and Macon Gas Co hi Navaro apts Dure Leon S jr student' rl Nevaro apts The Splendid Dure Leon S Co L S Dure pres J M DeBorde sec-treas Features of real est 610 Mulberry Past Editions are retained, with much New, Useful Dure Mary student rl Nevaro apts Dure Nela h251 Bond Dure & Beeks Co L S Dure pres W H Beeks sec-treas ins 610 Mulberry Durell Chas E (Lottie) slsmn h417 Forest av (V) and Duren Robt auto mech r253 Broadway Interesting Durham Alonzo (Fannie) carp h216 Northern Data added. Durham Annie lndrs r815 Amos Durham Charity maid r229 Jones Durham Clare mach hd Bibb Bag Co Milton Durham Columbus J (Leona) milk inspr City Health R. L. Polk Dept r662 Napier av Durham Dora r400 (300) Charles (SM) & Co. DURHAM E B (Emma), Pres Johnson, Durham & Publishers Burke, h300 Hillyer av, Phone 4433-L3 536 S. Clark St. Chicago, 111. Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 T CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 329 Durham Henrietta Indrs h423 Peachtree Durham Henry rl707 2d Durham H B driver Plummers Creamery rl707 2d Durham Jas (Sallie) rl256 2d Durham John (Johnnie M) lab r421 Bay Durham John lab rl57 Elizabeth Durham Julian h229 Jones Durham Junior (Annie) lab h352 Maynard Durham Otis porter rl57 Elizabeth Durham Roberta lab rl5 Bay Durham Rosa maid College Inn Apts r229 Jones Durham Thos (Nancy) lab hl57 Elizabeth Durham Watson lab rl57 Elizabeth Durham Wiley (Mary) lab hl6 (12^) Plant al Durham Wiley (Daisy) lab h354 Hazel Durham Wiley jr lab r354 Hazel Durham Wm (Ada) lab hl06 Tindall av Durham Wm lab r423 Peachtree Durrett Rogers (Helen) slsmn r356 Church (EM) Durrett Sarah C (wid David M) h356 Church (EM) Dusse Celie cook r242 Thompson al Duval Jos (Minnie) h220 Moughon Duval Paul (Letitia; Paul Duval & Son) h337 3d av Duval Paul jr (Addie; Paul Duval & Son) h237 3d av Duval Paul & Son (Paul and Paul jr) furn reprs 460 Cotton av Duvaw Hamlin hsemn Wilson & Co r Mikado pi Dyche Jack (Tiny) collr Villa av (B) Dyche Lon F r Mell Dyche Dyche Lonnie r Jack Dyche Dyche Mell D (Mollie) carp Grand av (B) Dyches Wastella Mrs r270 Main (EM) Dye Chas T (Kathryn) mgr Cherokee Pharmacy r426 Forsyth Dye David D sawyer r709 Adams Dye Mazie cook rl07 Rose Crest av Dye Robt firemn hl07 Rose Crest av Dye Wm O (Georgie) mldr hl25 Stratton Dye Wm S (Lula) mech h97 Violet Dyer Cecil appr T L Wood res Sofkee Ga Dyer Chas W (Josephine) eng h3042 Houston av Dyer Crawford W (Ernestine) phys Colored Pythian Temple hll7 Tatnall Dyer Ernest L (Ruth) pntr hll6 Enterprise FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 2?.! cn i We Do It Right BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 330 (1925) R. L. POLK & CO.'S R P Dyer Wm G (Mary) elk Am Bakeries Co r202 Center Dyes Buford mill hd r rear 303 Pio Nono av 0 L Dyes Chas R (Sarah) h rear 303 Pio Nono av Dyes Fannie M (wid John F) hl23 Rutherford av Dyes Sami L (Annie) gro 202 Crisp h do L U Dykes Anna r205 (162) Lincoln av (V) Dykes Ethel millwkr hl24 Corner ter L M Dykes Henry A millwkr rl24 Corner ter Dykes Hubert E r863 Cherry Dykes Ida millwkr rl24 Corner ter E B Dykes Jesse H (Julia) millwkr hl24 Corner ter Dykes John D (Hattie) ice cream mkr Kinnet-Odom R I Co h863 Cherry Dykes LaVerne elk 4th Natl Bank r863 Cherry Dykes Lewis lab rl24 Bright al N Dykes Minnie L branch mgr W U Tel Co r2134 2d Eady Henry P (Ella) carp hl50 Carling av (HH) & G Eagle Hotel H M Griggs prop 552i/2 Mulberry Eagle Jas (Nettie) lab rll Randolph pi M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls 1 H Eagles Club 258 y22d Earle John (Mary) section h27 Reid L E Early Ada student r209 Ellis av Early Addie B tchr rll4 Forsyth L A Early Clarence (Mary E) janitor h209 Ellis av Early Julius lab r529 Maynard Early Lucy dom r529 Maynard I T Early Luther lab Barker Bakery r529 Maynard Early Paul J student rll4 Forsyth R I Early Paul K (Josephine) formn hll4 Forsyth Early Paul K jr elk Georgia Grocery rll4 Forsyth Early Rosa L dom h390 Cowan 0 N Early Sally lndrs h529 Maynard Earnest C Carlyle elk David Wachtel r768 Mulberry N G Easley Lena B cook r318 Wall Eason Arcieola dom r326 Hammond Eason Henry (Ardenia) lab h326 Plammond S East Macon Baptist Church 255 Church (EM) 415 Third Phone 5113 FOR LISTS OF NARflES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO- CHICAGO a ENGLAND Xo THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 331 East Macon Cement Works (J J Ryle H) rear 119 Jones av East Macon Meth Church 100 Church (EM) East Macon Packing Co W E Hamlin mgr 304 Main (EM) East Macon Presbyterian Church Rev Carl Barth pas- tor se cor Clinton and Hydrola East Macon School 724 Frt Hill East Side Church of Christ 375 Church (EM) Easter Wm (Mary) lab h321 Plant Easterday Alice Mrs mlnr 359 3d r Fredonia apts Easton Eug (Della) hlpr h254 Madison Eaton Lucius (Leila) lab h267 White al Eaton Mae h341 Columbus Eavenson Wm L asst tchr Mercer University Ebenezer Baptist Church 757 Elm Eberhart Wm R (Ada) slsmn Dannenberg Co rl705 Forsyth rd MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Echols Geo H (Florence) eng Maintenance of Way Sou Ry System h363 College Echols Jas C (Annie M) elk Standard Oil Co r R F D 2 (Pio Nono av) Echols John R (Willie A) mgr Standard Oil Co r R F D 3 (Houston rd) Echols J eng rlOl 3d Echols Vinia E dom r264 (664) Hall Eckels Robt C (Isabel), mach r667 Mulberry Eden Chas T prop Sanitary Milk Depot r756 Mulberry Eden Leila G (wid Clarence A) tchr h7 Fredonia apts Edenfield Madge cashr r544 Forsyth Edenfield Mamie Mrs slswmn Dannenberg Co r544 Forsyth Edenfield Robt W (Margt) tchr h500 Holt av (NH) Edenfield Thos J (Mamie) carp h544 Forsyth Edgerton Hotel Mrs H C Lane mgr 555 Broadway Edings Maude L tchr h7, College Hill apts Edison Delia maid rill 44th av (V) Your City Directory Answers All Questions as to ( WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work R. L. POLK & Company j _ V LUMBER, SHINGLES, LATH Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 0) e: bo gig ox S fl H a. Gcccn 13 ^CM H ^ CO CO u etf 332 (1925) R. L. POLK & CO.'S Edison Edith, maid rill 4th (V) Edison Lawrence carp hill 4th av (V) Edmondson Frank (Orie) lab h393 Craft la Edmondson Nora E prin Bellevue School Edmondson Wm S (Claudie) farmer hl42 Colquitt Edwards Ace (Liza) lab h224 Turpin Edwards Alice nurse Macon Hosp Edwards A J elk r Y M C A Edwards Berry porter J B Riley Drug Co Edwards Bertha student r905 Clinton Edwards Bill (Clara) mech r521 Elm Edwards Chas (Pearl) elk hlll2 Main Edwards Chas A (Mattie) firemn h!28 Holt Edwards Chas L (Pearl) hll28 Milledgeville rd Edwards Chellie Mrs mach hd Central Bedding Co r 128 Violet av Edwards Cora M (wid Wm E) h286 Winship Edwards Corliss elk r2454 2d Edwards Edw elevator opr h203 Woodliff Edwards Elsie r286 Winship Edwards Ethel r631 4th av (U) Edwards Fannie pdlr rlOO Roberts Edwards Felton ship elk rl28 Park pi Edwards Hamp D (Viola) carp rl47 Pose Park Edwards Henry (Emily W) slsmn r258 College Edwards Hines M (Fannie) carp h2454 2d Edwards Howard elev opr Bibb bldg r203 Woodliff Edwards Hoyt (Mary) lab h327 Monroe Edwards Isaac (Mattie) pdlr h716 Campbell av Edwards Jas (Gertrude) carp hll3 Ernest Edwards Jean D hlpr Montpelia Garage r Columbus rd Edwards John H dishwasher Washington av Edwards John W (Sallie) blrmkr r442 Telfair Edwards J Alf elk r761 Courtland av Edwards J Campbell (Eliz B) hl40 High Edwards J C gro 802 3d h504 Oak Edwards J Lamar (Rose) mgr Commercial Loan & Inv Co r228 Jeff Davis Edwards J R Rev Rev (Essie) h Robinson rd nr Rock - ledge av Edwards Leola (wid Ernest) h255 Plant Edwards Lewis (Theresa) carp h877 (577) Maynard Edwards Lou maid h rear 854 Ocmulgee pfl More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 333 Edwards Louie millwkr Dixie Roll & Cot Co r905 Clinton Edwards Mary mill hd h39 Taylor Edwards Mary sten Am Bakeries Co r R F D 2 Edwards Mattie r211 Orange Edwards May O Indrs h458 Mitchell Edwards Melvin (Mary) bkpr r520 Johnson av Edwards Minnie student r905 Clinton Edwards Myrtle hllO Hill Edwards Nellie F elk Board of Public Education rll4 Coleman av Edwards Penelope B (wid John F) hll4 Coleman av Edwards Robt brklyr hlOO Roberts Edwards Robt (Mattie) carp h966 Ocmulgee Edwards Robt rural carrier P 0 res Macon Ga Edwards Robie (wid Jeff) r319 Clinton Edwards Ruth (wid H G) slsldy Union Dry Goods Co hl09 Latta pi Edwards Sami wtchmn r218 Bright Edwards Scott A (Mittie L) chf dep U S Marshal h234 Tattnall Edwards Velma opr Sou Bell Tel Co rl47 Rose Park Edwards Walter C (Nannie) millwright h.405 Mont* pelier av Edwards Wm brick mason h Bartletts la Edwards Wm (Jessie) lab h457 Douglas av Edwards Wm C Rev (Florence) pastor Stinsellville AMECh h631 4th av (U) Edwards Wm F mach N E Pace Edwards Wm L (Sophie) gro 10 Elm hl4 do Edwards Wm M (Lennie) agt Bankers Health & Life Ins Co h905 Clinton (EM) Edwards Zeke carp h Robinson rd nr Rockledge av Ehney Helen E rl316 2d Ehney John C (Daisy) elk C of G R R Co rl316 2d Ehney M Lucile r471 Orange Ehney Ruth C student r471 Orange Ehney Wm S (Maggie) hl316 2d Ehney Wm S jr (Constance) frt claim agt D M & S R R h471 Orange Ehrlicher Margarette r Mrs Naomi Ehrlicher Ehrlicher Naomi H (wid J F) slsldy R S Thorpe & Sons h Log Cabin Hts Ehrlicher Robt E auto mech r Mrs Naomi Ehrlicher 9 FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION dktrqit II L. POLK & CO. Chicago Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 334 (1925) R. L. POLK & CO.'S Eichbaum Isidore slsmn Weinstein & Starr r570 1st Eisner Fredk rl35 Rembert av Elbert Foster (Lucresa) lab hl21 (159) Nelson Elder Beryl tchr r705 Belmont av Elder Cbas R (Dorothy) mach hl48 Cole Elder Edwin tmkpr r251 Belmont av Elder Erwin R (Etha; King & Elder) h596 Boule- vardav Elder Jerry (Estella) driver h418 Ward Elder J B moulder r500 Edgewood Elder J Lester trav slsmn h598 Boulevard (NH) Elder J L (Frances) farmer r598 Boulevard (NH) Elder Mabel tcbr bl05 Cutter's Green Elder Paul mecb r251 Belmont av Elder Pearl music tchr r705 Napier av Elder Ruby tcbr r765 Napier av Elder Rutli tchr rl06 Buford pi ELDER WM F (Mary E), Pres W F Elder Lumber Co, li705 Napier av, Plione 754-W ELDER W F LUMBER CO, W F Elder Pres, G S Goodyear Sec-Treas, Lumber and Building Ma- terial, Ocmulgee se cor 7th, Phone 349 (See page 74) Elder W Grady (Mary) slsmn H L Barfield hill 2d Elder Zulee nurse r567 Walnut Electric Dry Cleaning Co (J D Rambo) 115 Cotton av Elexander Mary cook r966 Oculgee Elfe Margt r654 Forsyth Elfe Matilda (wid Wm W) h654 Forsyth Elfe Pauline r654 Forsyth Elfe Tbos B (Vallie W) treas Willingham Loan & Trust Co hl301 Vineville av (V) Elfe Wm W r654 Forsyth Elford Henry (Ruby) h314 3d av (V) Elite Cafe (Paul Stallworth, W M Hodge jr) 321 Cherry Elizabeth Chapel Baptist Church Bartletts la ELK AN ELI (Katherine), Pres Crescent Laundry Co, h300 Katherine Ct Apts, Phone 1369 ELKS LODGE, N R Winship Sec, 127 Cotton av, Phone 322 Elledge Richd V (Margt) repr Hamlin, Jones & Eaton h418 Forest av Ellington Edison student r739 Ridge av E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Ifforit'as aFoFrodr,d woer CARS-TRUCKS - TRACTORS have it. PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 335 Ellington Emmett (Anna) draymn h209 Kitchens Ellington Jonah R h739 Ridge av Ellington Jonah R jr (Lilah) r739 Ridge av Ellington Minnie (wid Jeptha) rl31 Charles (SM) Ellington Minnie fitter Union Dry Goods Co rl31 Charles (SM) Ellington Oca L cook hl44 Sycamore Elliot Edwin jr student rll6 Buford pi (V) Elliot Marion rll6 Buford pi (V) Elliott Albert W jr (Aline) elk Quality Market h253 School Elliott Baird J chf opr W U Tel Co Elliott Boce M (Eliz) slsmn J B Riley Drug Co h414 Montpelier av Elliott Elmer oiler r205 Holt av (NH) Elliott Florence student r403 Duncan av Elliott G Y baker Am Bakeries Co r208 2d Elliott Jas mach r205 Holt av (NH) Elliott John (Annie) formn h205 Holt av (NH) Elliott Jos C (Dora) lab h316 Vine Elliott Lee A (Mattie) plstr h383 Monroe Elliott Lee A jr lab r383 Monroe Elliott Lena r205 Holt av (NH) ELLIOTT MATT E (Theodosia), Pres Fidelity Loan & Investment Co, Elliott Warehouse Co, Terminal Transfer Co and United American Life Insurance Co, hll6 Buford pi, Phone 2240 Elliott Matt E jr elk M E Elliott Warehouse Co rll6 Buford pi Elliott Mattie rl03 Roose Crest av Elliott Mattie M (wid Albert W) h403 Duncan av Elliott Russell H (Nathalie) carp Macon Hosp r455 Walnut ELLIOTT WAREHOUSE CO, M E Elliott Pres, 201- 269 Poplar, Phone 79 Ellis Alice student rl013 Clinton rd Ellis Austin J (Rosa P) filling sta 1246 Broadway h 852% New Ellis Betty (wid G W) r808 Napier Ellis Building 201 Cotton av Ellis Cafe (Gus Floros, Jas Bachis) 456 Poplar Ellis Clarence (Clessie) rl08 Duncan av ELLIS CURRAN R, Pres Ellis Motor Co and Archi- tect, 201% Cotton av, h470 College, Phone 2819-J The most comprehensive reference work on tne banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH ana SEPTEMBER by R. L. POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. &C0. Polk DirectoryBldg. Detroit, Mich. ZUI Kqt j 3uO <0(0 KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 336 (1925) R. L. POLK & CO.'S Ellis Danl carp h565 Elizabeth Ellis Dave lawyer r544 Washington av Ellis Dollie hl08 Duncan av Ellis Doretha slsldy rl013 Clinton rd Ellis D Talmage (Alice) trav hl05 Cleveland av Ellis Edith F student r320 E 2d Ellis Emma (wid Robt) rl927 2d Ellis Ernest C (Ellis Pharmacy) r B L Cox Ellis Eugenia r470 College Ellis Eva r470 College Ellis Frances P student rl05 Cleveland av Ellis Fred (Isabel) brkmn h354 Bay Ellis Garage W W Ellis jr mgr auto reprs 621 3d Ellis Geo W (Hallie) hl09 Cleveland av Ellis Hattie drsmkr 548 Hazel r do Ellis Horace M (Eva) hl05 Enterprise Ellis Ida maid h320 E 2d Ellis Iva E (Nellie) gro rl05 Enterprise Ellis Jas H elk C of G R R Co r330 Napier av Ellis Jas H (Mary) traveling traffic agt r3503 Hous- ton av Ellis Jas F (Hallie) slsmn Gulf Refg Co h3503 Houston av Ellis John tailor 416i/2 2d h86 (128) Forest av Ellis John C mgr John C Ellis Co Ellis John C Co J C Ellis mgr paints 512 3d Ellis Jos T (Gertrude) gro ss Forsyth rd opp Forest Hill av h do Ellis Juniata rl013 Clinton rd Ellis J C Mrs slsldy Union Dry Goods Co r619 For- syth Ellis Louise r470 College Ellis Lucius (Lizzie) hl22 Tatnall ELLIS MARSHALL J (Martha P; Murphy, Taylor & Ellis), h310 Cherokee av, Phone 1260-W Ellis Martin (Amanda) lab h403 Craft la Ellis Mattie maid r320 E 2d (EM) Ellis Maxwell (Edith) rl95 English av Ellis Michl G (Agnes) restr 306 Cherry h250 Washington Ellis Morris (Ella) h241 Forsyth la Ir T I --Li ctAmCeoauraptstnyaoy.lfmookgoribnacidlloelsRnkto.aiofnLiwndm.snsPeeomrOrcfsLuhAcKaahnurdt&eovismaeClso.uOeba.l,ibeSleDlceetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtMssrkqInnCffeaHoowrr-r. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 337 ELLIS MOTOR CO, C R Ellis Pres, R P Brooks VPres and GenI Mgr, H H Riley Sec-Treas, Lincoln and Ford Cars, Fordson Tractors, 362-378 1st, Phones 46-723-724-1846 (See right side lines and page 52) Ellis Nathan (Pollie) lab h212 Elliott (EM) Ellis Nathan jr hlpr r212 Elliott Ellis Oscar L (Mary L) supvr h330 Napier av Ellis Peter lab rll30 Broadway Ellis Pharmacy (E C Ellis) 55 Forsyth rd opp Forest Hill av Ellis Rachael elk hl09 Peacock Ellis Roland (Virginia; Ellis & Glawson) res Rivoli Ga Ellis Roy G (Eugenia) slsmn hl927 2d Ellis Service Station (E C Ellis) ss Forsyth rd opp Forrest Hill av Ellis Theo W jr (Ella P) contr 2 College Hill apts h do Ellis Thos B (Eliz) dept mgr Dannenberg Co hl52 High Ellis Thos M hlpr Am Ry Exp Co rl95 English av Ellis T David lawyer Jones, Park & Johnston r544 Washington av Ellis Wm (Lila) lab r42 Railroad av. Ellis Wm jr (Frances; Ellis Garage) h ns Forsyth rd (V) 3 w Riverdale dr Ellis Wm L slsmn h298 College Ellis Wm S (Lizzie) farmer hl013 Clinton rd Ellis Willie lab East Macon Ellis Winder Rev (Sallie) retired minister r753 Mul- berry Ellis W Judson (Pearl) h852y2 New Ellis & Glawson (Roland Ellis, C A Glawson) lawyers 819 Ga Casualty bldg Ellison Chas W (Minnie) mech hl46 Concord Ellison John (Willie) lab h40 Smith (SM) Ellison Reesa (wid John) h8 Alabama Ellison Robt lab r212 Ocmulgee Ellison Wm (Annie) lab section h212 Ocmulgee Ellisonian Apartments 478 College Elmon Leo lab r457 Barracks al * FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALPT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 338 (1925) R. L. POLK & CO.'S as a Elmore Jasper G (Lula) mach Wade & Co h204 Glen Cove dr MMEI Elrod Gladys h359 9th Elrod Jos R mgr r359 9th Elrod Pearl student r359 9th ml Elsasser Hilliard r252 Broadway Elsasser Lonnie B (Ethel) appr Hamlin & Suhers THE h252 Broadway Elsasser Vincent T (Florence) pdlr h252 Broadway DIRECTORY Elton Henry pharm h521 Main (EM) Elton Wade (Blanch) elk Holleman's Pharmacy IS THE Elzie Allen (Jessie) lab h305 Elbert Elzie Henry (Alberta) lab hill Elm GREATEST Emelio Carlo lab r318 Main (EM) Emely Addie lndrs r403 Maynard MARKET "Emely Georgia lndrs h403 Maynard PLACE Emerson see also Amason and Amerson Emerson Charlotte sten r842 Courtland av IN THE Emerson Ella (wid Wm) r206 Hydrola Emerson Fred (Annie) mach hll7 Latta pi WORLD * Emerson G C electn R W Hurley r561 Mulberry Emerson Jas F (Bertha) eng h842 Courtland av Emerson Jas M dept mgr L K Liggett Co r821 Mul- Every Day berry in the Year Emerson Maude smstrs r825 Orange the Directory Emerson Wm M (Callie) eng r821 Mulberry Tells Where Emory Alberta lndrs r523 Plumtree All Kinds Emory Elsie lndrs r523 Plumtree of Goods Emory E D (Eliz) bkpr Dixie Ice Cream Co r226 Dun- and Service can av Can Be Had Emory Geo r518 Cedar ) * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Emory Jennie r207 Rogers av Emory Thos J carp r523 Plumtree EMPIRE CANDY CO, Alec Block Pres, Mrs Harriet P Robarts Sec, 5th nw cor Ocmulgee, Phones 42004201 EMPIRE FURNITURE CO, Robert Zarks Mgr, Furniture and Household Goods, 522 Poplar, Phone 402 EMPIRE INVESTMENT CO, W J Matthews Pres, B C Smith Sec-Treas, Salary Purchasers 356% 2d, RLPoiii&Co Phone 327 Empire Products Co G J Maxelhaum pres oils 502 PUBLISHERS Broadway More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUE MOTTO: "THOROUGHNESS" 656|/z CHERRY ST. PHONE 3041WRITE FOR INMFAOCROMNA, TIGOAN. MACON CITY DIRECTORY (1925) 339 Emrey Earl B (Leona) district plant chief rl07 Pierce av Engelhart Edw A (Annie) dept mgr S M Solomon jr h296 Cherry av ENGLAND ARCHIBALD (Josephine), Chiropractor 613-618 Bibb Bldg, Phone 4557, res R F D Honston rd (See right top lines and page 3) England Ursula (wid C H) r415 Virginia av English Dock (Hattie) hllO Royl English Dora (wid John W) h2639 2d English Edw lab hll4 Yates av (EM) English Emmett r2639 2d English Prank P r397 Morgan av English Hallie B student r770 Ash English Henry (Hannah) firemn h238 Telfair English Jas W (Laura) presiding elder East Macon h216 Telfair English Mollie rll4 Yates av (EM) English Myrtle emp Empire Cdy Co r2639 2d English Robt E (Amanda) repr Underwood Type- writer Co hl68 2d av (PH) English Roy W elk A B Shepard 2639 2d English Ruth student r216 Telfair English Sarah nurse r567 Walnut English Terry student rl514 Forsyth rd (V) English Thos W (Mary C; Sanitary Market) hl514 Farsyth rd (V) English Wm student r216 Telfair Ennis Clifton L (Eunice) carp h521 Arch Enterprise Packing Co (W J Stripling) cor 7th and Ocmulgee Entrekin Hazel spinner rl07 Roff Home av (V) Eppings Minnie tchr hl22 Fort Hill Epps Amanda supvr Sou Bell Tel Co r619 2d Epps Augustus H (Eliz) hlksmith h309 Reid Epps B Harden (Ida Lee) hl413 Edgewood av Epps David mill opr r6 Lake City Epps Ethel rl85 Cedar (SM) Epps Eva M r309 Reid Epps Fred carp h411 (311) Hall Epps Glynn A (Florence) flagmn h229 Reid Epps Jesse M (Ruby) supt hll3 Stonewall pi (V) Epps John J pharm r353 Walnut IL in spMrfi* 8i 1 Q w Sai> h h > 73 Z 2 Tr> >Tl s8 Q! 2 >' z > O H n Automobile owners are select prospects tor f- many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. 1 CO 00 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. 340 (1925) R. L. POLK & CO.'S Eps J Henry C night wtchmn r534 Clinton (EM) Epps Lula lndrs h.236 Collins la Epps Mariah maid r625 3d av (V) Epps Martha r534 Clinton (EM) Epps Mary (wid Horace) rl85 Cedar (SM) Epps Mary r645 Ash Epps Mary millwkr r223 Elliott (EM) Epps Sarah r645 Ash Epps Susie mill hd r223 Elliott (EM) Epps Terrell mill hd r6 Lake City Epps Thos rl85 Cedar (SM) EPPS T R (Annie H), V-Pres Liberty Savings & Real Estate Corp, Mgr North Carolina Mntnal Life Ins Co, h556 Broad Epps Wm (Azilee) mill hd h6 Lake City Epps Wm V (Lula) carp h619 2d Epting Jas W (Bertha) hl03 Coleman av EQUITABLE LIFE ASSURANCE SOCIETY OF THE U S THE, W E Pendleton Dist Agt, Louis A Shirley Dist Mgr, H 0 Tyner Special Agt, Thos L' Mitchell Mgr Loan Dept, 411-412 Citizens & Southern Bank Bldg, Phone 4305 (See page 70) Erb Sylvia M supt of nurses Macon Hospital Erickson Carlton collr G P Estes rl44 Colquitt Erickson Mabel rl44 Colquitt Erlicher Robt E hlpr Ellis Motor Co r Log Cabin Hts ERMINGER H B JR, Y-Pres Builders Lumber Co, res Havana, Cuba Ernest Carlisle C slsmn r768 Mulberry * Ernest Corinne r218 Belmont av Ernest Eliz student r218 Belmont av Ernest Lucile Mrs finan sec h218 Belmont av Ernest Ray M carp rl97 Ridge av Ernest Viola nurse Middle Georgia Sanitorium r do Ernest Wm H (Kath A) slsmn hl97 Ridge av Erguhart Julian F (Mary) atty New Colendon rd Erwin Annie J Mrs boarding h559 2d Erwin Aurel M (Helen) sec-treas Macon Gro Co h679 College Erwin E Iverson lieut Fire Dept Erwin Lenoir M (Helen) elk U S Dist Court h629 Walnut FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION " t DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MACON CITY DIRECTORY (1925) 341 Erwin Louisa agt Fidelity Mut Life Ins Co r629 Walnut Erwin Meta R dep elk U S District Court r629 Walnut Erwin Robt A elk Terminal Hotel of Macon r Terminal Hotel ESSEX CARS, Sparks Motor Co Distributors, 550 Broadway, Phone 4787 Estes Clarence (Mary) blrmkr hll7 Daley (SM) Estes David W electn Macon Electric Co Estes Emyal E electn Morris Putzel r225 Applewood Estes Geo P (Mattie) furniture 1225 Broadway hl44 Colquitt Estes Jas C (Jessie; DeFore & Estes) h726 Napier av Estes John H Rev (Rachael) h212 Powell (EM) Estes Nannie J (wid Claude) h414 College Estes Robt R (Tillie) hlpr r560 Oak Estes Trudie mill opr hl05 DeWitt Estes Zeddie K (Leila) lab h225 Applewood YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Etheredge Eliza (wid Robt M) hl717 3d Etheredge Emmett D (Clara) plmbr F X Daly Co h 220 Ayers rd Etheredge Jas N (Maud) tool formn h699 Anderson Etheredge Jas N jr student r699 Anderson Etheredge J Oscar (Cora) phone opr hl03 Dixie av Etheredge J Oscar jr blrmkr rl03 Dixie av Etheredge Martha r699 Anderson Etheredge R Linwood linemn rl03 Dixie av Etheredge Sophie student r699 Anderson Etheridge Algrine mech r536 Maynard Etheridge Annie Jopr r536 Maynard Etheridge Benj lab rl306 3d Etheridge Campbell B (Lucille) bkpr Macon Trading & Inv Co hl9 Navarre apts Etheridge Chas G sten J M Dasher Lumber Co r203 Progers av A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 342 (1925} R. L. POLK & CO.'S Etheridge Claude (Jennie) lab hl42 Washington (EM) Etheridge Dock (Margt) h962 Hazel Etheridge Dock F (Rebecca) cottonwkr h318 Cal- houn Etheridge Elma M (wid Cates) h416 Forsyth * Etheridge Eugenia (wid Dr Jas) h621 Orange Etheridge Francis C (Frances) artist r416 Forsyth Etheridge Frank (Marie) mach opr rll7 Maple Etheredge Geo W (Ruth) bge elk h900 Orange Etheridge Horace pharm Natl Drug Store Etheridge Jas W (Eliz) draymn hl306 3d Etheridge Jos hlpr A E Thornton Etheridge Julia sten r203 Pokers av Etheridge Levy J (Annie) car repr hl823 3d Etheridge Linnie (Sarah) opr r962 Hazel ETHERIDGE MARK F (Willie), Managing Editor Macon Daily Telegraph, h421 Forsyth Etheridge Mary Indrs h218 Moughon Etheridge Mary L Mrs smstrs Union Dry Goods Co rl823 3d Etheridge Mattie smstrs rl823 3d Etheridge Mildred opr Sou Bell Tel Co res Log Cabin dr Etheridge Monroe (Hecklie) lab hll Ellis av Etheridge Richd J (Fannie) formn W S Dickey Clay Mfg Co h203 Rogers av Etheridge Richd P electn r203 Rogers av Etheridge Robt N (Ollie) patrolmn h411 Elm Ethridge Rosa Mrs rll7 Williams Etheridge Ruth B Mrs slswmn Burden Smith & Co r 900 Orange Etheridge Wiley P (Rosalie) mech h217 Log Cabin dr Etheridge Wm B r416 Forsyth Ethredge Kate cook r531 Monroe Ethredge Mildred elk r220 Chappel Ethredge Milton hlpr rl89 Hatfield al Ethredge Motto (Onnie) pntr h220 Chappell Ethredge Richd H (Mary) blksmith h425 Chappell Ethredge Robt N rl28 Steele Ethridge Chas (Annie) carp h536 Maynard Ethridge Green B (Mildred) slsmn Burden Smith & Co r300 Pierce av natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 343 Ethridge Joel mech r536 Maynard Ethridge Mark (Willie S) tchr Mercer University r 538 Washington av Eubank Lila rl27 Rembert av Eubank W Calvin (Bessie) linemn r222 Ross Eubanks Addie r202 Cole Eubanks Andrew (Mamie) appr hl309 2d Eubanks Caroline student r210 Forsyth Eubanks Chas E (Mae) h210 Forsyth Eubanks Claudia r202 Cole Eubanks Gertrude elk r202 Cole Eubanks Jas appr r2619 2d Eubanks Jas C jr (Alice) truck farmer h408 Burton av Eubanks John student r210 Forsyth Eubanks John F (Mary W) formn h2619 2d Eubanks Mabel Mrs sten Macon Barber Supply Co r!309 2d Eubanks Mary r408 Burton av Eubanks Mattie (wid Wm D) h202 Cole Eubanks Mule student r210 Forsyth Eubanks Ralph student r210 Forsyth Eubanks Sarah student r2619 2d Euthon Rudolph (Ruby) pntr h2223 Broadway Evans Ada dom rl27 Kahn's al Evans Albert lab h rear 360 Spring la Evans Albert C (Nellie) lab h953 Broad Evans Alton student r710 Pine Evans Alva lab r317 Vine Evans Amy J nurse E L Jarvis r560 Ward Evans Anderson (Sarah) carp h202 Mitchell Evans Anna (wid John) h.753 1st Evans Augusta maid h211 Powell (EM) Evans Augustus (Mary) sta firemn h211 Green Evans Carrie cook r 431 Ward Evans Cecil A textile opr r739 Hawthorne Evans Chas (Frances) hlpr h93 Vine Evans Chas (Maggie) lab r520 New Evans Chas R (Annie B) eng h2011 3d Evans Cicero (Eva) lab h4 Bears al Evans Clifford lab r624 Prince Evans Clifford W (Lena) opr h215 Clinton Evans Coleman (Serletha) lab hll4 Middle (V) "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth " Automobile owners are select prospects for many binds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy II. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 344 (1925) R. L. POLK & CO.'S Evans Columbus P (Analou) reprmn r476 Ash Evans Cora lndrs h93 Vine Evans Crawford porter Stewart Oil Co Evans Crawford B (Viola) mech hl22 Moughon Evans Dessau lab rl22 Moughon Evans Eliz dom r526 Plant al Evans Eudelle rl05 Vineville av Evans E mech Ellis Motor Co r663 Walnut Evans Frank (Lizzie) lab rlO Fulton al Evans Fred W flagmn rl47 Charles (SM) Evans Geo W (Lillian) city slsmn h313 Giles Evans Harry P (Hallie) flremn rll05 Oglethorpe Evans Hattie cook h214 Duval (EM) Evans Hosie lndrs h83 Bay Evans H pntr r554 1st Evans H Jos eng r324 Jenkins Evans H J msngr boy r476 Ash Evans Ida (wid H B) r663 Napier av Evans Isom (Josephine) lab h218 Telfair Evans Isom W Rev (Minnie) h560 Ward (V) Evans Jas (Lucile) lab h706 Campbell av Evans Jas B (Mellie) porter h614 4th av Evans Jean sten Sou Ry System r201 Hines ter Evans John carp r rear 354 Spring Evans John (Laura) gard h353 Flanders (EM) Evans John B (Geneva) mech r207 Corbin av Evans John D (Mary E) blksmith H S Bynes r Rich- mond Hotel Evans John H Rev (Matilda) h558 Monroe Evans John R hlpr r619 Hazel Evans Jos (Geneva) porter h453 Alabama Evans J Cullen (Mae) mech Dunlap-Huckabee Auto Co h565 Oak Evans Lawrence (Annie) mech h626 4th av (U) Evans Lewis (Ida) restr 602 Hammond r do Evans Liza M cook h9 Cheatham al Evans Lowe (Laviiiia) lab hl27 Kahn's al Evans Malinda r344 Maynard Evans Marie smstrs r353 Flanders (EM) Evans Mattie r2162 2d Evans Minnie lndrs r202 Plumtree Evans Mittie M hlpr Lyons Harris & Brooks r251 Belmont av R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 345 Evans Mollie h342 Hammond Evans Molly lndrs rl4 Harris al Evans Murphey auto mech r317 Vine Evans Nancy dom hl032 Broadway Evans Nannie Mrs cashr Rialto Theatre r Houston av Evans Nathaniel (Mamie) lab h221 Mutual av Evans Nedie B maid r238 Telfair Evans Nellie r2166 2d Evans Rebecca cook G Gillon r Ward Evans Robt cond r753 1st Evans Robt porter r202 Plumttree Evans Robt H ) Rosalie) h860 2d Evans Rolla A mgr Morris & Co r Southland Hotel Evans Rufus R (Jean) collr Ellis Motor Co rll5 Hines ter (V) Evans Rufus W (Monie) sec-treas Merritt & Co h201 Hines ter (V) Evans Sami lab r271 Chestnut Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Evans Thos E (Nannie) barber Dempsey Barber Shop h710 Pine Evans Thos E (Ruth) elk r457 Carling av (HH) Evans Thos W hostler r324 Jenkins Evans Vera r551 Plum Evans Victoria lndrs h470 Bay Evans Virginia J (wid Henry) h317 Vine Evans Wash (Willie) lab h506 Maynard Evans Wm (Eva) lab h407 (9) Crisp Evans Wm (Annie) lab hll3 Tatnall la Evans Wm E (Ethel M) sta mgr Standard Oil Co h 436 Ross Evans Wm F brklyr h763 3d Evans Wm G police 504 New Evans Wm H lab r526 Plant al Evans Wm I (Cynthia) textilewkr h739 Hawthorne Evans Wm R (Ella) carp h324 Jenkins Evans Willie lab r506 Maynard Evans Wyatt C (Callie) firemn h2006 2d FOR FISTS OF NAMES ~ ANY TRADE -- ANY BUSINESS -- ANY PROFESSION ^DETROIT R. L. POLK. & CO. CHICAGO 14 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable cn * in City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be (Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 346 (1925) R. L. POLK & CO.'S Evens Sami E (Annie) dry gds 400-2 Mulberry h421 New Everett Alma W Mrs nurse r909 Orange Everett Annie M smstrs rl406 Broadway Everett Atwood C (Mamie) eng hl705 Forsyth rd Everett Ellmoses lab r543 Grant Chappel al Everett Hattie lndrs hl4 Fulton al Everett Hurley F lab r543 Grant Chapel al Everett Lillian cook r543 Grant Chapel al Everett Logene cook r543 Grant Chapel al Everett Luke (Lettie) hlpr h543 Grant Chapel al Everett Luke jr r543 Grant Chapel al Everett Malcolm slsmn C E Newton & Bro rl40 Mag- nolia Everett Malcolm E (Nettie W; Kingman & Everett) h28 Ardlington pi Everett Martha lndrs rl24 Bright al Everett Mary r203y2 5th "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuYoarTup.nHrrgdouYFdvmeooe. nlcrsaTtasisathstiaritoiclesen.A,niNasoTtIDtafHyaEUotdhuhYaSerenEyagDAlePtbrRrhYulyEegsOeigpgdRUiinsAnNatok'Llns-., Everett Nash M (Conie) gro 309 Madison h do Everett Sami (Farnelia) lab h311 Straight Everett Wm E (Ethel M) service sta mgr h436 Ross Everett Wm E jr elk Georgia Grocery r436 Ross Evergreen Cemetery Houston av bey limits Everhart John lab rll3 Rose Crest av Everidge Annie M mill opr r5 Lake City Everidge F Dozier (Mattie) elev opr hl60 Broadway Everidge Herman T elk Exchange Pharmacy r763 Poplar Everidge Jos J (Nannie) lab rl60 Broadway Everidge Jos W (Lucile) elk rl90 Magnolia Everidge Lucile smstrs r320 Chappell Evers Helen student r503 Woolfolk Evers Ophelia cook h5 Oavis al Evers Roderick C (Mollie) mgr h804 Main Evers Walter W mach r804 Main Evers Wm lab r503 Woolfolk Evridge Bertie L mill hd r!7 Randolph pi R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR BLDG. PHONE Will Remove the CAUSE of Your Disease 4557 MACON CITY DIRECTORY (1925) 347 Evridge Chas V (Lucinda) mill lid hl7 Randolph, pi Evridge Vertie L mill hd rl7 Randolph pi Exchange Hotel (I C Holt) 513 Broadway Exchange Pharmacy C F Lanier mgr 574 Poplar Ezell Beckie rl07 Enterprise Ezell Emmie rl07 Enterprise Ezell Eunice Mrs h218 Chappell Ezell Gene r200 Ridge av Ezell Jos R (Mary) elk J B Riley Drug Co h418 Beech av Ezell Kate elk r200 Ridge av Ezell Sallie T (wid B R) r200 Ridge av Ezell Thelma smstrs r516 Oak Ezell Thos M (Delia) ry cond hl03 Inverness av Ezell Wm D (Agnes) transportation dept hl37 Oak- land av Ezell Willie E smstrs r516 Oak Fagan Eliz (wid Robt) bkpr r360 College MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS CtoO t(Bo < to n rc o o pi o Fagan Evelyn nurse Middle Ga Sanatorium r do Fagan Thos V (Beulah) hl40 Magnolia Faile Ada M cashr r514 Jackson Faile Alice cashr r514 Jackson Faile Lee A (Ella) carp h514 Jackson Faile Mary A cashr Southland Cafe r514 Jackson Fain Clarence r860 2d Fain Col barber Douglass Sanitary Barber Shop Fair Belle reeler r310 Calhoun Fair Carlie dom r315 Gilmer Fair Chas (Janie) lab h315 Gilmer Fair Mary (wid Wm T) h612 Hawthorne Fair Pearl opr r505 Hawthorne Fair Rufus (Ollie) mill hd h24 Bibb av Fair Tobias (Lizzie) h762 Oglethorpe Fair Wm M (Mary) opr h505 Hawthorne Faircloth Jesse J barber R G Stripling r Southern Hotel Faircloth Jos T call boy r233 Chappell Telephone 2687 J. T. MOLTON, Mgr., 348 Oak CO G. J. MOLTON LUMBER COMPANY o Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER ky R. L. POLK 348 (1925) R. L. POLK & CO.'S Faircloth Oliver G (Nona) cond h233 Chappell Fairer Benj J lab r312 Gilmer Fairer Berry lab r312 Gilmer Fairer Dora dom r537 (114) Smith (EM) Fairer Gorena lndrs r312 Gilmer Fairer Jas presser r537 (114) Smith (EM) Fairer Jesse lab r312 Gilmer Fairer Nancy dom r537' (114) Smith (EM) Fairer Wm r537 (114) Smith (EM) Fairfax Jennie L cook h4 Cheatham al Fairfax Susie lndrs hl05 Hazel Fairman Beach B civ eng hll6 Magnolia Fairman Ellen (wid Henry J) rll5 Magnolia EALKNER TIN SHOP, C B Kitchens Prop, Tinners and Sheet Metal Workers 469 Cotton av, Phone 581 Fallen Chas H (Lula) eng hl26 Highland av Fallen Howard student rl26 Highland av Falling Chas (Mamie) car greaser h653 Ross Fambles Gilbert (Annie L) lab hl430 Broadway Fambro Chas C (Mary) millwkr h2 Manchester qtrs Fambro Dinah (wid Caesar) hl31 (105) Mutual av Fambro Irene rl31 (105) Mutual av Fambro Jas (Hattie) pdlr h540 Cedar (U) Fambro John B millwkr r2 Manchester qtrs Fambro Leonard (Sadie) ice cutter h Cedar (U) Fambro Luther (Fannie) millwkr r 2Manchester qtrs Fambro Mamie lndrs h Log Cabin blvd Fanery C A bakers Am Bakeries Co r760 Oak Fann Clara elk Coleman-Meadows-Pate Drug Co r 2134 2d (SM) Fann Geo (Mary) lab hll Alabama Fann Julia (wid Danl) r2134 2d Fann Tobie (Stella) lab hl211 1st Fann Wm lab rll Alabama Fanning Geo W (Mary A) contr 403 Ridge av h do Fant H Bruce tchr r319 Duncan av Fargason see also Ferguson Fargason Thos B (Nell) slsmn h204 Appleton av Farley Bose butler r675 Dunlap Farley Fredk (Daisy) eng h3606 Houston av Farley Horace (Willie) lab h.723 Fort Hill Farley John M (Jennie) formn h416 Oglethorpe &C0. Polk Directory Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Va% on Savings MACON CITY DIRECTORY (1925) 349 Farley Julia (wid Andrew N) r3606 Houston av Farley Lucile lndrs h257 (157) Center Farley Margaret maid r343 Douglas av Farley Martha cook 343 Douglas av Farley Richd (Estella) lab hll5 Ritchey al Farley Rosa lndrs hll4 Spring Farmer Amanda (wid Alonza J) rl74 Cedar (S M) Farmer Anna r260 Broad (E M) Farmer Edw (Reaba) r Ed Jackson Farmer Edw (Olivia) lab hl4 Short st la (E M) Farmer Emma dishwasher Elite Cafe r411 Shores la (E M) Farmer Franklin W (Helen) dentist 610 Bibb bldg r 644 Forsyth Farmer Geo A (Annie) pntr h307 Chappell Farmer Hattie (wid Thos) r469 Alabama Farmer Henry (Alice) lab h503 (172) Charles (S M) Farmer Jas (Lucy) lab C of Ga h406 (306) Charles (S M) L3s5 P t--I4 n CO p SOUTH'S LEADING FLORISTS m IDLE HOUR NURSERIES Farmer Jas (Rosa) shoe repr Jake's Shoe Shine h232 Calhoun Farmer May nurse r316 Washington av Farmers Exchange M E Everett mgr gro 701 3d Farnham L Dow (Blanche) electn rl08 Lawton av Farr Bowery H opr r215 Clinton Farr Henry (Dollie) mach opr h954 Hazel Farr Nellie opr Sou Bell Tel Co r327 American blvd Farrar Clara (wid Wm E) h93 Coleman av Farrar Clara student r93 Coleman av Farrar Sally lndrs r514 (239) Hall Farrar Sami L (Regina) mgr Natl Life & Accident Ins Co hl09 Stonewall pi (V) Farrar Wm E elk Atlantic & Pacific Tea Co r93 Cole- man av Farrell Buck F (Sallie) mill wkr h Lake Bellevue Farrell Elijah carp r217 Dannenberg av Farrell John (Della) lab h217 Dannenberg av gj v .FOR LISTS OF NAMES ANY TRADE ANY BUSINESS ' ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO E3 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO 350 (1925) R. L. POLK & CO.'S Farren John J (Irene) decorator Union Dry Goods Co r498 Hillyer av Farrin Walter L tailor It S Thorpe & Sons Farrior Lollie N (Jessie) presser Liberty Pressing Club h370 Monroe Farris Clyde K elk r479 Blackburn Farris Walter F (Clara) h479 (379) Blackburn Farrow Andrew (Minnie) spooler r235 Telfair Farror Homer (Rilla) carp h811 Ocmulgee Farrow Wm (Frances) farmer h9 Cbestney Fashion Shoe Store (Louis Snyder) 613 Cherry Faulk Ada cook hl37 Woodliff Faulk Emily r352 Madison Faulk Emmitt (Cornelia) lab h352 Madison Faulk Hattie L lndrs r352 Madison Faulkner Della r C F McCallum Faulkner Henry A (Gertie) blrmkr h307 White Faulkner Jessie T r804 Elm Faulkner J Lee r7 Bibb av Faulkner Tally M r406 Forest av (V) Faulks Wm (Nellie) lab h330 Campbell av Fausett Eva rl45 Laurel av (N H) Fausett John A asst bkpr rl45 Laurel av (N H) Favars Wilbur B (Agnes) inspr Macon Water Wks h866 Cherry Favors Jas W (Lucile) rl48 Cole Favors John A (Fannie) h27 Holt av Favors John G elk Paragon Pharmacy r620 Plum Favors Marie hlpr r27 Holt av (N H) Favors Mattie rl21 Holt av (N H) Favors Phyllis r273 1st av (V) Favors Thelma slswmn W T Grant Co r756 Pine Favors Wm H (Allie) h756 Pine Fay Geo cook Dempsey Hotel r573 Orange Feagin Eliz M Mrs elk F A Guttenberger r360 College Feagin Owen T (Eva) mach r310 Duncan av Feagin Prince W.rl32 Ells (S M) FEAGIN R DOUGLAS (Janette), Attorney-at-Law 2 Hardeman Bldg, Phone 193, li206 Vista Circle, Ingleside, Phone 1691-W Fearce Oscar (Mary) lab r315 Division . Fears B'ulah L cook r224 Hendrix la Fears Geo (Thelma) stmftr r825 Orange 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) Fears Myrtice Mrs rooms 161 Broadway h do Feb Chas I (Josephine) furn 616 Poplar hl63 2d Feb Chas I J (Myrtle) appr rl63 2d Federal Building Mulberry ne cor 3d FEDERAL CLOTHING STORE, R G Hammond Mgr, Credit Clothiers 312 2d, Phone 4121 (See page 58) Federick Jetty (Annie) janitor rl85 Grants Felder Allen (Leila) orderly h809 Ash Felder Champ lab r rear 354 Spring la Felder Ella L cashr Burden Smith & Co rl20 Hines ter Felder Erminie tchr r212 College Felder Mary cook r5 Harris al Felder Phyllis lndrs r622 Washington av Felder Sami L (Hattie) agt Life Insurance Co of Va h212 College Felder Simon (Jennie) lab h.86 Woodliff Felder Simon (Ella) porter h58 Davis la Felder Thos S lawyer 506 Ga Casualty bldg r Hotel Lanier MACON OPTICAL COMPANY Frank H. Johnson /V . . . mOptl-ici ans '"X * Optometrists 4668 CHERRY %* PHONE 321L3 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Felker Agustus F timekpr rl35 Beverly pi Felmore Virgil pntr r301 Elbert Felps Mattie lndrs r8 Fulton al Felps Wm (Lula) lab h274 Madison Felton Anna lndrs r96 Bay Felton Arth (Louise) druggist r207 Washington av Felton Augustus C (Hattie) pres-gen mgr Nye Odor- less Crematory Co h376 Cottage Felton Eddie T pntr r92 (122) Forest av V Felton Edw W (Mariah) pntr h92 (122) Forest av (V) Felton Ella lndrs h43 2d av (V) Felton John (Sarah) lab r236 Elliot (EM) Felton John pntr r92 (122) Forest av (V) Felton Lula maid h365 Craft la Felton Mamie lndrs h423 Ward (V) Felton Mary lndrs hll Harris al Felton Robt pntr r92 (122) Forest av (V) Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk &Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 352 (1925) R. L. POLK & CO.'S Felton Ruth M r376 College Felton Wesley (Hattie) lab h418 Stein's al FELTON WM H (Mary E), Pres Macon Ry & LlgEt Co and Macon Gas Co, hl24 Georgia av Felton Wm H jr (Central Georgia Automotive Co; Macon Bearing & Parts Co) rl24 Georgia av Felts Geo S lab r269 Madison Felts Julia lndrs r238 (234) Lynwood av Felts Paul (Lucile) lab h238 (234) Lynwood av Felts Wm (Maggie) lab hll7 Forest av (V) Fendt Essie L (wid Walter A) h246 Jeff Davis Fendt Otis H mach r246 Jeff Davis Fenn Wm (Maxwell W) trav slsmn r686 College Fennell Grover C printer Jones & Coney h272 Colum- bus Fenney Chas lab h720 (705%) Elbert Fenney Jessie cook r400 (541) Stevens Fenny Emma cook h400 (455) Colquitt Ferguson Ed (Mattie) lab h525 Grant Chapel al Ferguson Exbel (Tessie) lab h527 Middle (EM) Ferguson Janie tchr r222 Forest av (V) Ferguson John T ship elk Swift & Co r229 Tatnall Ferguson Sami H (Lucy) yd supt h423 Ridge av Ferguson Sidney J elk J B Riley Drug Co r Y M C A Fern Dugal (Sarah C) hll35 Broadway Ferrell Arth A (Fenella) air brake inspr rl35 Col- quitt Ferrell Chas (Nancie) lab h207 Ward (V) Ferrell Eug (Mary) brklyr rl36 (150) Lincoln av (V) Ferrell Henry G (Fannie) grocer 132 Green hl28 do Ferrell Mary grocer 267 Cowan r623 Ward Ferrell Ralph (Bessie) chauf h207 Ward (V) Ferrill Authur L (Mallie) trav slsmn hl75 North av (NH) Ferrill Margt slsldy Union Dry Goods Co r702 For- syth Ferrill Margt S (wid Hampton L) h702 Forsyth Ferrum Annie (wid Eig) r623 Main (EM) Ferry Bernard G dept mgr Dannenberg Co rl24 Stone- wall pi Ferry Frank elk Fourth Natl Bank rl24 Stonewall Pi Fetner Emmett S v-pres Bibb Brick Co r C H Phillips Fetner Leo A (Louise) formn h312 Duncan av n Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 353 FETNER WALTER C (Leila; Dixie Coal Co), hlOOS Bd Few Albert H deliverymn Am Ry Exp Co r803 Pine Few Mark C (Ethleen) produce 621 Poplar li265 Co- lumbus Few Roger elk r803 Pine Few Susie restr 1212 Broadway grocer 868 Hazel h 866 do Few Wm R ship elk Swift & Co h.661 y2 Plum Fick Harryotte student rllO (190) Buckingham pi Fick Peter N (Cecile) slsmn hl'10 (190) Buckingham pi Ficklin Chas lab r213 Elliot (EM) Ficklin Wm slsmn r673 Mulberry Fickling Jerry L (Eva) h713 2d Fickling Wm A collr Washington Dessau r673 Mul- berry FIDELITY LOAN & INVESTMENT CO, M E Elliott Pres, J N White Sec-Treas, 207 Georgia Casualty Bldg, Phone 1626 FIDELITY MUTUAL LIFE INSURANCE CO, R C Cheatham Jr Agency Supervisor 418-14-15 Macon National Bank Bldg, Phone 4822 FIDELITY PHENIX FIRE INS CO OF NEW YORK, John E Wilson Agent, 207 Citizens & Southern Bank Bldg, Phone 214 FIDELITY & DEPOSIT CO OF MARYLAND, Morris Harris Agent, 210-212 Bibb Bldg, Phone 131 Field Alex (Annie) lab h216 Jefferson Field Edmond G (Rosa) mach h2091 3d Field Jos H student r2085 3d Field Leon F student r2085 3d Field Marion E mach r2085 3d Field Maud r2085 3d Field Raymond F formn r2085 3d Field Rebecca student r2085 3d Field Wm E (Sarah) formn h2085 3d Fielder Jas L elk Piggly Wiggly r603 Forsyth Fielding Sami B (May W) opr W U Tel Co h505 Na- pier av Fielding Sami B jr opr W U Tel Co h206 Tatnall Fields Alonzo lab r220 Patterson Fields Edw janitor h315 (333) 1st av (V) Fields Feji carp h220 Patterson FOR LISTS OF NAMES ANY TRADE ^-- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 mm 354 (1925) R. L. POLK & CO.'S ___ as* a Fields Galveston (Gertrude) truck driver h205 Wood- liff MMEI Fields Gus D (Susie) elk Quality Market hll4 Cole Fields Jasper mach r238 Middle (V) Fields John porter r238 (Middle (V) Pin Fields Lawson (Lizzie) lab h238 Middle (V) Fields Leonard (Ethel) lab h419 3d av (V) THE Fields Luke porter r238 Middle (V) Fields Mary rll5 Washington av DIRECTORY Fields Robt D (Essie) insurance agt hl07 Roberts Fields Sarah sten Builders Lumber Co r771 Oak IS THE Fields Wm (Mary) porter h54 Davis la Fields Wm L butcher rll5 Washington av GREATEST Fields W Howard (Leo) cond h2534 2d Fierman Isaac bkpr Coplan Junk Co r911 Cherry MARKET Fierman Lillian sten r911 Cherry Fierman Philip (Katie) mgr Ga Shoe Factory h911 PLACE Cherry Fierman Yetta sten r911 Cherry M THE Filsinger C N grinder Macon Barber Supply Co Finch Louis (Susie) janitor hill Lynwood av WORLD Finch Perry (Freddie) hlpr hl26 Coleman al Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * FINCH W R (Mary T; W R Finch Motor Co), hl317 Yineville av (Y) FINCH W R MOTOR CO (W R Finch), Nash Motor Cars 658 3d, Phone 4354 (See left top lines and page 52) Fincher Arth B (Mollie) formn hlOll 1st Fincher C P r Y M C A Fincher Felton asst mgr r360 College Fincher Ira D (Lizzie) wtchmkr 503 Broadway hlOl Oakland av Fincher Robt F slsmgr Steven M Solomon Jr r305 The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year College Fincher Robt H musician rlOl Oakland av Findlay Arth P (Mary) hl219 Vineville av (V) Findlay Genevieve sten rl20 Lamar Findlay Richd E (Pauline) sec-treas City Board of Water Commnrs h926 College Findlay Susie de S sec to pres Macon Telegraph rl219 Vineville av (V) Findley Prentice (Delina) slsmn hl206 Ash MJkiCo Finlay Lola E (wid H C S) r252 1st PUBLISHEBS Finley Ollie womans auxiliary hl96 Laurel av (NH) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569*4 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 355 Finleyson Early elk Am Bakeries Co r233 Bond Finleyson J B bkpr Corbin Supply Co r200 Clisby pi Finleyson Lloyd F bkpr Swift & Co r233 Bond Finnell Eula lndrs rl220 Fort Hill Finney Addie (wid Tlios) hll7 Plant Finney Chas (Dollie) elk Moses Miles h260 Melrose (EM) Finney Cleve (Martha) lab hl61 Hazel Finney C Benj baker Am Bakeries Co r759 Spring Finney Dove (Ednie) lab h400 (541) Stevens Finney Deal lndrs hlOl Plummer's al Finney Delphy rl06 Cabaniss av Finney Fitzhugh L (Pearl L) uphol hl41 Tenney av Finney Grady P cigars 672 Cherry hl06 Cabaniss av Finney Jack cook r418 Elliott (EM) Finney Jackson (Clara) carp h263 Madison Finney John T (Clara) elk hll9 Garden Finney Jos (Ida M) elev opr h254 Middle (V) SASH, DOORS Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service SCREENS Finney Jos (Maggie) lab h464 Alabama Finney J Brady boilermkr rll7 Plant Finney Leila dom h329 Gilmer Finney Logan (Sarah) lab h7 Ford al Finney Lois elk rl06 Cabaniss av Finney Lula lndrs r722 Pear (EM) Finney Lucias B carp r254 Middle (V) Finney Mary lndrs h430 Log Cabin dr Finney Orra A (wid Oliver P) r759 Spring Finney P S (Grace) cond r265 Columbus Finney Rebecca elk Macon Pleating Wks r759 Spring Finney Richd (Ella) tchr hl04 Forest av (V) Finney Robt (Wilile) lab 635 Fort Hill Finney Robt porter Sanitary Barber Shop No 2 r759 Spring Finney Robt L (Rebecca) h759 Spring Finney Susie maid hl66 Coles al Finney Thos E (Louise) hl.1'9 Nelson Fire Baptism Holiness Church 10 Rock Hill la R 406 THIRD ST. USE YOUR CREDIT TEL. 3026 on yj O * 2 P gw 2gsyz it 0 5< 5OOSt>tunHSncU*>uSQOzfSittuSH>nn. < <= b KS K<3 YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Flanders Sami (Trudie) hlpr h910 Hazel Flanders Wm R (Pauline) supt Standard Oil Co hl07 1st (CP) FLATAU ISAAC (Estelle H), V-Pres Independent Laundry Co, h2I0 Delaware av, Phone 8592 Fleischer Cecil rl306 Vineville av (V) Fleischer David pawn broker 421 3d h219 New Fleischer Julius slsmn Dannenberg Co rl306 Vine- ville av (V) Fleischer Louis student r219 New Fleischer Seisel slsmn Dannenberg Co rl306 Vine- ville av (V) Fleischmann Yeast Co J G Carswell sis agt 246 Broad- way Fleming Beatrice cook h807 Ocmulgee Fleming Harry P (Adele J) agt New England Mutual Life Ins Co hl04 Alabama av Fleming John M (Fleming & Williams) r963 Hazel FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION w DETROIT R. L. POLK & CO. CHICAGO 210-212 MORRIS HARRIS Bibb Building Id INSURANCE SURETY BONDS Telephone 131 358 (1925) R. L. POLK & CO.'S Fleming Marshall (Pearl) r870 2d FLEMING MATTHEW L (Malinda), Tailoring, Be/ pairing, Cleaning and Pressing 615 Poplar, h22^ Telfair, Phone 9279 Fleming Wm B (Euphrasia) civ eng h757 Mulberry Fleming & Williams (John M Fleming, Hattie Williams) gro 963 Hazel Flemister Bob (Fannie) h798 Waterville rd Flemister Emmett (Mamie) firemn hl46 Bay Flemister N L dist mgr Peoples Health & Life Ins Co r318 Walnut Fletcher Beatrice rl008 Ernest Fletcher D C driver Yellow Cab Co Fletcher Florence hl008 Ernest Fletcher John (Thelma) emp C of Ga h2003 Broad- way Fletcher Scott C hlpr Loh's Cafe h313 Ellis av Fletcher Taylor (Mary) cook h227 Magnolia la Fletcher Thos (Ethel) lab r213 Patterson Fletcher Wesley (Christine) lab hl64 Cedar (U) Fleuellen Oscar (Maggie) lab rll55 Edgewood av Fleuellen Wiley rll55 Edgewood av Flewellen Edw (Leila) h224 Ernest Flewellen Geo E (Nancy) lab hl'O King Flewellen Jerry (Annie) porter h293 2d av (V) Flewellen Johnnie M drsmkr h289 2d av (V) Flewellen Wm C (Lena) mgr Manget Bros Co rllO Rogers Flewellen Willis driver W F Elder Lumber Co Flewellyn Lizzie lndrs rl8 Turpin la Flewellyn Pervis (Fannie) lab hll51 (811) Woolfolk Flint see also Flynt Flint Joe (Ida) firemn r218 Pear (EM) Flint Willie M lab b.4 Harris al Flippin Percy S (Laura) tchr Mercer University h505 Adams Flood Harry T (Angeline) eng h708 Pine Florida Fish & Oyster Co Sami Vullo prop 318 Main (EM) Florida Real Estate Co (Inc) C R Sovey pres F M Kincaid v-pres C W Barber sec-treas 311 Cherry Floros Gus (Maria; Ellis Cafe) hll66 Oglethorpe Flournoy Albert (Hattie) lab h234 Plant al A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company HEAVY HAULING MOVING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE O*to0 Phone 4951 256 Second St. <1 MACON CITY DIRECTORY (1925) 359 Flournoy Auto Co J E Flournoy mgr 519-521 Poplar W"o filling stations 667-671 Cherry and 551 3d Flournoy Foy slsmn Swift & Co r Nevarro Flournoy Jos A mgr Macon Cafeteria res Rivoli Ga 5s! Flournoy J Everett mgr Flournoy Auto Co res Rivoli Flournoy Lewis (Annie) carp h551 Smith row Flournoy Robt waiter Lohs Cafe Flournoy Walker J slsmn The J W Burke Co rl40 Magnolia Flowers Albert T (Della) mach hd Macon Lmbr & Mfg Co h603 Plum Flowers Arth J (Jewel) mstr mech C of Ga r604 1st Flowers Butler lab rl08 May av Flowers Earl elk r452 Woolfolk Flowers Edw D (Mollie) carp Willingham Sash & Door Co hl42 Stratton Flowers Emma student rl42 Stratton Flowers Ethel student rl42 Stratton Flowers Florence student rl42 Stratton Flowers John E gro 108 Mulberry rl42 Stratton Flowers John W (Alice B) barber H L Jenkins h452 Woolfoik (EM) Flowers Julian J (Iona M) plmbr Miller Bros r2523 2d Flowers Marie slsldy Burden Smith & Co rill Col- lege pi Flowers Mott (Carrie) lab h709 Campbell av Flowers Rada r210 Middle (V) Flowers Rebecca (wid Chas) r219 Newberg Flowers Rosa B sten W U Tel Co r452 Woolfolk Flowers R Fletcher (Clover) elk Howard Smith r429 Telfair Flowers Sidney L plmbrs hlpr F X Daly Co r204 Mi- kado av Flowers Thelma rl42 Stratton Flowers Walter lab r452 Woolfolk Flowers Wm E (Sarah) farmer h204 Mikado Floyd Aubrey carp rl5 Balkcom av Floyd Chas lab r451 Martha (EM) Floyd Edmund H bkpr J B Riley Drug Co rl30 High Floyd Etta lndrs h306 Madison Floyd Frank (Maude) reprmn h816 Elm Floyd Georgia mlnr r448 New Floyd Jas bellmn h208 Hazel T S' STORAGE FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION c | DETROIT R. I,. POLK & CO. CHICAGO W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 360 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Floyd Jesse I (Irma) city firemn hl5 Balkcom av Floyd John mach r760 (766) 2d Floyd Judge bkpr rl26 High Floyd Mary (wid Chas P) hl22 New Floyd Otto (Carrie) lab hl53 Coles al Floyd Pet lab r320 Williams Floyd Richd (Alma) lab h243 Division Floyd Rifles Armory D C Harris capt 65iy2 Poplar Floyd Steph O (Susie) real est r21T Buford"pl (V) Floyd Susie r307 Walnut Floyd Thelma Indrs r246 Mitchel Floyd Walter wtchmn Adams-Richardson Lmbr Co h ft of Poplar Floyd Wm (Mary) lab rll8 Bay Floyd Wm E (Georgia) barber R G Stripling r557 Oglethorpe Fluellen Donnie lab h355 Madison Fluellen Nancy Indrs r355 North Fluellen Tina cook r355 Madison -- Fl'uker Henry (Eliza) lab hl62 Virgin Flynn Dennis elk Corbin Supply Co h591 Carling av Flynn Jas W (Wander) bkbndr The J W Burke Co h 204 Center Flynt see also Flint Flynt Henry G (Mattie W; Flynt & Genone) hi, 474 Orange Flynt & Genone (H G Flynt, J E Genone) barbers 409 Cherry Fogarty Augustus C (Alberta) sten-bkpr h204 Mont- pelier av Fogarty Bernard A (Jimmie) elk h335 Winship Fogarty Marilou opr W U Tel Co r335 Winship Fogarty N John (Annie) mach W S Dickey Clay Mfg Co r456 Walnut Fogarty Thos Z (Vallie) cashr W U Tel Co hl04 3d Folds Chas (Laura) carp hl52 Fulton (EM) Folds Geo student rl20 Highland av Folds Margt r457 Oak Foley John G student r309 Georgia av Folk Ruth h703 Adams Folk Wm E (Minnie) trav slsmn h703 Adams Folkelman Richd M (Mattie) hl223 2d Folks Doris E student r210 Duncan av Folks John H h210 Duncan av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 361 Polks Oscar J (Dollie) mach rl017 2d Polks Sarah sten J H Spratting r210 Duncan av Folsom Carl cabtmkr Macon Lmbr & Mfg Co Folsom Marcus B (G'ussie) agt Metropolitan Ins Co h 404 Church (E M) Ponville P D cotton buyer r868 Mulberry Forbes E Howell (Ethel) genl agt N C & St L Ry h406 Forest av (V) Forbes Frances r374 Monroe Forbes Wm R Rev (Ella) pastor Tremont Temple Baptist Church h374 Monroe Ford Alger M cook r458 E Academy (EM) Ford Amelia lndrs h420 Peachtree Ford Anderson chauf r608 (227) Hall Ford Arth (Martilla) lab h265 Cowan Ford Byron (Ollie) millwkr r Buck Farrell Ford B B (B B Ford & Co) r Dothan Ala Ford B B & Co (B B Ford, P R Penn) cotton buyers 6121/2 3d FORD CARS, Adams-Buchanan Motor Co Authorized Dealers 716-720 Broadway, Fliones 3407-8498 Ford Cars, Ellis Motor Co Dealers 362-378 1st, Phones 46-723-724-1846 FORD CARS, Jones Motor Co Authorized Dealers 557-559 Plum, Phone 1591 Ford Chas (Eleanor) lab h403 (19) Hall Ford Chester (Mellvidie) lab h458 E-Academy (EM) Ford Clark (Nancy) farmer hi (117) Hydrola Ford Cleonus r608 (227) Hall Ford Clisby porter Askins r (608) 227 Hall Ford Clyde file elk Coml Credit Co res Masonic Home rd Ford Dave (Nettie) lab rl33 Broad (EM) Ford Dollie cook r450 Martha (EM) Ford Edw (Clara) porter h811 Center Ford Eppie E r608 (227) Hall Ford Erwin ydmn W F Elder Lumber Co Ford Frances lndrs h422 (15) Hall Ford Francis 0 (Lois( mech h Winship Ford Grace h608 (227) Hall Ford Henry (Stella) lab r410 Virgins la Ford Holsey lab r246 Mitchell Ford Irvine (Ida) insurance h264 Broad A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "list of Mailing Lists." r. l. POLK & CO., Detroit 2 w _ "0 5 -- r u a Q-w rW' * t/> > * f^ We Do It Bight BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 R 0 L L E R & M P L U M B I N G 362 (1925) R. L. POLK & CO.'S Ford Jas W (Fannie) furniture 1125-31 Broadway h 623 Main (EM) Ford Jas W jr (Ruby) collr J W Ford r623 Main (EM) Ford Janie lndrs hll7 Jones st la Ford Jesse (Phoebe) lab h539 Smith (EM) Ford John H lab r455 Barracks al Ford Kelly (Lula) lab h220 Northern Ford Laura lndrs h728 Reynolds al Ford Madie student r264 Broad (EM) Ford Margt tchr h601 Broad Ford Mary J lndrs r422 (15) Hall Ford Matilda lndrs h337 Woodliff Ford Milton lab r608 (227) Hall Ford Nora lndrs r501 E 2d (EM) Ford Oscar (Mamie) auto mech Montpelier Garage h Macon Rt 2 Ford Riley J (Mollie) pastor h246 Mitchell Ford Robt (Carrie) lab h2 Bright al "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseipdgUinnNaokln-,. SDeAeILyoYu,r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'L* 1 H Ford Robt 0 (Mamie; Montpelier Garage) r R F D 2 Thomaston rd Ford Sallie maid hlOl Cedar L E Ford Sarah cook 130 Georgia av Ford Savannah pdlr rlOO Roberts L A Ford Thos V (Lottie) firemn rlOl Nelson Ford Walter truck driver r264 Broad (EM) Ford Wm (Cora) carp h215 College I T Ford Wm (Lillie) stone ctr r518 New Ford Wm D (Clifford) expressmn h909 Clinton rd R I Ford Willie lndrs r98 Bay Fordham Eliza cook r418 Ward (V) Fordham G Desota (Bessie) jwlr J H Sherwood r324 0 N Hanson Fordham Hattie Mrs h616 Telfair N G Fordham Hattie smstrs r616 Telfair Fordham Jos D (Mollie) farmer h527 Montpelier av Fordham Luther F (Exa) linemn W U Tel Co h204 S Grand av ^-- 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND lyf THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) Fordham Ruth r527 Montpelier av Fordish A1 T eng r560 Plum FORDSOA TRACTORS, Ellis Motor Co Dealers, 862- 878 1st, Phones 46-728-724-1846 FORDSOA TRACTORS, Jones Motor Co Authorized Dealers 557-559 Plum, Phone 1591 Forehand Claude hlpr r533 Coleman al Forehand Oscar hlpr r533 Coleman al Foreman Green J (Willie L) blksmith hl23 Telfair Forest Jas (Mamie) cabtmkr r203 Fort Hill Forester Louie student rl72 High Forman Isaac (Annie) lab h259 Ocmulgee Forrest Chas (Florence) wtchmn Sou Ry h504 Edison Forrest Leon K elk County Engineer r343 Carling av Forrester Gerard A (Kate) contr h225 Belmont av Forrester Heller K h225 Belmont av Forster Chas C (Hilda) hl28 Rogers av Forster Georgia B cook r558 Ward (V) Forster Jas lab r7 Clara (EM) MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Forster Richd gro 339 Douglas av r610 3d Forster Robt M (Grace) insurance agt h Rocky Creek rd (SH) Forster Theo lab r558 Ward Forsyth Estell Indrs h608 Ross Forsythe Terrace 579-87 Orange Fort Bruce (Sallie) carp hllO Ward Fort Hawkins Cash & Carry Store (W M Mitchell) 500 Fort Hill Fort Hawkins Lodge 418 F & A M 609 Main (EM) Fort Hawkins School Emma O Smith prin 450 Fort Hill Fort Hill Cemetery Hall bet Short and Mitchell Fort Julia Indrs r468 Broad Forte Lavinia Indrs r520 Northern Forter Paul E (Eliz) uphol h308 Peachtree Foster Benj F Rev (Artemissia) pastor First Chris- tian Church hl32 Remhert av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answ 3rs All Questions as to WHOM You Are Looking For and where They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company 43 43 Oh* J3 CM co Oh 0) CU P c* G o < r* x pS cl Jh50 "3 ^ CM H CD u ctf s flj pJS cu C/3 e\ a $* CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 364 (1925) R. L. POLK & CO.'S Foster Chas B stone ctr B H France rllO Napier av Foster Chas C (Hilda) bkpr Idle Hour Nurseries hl28 Rogers av Foster Chas W (Lena) dispr h276 Hillyer av FOSTER CLAUDYA, Bkpr L H Burghard, r716 Mul- berry Foster David (Lila) lumber stacker h220 Telfair Foster Emma waitress r774 Nussbaum Foster B L detective Police Dept 614 Ocmulgee Foster Fannie cook rl23 Virgins la Foster Hattie (wid Richmond) rl09 Patterson Foster Hattie r314 (219) Pio Nono av Foster Henry (Mary) firemn h523 B 1st (BM) Foster H L repr A G Rhodes & Sons r Bellevue Foster Janie dom b.549 Massee la Foster John (Anna) lab h201 Lee Foster Jos (Georgie) boilermkr h.49 Orchard av Foster Kirk cashr Coml Credit Co r276 Hillyer av Foster Leona (wid Wm B) rllO Napier av Foster Lizzie cook r330 (234) Pio Nono av Foster Paul B refnshr A G Rhodes & Son Foster Pinky lndrs h522 Army Lot Foster Sami (Pearl) lab r753 Broadway Foster Vile r774 Nussbaum Foster Robt M (Grace B) agt N Y Life Ins Co 62 Rocky Brook rd (SH) Foster Wade FI (Clio) benchmn Willingham Sash & Door Co h606 Clinton (EM) Foster Wm M (Beulah) gro 231 Roff Home av h do Fountain Aca (Mattie) mech C of Ga Shops h322 (223) Roye Fountain Bertie M bkpr H A Kennington r253 Church (EM) Fountain Claude R (Lucy) tchr Mercer University h 706 Napier av Fountain Ernest (Sussie) pntr h219 Chappell Fountain Frances M (wid Thos) r851 Oak Fountain Geo (Beatrice) lab h645 Long Fountain Hubert (Liza) lab r325 Long Fountain Iola sten Coml Credit Co r253 Church (EM) Fountain Jas A D phys 402-6 Grand bldg r209 Clisby Pi Fountain Jas M (Ada) formn h253 Church (EM) Fountain Jos (Idella) lab h325 Nussbaum J3 H LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 365 Fountain. Lula cook h53 Craigs la Fountain Mattie Indrs r325 Nussbaum Fountain Sallie (wid Frank) Indrs h606 Ross Fountain U C lab r53 Craigs la FOURTH NATIONAL BANK, C B Lewis Pres, J N Neel, W R Rogers Jr and G E Patterson Y-Prests, C 0 Carpenter Asst Y-Pres, J K Hogan Cashr, Frank Branan, P G Hogan, H A Kriebel, J T Hogan, G F Gilleland Jr and N D Mallary Asst Cashrs, Fourth National Bank Bldg 502-504 Cherry, Phone 4166 (See right top lines and page 54) FOURTH NATIONAL BANK BUILDING, 502-504 Cherry Fousse Mary opr The Wm Carter Co Route No 2 Fowler Amanda (wid John W) rl65 Ells (SM) Fowler Arth T (Thelma) real est h49 Marion pi (HH) FOWLER BENJAMIN J, Attorney-at-Law, General Practice 314 Macon Natl Bank Bldg, Phone 886, r298 College, Phone 2216-J Fowler Boisy lab r83 Bay Fowler Cora L Mrs h Osborne pi (I) Fowler Eug H slsmn r514 Orange Fowler Harry C (Annie) pres Case Fowler Lmbr Co pres-treas Fowler Lmbr & Plywood Co hll8 Buford pi (V) Fowler Lizzie Indrs hl22 Virgins la Fowler Lumber & Plywood Co H C Fowler pres-treas C C Hammond sec ft of Division Fowler Margt h315 Water (EM) Fowler Nora (wid John) hll9 School Fowler Sidney (Carrie) lab h610 Prince Fowler Sylvester porter rl537 Johnson's al Fowler Thos E (Ida) cond hl008 Walnut Fowler Thos J (Sallie M) h rear 920 1st Fowler Ulysses slsmn Simon Moore r664 Plum Fowler Virginia rl008 Walnut Fowler Wainwright Handle Co Benj F Wainwright gen mgr Forsyth rd % mi w Pio Nono av Fowler Walter G ship elk Natl Biscuit Co rll9 School Fowler Wm student rl537 Johnson's al Fowler Wm M v-pres Case Fowler Lbr Co res Cedar Key Fla Fox Ada M sten r289 Winship Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. C/3 H9 ZS-W* CO ss Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES ASD CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 366 (1925) R. L. POLK & CO.'S Fox Anna L (wid Benton D) h568 Walnut Fox Benj (Hattie) rllO (15) Mason (SM) Fox Benton D ship elk Gulf Refg Co r568 Walnut Fox Crayton lab r320 Hammond Fox Edw elk r664 Plum Fox Fannie (wid Henry) hl32 Gordon (SM) Fox Harold W r289 Winship Fox Harold W tmkpr r372 Clinton (EM) Fox Hazel cashr Bethune & Stevens r204 Washington av Fox Henry A genl mdse 1751 Broadway rl32 Gordon (SM) Fox Lewis A (Lena) supt Macon Cooperage Co h289 Winship Fox Lloyd r J B Marshall Fox Louise C sten N W Mut Life Ins Co r568 Walnut Fox Mae T cook F N Burch r356 Patterson Fox O'Hara (Julia) supt Independent Chemical Co h 204 Washington av Fox Sallie smstrs Day's r373 Clinton Fox Wm C (Sallie) mach h372 Clinton (EM) Foy Frances cashr Union Dry Goods Co res Colum- bus rd Foy H W ship elk Dunlap Hdw Co res Columbus rd Fraley Benj (Estell) lab r914 (14) Short (EM) Fraley Malichia carp hll8 Simmons av Fraley Mollie r408 Ash Framble Jas lab r25 Tinsley la FRANCE ERNEST H (Edith), High-Class Monu- ments and Slabs, Marble, Granite, Limestone, Sandstone, Etc 1015 5th, Phone 4526, h731 Ridge av, Phone 4999-J France Sydney mgr E H France r731 Ridge av FRANCES HOTEL, A E Weems Prop, T N McKibben Mgr, 317 Cherry, Phone 4961 Francis Hines L (Ermine H) sec-treas Birch Ins Agcy h258 Wesleyan dr Francis Tony J gro 562y2 Poplar Frank Augustus (Eva) lab r204 Woodliff Frank Gustav cook Southland Cafe r Edgerton Hotel Frank Jas hlpr r304 Orange Frank Mittie Indrs hl20 Phillips la FRANK PETER (Helen; Try-Me Bottling Co), h304 Orange, Phone 3906-J E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 . |IW|||| AUTHORIZED LmcolntSfctf^ - CARS-TRUCKS -TRACTORS " have it. PHONE 1591 JONES MOTOR COMPANY 557-550 PIjUM ST. MACON CITY DIRECTORY (1925) 367 Franke Wm (Louise) h758 Plum Franklin Alwilda (wid J A) r C G Franklin FRANKLIN AUTOMOBILES, Yates Motor Co Distri- butors, 707 3d, Phone 1446 Franklin Carolyn student r82.1' Curd (SM) Franklin Cary G formn h ss Forsyth rd (V) Franklin Eliz cook r936 Elbert Franklin Eug (Isalene) h853 Edgewood av Franklin Felton lab r706 (442) Hall Franklin Guaranty Co L F Parker mgr salary broker* 613% Poplar Franklin Jas A (Eliz) h821 Curd (SM) Franklin Janie (wid Will) hll2 May av (U) Franklin John (Maggie) hostler blpr r322 Maple Franklin John B (Johnnie) train dispr h867 New Franklin John B jr collr r867 New Franklin Jos P chauf r420 Forsyth Franklin Lee (Ethel) lab hl23 Jones Franklin Life Ins Co W C Willis mgr 308 Ga Casualty bldg Franklin Lillie M lndrs r83 Bay Franklin Paul A student r821 Curd (SM) Franklin Rachel lndrs r256 Plummer's al Franklin Robt r558 Ward (V) Franklin Teldeo lab r221 Elliott (EM) Franklin Wm lab r706 (442) Hall Franks Annie lndrs h843 Main (EM) Franks Beauty maid r427 Madison Franks Carrie lndrs h474 (421) 3d av (V) Franks Colton r427 Madison Franks Jas lab r84 Schofield Franks Jas (Ira L) pdlr h303 1st av Franks Julius (Nettie M) lab h521 E 2d (EM) Franks Moses lab r427 Madison Franks Viola lndrs r84 Schofield Fraser Chas (Bertha) lab r218 Telfair Fraser Jos A (Pearl) pntr hl28 Wyche Frawick Claud M (Lula L) bkpr h20 Marion pi (HH) Frayser Wm N phys r250 1st av (V) Frazer Carrie lndrs rl47 (150) 1st av (V) Frazer Geo S Rev (Mary W) pastor First Presby Ch hll2 Buford pi Frazer Pearl nurse rl47 (150) 1st av (V) The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 368 (1925) R. L. POLK & CO.'S Frazier Albert (Leila) switchmn hl96 Washington (EM) Frazier Essie nurse r473 Peacock (SM) Frazier Eug (Emma) h303 (607) Colquitt Frazier Gladys nurse Macon Hosp h473 Peacock (SM) Frazier Inez elk McLellan Store Co r316 6th av Frazier Jas (Aline) lab r303 (607) Colquitt Frazier Jessie rl43 Evergreen la Frazier Joshua W (Florence) lab hl43 Evergreen la Frazier Joshua W jr lab rl43 Evergreen la Frazier Julius (Lula) porter h506 Flanders (EM) Frazier Lillie cook r473 Peacock (SM) Frazier Nancy (wid Joe) h473 Peacock (SM) Frazier Robt (Mattie) lab h203 Ocmulgee Frazier Taft student rl43 Evergreen la Frazier Theoda lab r473 Peacock (SM) Frazier Wm P (Cora) carp h316 6th av (SM) Frederick Abr (Rosa) lab r840 (340) Williams Frederick Emma lndrs hl85 Grants Frederick Fanny O smstrs r410 (214) Pio Nono av Frederick Floyd (Mary H) slsmgr hAl, 401-5 Col- lege Frederick Hattie cook J H Fretwell h706 Hawthorne Frederick Ina cook h238 (212) Green Frederick Jas auto mech r706 Hawthorne Frederick Jesse (Alice) hlpr hl30 Army Lot Frederick Jettie (Annie) porter rl85 Grants Frederick Julian V pharm Smith's Pharmacy r234 Tatnall Frederick Lena lndrs r238 (212)'Green Frederick Mittie rl42 Pierce av (V) Frederick Sank (Martha) h807 Ash Fredonia Apartments 213 Bond Fredrick DeWitt (Kate) flagmn r349 Hydrola Freewill Baptist Church Rev J R Hunt pastor Cedar cor Whitehead (SM) Free Will Baptist Church 400 Bailey av Freeman Arth lab r478 Chestnut Freeman A Cullen sec Macon Sand Co h911 Clinton Freeman A Pope (Hattie) bldg contr 2525 Broadway h do Freeman Carlton (Lizzie) firemn rl31 Elizabeth Freeman Chattie nurse rl Braswell's la Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaorrtcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhutofvemaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeoHwr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 369 Freeman Cleora T society editor Macon Telegraph r7 Arlington pi Freeman Cleveland mill hd r22 Bibb av Freeman Clifford M (Alma) inspr Willingham Sash & Door Co r707 Holt av Freeman Cornelius musn r415 Middle (EM) Freeman Edw D (Mary) mill hd h22 Bibb av Freeman Ellen lndrs h622 Williams Freeman Emma Mrs h40 Marion pi (HH) Freeman Erastus N collr Macon Telegraph r564y2 Poplar Freeman Ethel supvr Sou Bell Tel Co r40 Marion pi (HH) Freeman Forrest (Flossie) brkmn hl223 Broadway Freeman Frances Mrs sten The Bradstreet Co r333 Carling (HH) Freeman Fred (Charity) lab hT Cherokee av (SH) Freeman Gertrude (wid Frank) h418 Walnut Freeman Harry W mgr Williamson Inman & Co r 418 Walnut Freeman Hattie (wid A W) lndrs h859 Broadway Freeman Homer H (Ruby) bldg contr 2525 Broadway h do Freeman Izetta cook 727 College Freeman Jas A (Lillie) hl905 Broadway Freeman Jeff r214 Vineville av Freeman John (Ella) cook h315 Moughon Freeman John lab rl31 Elizabeth Freeman John lab r303 1st av Freeman John B (Eunice) car repr r3500 Houston av Freeman John F elk Macon Telegraph r207 American blvd Freeman John L chauf r202 Lexington av Freeman John R (Ida) carp h405 Duncan av Freeman John S (Myrtle B) electn hl54 Oakland av Freeman John T (Laura) formn h3500 Houston av Freeman Jonnie student r40 Marion pi (HH) Freeman Jos (Minnie L) cabtmkr r909 Orange Freeman J B (Frances) r333 Carling av (HH) Freeman Laughlin S ship elk Bateman-Freeman Co rl58 High Freeman Lee (Fannie) carp rl67 Elizabeth Freeman Leonard K collr Macon Telegraph h207 American blvd FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALPT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 370 (1925) R. L. POLK & CO.'S Freeman Lizzie lndrs hl39 Linden av Freeman Lula nurse r554 Henrietta MMLT Freeman Mary elk Palmetto Pharmacy r40 Marion pl (HH) Freeman Mary student rl34 Stratton PLACE Freeman Mattie B washer r528 Ross Freeman Melton lab r320 Hammond THE DIRECTORY Freeman Minnie (wid John) h Bellevue rd Freeman Morrison F appr Lyon Harris & Brooks r207 American blvd Freeman Myrtice slsldy Burden Smith & Co r405 Dun- IS THE can av Freeman Ollie lndrs h628 (128) Hall GREATEST Freeman Oscar lab rl21 (1) Braswell la Freeman Otis (Daisy) chauf h257 North MARKET Freeman Richd H v-pres-mgr Bateman-Freeman Co r Southland Hotel PLACE Freeman Richd H jr prof r Southland Hotel IN THE Freeman Robt W (Mattie) creditmn hl34 Stratton Freeman Sami lab h468 Chestnut WORLD Freeman Tyrus mgr r718 Mulberry Freeman Win A (Alice M) slsmn J B Riley Drug Co * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had h7 Arlington pl N Freeman Wm B asst tchr Mercer University Freeman Willie M dom h224 Whitlock Freeney Agnes (wid A E) rlOO Summit av (NH) Freeney Dock (Ella) switchmn hll5 (111) May av (U) Freeney Edw W (Susie) adv slsmn h.121 1st Freeney Henry W elk r509 Arch Freeney Jas I rl27 Wyche Freeney Laura M sten Macon Sav Bank rlOO Summit av (NH) The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Freeney Mamie B Mrs h509 Arch Freeney Marian student rlOO Summit av (NH) Freeney Plenny A (Clara) car inspr hl20 Florence (SM) Freid Jos H (Hattie) h301 Katherine ct apts French Jewell slsldy W T Grant Co r563 Woolfolk French Mildred L (wid Joel S) h2, 613 Orange French Orville S (Jewel) musen r563 Woolfolk Fretwell J Ames H elk Stewart Oil Co hl057 Elm MJkifo Fretwell Mary rl057 Elm publishm Frewick Robt (Julia) lab h702 Ocmulgee for lists of names ANY TRADE ^ ANY BUSINESS -- ANY PROFESSION DETROIT R. L. PDl Iv & CO. CHICAGO Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE 656i/2 CHERRY ST. PHONE 3041 FOR INFORMATION MACON, GA. MACON CITY DIRECTORY (1925) 371 TERMINAL TRANSFER COMPANY Frey Mamie Mrs elk H A Kennington Gro Co rill Appleton av Friar Mack (Marie) lab r315 Division Fried Bertha r752 Oak Fried Harry (Eva B) trav slsmn r321 New Fried Irving slsmn Royal Shoe Store r752 Oak Fried Jacob R (Katie F) office 452 Broadway r752 Oak Fried Kate F (wid Jacob R) h752 Oak Fried Leon J slsmn r752 Oak Fried Milton R slsmgr Coleman Motor Co r752 Oak Fried Nettie H r752 Oak Fried Sol J (Esther) office 452 Broadway h225 North av (NH) Fried Theo D r752 Oak Friendship Baptist Church 1304 1st Frierson H Rudolph elk rl04 English av Frierson Janie sten W S Dickey Clay Mfg Co r671 Ridge av Frierson Mary N (wid H R) h.1'04 English av Frink Peter H auto slsmn r514 Oglethorpe Frisby Moie rl529 3d Fritts Wm J (Maude) dispay mgr Dannenberg Co h 607 Hillyer av Fromshon Isaac (Hattie) optician 456y2 Mulberry h do Frost Edwin R (Irene) mill hd hl7 Bibb av Frost Ella millwkr rll4 Comer ter Frost R Arth (Lucile) millwkr hll4 Comer ter Frost Sallie L spooler rl7 Bibb av Frutlicher Jas C elk Sands & Co r976 Walnut Fry Bros (D G and E H Fry) bicycles 165 Cotton av Fry Dave C (Daisy) lab hl29 Ritchey al Fry David G (Fry Bros) h478 (378) Blackburn Fry Earl H (Myrtle; Fry Bros) r478 (378) Blackburn Fry Louise cook h209 Hawkins av Fryer Clifford Mrs slsldy Levy's Jewelry Store r764 Cherry Fryer Irene nurse r260 Winship Fryer J Perry (Clifford) printer Macon News r764 > Cherry Fryer Nora nurse Macon Hosp a Fryer Rose r260 Winship Fudge Callie rooms h318 Walnut H JftL m Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy It. L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 372 (1925) R. L. POLK & CO.'S Fudge Henry hlpr h201 (220) Texas Fudge John (Clara) lab h711 Daisy Fugate Eliz student rill Coleman av Fugate Henrietta student rill Coleman av Fugate Henry M Rev (Elsie) pastor hill Coleman av Fugate Henry M jr elk rill Coleman av Fugate Mary tchr rill Coleman av Fugate Watkins student rill Coleman av Fuge Eula lndrs h5y2 Bookers al Fuggs Cleveland (Viola) lab rl55 Green Fulford Foy W (Effie) mldr Schofield Iron Wks hl05 Charles (SM) Fulford Herman 0 (Nettie) cranemn h455 Arch Fulford Manda Mrs r222 Shamrock Fulghum Caroline tchr r205 Hines ter (V) Fulghum Chas B student rl09 Rogers av Fulghum Jas H student rl09 Rogers av Fulghum J Walter (Caroline) slsmn Taylor Iron Wks & Supply Co h205 Hines ter Fulghum Lillian tchr rl09 Rogers av Fulghum Marian student r205 Hines ter (V) Fulghum Tillie S (wid Chas M) hl09 Rogers av Fullam Mary opr h208 Hydrola Fuller Annie B r330 Shamrock Fuller Brush Co W M Watts mgr 512-13 Ga Casualty bldg. Fuller Chas lab r782 Reynolds al Fuller Chas F (Addie) lab h782 Reynolds al Fuller Cicero lab h rear 856 Mulberry Fuller Dave (Silla) carp h278 Whitehall Fuller Edw L (Luella) prop Fullers Garage r R F D 4 (EM) Fuller Emma L r O C Fuller Fuller Geo porter H Marshall Furn Co r782 Reynolds la Fuller Grant P (Myrtle L) books 416 2d h931 Orange Fuller Homer C slsmn Kinnett-Odom Co r330 Sham- rock Fuller John H (Clara) lab h530 Maynard Fuller Jos B (Carra) bleacher opr rl54 Carling av (HH) Fuller Lewis H firemn r330 Shamrock Fuller Lizzie (wid Chas H) h330 Shamrock Fuller Mary lndrs h!34 Malloy's al FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 373 Fuller Mattie lndrs hl41 (2) Carling av (HH) Fuller Millard r 0 C Fuller Fuller M Mozelle student r931 Orange Fuller Otis C (Allie) meat ctr h Benton av Fuller Patk lab r203 (112) Toombs (SM) Fuller Talvilla Mrs opr The Wm Carter Co r2921 Houston av Fuller Thos (Linconia) porter Reis & Armstrong h812 Ocmulgee Fuller Wilfried B (Mattie) mach hd Builders Lbr Co 401 Fort Hill Fuller Will L (Stella) supt Chambers Lbr Co Inc r438 Vineville av Fuller Wm (Carie Lee) emp Creosote Plant r221 Green Fuller Wm M (Clara) mach Fullers Garage r R F D 4 (EM) Fuller Willie lndrs h217 Thomas Fuller Willie J smstrs r330 Shamrock YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Fuller W M Mrs slsldy Empire Candy Co res Milledgeville rd Fuller's Garage E L Fuller prop 408-410 Main Fullington Annie M (wid Louis L) boarding 765 Mul- berry h do Fullington Ben H (Lula) supt hl004 Walnut Fullington Douglas student rl004 Walnut Fullington Hoke lens grinder J H Spratting r451 Spring Fullington Kent repr Underwood Typewriter Co r451 Spring Fullington Lewis E ship elk r45T Spring Fullington Louise sten and bkpr rl004 Walnut Fullington Russell M (Mary) carp h451 Spring Fullington Sara L slsldy Dannenberg Co r765 Mul- berry Fulmore Ruth maid rl53 Park Hotel al Fulton Alex (Mary) lab h324 Monroe A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS BARKIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 374 (1925) R. L. POLK & CO.'S Pulton Alice lndrs I16I6 Maynard Pulton Baptist Church 506 Hawthorne Pulton Etta cook r324 Monroe Fulton Investment Co S P Strickland mgr 318V2 2d Pulton, Marie cook r324 Monroe Pults Burney (Leila) lab h315 Short (EM) Pults Robt T lab r315 Short (EM) Pulwood Eliz slsldy Burdon Smith & Co r619 Pine Fulwood Hill W mech r222 Chestnut Pulwood Susie sten Wesleyan College r222 Chest- nut Punderburke Addie L student r410 Forest av (V) Funderburke Alice bkpr Henry Whitehead rl26 Cole- man av Funderburke Julian slsmn Burden Smith & Co r410 Forest av Funderburke Thos L (Julia) gen mgr Peeler Hdw Co h410 Forest av Funderburke Thos M asst mgr Modern Gro Co r410 Forest av Furguson David C (Wyline) r62 Arlington pi F'urlington Wm T (Mary) hl29 Rembert av Furlow Peter rl06 Rock av Furman Emma L C (wid Farish) r650 (1014) Vine- ville av Furman Willie lndrs h84 (130) Forest av (V) Fuss Allen rl26 Cole Fuss Ashby elk Southern Sport Supply Co res Colum- bus rd Fuss Florine M Mrs opr W U Tel Co rl517 Broad- way Fuss Harvey mach rl26 Cole Fuss John P (Laura M) bkpr rl517 Broadway Fuss M Eliz (wid Allen) hl26 Cole Fuss Otis bkpr X V Clothes Shop rl71 Mary Fuss Reba slsldy J P Allen & Co Artope Hts F'utch Lonnie (Ilda) blrmkr r630 Montpelier av Futral- Ralph elk Chapman's Pharmacy r258 1st Futral Susie (wid Rayburn) r258 1st GUO Wise Men of the East T A Lumpkin supvr and grand chf 523Y2 Cotton av Gabbert's Candy Land (C H Prater, Note Allison) soft drinks 464 Cherry Gable Albert C student r258 Washington av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth* CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 375 Gable Albert E (Phoebe L) elk h258 Washington av Gabriel Fredk B (Lula) mgr Postal Tel & Cable Co h317 Beech av Gadcliff B F (Nettie) carp r817 New Gaddy Martha student r8, 559 Orange Gaddy Paul C (Maude) elk Hotel Lanier r750 Pine Gadsen Wm (Emma) lab h211 Hazel Gadson Jas H Rev (Della) pres Central City College rll50 Clinton rd Gaffney Fredk B (Lizzie) barber h222 Chestnut Gafford Allie sten-bkpr Ga Academy for the Blind r 247 Madison Gagliardi Lula h978 Walnut Gaillard Jas slsmn rl07 Culver Gaillard Jas J concretewkr h.107 Culver Gaillard Wm P (Margt) city marshal h405 Napier av Gailmard A B cashr C'udahy Pkg Co r Y M C A Gaines Chas M (Jessie) elk h2437 Broadway Gaines Cora cook hl56 College Gaines Frank formn rl305 3d Gaines Lucy r2437 Broadway Gaines Mary h202 Reid Gaines Mary E r202 Reid Gainey Ebony (Ida) mill hd hll5 Middle (EM) Gainey Forrest lab r411 Applewood Galary Jurod (Hattie) lab h408 (308) Charles (SM) Galkin Benj (Esther) tailor Bernard Jacobs 41 Cherry Galkr978SWalnutS (MaCn She ShP & Army Store Galk578IwIlnCuItk MaC0H She ShP and Army Stor' The most comprehensive refer- ence work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking GaI1Walnut<'MaCOn She ShP and Army Store) r97i Gallagher Mary E h453 Arch Gallamore Ellidia lndrs h436 Flonders (EM) Gallemore Clara H (wid John L) h865 Orange Gallemore J Parker (Fannie M) formn Bibb Bae Ct h918 Walnut ~ 65 Gallemore Ruth r865 Orange Gallenberger Lena music tchr 21 Jaques bldg res Lanier Hotel Gallimore Floyd (Mary) h759 Ash Price $20 Published semiannually MARCH and SEPTEMBER by R. L. POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy H. L. POLK & CO., DETROIT, MICH. &C0. Polk DirectoryBldg. Detroit, Mich. A natural by-product of the Directory1 Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 376 (1925) R. L. POLK & CO.'S Gallory Alonzo (Nellie) farmer h302 Gant City rd Galloway Jos (Helen) elk hl28 North av (NH) Galmore Opsey lndrs h321 Hammond Galouremus Anatea r340 Duncan av Galouremus Steph r340 Duncan av Galry Sami (Hattie) lab h74 Oliver av Gamble Lily mlnr J P Allen & Co rll5 Lamar Gamble Mary student r616 Forsyth Gamble Mildred tchr r616 Forsyth Gamble Robt M adv mgr Happ Bros Co r616 Forsyth Gamble Robt W r277 College Gamble Wm A bkpr Try Me Bottling Co h616 ForGambrell Hall 1356 Bdgewood av Gambrell Patk H (Harriette) h268 Hardeman av Gammade Allen (Lillie) barber rill Calhoun Gammage Angie M Mrs rl53 Park pi Gammage Eliza T law student E W Maynard rl53 Park pi Gammage Etta Mrs slsldy Isidore Brinen h517% Mul- berry Gammage Norman C student rl53 Park pi Gammon Robt M (Alice) mech hl017 Clinton rd Ganaway Anna lndrs hl55 4th av (V) Gandy I Gilbert millwkr h5 Lake Gandy J Ogden (Caroline K) ins agt 911 Ga Casualty bldg r Masall apts Gann Viola mill hd rl309 Broadway Gannon Allen T asst mgr John Malloch & Co r363 College Ganns Robt (Ida) porter h503 Fulton (EM) Gans Adele r811 y2 Cherry Gans Milton N (Floy) slsmn h716 Mulberry Gans Sanford N (Rhetta) trav slsmn h811 % Cherry Gant Hugh A (Mary) swtchmn h515 Plum Gantt Emmitt (Nora) janitor h345 Long Gantt Eugenia A (wid Geo) h421 Orange Gantt Jas T (Blanche) pres Gantt Mfg Co h424 Vine- ville av Gantt Mfg Co J T Gantt pres W S Smith sec-treas Bay sw cor Elbert Gantt Margt h326 Monroe .Gantt Mary (wid Broke) h418 Elizabeth Gantt Rose B tchr r329 Madison Gantt Sami r314 Elm Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 377 Gantt Sami M (Rosa L) baker h329 Madison Gar Low In dry 657 Broadway h do Garaughty Mary rl431 3d Gardard Calvin (Ida) flour weigher h452 Martha (E M) Garddard Candus (Ester) gro 205 Jones h do Garden Evelyn r784 Holt av Garden Fredk (Annie) 11211% Yates av (EM) Garden Harry (Evelyn) slsmn h.784 Holt av Garden Saul (Daisy) lab hll32 Broadway Gardiner Alf student r G A Gardiner Gardiner Geo A (Clara) supt h es Riverdale dr (I) 1 n Ridge av Gardner Amanda h2 Short st la (EM) Gardner Chas (Willie) hl021 Edgewood av Gardner Chas lab r231 Ellis av Gardner Danl (Mahaley) lab h451 Johnson's al Gardner Dennis (Irene) lab h608 Gilmer Gardner Eliz nurse r31 Orchard av Trucks and Auto Repairing Authorized for White Motor Trucks N. L PACE 657-659 THIRD ST. PHONE 4846 Gardner Ella hl20 Green Gardner Elline student r519 Oak Gardner Eunice r519 Oak Gardner Fannie h231 Ellis Gardner Fred (Annie) lab h211 Yates al Gardner Fred P (Freddie D) store room kpr hll9 Richmond Gardner G G barber T H Cater 1219 Bway Gardner Henry lab h320 Madison Gardner John (Annie) pntr r660 Walnut Gardner John C (Docia M) carp h519 Oak Gardner Katie Indrs r3 Center Gardner Marshall H (Dorothy) formn r22, 533-47 Orange Gardner Rena (wid Jesse A) h204 Spring Gardner Sadie r262 Washington av Gardner Thos L (Sadie) eng h262 Washington av Gardner Wm (Mary) lab hi Short st la (EM) FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TFI FPHONE 213 City Directory Answers All Questions as to WHOM You Are Looking For and 378 (1925) R. L. POLK & CO.'S Gardner W Bryant (Effie) pntr r316 Calhoun Garey Junia B tchr r449 Broad Garey Lizzie (wid Lawrence G) h449 Broad Garey Raymond (Laura) lab h24 7th Garey Richd (Florence) lab rll7 Tindall av Garfield Albert porter r831 3d av (V) Garfield Annie Mrs r706 Pine Garfield Howard R rl053 Hazel Garfield K Jeanette tchr rl053 Hazel Garfield Leonard H (Kate B) carrier P O hl053 Hazel Garfield Mary r831 3d av (V) Garfield Wm (Gertrude) turn repr h831 3d av (V) Garland Cora dom r406 (106) Lexington av Garland Jas lab Jones Motor Co Garland John T (Susan) hl08 Buford pi Garland Sarah lndrs 257 (157) Center Garling Ada lndrs h3 Chestnut la Garman Carrie lndrs h300 Blount Garner Eug lab r217 Chestnut WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH Ififrmyo, uarngdumelsasatrice. noItf athheeyaltbhlyeepdinokn, sSDHleiAEegAIhLytLYoTup. HrroYFdveoo.ncrTtaisthsiatoilsenA,iNasTtDaHyEoUduYaSrnEgDAePRrrYuEgsOiggRUinsANat'Lls-. Garner Gary (Ethel) h738 Oglethorpe Garner Homer C (Eliz) elk Ga R R r825 Orange Garner Irene lndrs r206 (276) Astor (EM) Garner J P Mrs r262 Washington av Garner John C (Dossie) eng h860 Oak Garner Leroy U (Eliz) hl4 Blosfeld av Garner M Virginia tchr Wesleyan College r232 Georgia av Garner Patience tchr r217 Chestnut Garner Oscar (Anna) lab h217 Chestnut Garner Wm M (Emily G) carp h2231 Grant Chapel al Gairafa Camilla B watchmkr Williams Jewelrv Co r 22, 533-47 Orange Garrafa Q'uento mach r22, 533-37 Orange Garrard Annie L nurse Middle Georgia Sanatorium Garrett Annie r211 Hines ter (V) L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR BLDG. PHONE Will Remove the CAUSE of Your Disease 4557 MACON CITY DIRECTORY (1925) 379 Garrett Barney L (Nettie) Fourth Natl Bank h312 Linden av Garrett Barney L jr bkpr Macon Natl Bank r312 Linden av Garrett Benj H (Essie) agt Metropolitan Insurance Co hll6 Richmond GARRETT CHARLES H, Solicitor General Bibb County Solicitors, h626 (926) Vineville av Garrett Danl N rl401 Oglethorpe Garrett Ettie (wid Robt) hlO Glynn av Garrett Eug E (Olivia) farmer hl22 American blvd Garrett Eug E jr train checker rl22 American blvd Garrett Fred flremn r355 Elm Garrett Fred C field rep U S Vet Bureau r Y M C A Garrett Harry P student r915 Oglethorpe Garrett Irma rlO Glynn av Garrett Jas B (Eliz V) waiter h853 Oak Garrett Jos F slsmn Jos N Neel Co rl89 Magnolia Garrett Mark (Mattie) r!15 Rose Crest av Chero-Cola MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIINSS Garrett Mary rl401 Oglethorpe Garrett Mary student r312 Linden av Garrett Robt L (Pearl) solr Crescent Lndry Co h915 Oglethorpe Garrett R Ernest waiter r853 Oak GARRETT SAMUEL W (Louise M), Business Mgr Mercer University, lil401 Oglethorpe Garrett Talmadge E lieut Police Dept r51'8 Pine Garrett Viola lndrs r4 Cheatham al Garrett Wm E (Annie) fnshr Mozo-Cater Co h217 Jackson Garrison Roscoe.C (Ruth) cond hl21 3d Garrison Semmie (wid Marion E) hl820 Broadway Garrity Walter J (Mammie) elk hl427 3d Garthan Lillie cook h316 Mutual av Gartin Pedro shoe repr r525 Forsyth Gartrell Geo (Amanda) lab h421 Elizabeth Garvin Calder elk r509 Mikado av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 5976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK & CO. Polk Directory Bldg. , Detroit, Mich. 380 (1925) R. L. POLK & CO.'S Garvin Wm F (Jimmie) eng h418 Hazel Gary Anna cook r476 Jones st la Gary Geo (Katie) porter h227 1st av (V) Gary Henry (Anna) Indrs h52 Smith row Gary Jack (Mattie) blksmith rl21 Tatnall Gary Mary (wid Rufus) hl31 Elizabeth Gary Rebecca r72 Plummer's al Gary Richd lab r468 Chestnut Gary Sami D (Annie) chauf h528 (526) 3d av (V) Gary Wm carp r215 (237) Fargason Gary Wm (Sarah) lab h225 North Gasaway Arth (Eula) lab hl642 1st Gasaway Louise mach r821 3d Gaskins Mattie real est h7 Barnes apt Gassett Myra student rl56 Oakland av Gaston Eliza Indrs hll3 Main (Stinsonville) Gaston Zilla dom rll3 Main (Stinsonville) Gaswald Lizzie nurse r308 Spring la Gates Caroline rll26 College Gates Cleo (Dorris) pdlr rl50 Ernest Gates Duncan (Mary) pdlr hl52 Ernest Gates Eug (Leverne) pdlr r304 Gordon Gates Lillian sten Bibb Lbr Co r625 Linden av Gates Martha tchr rll5 Buckingham pi Gates Mittie Indrs h518 Plant al Gates Nettie (wid Wright) r Wash Williams Gates Oscar H cond hll'26 College Gates Parlor sten rll5 Buckingham pi Gates Paul G (Reba J) dentist 703 Citizens & Sou Bank bldg hll5 Buckingham pi Gates Robt (Josephine) lab h520 Plant al Gates Thos (Mary) gro Columbus rd h do Gates Thos (Gertrude) pdlr h Columbus rd Gates Walter (Ada) lab h714 Campbell av Gatsori Wm (Laura) pntr r217 Madison Gattie Perry (Lula M) ltab r353 Flanders (EM) Gauf Chas (Lula) lab h226 Plant Gaultney Caroline student r658 Arch Gaultney Ira B slsmn Armour & Co h96 Daisy pk Gaultney Walter B (Minnie O) bgemn h658 Arch Gautier John H (Jewel) real est rll5 Buford pi (V) Gavin Chas M (Estelle S) trav slsmn r296 College Gavina Francis student rYMCA Gay Beulah Indrs h406 Bowman KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 381 Gay Hattie rl22 Hill Gay Homer lab r406 Bowman Gay Sami (Essie) lab r20 Siam Gear H Seymore (Pearl) pntr hll38 Milledgeville rd Gear Pearl (wid Horatio S) hll40 Milledgeville rd Gear Wm E student rll'40 Milledgeville rd Geeslin Chas B (Sallie) rll2 Lawton av GEESLIN EMMIE L, Dept Mgr Macon Supply Co, r 216 Adams Geeslin Ernest elk Bayne's Pharmacy r859 Cherry Geeslin Jas M student r216 Adams GEESLIN JAMES IV (Pearl; Macon Transfer & Stor- age Co and Herin & Geeslin), h216 Adams, Phone 1083 Geeslin Wm F (Louise W) chf elk supt's office h720 College Geesling Wm F slsmn Coleman Meadows Pate Drug Co r Y M C A Geeter Cedan lab h3 (4) Tatnall la SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES General Sprayer Co C B Clay pres 12-14 Jaques bldg Genone J Ernest (Leatha L; Flynt & Genone) rl04 Magnolia Genone Rose (wid Jos) hl04 Magnolia Gentry Aileene J Mrs elk rlOl Cabiness av Geoghegan Brooks (Vera) acct J L Holcombe r218 Georgia av George Amelia r325 Nussbaum George Daisy cook r336 3d av (V) George Edgar (Virginia) lab hl55 2d av (V) George Estella lndrs r.1'02 Woolfork (EM) George John C carp r2218 2d George John G (Plelen J) fish 456 1st hl03 Ross George John P (P G & J P George) rl06 Ross George Luther (Mattie) h6 Cheatham al George Marie lndrs hl52 Hillcrest av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FIRE INSURANCE ~ INVESTMENTS TaZ" R. A. WILLIAMS, Realtor _ FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 382 (1925) R. L. POLK & CO.'S George Peter G (Sophie; P G & J P George) hl06 Ross George P G & J P restr 404 Cherry George Silvie cook rl52 Hillcrest av George Thos E (Mary B) slsmn h2218 2d George Ulysses (Frankie) lab r415 Nussbaum George Walter (Daisy) lab h904 Elbert George Washington Life Insurance Co T A Coleman supvr 305 Ga Casualty bldg George Wm (Phila Hat Clng Co) r608 Plum Georgia Academy for the Blind G F Oliphant supt ns Forsyth rdlw Alabama av Georgia Academy for the Blind L H Williams prin 247 Madison Georgia-Alabama Business College Eug Anderson pres J D Braswell sec 616 Mulberry Georgia Auto Co R B Domingos mgr 609 3d Georgia Banana Co Geo Peters mgr 310 Poplar GEORGIA BANKING CO, R W Crockett Pres, W C Turpin V-Pres, W E Bozeman Cashier 603 Cherry Georgia Battery & Vulcanizing Co B T Oxley 712 3d Georgia-Carolina Lumber Co A E Rood pres-treas Mrs G B Rood v-pres M E Rood sec 1001-4 Ga Casualty bldg Georgia-Carolina Oil Co R W Jones pres J R Maddux sec-treas 263 Edgewood av Georgia Casualty Bldg 516-22 Mulberry GEORGIA CASUALTY CO, Dr John C McAfee V-Pres, Earl H Strickland General Manager 210-213 Ga Casualty Bldg, Phone 4892 (See page 3) GEORGIA CASUALTY CO OF MACON, GA, Morris Harris Agt, 210-212 Bibb Bldg, Phone 131 GKORGIA CASUALTY CO OF MACON, GA, John E Milson Agt, 207 Citizens & Southern Bank Bldg, Phone 214 Georgia Cottage 1321 (321) Edgewood av GEORGIA FURNITURE CO, Ben M Goldgar Prop, New and Used Furniture 466 Poplar, Phone 857 GEORGIA GROCERY, R J Carmichael Mgr, 5th sw cor Walnut, Phone 537 (See page 68) FARMS HOMES 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) Georgia Grocery Co 2636 Broadway, 214 Cotton av, 464 1st 204 Forsyth, 205 Hardeman av, 619 Lin- den av,' 328 Main (EM), 503 E Napier av (HH), I'll North av, se cor Oglethorpe and 2d, 424 (210) Pio Nono av, 651 Poplar, 420 2d and 289 Wash- ington av , _ , Georgia Industrial Home for White Orphan Boys and Girls J A Harris mgr Mrs E A Hilton matron Industrial Home rd 1 mi w American blvd Georgia Investment Co T O Crowder mgr salary brokers 304^ 3d Georgia Investment & Trust Co H K Burns mgr 306 Ga Casualty bldg Georgia Kaolin Co E Y Mallary pres Cecil Morgan sectreas clay products 606 Ga Casualty bldg GEORGIA LOAN & TRUST CO THE, 0 A Coleman V-Pres and Genl Mgr, T H Boone Treas, Macon Natl Bank Bldg MACON OPTICAL Frank H. Johnson Opticians 468 CHERRY COMPANY Optometrists PHONE 3213 Georgia Mutual Industrial Life and Health Insurance Co T J Coleman agt 608 New Georgia Peach Growers Exchange M Felton Hatcher pres Wm C Bewley sec-treas mgr 310 Broadway GEORGIA PUBLIC SERVICE CORPORATION, J B Hart Pres, 220 2d Georgia Quincy Granite Co D W Jeter pres J A Reynolds sec-treas 304 Citizens & Sou Bank bldg Georgia Railroad F F Powers coml agt 208 Bibb bldg Georgia Seed Store Inc R H Kingman jr pres C H Milam sec-treas 469 3d Georgia Shoe Factory Philip Fierman mgr 660 Poplar Georgia Southern & Florida Ry Co O G Prentiss frt agt sw cor Plum and 5th Georgia State Exposition E G Jacobs pres L M Rossignol sec Central City Park Drink in Bottles TELEPHONE 287 w 8 WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 o W I 384 (1925) R. L. POLK & CO.'S Georgia State National Guard Armory 104 Ga Casualty bldg Georgiades E N (Alice) elk J G George h396 Belmont av Georgian Apartments 813 Poplar Georgian Terrace Apts 261 Georgia av GEORGIANS' ORCHESTRA THE, Bob Lee Mgr and Leader, 14 College Hill Apts, Phone 5239 Gercken Wm D (Addie) agt Carolina Life Insurance Co h420 Winship Germany Kath Indrs hl57 Bright al Germany Thos (Ella) lab h232 Telfair Gernigan Chas rlOO Crisp Gernigan Mell slsmn rlOO Crisp Getson John C (Carrie) gro 317 Log Cabin dr h319 do Getson Mabel student r Log Cabin dr Getter Booker (Etella) lab r610 3d av (V) Getter Essie M Indrs r531 Calhoun Gewin Christopher C (Dora) hl3T High Gewinner Hazel tchr rl205 Vineville av Gewinner Napoleon G phys 1205 Vineville av h do Gholson Francis student rl65 Ells (SM) Gholson Richd L (Bessie) formn hl65 Ells (SM) Gibbons Chas A (Edith) bkpr Nash Sausage Co r427 Forsyth Gibbons Henry lunches 323 Broadway r do Gibbons Henry porter rl57 North Gibbons Jane maid r649 Elm al Gibbons Julius lab r316 Monroe Gibbons Lessie cook rl53 Park Hotel al Gibbs Carrie B Mrs smstrs Union Dry Gds Co hill' Boulevard av Gibbs Chas (Pearl) h470 (323) Bowman Gibbs Erasmus E (Josephine) porter h806 3d av (V) Gibbs Jas E (Carrie B) ship elk h417 Boulevard (NH) Gibbs John E jr formn r417 Boulevard (NH) Gibbs Wm (Mary) lab h321 Gilmer Giblin Creston A (Margt) mgr R G Dun & Co h642 Ridge av Gibson Annie Indrs rl32 Broad (EM) Gibson Annie B teller Cit & Sou Bank r257 High u Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeecatdsqufaor-r ters for all kinds of Automobile Lists. Our new o ccoaptayl.og coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfoHr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St. MACON CITY DIRECTORY (1925) 385 Gibson Arth C lab h230 Jones Gibson Caroline K student r404 Forest av Gibson Cesor J (Marnmie) bell boy r822 Ocmulgee Gibson Elijah lab hl62 Bay Gibson Ella lndrs hl208 3d Gibson Ethel cashr Life Insurance Co of Va r630 Forsyth Gibson Eug C elec opr r404 Forest av (V) Gibson Fannie lndrs hi Stewart's la Gibson Geo (Nancy) driver rll9 Boundary Gibson Geo (Susie) lab h211 Division Gibson Geo G (Lulo) switch tender h222 Knott Gibson Geo W (Irene) elk h909 Elbert Gibson Geo W (Bessie) gro 324 Danenberg av h do Gibson Glenn J r203 Henry (SM) Gibson Harry A (Marie A; Gibson Vinegar Works) h 249 Boulevard (NH) Gibson Hattie B dom r545 Mitchell Gibson Hattie W (wid Harry) h404 Forest av Gibson Hugh J bkpr Bankers Finance Cdrp r7 Hill Park av Gibson Irene maid r299 Craft la Gibson Irma lndrs r59 Spring Gibson Jack (Sweetie) plstr h Burton av Gibson Jas baker Central Ga Baking Co 512 1st Gibson Jas S (Wilma) watchmkr rl09 Inverness av Gibson John T agt Met Insurance Co rlOl Clayton Gibson Lane elk Coleman-Meadows-Pate Drug Co r YM C A Gibson Lawrence H (Nellie) agt Guaranty Life In- surance Co h9 Ellis av Gibson Leila attndt Dr S B Harrell hll7 Jones Gibson Levi (Fannie) lab hl05 Tindall av Gibson Lewis L (Emma) mgr Macon Food Clinic hl8, 538-47 Orange Gibson Lillie B (wid Robt) phone opr City Hall h860 New Gibson Martha sten Happ Bros Co r222 Knott Gibson Mary hl31 Cedar Gibson Mary maid h558 Ward (V) Gibson Monroe (Blanche) porter Union Dry Gds Co Gibson Obediah C (Willie) phys 658 Mulberry h254 Hardeman av Gibson Robt (Alberta) lab h239 Morgan av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ! vi n5w o-S m Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 6S2-690 THIRD ST. PHONES 5100-5101 Dim 386 (1925) R. L. POLK & CO.'S as a Gibson Robt H (Tabitha) 1x130 Daley (SM) Gibson Rosa lndrs rlOO Society MET Gibson Simeon (Susiella) firemn r333 3d av (V) Gibson Thos A (Ada) hlpr Plummer's Creamery hl22 Tenney av Gibson Van carrier P O r623 Pio Nono av PLACE Gibson Vinegar Works vinegar mfrs 149 5tli Gibson Willis W tchr r404 Forest av THE Gibson W Geo Rev (Nancy) hill Edgewood av Giddens Isbon (Louise) welder hl24 Peachtree DIRECTORY Giddens Nora Mrs opr Sou Bell Tel Co rl47 Rose IS THE Park Giddens Robt (Irene) waiter r318 Cleveland GREATEST Giddens Winfred A student rl24 Peachtree Giden Thos (Roberta) lab rl05 Bay MARKET Giesen Anthony F interne Macon Hosp Giglio Jack M r203 Central av PLAGE Giglio Jos r203 Central av Giglio Jos F (Lillian) expmn h203 Central av IN THE Giglio Mary r203 Central av Gilbert Alf (Lula) driver hl04 (105) Randall al WORLD * Every Day in the Year the Directory Tell* Where All Kinds of Good* and Service Can Be Had Gilbert Dorothy maid rl58 Sycamore Gilbert Esther maid hll8 Lynwood av Gilbert Fannie maid r368 Collins av Gilbert Frank I (Estell) electn hl31 Oakland av Gilbert Geo (Victoria) swtchmn r417 Ward (V) Gilbert Gwendolyn lndrs r311 Division Gilbert Helen smstrs rl58 Sycamore Gilbert Henry lab rl76 Park Hotel al Gilbert Herschel (Laurene) h702 (206) Colquitt Gilbert Ida rl58 Sycamore Gilbert Ima phone opr City Hall hll5 Lawton av Gilbert Jas F (Della) eng hl442 2d The Directory is the Natural Source of Information and is "On the Job'* 365 Days Every Year Gilbert Jeremiah (Jemima) lab hl21 2d av (V) Gilbert Julia (wid Thos) r2324 2d Gilbert Kate (wid Randolph M) hl30 Cleveland av Gilbert Kath oral hygienist Dr W B Childs r285 Orange Gilbert Maria cook h279 2d av (V) Gilbert Mary cook r.158 Sycamore Gilbert Mary maid h517 E Academy (EM) Gilbert Mildred sten Ga Mutual Industrial Life & Mikifo Health Insurance Co r.1'18 Lynwood av PUBLISHERS Gilbert Milridge cook r!18 Lynwood av PoIEIWIokiS DETROIT A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit Central Sash & Door Co. SASH, CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 56934 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 387 Gilbert Ocilla h313 Pio Nono av Gilbert Rebecca rl58 Sycamore Gilbert Ruth elk rl26 Highland av Gilbert Thos (Rosa) formm h!20 Callaway (V) Gilbert Walter carp r454 Pine Gilbert Wm (Pearl) carp h317 Church (EM) Gilchrist Bessie cook r571 Monroe Gilchrist Ida lab r642 Hammond Gilchrist Viola cook h571 Monroe Gilcrea T W lab r571 Monroe Gilder Jordan T (Lillian) hll Lake City Giles A Jackson r632 Anderson Giles Binder H crane opr r632 Anderson Giles Christian rl'44 Magnolia Giles Foster (Marie) barber 213% 5th h50 Harris (SM) Giles Jas elk Cassidy Garage r4221/2 Mulberry Giles Jas A collr r868 Mulberry Giles John B electn r632 Anderson DOORS Royal Corona Typewriters SC01T-PARKERC0. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service < SCREENS R Giles Josephine (wid Andrew) h632 Anderson Giles J Carl (Hazel) asst cashr hl501 2d Giles Lewis F slsmn H L Barfield r467 Monroe Giles Mary h40 Manchester qtrs Giles Wm M (Lucille) slsmn R S Thorpe & Sons rl44 Magnolia Gilfiled Primitive Baptist Church 8 Hazel Gilford Callie lndrs h320 Cheatham al Gilham Henry (Sarah) mech hl223 (123) Woolfolk Gilham Irwin hlpr Beeland-Conrad Motor Co 123 Woolfolk Gill Chas E (Paula) mach hl327 3d Gill Earl (Paula) mech rl23 Fort Hill Gill Ernest (Effle M) mach hl20 Latta pi Gill John J (Lena; Central Georgia Baking Co) r22 Progress Gill Pearl tchr r461 Boulevard (NH) Gillam Chas lab h600 4th av (U) DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 4> fl O UJOJSJ JJId s < d T3 H & s */> 5 V o * g a P gy < 3 w g w> QI Z |Z <0 s M8 oa j ^ ^S s= H 1A<43D> 3CS *8 o o2 o2 18 P P ^2W SC5O 2^W5c3/5 H c/) H H ^ EH u<3pH > O s ctf X (X CO V\ a, &4 3 -C H 396 (1925) R. L. POLK & CO.'S Goodwin Benj mech rl45 Academy Goodwin C A lab r405 Grant Chapel al Goodwin Daisy student r303 Fort Hill Goodwin Emma r322 E 2d Goodwin Frank (Leila) lab h345 Hammond Goodwin Geo elk Broadway Trading Co r303 Fort Hill Goodwin Irene rl45 Academy Goodwin Janie mill wkr r303 Fort Hill (EM) Goodwin John D (Callie) frt collr r607 4th av (U) Goodwin Jos porter H E Bell r Cross Keys Goodwin Judge (Mary) lab h317 Short (EM) Goodwin J Taylor (Annie; Lettice-Goodwin Co) r207 Boulevard Goodwin Kate (wid Miles) rll2 Stonewall pi (V) Goodwin Marcellina student r235 4th av (V) Goodwin Mary h78 Short (PM) Goodwin Mattie E sec to registrar Mercer University r700 Napier av Goodwin Maude Mrs rl070 Hazel Goodwin Mildred tchr r235 4th av (V) Goodwin Paul waiter M G-Ellis Goodwin Sami (Gracie) lab h405 Grant Chapel al Goodwin Serna slsldy W T Grant Co rl45 Academy Goodwin Thos J (Maude L) mach h303 Fort Hill Goodwin Walter (Cora) lab h260 Bright Goodwin Wm R (Eula) bgemstr h516 Oak Goodwyn Fannie hl43 (142) 1st av (V) GEORGE S (Lillian), Sec-Treas W F Elder Lumber Co, h666 Napier av, Phone 3929-W Goodyear John H (Isora) h419 Ross Goodyear John K ship elk Central Bedding Co r419 Ross Goolsby Chas (Pearl) lab h8 Chestney Goolsby Eug (Emma) lab hl95 Division St la Goolsby Geo (Melvina) lab h523 (87) Plumtree Goolsby Jas (Janie) h334 Elizabeth Goolsby Jas (Estella) lab h622 Prince Goolsby Johnson (Mattie) lab h865 (65) Ballard Goolsby J C (Anna) lab r725 Daisy Goolsby Leonard 0 meat ctr Kash & Karry Mkt r Ar- cade Hotel Goolsby Lillie dom r865 (65) Ballard Goolsby Mildred sten rlOl Rembert av Goolsby Wm (Mattie) lab hl09 Edgewood av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY. (1925) 397 Goolsby. Wm (Elnora) pastor Union Baptist Church h612 Center Goolsby Willie M Indrs r612 Center Goosby John (Sarah) lab h205 Coles al Goosby Lillie h247 5th Gorden Albert orderly rl37 (139) 4th av (V) Gorden Willie Indrs h9 Short (EM) Goodin Henry C (Bessie) car insp h242 Jeff Davis Gordon Ada (wid John) h724 Campbell av Gordon Allie student r372 Monroe Gordon Ann r205 New Gordon Asa (Lucie) drymn hl29 2d av (V) Gordon Carrie sten Sou Ry System rll8 Corbin av Gordon Channey (wid Edmond) h Robinson rd Gordon Chas (Annie) firemn h416 E 1st (EM) Gordon Chas (Frances) pntr h327 Burnett av Gordon Edw (Martha) h372 Monroe Gordon Ella cook h Lawton av nr Rockledge av Gordon Ella cook h Robinson rd Gordon Elnora maid h247 Cheatham al Gordon Emanuel (Lula) lab h634 Hammond Gordon Emma h430 Winship Gordon Frank (Lillie) lab h309 E 2d (EM) Gordon Harry (Frieda) tinner 320 Wall h205 New Gordon Henry carp hl30 Hardeman av Gordon Henry (Annie K) lab h268 Davis la Gordon Horace (Laura) lab h6 Frank al Gordon Jas r221 Johnson av Gordon Jas (Alice) elev opr h308 3d av (V) Gordon Jas lab r331 Elizabeth Gordon Jas (Lizzie) lab h510 Hammond Gordon Jas A (Nora) firemn rl03 Troup Gordon Jas S carp r430 Winship Gordon John (Gussie) lab hll2 Plummer's al Gordon John J (Annie) farmer hl03 Troup Gordon Jos (Alma) carp hl80 Grants Gordon Julius (Susie) lab hl96 Tindall av Gordon Lawton F r552 Ocmulgee Goodin Lester elk Jones Park & Johnston Gordon Leila M dom hl09 Bay Gordon Lula maid h571 Siam Gordon Marshall (Anna) driver rl40 North Gordon Mamie student rl80 Grants Gordon Miller (Sadie) driver h!230 1st * FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT Jv. I.. POLK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 398 (1925) R. L. POLK & CO.'S Gordon Minnie gro 1072 Oglethorpe h do Gordon Myer H adv mn r205 New Gordon Nora L toll supvr Sou Bell Tel Co rl03 Troup (Mikado pi) Gordon Pauline r372 Monroe Gordon Rebecca gro 280 Columbus h do Gordon Sami (Union Bargain Store) h239 Ross Gordon Sami lab h841 (812) Fort Hill Gordon Sylvester (Rosa) ice ctr r490 Virgin Gordon Thos (Frances) h20 Prince Gordon Thos mldr rl433 Broadway Gordon Tony (Sussie) cook hl96 Tindall av Gordon Wm F (Birlie M) elk Vineville Packing Co h 457 Virginia av Goodrum Edgar W (Hattie) car repr h307 Mikado av Gordy Annie L opr Sou Bell Tel Co rl309 2d Gordy Geo B (Fay) ship elk Swift & Co r56 Marion pi (HH) Gordy Louis E (Annie L; Jackson & Gordy) rl309 2d Gore Ada cook r331 Maple Gore Chas (Mary) lab h 2d av (B) Gore Emmett (Ruth) mach r311 Main (EM) Gorley Mary lndrs hl07 Douglas av Gorman Archie B (Mary) firemn hl240 Broad Gorman Ruth cashr Union News Co 361 5th Gormly Aurora (wid Jas C) h423 Carling av (HH) Gormly Cath S sten r423 Carling av (HH) Gormly Frank M sten Taylor Iron Works & Supply Co r423 Carling av (HH) Gormly Jamesina C student r423 Carling av (HH) Gornto John S (Willie) slsmn Standard Oil Co hl05 Grady Gosse John (Jessie) lab h421 Liberty Gostin Belgrave F student r636 Orange Gostin Bernard S (Kath) phys 567 Walnut h636 Orange Gostin E Lamar (Martha S) civ eng 29 Washington bldg hi, 301 Napier av Gostin Mack lab h258 Ellis av Gostin Mitchell elk H A Kennington Gro Co r356 Woolfork (EM) Gostin Rosa J (wid Geo P) h909 Orange Gostin Rosita J student r636 Orange Gotrell Alex lab rl08 Gant City rd E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS If It's a Ford or CARS-TRUCKS-TRACTORS hfoarve ait.Ford, we PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 399 Gouder Alf (Lula) lab h214 (226) Fargason Gouder Eula lndrs rl03 (484) Short al Gouder Lillie maid rl03 (484) Short al Gouder Wm (Mary) lab hl03 (484) Short al Gouder Wm jr lab rl03 (484) Short al Gould Mary lndrs r342 Grant av (V) Gould Robt plmbr rll2 4th av (V) Gould Solomon (Georgia) carp h342 Grant av (V) Gouldman Jas B (Willie) slsmn r C B Norris Gowens Walter lab r586 Monroe Grace A Dewey mech Montpelier Garage res R F D 1 Moran Grace Chas B (Thelma) agt Metropolitan Ins Co h8, 165 Spring Grace Danl lab h93 Harris al Grace Delphene lndrs h727 Clinton Grace Domingle maid r727 Clinton Grace Elijah (Julia) lab h805 (124) Charles Grace Eug B h508!/2 3d Grace Eugenia nurse r567 Walnut Grace Florence cook h rear 157 1st Grace John L (Wyolene; Heard Bros) res R F D 3 Grace Lee (Celia) housemoving h721 Clinton Grace Louis S (F Meredith) police h430 Beach av Grace Ruby J (wid Walter T) h631 Forsyth Grace Walter J lawyer Jones Park & Johnston h404 College Grace Wm L (Nannie) mtrmn Macon Ry & Light Co hl43 Charles Graddicks Margt lndrs hl76 Park Hotel al GRADDY LEWIS F (Mae), Asst Cashier Bibb Nation- al Bank of Macon, h475 Monroe Grady Ada maid h717 3d av (V) Grady Alf lab rl09 Bay Grady Bertha tchr rl53 Lincoln av (V) Grady Colquitt (Nancy) swtchmn hl91 (159) Lin- coln av (V) Grady Ella M tchr rl38 (153) Lincoln av (V) Grady Isaiah (Eliz) swtch hl50 (155) Lincoln av (V) Grady Lester W(Lois) gro 2640 2d h2721 Houston av Grady Lillie cashr r238 Calhoun Grady Littleton J (Mattie) mech hll6 (633) Holt av (NH) The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of AI1 Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R.LP0LK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. < &C0. Polk Directory Bldg. Detroit, Mich. &*J If--% OL LD KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 400 (1925) R. L. POLK & CO.'S Grady Mamie P (wid Oscar M) h314 Georgia av Grady Marion hlpr Hampton Garage r336 3d Grady Olen lab r224 Long la Grady Robt (Julia) lab hl95 (160) Lincoln av (V) Grady Rozier (Annie L) lab h336 3d av (V) Grady Wm (Jessie) carp hll5 Glen Grady Wm S (Amanda) ins agt hl38 (153) Lincoln av (V) Gragg Chas wood pdlr h326 Tindall av Gragg Eliz r436 Tindall av Gragg Rosa solr r436 Tindall av Graham Edwin A (Nora) cond hll7 Madden av Graham Essey (Gertrude) lab h222 Jordan al Graham Gertie E matron Methodist Orphans Home r do Graham Jack (Sarah) lab rl238 1st Graham Jas C (Gertie E) utility Methodist Orphans Home r do Graham John W (Charlie) credit mgr Kinnett-Odom Co hl23 Crescent av Graham Julia M waitress rl221 2d Graham J W elk r Central City Hotel Graham Lizzie lndrs h264 (770) Park Hotel al Graham Martha rl23 Crescent av Graham May C student r239 (230) 1st av (V) GRAHAM OSSIE L, Sec Home Demonstration Bureau h422 Duncan av Graham Ralph waiter r239 (230) 1st av (V) Graham Sarah cook h819 3d Graham Terry R cook P A Gallianos r239 (230) 1st av (V) Graham Wadus L agt Life & Casualty Ins Co rl221 2d Graham Wm W slsmn r208 2d Grahl Jas S Rev (Celia E) pastor Centenary M E Ch h425 Johnson av Grahl Paul elk C of Ga R R Co r425 Johnson av Grahl Ruth student r425 Johnson av Granade Lanier student rll2 Montpelier av Grand Building 617 Mulberry Grand Chapter R A M E A McHan sec 612-14 Mul- berry Grand Council of Ga R & S M E A McHan sec 612-14 Mulberry Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ctCeoarpstya.lfoogr aclolRnkt.ainiCnd.ssPomOfutAKchut&ovmaClouOba.,iblelDeEl.dTisaRttsaO..ITOA, uMsrkInCfeoHwr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 401 Grand John carp r547 Mitchell GRAND LODGE OF GEORGIA F&AI.IF Baker Grand Sec, 612-14 Mulberry, Phone 512 GRAND LODGE COLORED KNIGHTS OF PYTH-IAS, Walter T Reid Grand Chancellor, 556 New, Phone 2116 Grand Theatre 617 Mulberry Granniss Etta F (wid Horace M) r314 College Grant Alma Mrs opr The Wm Carter Co res R F D 2 Grant Chapel A M E Church Rev J H Hall pastor 524 Grant Chapel al Grant David (Sarah) carp hll48 Broad Grant Eliz (wid J W) smstrs Dannenberg Co r2505 2d Grant Emma L (wid J H) h417 Edgewood av Grant Fred driver r756 Edgewood av Grant Geo (Aria) elev opr h383 Middle (V) Grant John (Mary) lab h331 Elizabeth Grant Julius (Leslie) lab h619 Division Grant Lee lab h430 (1320) Steins al Grant Leila cook hllO 4th av (V) Grant Louise student r417 Edgewood Grant Lurena dom r416 Hammond Grant Mary sten r417 Edgewood Grant Millus (Sadie) carp h432 North Grant Nancy lndrs r257 Chestnut Grant Otis G (Eunice) mldr hll55 Napier av Grant Pink (Annie M) lab h419 Bright al Grant Robt A (Eddie) h756 Edgewood av Grant Russell msngr P O r222 6t.h av Grant Starling phone opr r417 Edgewood av Grant Warren (Clara) lab rlO Frank al Grant Wm E (Sarah) carp h222 6th av (SM) Grant Wm L firemn h272 White al Grant Willis (Addie) carp hl004 Broad Grant W Russell r222 6th av (SM) Grant W T Co H A Batson mgr 408-412 3d Grantham John T (Dove) ins agt h2337 2d Grantham Katie r2337 2d Granville Bertha mill wkr rl71 Wings Hill Graves Albert M (Bertha) slsmn Try Me Bottling Co hl23 Grady Graves Annie (wid Wm A) rl09 Crisp ' FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALET, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART IK CLOTHING CO. If !'ll I 559VCHERRY ST. PHONE 951 till 402 (1925) R. L. POLK & CO.'S IK as a Graves Archie W lawyer 219-20 Ga Casualty bldg r 709 Walnut MMEI Graves Benj (Claudia) carp hlll7 Kitchens Graves Wm A (Mamie) elk Adams-Buchanan Motor Co hl09 Crisp PLACE Gray Alfonso lab h411 Ward (V) Gray Annie M Indrs r318 Wall THE Gray Beatrice barber Moses Miles r441 Craft la Gray Bernie (Marie) butler r368!/2 Flanders (EM) DIRECTORY Gray Boisy lab rl33 Jones Gray Chas L (Thelma) formn Bibb Basket Co hll20 IS THE Oglethrope Gray Clarence (Sereather) firemn h815 Daisy GREATEST Gray Cora (wid Lorenza) gro 328 Dempsey b do MARKET Gray Daisey H (Willie M) janitor h220 Powell (EM) Gray Dempsey lab r369 Monroe PLAGE Gray Eli S Rev (Fannie) h369 Monroe Gray Eliz cook r369 Monroe IN THE Gray Evelyn pupil nurse Oglethorpe Private Infirmary r717 Oak WORLD Gray Geo A slsmn rl07 Highland av Gray Hampton (Eliz) h224 Lee Gray Henry (Fannie) lab h238 (838) Penn Every Dayin the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Gray Howard (Della) brkmn hl066 Oculgee Gray Hugh baker Barker Bakery r717 Oak Gray Jas C (Julia) auto mech rl59 Jeff Davis Gray Jas S (Alice) gro 1216 Broad hl014 Main Gray John (Carrie) lab r269 Cowan Gray John mill wkr r441 Craft la Gray John T (Phyllis) gro 299 1st av (V) h441 Craft la ) * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Gray Jos A collr Daily Telegraph rl07 Highland av Gray Kittie (wid Wm E) rll20 Oglethorpe Gray Lee firemn r321 3d av (V) Gray Mansfield F (Maude) pntr h528 Telfair Gray Mary hi26 Edison (EM) Gray Mary h268 2d av (V) Gray Monroe (Eula) lab h658 Strayers al Gray M J (Jane) rl07 Highland av Gray M Janie (wid Walter H) hl03 Highland av (L C Hts) BLPoiKjfo Gray Nathaniel delivery boy r369 Monroe Gray Raleigh J stmftr rll20 Oglethorpe PUBLISHERS Gray Reah store kpr r328 Dempsey av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656i/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 403 Gray Robt (Patsy) chauf h229 Ellis av Gray Robt lab r320 Hammond Gray Sami lab rl26 Edison (EM) Gray T Edwin (Eliz) elk Mrs Iva Ivey r717 Oak Gray Willard L (Emmie) mech h655 Arch Gray Willena maid r369 Monroe Gray Wm (Rebecca) lab hl50 Bennett al Gray Wm E (Lina) electn rlll6 Oglethorpe Gray Wm H stmftr rll20 Oglethorpe Gray Wyatt (Katie) carp h413 Peachtree Gray W E cond Sou Ry r Hotel Macon Gray's Chapel M E Church 508 Hall Graybill Lenon A (Anne) textile exp hl46 Summit av (NH) Grayer Albert (Daisy) tailor h3 Harris al Grays Shedrick (Anna) agt Pilgrim Health & Life Ins Co h320 4th av Grayson Annie (wid Walter) r756 Pine Graze Abram r303 Ellis av Graze Sallie lndrs r303 Ellis av Greager Geo (Lola M) cabtmkr r219 Applewood Great Atlantic & Pacific Tea Co The R M Kelly mgr 692 College Greater Allen Chapel A M E Ch Rev Leroy R Parker pastor cor North and 4th av Grechi Jos (Sarah) musician hl25 Beech av Grechi Piro musician Rialto Theatre rl25 Beech av Greeley Addie cook h59 Spring Greeley Jeff (Viola) firemn hll2 Pringle Greely Alex (Pearl) hl56 Guernsey la Green Alton L (Lucille) mgr L K Liggett Co hl57 Crescent av Green Andrew E slsmn Newark Shoe Co r201 College Pi Green Aurelia lndrs r546 Broad Green Benj lab r558 Smith row Green Berta lunches ft of Poplar r533 Flanders Green Birdie (wid Chas A) hl435 2d Green Caesar (Ella) lab r248 Powell (EM) Green Chas dairymn r224 Ayers rd Green Chas (Lula) lab h50 Craig's la Green Chas lab r301 (160) Peacock Green Chas E carp hl31 4th av (V) Green Clinton D chf elk Sou Ry System rl435 2d Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go, Publishers 536 S. Clark St. Chicago, 111. 404 (1925) R. L. POLK & CO.'S Green C Jackson wtchmn rl3 Donnenberg av Green Eddie M lndrs r546 Broad Green Edgar (Mamie) porter h240 Middle Green Edw (Irene) lab h369 Ocmulgee la Green Edw (Mary) lab h202 Turpin Green Eliz nurse rllO (406) Randall al Green Ellen cook h339 North Green Ester (wid Silas R) rl02 Lamar Green Florrie lndrs r546 Broad Green Floyd hlpr Taylor Iron Works & Supply Co h 1232% Broadway Green Focious S (Henrietta) gro h706 (108) Crisp Green Frank dairymn r224 Ayers rd Green Frank (Mary) lab h613 Smith (EM) Green Geo lab r215 Jones Green Geo F (Lillian M) Rivoli Dairy Forsyth rd h do Green Geo M (Bessie O) door mkr h515 E Academy (EM) Green Geo M (Mary L) dairymn h224 Ayers rd Green Geo W (Jane) night wtchmn h452 Hazel Green Gladys opr W U Tel Co r222 Lawton av Green Hattie M (wid Robt L) r223 Buford pi Green Helen student r222 Lawton av Green Howard lab r541 Tinsley la Green H W r Y M C A Green Ida cook r4 Cheatham al Green Ida D (May) h208 Hill Crest av Green Jas (Sadie H) h42 Arlington pi Green Jas C (Lucille) slsmn h American blvd Green Jas H (Emma A) inspr Willingham Sash & Door Co h222 Lawton av Green Jarrett N (Lola) agt Life Ins Co of Va h2132 Broadway Green John (Bertha) chauf rl50 Georgia av Green John (Sarah) lab r4 Harris row Green John (Nancy) lab h621 Johnson's al Green John C lab r426 Flanders (EM) Green John W car inspr r270 Maple Green John W (Anna) wtchmn h757 Poplar Green Jos gro 499 Hall r do Green Jos (Ida) lab rl04 Peacock Green Jos lab rl227 3d Green Julia E sten P O r42 Arlington pi Green J Fred student r757 Poplar FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS. n p o*5 , MACON CITY DIRECTORY (1925) 405 Green Lafayette plumbing inspr City Health Dept h240 Duncan oHPzi 02Q "F < Green Laura B (wid Moses) h307 1st av (V) Green Lawrence lab r339 North Green.Lee lab r613 Smith (EM) Green Leila cook rl9 (17) Wise av (V) Green Lela M Mrs slsldy Dannenberg Co hl53 Cole Green Lettie Indrs rl227 3d Green Luella dom r233 Gilmer Green Maxie M maid r rear 1232 3d Green Melinda Indrs hll30 Broadway Green Melissa Indrs h301 (220) Peacock Green Mildred student r222 Lawton av Green Milton shoe repr h612 Pebble Green Milton L flagmn r514 Pine Green Minnie Indrs hl27 Phillips la Green Namos (Mabel) lab h546 Broad Green Nisbet W (Pearl) mill hd hl33 (138) Forest av YATES MOTOR C9. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Green Norris dairymn r224 Ayers rd Green Patsey cook hl33 Jones Green Paul H (Lennis) stonectr E H France res Ri- volia Ga Green Pearl Indrs h385 Melrose (EM) Green Ralph D carp r546 Broad Green Reid (Lula) lab hl4 Turpin la Green Ruby rl232!/2 Broadway Green Sallie Mrs h506 Telfair Green Seaborn (Bertie L) cook h533 Flanders (EM) Green Sherman (Gracie) lab h228 Jordans al Green Street School Metta Danforth prin I'll Green Green Susie r848 Hazel Green Sylvester lab r301 (220) Peacock Green Thejus lab r326 Hammond Green Thos dairymn r224 Ayers rd Green Thos (Janie) lab h255 (155) Center Green Thos B (Maude) rl03 Nelson A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit Id nJ o 2 u < 06 a a d 2*--< cu u< o u d >* d Is: < 2 co *3 uz DO o J* ".& uj fluid >< EH w as Id Id cO a b O cO a 06 Id 06 CO B O 2 D 2 < s MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 406 (1925) R. L. POLK & CO.'S Green T S firemn r514 Pine Green Victoria cook r304 (220) Peacock Green Wilbur lab r466 Coles al Green Wilburn driver Dixie Ice Cream Co Green Wiley (Bertha) deliverymn h427 Ward (V) Green Wm (Georgia) carp h207 Log Cabin dr Green Wm lab r rear 1232 3d Green Wm (Effie) lndrs h.319 (721) Lexington av Green Wm porter Stewart Oil Co Green Wm F (Carrie) coppersmith r205 Carling av Green Wm H (Louise) lndrs h608 Broad GREEN WM T (Claude F), Mgr Terminal Transfer Co, h715 Forsyth Green Jas T jr r715 Forsyth Greenberg Charlotte r403 Spring Greene Benj W (Gladys) phys 722 Bibb bldg h845 Courtland av Greene B Ethel tchr Beda Etta College r307 1st Greene Carrie rl03 Womack Greene Chas (Mattie) lab h323 Short (EM) Greene Chas E asst tchr Mercer University Greene Chas W (Rosa) brklyr hl012 Oglethorpe Greene Clay L (Leila M) ship elk Dunlap Hdwe Co r 114 Cole Greene Cleo slsldy Burden Smith & Co rl35 Highland av Greene Clifford M (Martha) collr Union Furn Co h 219 Duncan av Greene David (Celia) hl43 Tatnall Greene David (Clifford) brkmn hl24 Adams Greene Eolyne student r845 Courtland av Greene Eug lab r260 Gant City rd Greene Hezekiah M (Ida) h260 Gant City rd Greene Imelda elk City Realty Co rl35 Highland av Greene Jas B (Jessie) mgr r465 Napier av Greene Jennie C student rl506 Forsyth rd (V) Greene John A (Ruth) cond h.448 Beech av Greene John M (Lucille) tel opr h204 Crescent av Greene Kathryn student r845 Courtland av Greene Lamar Q elk Fourth National Bank r761 Mul- berry Greene Lee R (Lollie) plmbr hl03 Womack Greene Lizzie lndrs rl02 Rock av Greene Lucius C (Ray H) bkpr h715 College A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists.' R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 407 Greene Malcolm L student r715 Forsyth Greene Mamie (wid John C) hl35 Highland av Greene Mamie Indrs h321 Short (EM) Greene Margt sten rl35 Highland av Greene Martha L sten rl03 Womack Greene Quince lab r5 y2 Bookers al Greene Sidney butter 435 Vineville av Greene Taylor student r465 Napier av Greene Thos E (Nettie) collr Taylor Furn Co h821 Oak Greene Walter K tchr Wesleyan College hl506 For- syth rd (V) Greene Wiley T (Mattie L) agt Ind Life & Health Ins Co h301 Cleveland Greene Wm A (Lilia) city firemn h201 College pi Greenleaf Jos P Imbr hlO College Hill apts Greenwood Danl lab r406 (306) Charles (SM) Greenwood Louise r300 Gant City rd Greenwood Nelson (Josephine) swtchmn h300 Gant City rd Greer see also Grier Greer David A (Minnie L) elk rl802 2d Greer Duncan (Annie) lab hl056 Hazel Greer Emma smstrs hll42 Broadway Greer Horace (Lillie M) barber r503 Hazel Greer Jennie Indrs hl52 Coles al Greer Louise h317 Burnett (EM) Greer Mattie dom r602 Gilmer Greer Robt L (Annie) formn h2444 Broadway Greer Wm H (Annie L) driver hl20 Winship Gregg Thos E (Lena) mill hd hl015 1st Gregorie Chas H (Margt) dentist 161 Cotton av rl44 High Gregory Clara student rll6 School Gregory Clifford slsldy Federal Clo Store rll6 School Gregory Homer F (Mattie) planing mill r32 Marion pi H H Gregory Lucile Mrs r766 New Gregory Mandy rl26 (3) Holt av (NH) Gregory Marvin student r402 Fort Hill Gregory May (wid Geo) r402 Fort Hill Gregory Minnis (Maggie) h24 S College Gregory Robt E elk rl53 Lamont "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 408 (1925) R. L. POLK & CO.'S Gregory Rogers C elk Chapmans' Pharmacy r Wesley dr (R) Gregory Wm E (Estelle) eng C of Ga hl53 Lamont Gregory Wm M (Hannah) carp hll6 School Grehan Celia (wid John) r637 Orange Gresham Grady (Alice) eng r765 Spring Gresham Grammar School Mrs Stewart Jones For- syth cor Spring Gresham Pearl Mrs opr The Wm Carter Co h207 Peachtree Gresham Wm (Addie) h216 Hydrola Gresham Wm F (Pearl) wtchmn h207 Peachtree Grice Ruth r629 (1013) Vineville Grice Samuel R student r629 (1013) Vineville av Grice Warren (Clara E; Hall, Grice & Bloch) h629 1013) Vineville av Grier see also Greer Grier Alex (Roxie) brklyr hl02 Woolfork (EM) Grier Amanda lndrs rl02 Woolfork (EM) Grier Anna maid r8 Woodliff Grier Dora cook r302 Madison Grier Ernest h803 Ocmulgee Grier Essick (Mattie) farmer hl07 Peacock Grier Hubert (Louise) lab rll2 Long Grier John (Minnie) h202 Gantt City rd Grier John (Ominzevolee) auto mech r220 Jones Grier Lewis lab rl29 Jones Grier Lizzie lndrs hl36 North Grier Lobie mech hi Balkcom Grier Mary (wid Dolfield) r345 Bright Grier Mirties cook r206 Forest av Grier Monroe (Eula) lab h658 Strayers al Grier Robt lab r658 Strayers al Grier Sandy (Celia) h221 Johnson av Grier Thos (Martha E) h620 Plum Grier Tobias (Victoria) h435 Elbert Grier Wm dyer rl02 Woolfork (EM) Grier Wm jr (Alma) h302 Madison Grierson E Rosa r765 New Griffin Adalaide (wid W H) rll9 Log Cabin dr Griffin Albert G r232 Tatnall Griffin Amanda sten rl5 Willingham Griffin Arth electn Morris Putzel Griffin Benj (Gertrude) flagmn hl08 Rutherford av R. L. POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 49S6-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 409 Griffin Berrice C flagmn rlOO Richmond Griffin Chas D (Mary) appr Taylor Iron Works & Supply Co hl29 Rutherford av Griffin Chesley B (Bessie) sec-treas Industrial Loan & Inv Co rl20 Iverness Griffin Clara lndrs rl50 (240) Green Griffin Clinton F (Olive) slsmn h702 Holt av Griffin David (Rhoda; South Side Garage) h508 Stephen Griffin David (Carrie) lab r541 Tinsley la Griffin David J (Ella) insp Fire Dept rl23 2d Griffin Dennis B h.554 3d Griffin DeWard lab r362 Hazel Griffin Edd (Rosa) lab h305 (10) Wood al Griffin Eva cook r541 Tinsley la Griffin E Lyman mldr r601 Mikado av Griffin Fannie dom r5 Harris row Griffin Geo R (Lula) lieut Police Dept hl414 3d Griffin Geo W (Grace) reptr Macon Telegraph h232 Tatnall Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Griffin Gladis F (Jessie) auto mech hl44 Knott Griffin Groccie r541 Tinsley la Griffin Henrietta h610 Clinton (EM) Griffin Henry L (Tillie) hostler hl5 Willingham Griffin Homer C (Zollie) cond hl21 Holt Griffin Howard lab rl50 (240) Green Griffin H Minter (Lizzie) hrness mkr Otto-Isaacs Harness Co h220 Hydrola Griffin Irvin H carmn rl53 Boulevard (NH) Griffin Ivey D (Lillian) shoe repr H H Harris r873 Mulberry Griffin Jas A (Carrie) electn) li503 Main (EM) Griffin Jas H(Lula) asst supt hl29 Nottingham dr Griffin Jas M (Gertrude) firemn h807 3d av (V) Griffin Jas W driver Yellow Cab Co r355 Walnut Griffin Jessie dom r5 Harris row Griffin John B (Glanda L) plainer h907 Elbert FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION .DETROIT R. L. POLK & CO. CHICAGO Questions as to WHOM You Are Looking For WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 410 (1925) R. L. POLK & CO.'S Griffin John H elk rll9 Log Cabin dr Griffin John S r232 Tatnall Griffin Jos (Rosa) lab h230 Jefferson Griffin Jos P (Minnie L) cabtmkr Muecke & Sons Co Inc r909 Orange Griffin Jos T copy boy Macon-Telegraph r232 Tat- nall Griffin J Leon mldr r601 Mikado Griffin Lewis H (Jewell) electn Morris Putzel r314 Cutlers Green Griffin Lilly h416 Bay Griffin Louvinia sten Martin & Martin rl53 Boule- vard (NH) Griffin Lucy cook h243 Jones Griffin Lula Indrs h5 Harris row Griffin Mangham (Etta) carp rl227 2d Griffin Martha Indrs rl50 Bennett al Griffin Mary Indrs h356 Hawthorne "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIh,oLytLuoYarTup.nrHrgdouYdFvmeooe. nlcrsaTtasisathstiaritoiclesen.A,niNasoTtIDtafHyaEoUtdhuhYaSerenEyagDAlePtbrRrhYulyEegsOeigpdgRUiinsAnNatok'Lln-s., Griffin Mattie R (wid Wm) matron Travelers Aid h 453 Carling av (HH) Griffin Maude spinner r667 Elm Griffin Mildred student r807 3d av (V) Griffin Peter (Ellen) lab h224 Collins la Griffin Ralph W E elk r2134 Broadway Griffin Randolph lab r305 (10) Wood al Griffin Richd porter rllO 4th av (V) Griffin Richd M (Lillie) mech r250 Hydrola Griffin Roscoe cook hl50 (240) Green Griffin R Lee (Jennie) farmer h601 Mikado av Griffin Sami B (Lizzie) r307 Chappell Griffin Sami B (Clyde) r2480 2d Griffin Sami C (Addie) carp hlOO Richmond Griffin Scott (Lizzie) porter J B Riley Drug Co h318 Monroe Griffin Verna student rl5 Willingham Griffin Walter D (Mary V) contr h210 Winship Griffin Walter D jr student h210 Winship R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND T"p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 411 Griffin Wm L harness mkr Otto-Isaacs Harness Co h 250 Hydrola Griffin Willie M sten hll9 Log Cabin dr Griffin W Ewing (Selma) boys wkr sec Y M C A r286 Hillger av Griffith Arth (Derrelle; Wm D Griffith & Son) hl23 Rogers av Griffith Jas F student r220 1st Griffith Lillie D sten G G Hardeman Co r411 Forsyth Griffith Marvin F (Eloise) eng Southeastern Under- writers Assn h.512 Washington av Griffith Percy D (Vickie M) mgr h414 Ridge av GRIFFITH WM I) (Emma H), Agt Southern Mutual Insurance Co and Atlantic Mutual Fire Insurance Co of Savannah, Office 208-209 Macon Natl Bank Bldg, Phone 456, h411 Forsyth, Phone 2109-J Griffith Wm D & Son (Wm D and Arthur Griffith) ins agts 208-9 Macon Natl Bank bldg MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAIWLKLIISNS Griggs Carrie B student r204 Ward (V) Griggs Edw Rev h204 Ward (V) Griggs Emmett A (Mary) trainmn Macon Ry & Light Co hl04 Yates av (EM) Griggs Harry M (Angie M; Eagle Hotel) h461 New Griggs Henry (Miley) lab h5 White al Griggs Jennie hl29 Jones Griggs John driver Parcel Delivery Co r204 Ward (V) Griggs John (Mattie) lab h259 North Griggs Jos H (Thelma) elk The Rent A Ford Co h 850 Walnut Griggs Judge jr (Eula) mech hl35 Mutual av Griggs Lillie dom rl06 Elm Griggs Lucian (Daisy) lab h316 3d av (V) Griggs Lucile student r204 Ward (V) Griggs Lula lndrs r259 North Griggs Marion (Nellie) porter h757 Ash Griggs Mary cook h72 Schofield Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work O CD Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK &CQ. Polk Directory Bldg. Detroit, Mich. 412 (1925) R. L. POLK & CO.'S Griggs Mary C r72 Schofield Griggs Maurice (Emma) trucker h920 Hazel Griggs Mill (Annie D) orderly hl37 (139) 4th av (V) Griggs Pearl Mrs textile opr h765 Hawthorne Griggs Rufus (Leona) porter Wellingham Sash & Door Co h602 Fort Hill (EM) Griggs Seadron A (Mary L) formn hl05 Yates av (EM) Griggs Thelma Mrs sten Clements & Clements h850 Walnut Griggs Tom (Leila) lab h209 Wood al Grigsby Mary L lndrs h621 Division Grigsby Rufus (Emma) lab h200 Short (EM) Grimes Cora lndrs h204 Wood!iff Grimes Cornelius H slsmn r Y M C A Grimes Hattie (wid Morris W) h Adams Boarding House Lake Grimes Jas (Alberta) lab h312 Telfair Grimes Matilda (wid Chas) r Adams Boarding House Lake av Grimes Morris C (Lessie) mill wkr h32 Bellevue rd Grimes Nathaniel firemn Hotel Lanier r do Grimes Simon M (Lura L) restr 619 Broadway h204 Forest av Grimes V G (Alvonia) lab r312 Madison Grimes Willella slsldy Union Dry Goods Co r460 Vir- ginia Grimes Wm V (Fannie) slsmn Lees Dept Store h460 Virginia av Grimes Wilmer A slsmn Burden Smith & Co r460 Vir- ginia av Grimmett T Wallace (Florine) train dispr h851 Oak Grimsley Belle mill hd r31 Bibb av Grimsley Frank C (Willa M) dept mgr Union Dry Gds Co h710 Napier av Grimsley Myrtle mill hd r31 Bibb av Grimsley Theron D elk Ainsworth Optical Co r710 Na,pier av Griner Elmo (Annie) meat ctr r753 1st Grisby Ballard (Sarah) lab h311 E 2d (EM) Grisby Evelena h624 Prince Grissel Annie L cook rl21 Gordon Grissit Webb lab r9 Harris al Grissom demon D eng hl918 3d KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY (1925) 413 Grissom Eug rl918 3d Griswold Florene tchr h368 Monroe Griswold Gertie cook r249 Railroad av Griswold Julia H (wid Harry G) bkpr Singer Sewing Mach Co Griswold Lawrence lab r317 Asb Griswold Rosa lndrs hl41 Frank al GRISWOLD SIDNEY S, Sec and Treas Jos N Neel Co, r211 Boulevard (NH) Griswold Wm (Pearl) driver Corbin Supply Co hl26 Asb Groce Spartan T (Althea) slsmn Standard Oil Co h 458 Edgewood av Groce Spartan T jr apprentice r458 Edgewood av Groh Harold J (Henrietta) mgr Commercial Credit Co h610 Montpelier av Groom Edw (Daisy) lab h369 Wright al Gross Abr flremn r420 3d av (V) Gross Addie lndrs h227 Wright al SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Gross Albert (Stella) formn h60 Davis (NH) Gross Danl (Daisy) lab h618 (117) Cowan Gross Ella M r243 (236) 3d av (V) Gross Emma smstrs h420 3d av (V) Gross Ernest lab r618 (117) Cowan Gross Ira (Florine) blk str h526 E 1st (EM) Gross Jessie rl2 Wise av (V) Gross Nettie lndrs r618 (117) Cowan Gross Rufus lab r227 Wright al Gross Walter L (Ollie) elk r Lanier pi Gross Wm porter R G Stripling Grote Ernestine tchr Wesleyan College r66 Arlington Pi Grovenstine Angus S (Bertha M) mach r Mrs M J Clctro Grovenstine Bertha C Mrs sis mgr r Mrs M J Clare Grovenstine Minnie r607 Oakland av Groves Allen N (Myrtle) linemn r50 (352) White s m CO p m5 On 5ow -ow v Jfor lists of names AI N'Y TV RA. DVE ***' *< ANY BUSINESSr j-- ANY PROFESSION 5 DETROIT R. L. POLK & CO. CHICAGO R. A. WILLIAMS, Realtor UJ rti ,~o zS z < 5O gw 0$ D C/5 Z CO H H co U > Z UJ z 2X OoJ a Dh -- UJl ^ UJ I H i FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO 414 (1925) R. L. POLK & CO.'S Groves Ruth elk Jas L Caldwell r do Grover Sallie (wid (Jas) dom h Robinson rd Grubbs Jos E (Rose) elk h553 Boulevard (NH) Grubbs Rose E sten Scott-Parker Co r553 Boulevard Gruce Chas B (Thelma) ins agt h305 Mikado av Gruden Pearl bottle wshr rll9 Powell (EM) Gruhn Adolph (Louise) mgr h302 Main (EM) Gruhn Louise elk r302 Main (EM) Gruhn Wm J gro 302 Main (EM) h do Grunnels Lewis elk Mrs M H Grunnels r802 Edge- wood av Grunnels Mary H Mrs gro 802 Edgewood av r do Guaranty Life Insurance Co Calvin N Walker agt in charge 556 New Guerardie Virgil C capt Fire Dept r804 Orange Guerry Jacob L (Eliz) farmer hll41 Milledgeville rd Gufford Albert R millwright Massee Felton Lumber Co rl21 Stratton Gufford Jos P (Lina) mill wright hl21 Stratton Gufford Lee auto shield rl21 Stratton Gugel Virginia (wid Wm H) h2 Nevaro flats GULF REFINING CO, D W Lanier Agt, 210 Edge- wood av, Phone 1038, Filling Stations 209 2d, 259 5th, 362 Hardeman av, 600 New and Cor Oglethorpe and College (See page 78) Gullatt Wm (Susie) shoe repr 1219 Broadway h712 Campbell av Gunn Henry E (Tommie) slsmn Johnson Bros h258 Maple Gunn John (Christine) truck driver hl56 Phillips Gunn John W (Mary I) blksmith 422 Plum h do Gunnells Jas L carp r305 Pio Nono av Gunnells Ophelia (wid Tony) mill hd h305 Pio Nono Gunnells Sami (Hattie) carp h312 (221) Pio Nono av Gunnells Willie M mill hd r305 Pio Nono av Gunter Daisy lndrs h699 Cowan Gunter Eliza (wid Jackson) r520 Telfair Gunter Henry H (Effie) carp r330 Hanson Gunter Jas H (Zelma) carp h.306 Peachtree Gunter John D elk W A & J A Spiller r520 Telfair Gunter Leon O barber Jackson & Gordy r360 New Gunter Luther L barber J C Mitchell rl716 3d Gunter Tillman R (Grace) carp r608 Oglethorpe Gurganious Homer (Willie) lab h328 Hydrola 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 415 Gustin Riley (Julia) driver hill Wyche Guthman Clarice r860 Mulberry Guthman Sami (Nona) h860 Mulberry Guttenberger Benj P bkpr Luther Williams Bank & T-p Pn -pi 9Q noV TTovPn av GUTTENBERGER CURTIS N, V-Pres Williams Guttenberger Music Co, hl23 Oak Haven, Phone 1872 Guttenberger Perd A (Felicia) music 364 2d r P P Brock Sunset dr (SH) Guttenberger Helen Mrs rP P Brock Sunset Drive (SH) Guttenberger Martha student rl23 Oak Haven av Guttenberger Mary sten rl23 Oak Haven av Guyden Thos r225 Elliott (EM) Guyer Roy J elk r754 Cherry Guyton Albert (Estory) lab r503 E 1st Guyton John (Letha) r622Ath av (U) Guyton John S Mrs slswmn J P Allen & Co rl47 High MACON OPTICAL COMPANY 7ra^ H; ^ohnson Opticians ;<*f O Optometrists \ rHFRRY -A > - PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Guyton Pearl hlpr Macon Coca Cola Bottling Co rll9 ` Powell (E M) Guyton Walker C (Leola) millwkr h24 Brigham Guyton Wm G (Etta) millwkr r Minnie Freeman Gyles Emily r508 Walnut Haas Albert A (Oliver B) eng h55 Forsyth rd (V) 1 e Tyrone blvd Haas Albert A jr student r A A Haas JHaas-Mamie nurse hl2 Bibb av Haas Thelma emp r A A Haas Habersham Jacob lab Builders Lbr Co res Clinton rd Hackett Eliz student r240 Hardeman av Hackett Minnie S r240 Hardeman av Hackett Pearl student r240 Hardeman av Hackett Wm W (Isabelle D) div pass agt C of Ga h 240 Hardeman av Hackney Clem trav slsmn 251 New Hackney Eleanor r631 (933) Vineville av Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. i !!#' I * i&L WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 416 (1925) R. L. POLK & CO.'S Hackney John student r251 New Hackney Robt carp rl61 3d Hadasits Jos P (Mary) planing mill opr h3003 Hous- ton av Hadasits Wm A planer r3003 Houston av Hadaway Clifford T (Sarah) lmbrmn h267 Washing- s ton av Hadaway Geo W agt Geo Washington Life Ins Co r 1120 Milledgeville rd Hadaway Jos L jr (VanLandingham & Hadaway) r240 Washington av Hadaway Roy H slsmn Burney Bros Co Hadaway Sami E student r267 Washington av Hadaway Wm F (Alma) lab hll20 Milledgeville rd Hadden Lee (Laura) lab h.667 Plummer's al Hadden Richd (Bell) lab h211 Ocmulgee Hadden Thos A (Jewel) telegraph opr h33 Marion pi (H H) Hadden Troy F (Effie) pntr The J W Burke Co r554 Ash Haddock Bessie (wid Jos) r500 Forsyth Haddock Burney L (Susie) gro 500 Forsyth h do Haddock Drucilla (wid Jos W) rl07 School Haddock Eliz musician Rialto Theatre r313 Cherry oaf? Haddock Emerson C (Rebecca) carp h716 Main Haddock John H asst exec Boy Scouts of America r679 Courtland av Haddock Otis lab r531 Maynard Haddock Rachael lndrs h531 Maynard Haddock S H (Nora) dept mgr Dannenberg Co h679 Courtland av Haddock S H jr student r679 Courtland av Haden Annie (wid Jas M) hl62 Jeff Davis Haden Chas R appr rl38 Lamont Haden Joel A (Florence) carp Taylor Iron Works & Supply Co hl38 Lamont Haden Riley B (Leona) ad compositor r274 Hillver av J Haden Sallie Kate sten Remington Typewriter Co rl38 Lamont Haden Wm T (Emma J) adv slsmn Macon Telegraph r312 Johnson av Haffy Jas P (Mary E) eng h873 Mulberry Automobile owners are select prospects for many kinds of merchandise. Send to Headquar~ ters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kepi in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 417 Hagan Dora opr Sou Bell Tel Co r2301 2d Hagan Prank L wtchmn r2301 2d Hagan Hennie (wid John C) hl73 Cedar (S M) Hagan H McArthur (Irma) flremn rl73 Cedar (S M) Hagan Jas O (Bertha) loans 552% 2d r952 Elm Haines see also Haynes Haines Edw (Annie) lab hl24 Plummer's al Haines Minnie maid r223 Shamrock Hainline Edelia r632 Forsyth Hainline John L (Cora A) wall paper 228% Cotton av h632 Forsyth Hainline Sami E drugs r632 Forsyth Haire Harrison D elk Rogers Grocery r611 2d Haire Jos C sec and adv mgr Macon News r527 Col- lege Haisten Annie (wid Clarence) hl49 Williams Haisten Chas C (Mary) h280% Orange Haisten Claude (Mary) hll22 Walnut Halcomb Christopher C (Rosa) photog h417 Arch Halcome J Leroy (Leona) aud b.341 Hardeman av Hale Crowder spl agt Southeastern Underwriters Assn res Atlanta Ga Hale G T eng r750 2d Hale Isabelle (wid I R) h7 Holt av (N H) Hale Jas K (Emelia) asst eng City Water Wks h200 Log Cabin dr Hale Leslie M slsmn Gulf Refining Co rill Rogers av Hale Rosa wks r7 Holt av Hale Ruth school tchr r200 Log Cabin dr Hales Leonard L (Laura) carp h Church (C H) Hales Robt L (Watts & Co) r664 Poplar Haley Calvin C (Rebal) collr Day's h768 Oak Haley Franklin asst ship elk Coleman Meadows Pate Drug Co rl04 Buford pi Haley Mamie H (wid Herbert F) hl04 Buford pi Haley Margt student rl04 Buford pi Hall Albert student rll29 Milledgeville rd (E M) Hall Alonzo student rll29 Milledgevill rd (E M) Hall Annie lndrs hl31 Ritchey al Hall Annie M dom r624 Gresham la Hall Arnold D copy holder Macon News r211 Broad- way Hall Berry (Emma) lab hill Peacock Hall Bertha cook h859 Ocmulgee FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS * -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 Dim 418 (1925) R. L. POLK & CO.'S as a Hall Bird lab h215 Turpin Hall Carrie lndrs r7 Harris al MMEI Hall Charity lndrs r78 Bay Hall Chas lab r633 Peeble pm Hall Chas B lab r624 Gresham la HALL CHARLES H (Emma W), Attorney-at-Law 618-619 Ga Casualty Bldg, Phone 2614, h507 Col- THE DIRECTORY lege, Phone 69 Hall Chas H (Mabel) eng hl27 Highland av Hall Cicero (Mattie) lab hl03 Hazel Hall Clarence S elk P O IS THE Hall Clyde lab r3 Malloy's al Hall Curyus h Robinson rd nr Bond GREATEST Hall David (Lena) lab h642 Hammond Hall Edna student rl27 Highland av MARKET Hall Edw (Laura) concretewkr h520 New Hall Edw (Annie) lab hl2 Cheatham al PLACE ; IN THE Hall Edw (Ida) lab h624 Gresham la Hall Elbert (Maggie) mach hll29 Milledgeville rd (E M) WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Hall Eliz r231 High Plall Ella cook hl30 Schofield Hall Ella lndrs h84 Schofield Hall Elsie opr Sou Bell Tel Co rl22 Holt Hall Eug (Mattie) lab h379 Madison Hall Eva rl50 Georgia av Hall Fannie cook h404 Ward Hall Francis K M student r231 High Hall General S janitor Federal bldg r408 Ross Hall Geo T (Annie) lunch 23 Bellevue rd h do HALL, GRICE & BLOCH (J E Hall, Warren Grice, C J Bloch), Attorneys-at-Law 614-618 Ga Cas- The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year ualty Bldg, Phone 391 Hall Harris F slsmn hl'99 Laurel av Hall Harry S slsmn Liggett & Myers r Y M C A Hall Henry (Mattie) lab h6 Turpin Hall Henry (Ida) lab h502 (402) Smith (EM) Hall Irving E (Pearl) boilermkr h817 Beech av W Hall Jackson T Rev (Jessie) h552 Monroe Hall Jas B (Julia) sec h355 New Hall Jas H asst tchr Mercer University r do Hall Jas H Rev (Annie) pastor 235 Grand Chapel al Hall Jas L lab r624 Gresham la PUBLISHERS Hall Jas M (Nina) blksmith h!02 Center PoIkDirecbryH DETROIT. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 419 Hall Jas S (Mona) lab hl64 Ellis Hall John E jr student r231 High Hall John Q student r231 High Hall Johnnie M lndrs r333 Woodliff Hall Jos lab r303 Ward Hall Joshua (Clifford) hlpr hll40 Broadway Hall J Ellsworth (May K; Hall, Grice & Bloch) h231 High Hall Laura lndrs r450 Alabama Hall Lee (Lizzie) furn repr h260 2d av Hall Lorain dom r316 Division Hall Louise student r231 High Hall Louise student rll29 Milledgeville rd (E M) Hall Lucius (Alice) lab h540 Henrietta Hall Lula A Mrs elk J B Riley Drug Co rll7 Washing- ton av Hall L Emmett (Drue M) slsmn Yates & Tabor Co hl24 Merritt av (M A) Hall Malinda lndrs r303 (583) Hall Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Hall Mansfield P (Mamie) lawyer 150 Georgia av h do Hall Marie nurse Macon Hosp r do Hall Martha (wid Robt) r319 Clinton Hall Mary h95 Green Hall Mary maid r222 Jordans al Hall Mary student rl50 Georgia av Hall Matilda lndrs r78 Bay Hall Nellie lndrs hlO (3) Tatnall la Hall Omelia r552 Monroe Hall Ora L lndrs rlOO Society _ Hall O M sec-mgr Peoples Health & Life Ins Co Hall Rachael r552 Monroe Hall Rachel Mrs r408 Ross Hall Robert L (Mamie) opr h589 Carling av (H H) Hall Robt M county surveyor r903 Cherry Hall Roxie nurse r324 Hill Crest av Hall Sallie r512 Walnut DRESS IN STYLE I DAYS USE YOUR CREDIT 406 THIRD ST. TEL. 3026 More goods are bought and sold through the c o aU_j;jJ Iajjds Classified Business Lists of the Directory than any other medium on earth. < d T3 a o V d 8 * m u o 2 .S H gul 2 H K tOtsM1J Q .it < 2 2 <*P 5,8 il sfig 3ft,sd A d 2 3 oz og 2 H H = y ^ on E .. WcH/i tS;n>HUt/3 *28 EP OVOS QOZS <80 o"<=Sta. QI < < 420 (1925) R. L. POLK & CO.'S Hall Sami gro 701 Elbert (S M) h do Hall Silas S (Minnie) car repr hl533 3d Hall Taylor (Patience) lab h735 Hall Hall Thos H (Lura M) mech Jones Motor Co hl026 2d HALL THOMAS H (CAEOLIE E) Physician and Sur- geon 404-406 Grand Bldg, Phone 4216, hll7 Oak Haven av, Phone 905 Hall Thos H (Mildred B) slsmn L A Thorpe h509 College Hall Vera waitress Jack Williams r500 Chappell Hall Viola lndrs hl8 Gustin av Hall Virginia B student r355 New Hall Wesley H (Lulak) pastor Bethel C M E Church h326 (224) Pio Nono av Hall Wm (Ola M) carp r699 (131) Hall Hall Wm Winnie) carp h244 Church la Hall Wm (Rosa) lab h618 Gilmer Hall Wm B (Mary) pntr hl8y2 Blosfeld av Hall Wm F carp rl31 Ritchey al Hall Wm H Rev (Ethel) pastor Mt Moriah Baptist Ch r402 Broad Hall Wm M (Marie) gro 159 5th h226 Elliotte (E M) Hall Wm R elk rl99 Laurel av Hall Willie lndrs r624 Gresham la Hall Winkfield F (Lucile) grocer 1010 Main hlOO So- ciety rd Hall W Russell elk J B Riley Drug Co Halliburton Mamie W Mrs ins 522 Citizens & Sou Bank bldg h531 Georgia av Halliburton Robt L (Mamie W) h531 Georgia av Halliburton Thos H (Lizzie L) Roughton-Hallibur- ton Co) hl04 Summitt av (N H) Hallman Claude E (Winnie) auto repr 550 3d res Skipton Ga Hallman Ernest L (Willie) mech C E Hallman Halm Wm A (Cecilia) h5, 811 Poplar Halsall W chef Dempsey Hotel r573 Orange Halstead Zillah tchr Wesleyan College r445 College Ham Bessie slsldy W T Grant Co Ham Lamar F (Anna B) mgr Alex Sprunt & Son h 122 Merritt av (M A) Ham Lucy lndrs h310 Burnett (E M) Hambrick Edw C (Bessie) h2011 Broadway Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 . H. HUNNICUTT CLOTHING CO. ing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 421 Hambrick Edw E appr r2011 Broadway Hambrick Eunice slsldy McLellan r2011 Broadway Hambrick John (Ludie) h811 Elm Hambrick Leo H (Ola) overseer h(55 Davis Hambrick Paul C (Rebie) pipeftr r814 Elm Hambrick Richd opr rll7 Maple Hambrick Wm T millwkr r65 Davis Hambry Anna maid h67 Spring Hamilton Agnes E tchr Wesleyan College r520 Col- lege Hamilton Alex D agt N C Mut Life Ins Co r422 Peachtree Hamilton Anna E (wid Drew) h494 Orange Hamilton Annie E (wid Geo) h217 1st Hamilton A L city firemn Fire Dept r do Hamilton Edgar S (Daisy C) sec-treas BatemanFreeman Co sec-treas Macon Orange & Banana Co h905 Orange YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES 317-319 Third St. Hamilton Eugenia (wid Geo) tchr h55 Spring Hamilton Gennie (Mattie) lab h701 Daisy (S M) Hamilton Geo B bkpr r768 Oak Hamilton Harry D elk r217 1st Hamilton Jas (Pinkie) barber h369 Hazel Hamilton Jas (Nancy) lab hi Alabama Hamilton John R asst supt Bibb Mfg Co No 2 r217 1st Hamilton Kizzie lndrs hllO Moore av Hamilton Lester (Viola) lab h332 Madison Hamilton Lucile r332 Madison Hamilton Lucious lab r332 Madison Hamilton Noble R chief elk r331 (393) Hill Crest av Hamilton P Thos (Daisy) cond hl43 Tenny Hamilton Richd lab r369 Hazel Hamilton Rosevilt del boy r323 Long Hamilton Savana r323 Long Hamilton Wm L (Emma) elk L W Rogers Co r900 Main (E M) Hamilton Wm T elk rl43 Tenny FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO t&L W. S. DICKEY CLAY MFG. CO. 210-212 MORRIS HARRIS INSURANCE SURETY BONDS Bibb Building Telephone 131 422 (1925) R. L. POLK & CO.'S Hamlen Andrew B (Janie) carp h Forsyth rd (V) end car line Hamlie John E (Georgia) formn h335 Calhoun Hamlin Carl hlpr Hamlin & Subers res Rutland Ga Hamlin Chas H (Daisy) mach r3611 Houston av Hamlin Daisy Mrs elk R E Morgan r2006 2d Hamlin Duvall G pkr rl21 Grady Hamlin Earle (Bessie) carp r243 Belmont av Hamlin Earnest L (Lizzie) h3601 Houston av Hamlin Eliz nurse Middle Georgia Sanatorium r do Hamlin Ella lndrs hl37 Kahn's al Hamlin Ellavel r503 Bailey av Hamlin Floyd R (Fannie) car repr hl21 Grady Hamlin Geo lab h346 Bright al Hamlin Georgia smstrs r542 (442) Mitchell Hamlin Gladys cashr Union Dry Goods Co r241 Bel- mont av Hamlin Gussie (wid Frank E) hl817 3d Hamlin Horace A (Emma) elk hl26 Grady Hamlin Inez elk C & G R R Co res R F D 3 Hamlin Jas L (Susie) carp h503 Bailey av Hamlin Jas O (Jessie) plmbr Miller Bros h301 Beech av Hamlin Jas T (Katie; Crystal Mkt) h294 Cherry av Hamlin Jessie Mrs slsldy Union Dry Goods Co h301 Beech av Hamlin Jones & Eaton R V Elledge repr lumber 8 Jaques bldg Hamlin Jos H msngr rl26 Grady Hamlin Jos W (Martha) tinner r2615 2d Hamlin Julian L (Mabel) h246 Windship HAMLIN J LON (Ruby; Hamlin & Subers), res Rut- land Ga Hamlin Lois student r A B Hamlin Hamlin Louis lobby cashr Dempsey Hotel r241 Bel- mont av Hamlin Louis E (Annie) car inspr h3611 Houston av Hamlin Lovett (Daisy) car repr r2006 2d Hamlin Martha opr The Wm Carter Co r503 Bailey av Hamlin Mary M elk G R Kinney Co Inc h398 Morgan Hamlin Otis F finisher Sou Duco Enameling Co r3601 Houston av Hamlin Robt F (Mary) linemn W U Tel Co hl20 Plant A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company HEAVY HAULING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 258 Second St. MACON CITY DIRECTORY (1925) 423 Hamlin Robt L (Mary) carp h398 Morgan av Hamlin Ruben W h241 Belmont av Hamlin Vera student r A B Hamlin Hamlin Veter rl21 Grady Hamlin Wm B (Fannie) prop h282 Main (E M) Hamlin Wm J (Laura M) real est 504 Mulberry h3005 Houston av Hamlin Wm L elk rl26 Grady HAMLIN & SUBERS (J L Hamlin, A B Subers), Architectural Sheet Metal Work, Hot Air Furnaces 27 Wall, Phone Local and Long Distance 179 (See page 85) Hammack Chas E (Emmie) transfer h.467 Boulevard (N A) Hammack Frank H (Gussie) slsmn Kinnett Odom Co hlll4 Walnut Hammers Chester B (Alma) mach h620 Plum Hammett Elder (Mattie L) plmbr r387 Melrose Hammett Eliz student r608 1st Hammett Jas T (Ophelia) millwkr h21 Manchester qtrs Hammett Jos lab r387 Melrose Hammett Mary (wid Lewis H) r21 Manchester qtrs Hammett Sallie lndrs r387 Melrose Hammock Ada h711 Ash Hammock Columbus M millwkr r Eldora Hammock Hammock Eldora (wid Wm) h Railroad Bellevue Hammock Marion J (Lucy) parkmn h223 Applewood Hammock Nannie r Eldora Hammock Hammock Peter (Pricilla) lab h720 Short (E M) Hammock Richd mgr Jackson Blacksmith Shop rl016 Main Hammond Ada lndrs r527 Railroad av Hammond Alberta cook rll2 Moore la Hammond Anderson phys h93 (113) Roosevelt (V) Hammond Claude C (Annie M) sec Fowler Lumber & Plywood Co h716 Holt av Hammond Eunice A student r231 Boulevard (N H) Hammond E Frank (Gertrude) tchr Ga-Ala Business College h231 Boulevard (N H) Hammond Grattan (Laurie) acct W L Thaggard h215 Hines ter Hammond J E metalwkr Hamlin & Subers h246 Win- ship MOVING STORAGE FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLIv & CO. Chicago W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 424 (1925) R, L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Hammond J W metalwkr Hamlin & Subers h2615 2d Hammond Lewis (Hallie) porter hl53 (152) Lincoln av (V) Hammond Mac B (Rosalie) mgr Hammond Oil Co h 108 Courtland av Hammond Marie sten rl08 Courtland av HAMMOND OIL CO (M B Hammond), 5th sw cor Hawthorne and 689 3d, Phone 4051 HAMMOND REGINALD G (Bettie J), Mgr Federal Clothing Co, h Lanier Hotel Hammond Robt M student rl08 Courtland av Hammond Sami lab rl333 1st Hammond Service Co R E Slappey mgr br 467 2d Hammond Wm (Strawdy) lab h641 Hammond Hammond Wm A (Lena) flremn hl327 3d Hammond Wm A (Gertrude) sheetmetalwkr h3203 Houston av Hammond Buck lab h4444 Pulton al Hammond Obe (Alberta) carp rl521 2d Hampton Chas r432 Monroe Hampton Chas (Mabel) lab hl052 Watson al Hampton Chas B (Bessie) millwright rll3 (6) Log Cabin dr Hampton E J (Pearle) lab h225 Long Hampton Prank (Annie) lab h549 (449) Smith (E M) Hampton Garage C Jones mgr 257 5th Hampton Georgie L Indrs rl052 Watson av Hampton Henry (Mattie) gro 205 4th av (V) h272 3d av (V) Hampton Jas (Pinkey) barber Clinton Brantley r408 Craft la Hampton Janie r400 (300) Charles (S M) Hampton Julious J (Beatrice) lab h340 Long Hampton Mattie cook h4 (904) Clayton Hampton Mattie B student r272 3d av (V) Hampton Nora (wid Edw) asst matron Tabernacle Rescue Home r do Hampton Nora cook r400 Hill Crest av Hampton Preston B (Daisy) mgr Tabernacle Rescue Home h do Hampton Raford (Carrie) hl54 (113) Roye Hampton Robt L depy sheriff Municipal Court res Glencoe Springs Ga Hampton Ruth cook r rear 402 Montpelier av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 425 Hampton Wade (Susan) hl21 Tatnall Hamrick Horace C (Ila E) slsmn City Realty Co h863 Orange Hamsley Jas W (Ollie V) carp hl325 Broadway Hanberry Richd L (Beulah; Holt & Hanberry) h808 Napier av Hancock Alf J (Linda) trainmn Macon Ry & Light Co r444 New Hancock Clarence H (Bertha) city firemn r427 Mont- pelier av Hancock Docia (wid Green) rl40 Charles (S M) Hancock Edna slsldy W T Grant Co r444 New Hancock E Jas (Josie) lumbr buyer rl223 Oglethorpe Hancock Jas S (Annie) metalwkr Hamlin & Subers r 220 1st Hancock Jesse carp h598 Norris Hancock Jesse M (Cora) formn hl40 Charles (S M) HANCOCK JOHN M (Pearl), Attorney-at-Law 1 Washington Bldg, Phone 1837, h315 Johnson av, Phone 4889 Hancock John W (Emmilu; Bibb Printing Co) hll21 Walnut Hancock J Lowe (Ola) hl05 Dixie av Hancock Laura J rooms 452% Mulberry h do Hancock Mabel W student rl42 Hines ter Hancock Marvin A (Katherine) elk Merritt & Co rll5 Cole Hancock Melly r613 Maynard Hancock Theodocia rl40 Charles Hancock Wm L student r220 1st Hand A J elk r Y M C A Hand Pearl maid r338 Woodliff Hand Thos O jr bkpr 4th Natl Bank r220 High Hand Twyman r203 Lynwood av Hand Wm (Mannie) plstr h809 Dempsey av Handley Agnes elk r2602 2d Handley Danl M (Clara) cond h2602 2d Handley Geo D appr r2602 2d Handley Robt D mach r2602 2d Handy Geo fruits 505 Broadway r456% Poplar Handy Josephine elk r456V2 Poplar Hand Katrena elk r456!/2 Poplar Handy Mamie elk r456% Poplar Haney Benton J (Eva) bkpr r320 Johnson av A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do It Right R P BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 426 (1925) R.. L. POLK & CO.'S Hankins Jesse (Anna) lab h273 Garden Hanks Lester F (Mary) elk rill Rogers av Hanna H G mech Try Me Bottling Co Hanna Leone Mrs slsldy Union Dry Goods Co r252 Columbus Hannah Bingley S Rev (Sarah) pastor Stewart A M E Ch h653 Spring Hannah Essie I tchr r653 Spring Hannah Ethel tchr r653 Spring Hannah Lydia E tchr r653 Spring Hannah Ruth B lndrs hl36 Cowan Hanner Alvin L msngr r414 Jeff Davis Hanner Chas A piano tuner h414 Jeff Davis Hanner Ethel r414 Jeff Davis Hanono Isaac (Lilly) gro 120 Bay r do HANOVER SHOE THE, R R Holsenback Mgr, 362 2d Hansard Henry P (Nancy J) dentist r430 Ridge av Hanse' Carroll F elk r804 2d Hanse Geo A (Nellie) elk C of G R R Co h804 2d "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuYoarTpu.nHrrgdouYdFvmeeoo. nlcsraTtasiasthstiaritoicelsen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAlePtbRrhrYulyEegsOeigpdgRUiinsnANaotk'Lln-s., Hanse Lee A (Zona) electn rl55 1st Hanse Lora (wid Albert) h504 Oak Hansford Hallie D (Annie) slsmn Lee's Dept Store h203 Hines ter Hansford Louie mach r203 Hines ter Hansford Melba student r203 Hines ter Hansford Montine student r203 Hines ter Hanson A Sidney r426 Forsyth Hanson Jas W (Jennie) genl mgr Southland Knitting Mills r426 Forsyth Hanson Wesley L mgr Met Life Ins Co v-pres Southland Knitting Mills rl64 Cherokee av Hapeville' Martha maid rll6 (401) Braswell la Happ Bros Co (L M Happ, M Michl, P Happ) overall mfrs 674 Broadway Happ Frank R (Alma) archt 24-25 Fourth Natl Bank bldg h608 (912) Vineville av 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 427 Happ Lee M (Tatum; Happ Bros Co) h604 (904) Vineville av Happ Pinkus (Mary; Happ Bros Co) rll07 Vineville Harbaum Mary E Mrs h4, 853 Cherry Harbuck Mae rl811 Broadway Hard Cottage Mercer Univ 1123 College 1IAHIII:.MAN AVENUE PHARMACY (E C Jones), Drugs, Sundries, Candies, Soft Drinks, Cigars and Tobacco 124 Hardeman av, Phone 3798 (See page 64) Hardeman Beauregard (Hattie) lab h Adams Mill (B) Hardeman Building 105 Cotton av Hardeman Columbus (Berta) driver hl08 Tindall Hardeman Daisy (wid Wm G) rll4 Clayton Hardeman Edith rl06 Clisby Hardeman Ellen (wid Robt V) rl03 Courtland av Hardeman Frank S jr teller Luther Williams Bank & Trust Co rl06 Hill Crest av MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Hardeman Geo W (Emma H) meter dept h862 Orange HARDEMAN GILES G (Gazelene), Pres G G Harde- man Co, h305 Bond, Phone 2170-J HARDEMAN GORDON I (Pauline J; Hardeman & Williams), Sec-Treas Southwestern R R Co, h 106 Clisby, Phone 3599-W HARDEMAN G G CO, G G Hardeman Pres, I L Domingos Sec-Treas, Real Estate, Fire Insurance, Loans and Rental Collections 563 Mulberry, Phones 1963-1964 (See page 81) Hardeman John W (Irene) slsmn h331 Calhoun Hardeman Jos D (Pauline) blrmkr r458 Carling av (HH) Hardeman Louise r340 Hardeman av Hardeman Lucia G (wid Isaac) h340 Hardeman av Hardeman Marshall (Ollie) lab h329 Frank al Hardeman Martha student rl06 Clisby Hardeman Pauline refinshr Metro Studio rl06 Clisby Pi Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Ansars All Questions as to WHOM You Are Looking For and WHERt They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company Tharp's Pharmacy CABINET MANTELS, TILE, GRATES, ETC. a> Willingham Sash & Door Co. 1--4 CU -b CNJ CO DU ^DU fl* o PcM ? T3 ^cvj H ^ CD Office, 457 Third St. Telephones 278 & 3976 428 (1925) R. L. POLK & CO.'S Hardeman Wilber A (Ida) carp h664 Elm Hardeman Wm G elk G G Hardeman Co rll4 Clayton HARDEMAN & WILLIAMS (G I Hardeman, F W Williams), General Insurance, Automobile, Casualty, Fire, Liability and Life Insurance 808-809 Georgia Casualty Bldg, Phone 1381 (See page 71) Harden Ada r512 Walnut Harden Clara r305 Campbell av Harden Etta lab r634 Hammond Harden Eug (Corinne) suit prsr h618 Washington av Harden Geo W (Addie) wtchmn Macon Gro Co h509 Main (EM) Harden Henry O (Amanda) car repr h718 Plum Harden John lab rl206 Broadway Harden John H (Maude) train dispr C of Ga h513 (705) Ridge av Harden Margt maid r435 Forest av Harden Mary sten Coml Credit Co r678 Courtland av Harden Monroe T student r912 Orange Harden Narcissi F (wid Henry S) r208 Spring Harden Sami (Sally M) lab h355 (12) 7th Harden Timothy (Mary E) dentist 511 Bibb bldg h208 Buford pi (V) Harden Wm H (Ida) rll71 Oglethorpe Harden W Thos (Carrie T) poultry 409 Cotton av h912 Orange Hardin Alene lawyer 301 Ga Casualty bldg r Hotel Lanier Hardin Cecil hlpr Kidd & Taylor r626 (618) Mont- pelier av Hardin Ella cook r642 Hicks al Hardin Ernest H (Frances) cashr circ dept Macon News r452 Spring Hardin Francis DeB Mrs sten Steven M Solomon jr r452 Spring Hardin Geo (Ella) plstr h642 Hicks al Hardin Nannie E elk Fourth Natl Bank r483 Orange Hardin Nelson (Lillie) Imbr chkr hl05 (141) Richard Hardin Sarah cook r642 Hicks al Hardin Wm H (Iola) asst mgr hl05 Feb av Hardin W Reeves (Clara S) bgemstr h483 Orange Harding Carrie L cook r517 E 1st (EM) Harding Rebecca maid h517 E 1st (EM) Harding Sarah lndrs r517 E 1st (EM) | FOR LISTS OF NAMES ! ANY TRADE -- ANY BUSINESS -- ANY PROFESSION I DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 429 Hardis Preacher (Minnie) lab h666 Long Hardison Adolphus R (Louise) rl03 North av (NH) Hardison Chas H (Kate) filling sta 3019 Houston av hl02 North av Hardison Geo O slsmn A S Hatcher Co rl89 Magnolia Hardison Henry C elk Highland Pharmacy rl03 North Hardison Homer (Ellen) narcotic agt hl03 North av Hardison Jessie (Rosa) lab h75 Craft la Hardison Lottie maid h3 Barfield al Hardison Louise' student rl03 North av Hardon Andrew brkmn r420 Hawthorne Hardrick Essie cook h714 Hazel Hardrick Monroe (Ola) hlpr rl207 1st Hardrick Thos r755 Ash Hardwell Emerline lndrs h648 Rock Hill la Hardwell Oliver B soldier r648 Rock Hill la Hardwell Wm lab r648 Rock Hill la Hardwick Arth lab rl6 Bay Hardwick Benj car repr r730 Nussbaum Hardwick Carrie dom rl05 Massee la Hardwick Clara cook h254 Railroad av Hardwick Emma Lee lndrs rl05 Massee la Hardwick Hattie lndrs hl59 Thomas Hardwick Kelly (Callie) inspr h6l9 1st Hardwick Lena lndrs rl59 Thomas Hardwick Lum (Louise) hlpr h75 New Hardwick Marshall (Nola) lab hl05 Massee la Hardwick Mary midwife h407 E 1st Hardwick Otis (Mozella) waiter h520 E 2d Hardwick Sophie (wid Orange) h755 Ash Hardwick Wm (Luella) car repr h730 Nussbaum Hardwick Wm (Mary) lab h605 Gilmer Hardy Alf D bkpr Armour & Co r Y M C A Hardy Alvah T elk C of G R R Co r410 Hanson Hardy Augustus B (Eleanor) inspr h209 Calhoun Hardy Chalmers (Annie) firemn h532 Campbell av Hardy Clarence F (Jessie) slsmn Burden Smith & Co h754 Broad Hardy Dotsie rl08 Pierce (EM) Hardy Emmett lab rlOl Bay Hardy Estelle J Mrs bdg 518 Pine h do Hardy Eug H sten Bibb Grocery Co r754 Broad Hardy Geo lab T & T Sausage Co res Skipperton Ga Hardy Gilbert (Liza) lab rll2 Edgewood av Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 430 (1925) R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Hardy Herbert (Dorothy) elk r2480 Broadway Hardy Ida maid r21 Tinsley la Hardy J Basil elk C of G R R Co r410 Hanson Hardy Lucile r410 Hanson Hardy McKinley janitor Macon News res R F D 1 Hardy Morning Indrs r92 Bay Hardy Robt C (Annie) collr J R McElrod r Lanier pl Hardy Roland (Ida) agt Am Ry Exp r2 Nevaro flats Hardy Sarah A (wid J T) h410 Hanson Hardy Wm C boxmkr hl08 Pierce (EM) Hardy W H cattle buyer T & T Sausage Co res R F D 3 Hargrove Anna M pub sten Dempsey Hotel r821 Cherry Hargrove Clara N student rl80 English av Hargrove Ebb W mech Ellis Motor Co r267 IVash- ington av Hargrove' Evelyn rl80 English av Hargrove Senie (Josie) porter Dannenberg Co h211 Orange Hargrove Wm lab hl63 Elm Hargrove Wm (Leola) porter h.266 Madison Hargrove Wm M (Clara) asst mgr Met Life Ins Co h 180 English av Harkless Robt (Idell) driver Yates & Tabor Co 107 Pringle Harkless Rosanna Indrs hl07 Pringle Harley Benj (Ada) lab h269 Madison Harling Benj L bkpr Armour & Co r251 New Hardy Jas A sten Armour & Co Harmon Geo F student r219 High Harmon Jas (Mary) lab h794 Center Harmon Jas A Rev (Mamie) h219 High Harmon Mamie student r219 High. Harmon Susie Indrs r3 Coleman al Harmony Baptist Church 330 2d av (V) Harmount Edwin H (Ida) coach pntr hll4 Crisp Harmount Ida Mrs chmn of. jail work Welfare Board hll4 Crisp Harp Leslie H appr Macon News r39 Pio Nono av Harp Louise (wid Dewitt) cook h224 Main (EM) Harp Wm E (Lou) eng h39 Pio Nono av Harper Albert lab r770 Park Hotel al Harper Andrew (Hattie) lab r327 Monroe 536 S. Clark St. Chicago, III. E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED j DEALERS Lincoln CARS-TROCKS -TRAC_TFO_o_Rr_dSSOIVhlffoarvPietH'asOitN.aFEoFro1d5r,9d1woer JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 431 Harper A Dewey (Mary) mach h3205 Houston av Harper Clarence (Fannie) lab h.753 Broadway Harper Cornelius B (Lena) hlpr h902 Orange Harper Edwin mach rl62 High Harper Ernest C (Lucile M) police h715 Pine Harper Eula M millwkr r229 Nussbaum Harper Frances (wid F M) smstrs Union Dry Gds Co r905 2d Harper Frank (Ezelle) mach h902 Orange Harper Hansel L (Rachel) mech rl46 Winship Harper Henry (Mollie) lab h405 Norris Harper Irene slsldy Dannenberg Co rll9 Cedar (SM) The most comprehensive reference work Harper John (Lucy) lab hl44 Carling av (HH) on the Harper John T (Hattie) blksmith hl537 1st banks of Harper Jos A (Callie) dir h622 Forsyth Harper Jos B (Annie Mae) linemn h437 American blvd Harper Leila Mrs smstrs rl28 Grady Harper Lena r902 Orange Harper Lizzie r467 Monroe the world Contains Condensed Statements Harper Louise slsldy Burden Smith & Co r902 Orange Harper Lucile (wid Jas) h261 Willingham Harper Mamie (wid John V) hl62 High Harper Max W linemn r437 American blvd Harper Nora (wid Jos S) r3205 Houston av Harper Payton (Mary) carp h Lawton rd Harper Sami lab r327 Monroe Harper Silas L (Mollie) collarmkr Otto-Isaacs Har- ness Co hl46 DeBorde (SM) Harper Thos (Lillian) hl634 1st Harper Tobe (Jennie) mech h Robinson rd Harper Tony lab hi 5 Railroad av of All Banks, Lists of Officers of All Banks, Digest of | State Banking Laws and Much Other Data related to Banking Harper Victoria rl5 Railroad av Price $20 Harper Wm (Minerva) firemn hl02 Pringle Harper Wm H (Rosa L) aud U S Int Rev r436 Wash- Published ington av semi- Harper Wm H (Bannie) carp h933 Woolfolk annually Harper Wm T msngr rll9 Cedar (SM) Harper Wm W (Mary) eng hll9 Cedar (SM) Harper Willie r237 Chestnut MARCH anfl SEPTEMBER Harper W T r560 Plum t4 _ by Harps Lewis (Hattie) emp Dunlap Huckabee Auto Co h608 May av R. L POLK Harrel Savanah lndrs r4 (650) Tatnall la Harrell Daisy smstrs rll5 Habersham av &C0. More goods are bought and sold through the Polk Directory Bldg. Detroit, Mich. Classified Business Lists of the Directory than any other medium on earth. <1 :ui |S|j |S KAIGLER S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 432 (1925) R. L. POLK & CO.'S Harrell Dora (wid Prank G) hll5 Habersham av Harrell Eason H (Mamie) mach h456 Duncan av Harrell Edw (Miranda) plstr h60 Davis la Harrell Emory S (Dora B) mgr L W Rogers Co rll5 Habersham av Harrell Essie r232 Cedar (SM) Harrell Everett L (Sallie M) cond hl51 1st Harrell Frankie slsldy S H Kress & Co rll5 Haber- sham av Harrell Glover student r815 Poplar Harrell Jack cloth ctr r232 Cedar (SM) Harrell Jas student rll60 Elm Harrell Jas C (Masine) car inspr h232 Cedar (SM) Harrell Jas W (Ruby) h815 Poplar Harrell John r456 Duncan av Harrell Juanita r Jas C Green Harrell J Henry (Elethia) carp hl04 Whitehead Harrell Luther A Rev (Mary) pastor Cherokee Hts Meth Ch h500 Hillyer av Harrell Mary (wid Jim) r456 Duncan av Harrell Melvin (Charlotte) lab hl4 Alabama Harrell Minnie (wid John L) r Jas C Green Harrell Rennie elk Max Lazarus r815 Poplar Harrell Sandy B (Zella) phys 605% Cherry h908 Walnut Harrell Thelma mgr N Y Waist House r238 Harde- man av Harrell Thos H (Eunice) cook h236 Powell (EM) Harrell Wilbur electn Morris Putzel rll5 Habersham Harrell W Lamar teller Fourth Natl Bank r815 Poplar Harrellson Dollie dept mgr J P Allen & Co r7 Nevaro apts Harrelson Pantha V tchr Wesleyan College r520 Col- lege Harrington see also Herrington Harrington Francis Y phys 614 Grand bldg r811 Wal- nut Harrington Ernest carp r963 Oglethorpe Harrington John (Sarah) carp h963 Oglethorpe Harrington J W jr mech rll4 Steele Harrington Mary A r34 S College Harrington Mary A cashr rll4 Steele Harrington Mattie L smstrs rl25 Steele Harrington Robt F (Lillie) mech h316 Chappell Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeecatdsqufaorrtCeartsalfoogr: aclolnktianindss omfuAchutovmaloubaibleleLdisattsa.. OAusrknfeowr copy. R. L. POLK & CO., DETROIT, MICH. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 433 Harrington Walter E mech rl25 Steele Harrington Walter J (Nannie) carp hll4 Steele Harrington Wm M car wrecker h34 S College Harrington Wm T (Lora) pipeftr hl25 Steele Harrington Wm T jr msngr rl25 Steele Harris Ada M (wid J W) elk Gabbert's Candy Land r716 Pine Harris Albert auto lndry 210 3d rl44 Forsyth la Harris Alberta dom r356 Bay Harris Alberta student rl33 4th av (V) Harris Alex (Gertrude) brkmn h453 Bay Harris Amy student r John A Harris Harris Andrew L (Annie E) meats 666 Poplar h322 New Harris Andrew M (Hattie) drugs 1301 Broadway r818 3d Harris Anna lndrs h311 Ash Harris Anna M sten rllO Latta pi Harris Annie' (wid Geo L) hllO Latta pi Harris Annie maid r419 Elbert Harris Annie B lndrs r412 Ward Harris Arneita maid r335 Madison Harris Bessie smstrs r436 Tindall av Harris Chas r Evergreen la Harris Chas (Ella) lab hl221 3d Harris Chas hlpr Taylor Iron Wks & Supply Co Harris Chas lab h205 Orange Harris Chas O (Lucile) carp h223 Patterson Harris Chester (Ethel) lab r5 Spring Harris Claire rll3 Culver Harris Clara lndrs r6 Jordan Harris Claude hlpr Taylor Iron Wks & Supply Co Harris C Spurgeon dept mgr Jones Motor Co r560 Plum Harris Danl (Mammie) lab h308 4th av (V) Harris Danl (Essie) lab r451 Johnson's al Harris Danl D teller Citizens & Sou Bank res RFD2 Pio Nono rd Harris David C sis agt Dayton Scale Co rl321 Ogle- thorpe Harris David C jr agt rl321 Oglethorpe Harris Demus h607 4th av Harris Earle D nurse r500 Singletons la Harris Edw H Rev (Malinda) h412 Ward (V) FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 434 (1925) R. L. POLK & CO.'S THE DIREGTUHY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year RUkifo PUBLISHERS Harris Eldridge (Lillie) lab r318 Patterson Harris Eliz rl386 2d Harris Ellen r501 Martha (EM) Harris Elliott (Lula L) h62 Arlington pi Harris Emma cook hi Moore al Harris Ernest C (Sallie) phys 507 Bibb bldg h2646 Houston av Harris Esther student r John A Harris Harris Eug (Margt) slsmn r811 Napier av Harris Eula M lndrs r735 Hall Harris Eulie E car repr rl57 Williams Harris Eunice lab h309 Hanson Harris Eva (wid Jacob) h720 2d Harris Falbia lndrs h8611/2 Broadway Harris Fannie (wid John) rl67 Elizabeth Harris Fannie maid h200 (164) Green Harris Frank (Cleo) mattressmkr Acme' Mattress Co h531 E 1st Harris Frank (Lee) mill hd h234 Roff Home av Harris Frank (Rosa) truck driver r385 Madison Harris Geo (Clara) mill hd hl037 1st Harris Geo (Lula) soft drinks 213 5th h253 Broad (EM) Harris Geo (Minnie) truck farmer h313 Hanson Harris Georgia cook h261 Chestnut Harris Grady (Emilee) lawyer r37 Arlington pi Harris Greely (Loudella) lab h301 Edgewood av Harris Gussie lndrs h3 Buckner al Harris Guy (Vina) lab h Barracks al Harris Hal rll3 Culver Harris Hampton candymkr Empire Candy Co r200 (164) Green HARRIS, HARRIS & POPPER (N E, W A and J B Harris, J W Popper), Attorneys-at-Law 914-917 Ga Casualty Bldg, Phones 4861-4862 Harris Harry L (wid Eleck) h531 Grand Chapel al Harris Harvey A mach r664 Plum Harris Hattie Mrs r818 3d Harris Hattie L bkpr Central City Undertaking Co rl33 4th av (V) Harris Hattie L lndrs r321 McLean al Harris Henry (Rosalind) bkpr Morris Harris r254 New Harris Henry lab h7 Cheatham al 'PoIkJ)irec!omW DETROIT , FOR LISTS OF NAMES ANY TRADE ^ ANY BUSINESS -- ANY PROFESSION DETROIT R. L. PGTJv & CO. CHICAGO Southern Business College E. L. RAY, President DAY AND NIGHT OUK MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 435 Harris Henry (Fannie) lab h206 (211) Ferguson Harris Henry B (Eula) printer rl05 Carlisle av Log Cabin Hts Harris Henry T (Florence) res mgr Macon Credit Bureau h869y2 Mulberry Harris Hezekiah H (Jonnie) carp r304 Reid Harris Hilton H shoe repr 572 Mulberry r John A Harris Harris Hollis St C (Mary) mach opr r603 Plum Harris Homer (Amanda) carp r213 Henrietta Harris Homer H (Addie) h420 Forest av (V) Harris Houston (Viola) lab h224 Dannenberg av Harris Howard (Bessie) lab rl5 Alabama Harris H Earl (Eula; Lyon, Harris & Brooks) res R F D 2 Harris Ida lndrs r301 Ward (V) Harris Isaac (Lucile) lab rl223 (123) Woolfolk Harris Jas (Sarah) hl7 Bay Harris Jas hlpr h449 Orchard av Harris Jas lab T L Wood Harris Jas B agt Atlanta Life Ins Co rl08 Spring Harris Jas O (Mary E) hl223 Oglethorpe Harris Jennie cook h304 (606) Colquett Harris Jennie lndrs h216A Lynwood av Harris Jennie lndrs h364 Flanders (EM) Harris Jesse C lawyer 211-13 Citizens & Sou Bank bldg r720 2d Harris John janitor li rear 904 Cherry Harris John (Louise) lab r676 Tinsley la Harris John A (Stella) mgr Ga Industrial Home for White Orphan Boys and Girls h Industrial Home rd Harris John B (Louise; Harris, Harris & Popper) hll8 Oak Haven av Harris John B (Polly) section lid r Shuman Harris Harris John L hlpr r321 McLean al Harris John L (Gladys) knitter h Bailey av (CH) Harris John W (Blue) lab r525 Waterville rd Harris Johnson lab h422 Plummers al Harris Jos (Adeline) lab h772 Park Hotel al Harris Jos (Mary) lab hl88 Turpin la Harris Jos P (Ellen) lab h381 Melrose (EM) Harris Judge B porter American Optical Co r718 3d av (V) Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog' contains much valuable data. Ask for a copy Ri L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OF THE UNITED STATES AMD CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 436 (1925) R. L. POLK & CO.'S Harris Julia lndrs h25 Clara (EM) Harris Julia lndrs h424 Lawton av Harris Julian T bkpr Herbert Smart Clo Co r Y M C A Harris J R hlpr P B Yates Mach Co Harris J Thos (Corine) rlOO Harrold Harris Leonard del boy r304 (606) Colquitt Harris Lewis (Julia) lab r454 Pine Harris Lonnie O (Irene) car repr r704 Anderson Harris Lucile lndrs r718 3d av V Harris Lucy cook V H Roberts rl6 Willingham qtrs Harris Mabel elk Sou Bell Tel Co r611-15 2d Harris Mabel H prin Alexander School No 2 rl321 Oglethorpe Harris Maggie maid r266 Madison Harris Mamie cook rl66 Cedar Harris Mamie lndrs r470 Bay Harris Mamie' lndrs rl200 3d Harris Mandy lndrs r255 (155) Center Harris Marvin P (Carrie) eng h616 2d Harris Mary A (wid E B) h811 Napier av Harris Mattie cook T J Crowley rl6 Parkers av Harris Mattie maid r424 Lawton av Harris Miles (Evie) chauf rll5 Fairview Harris Minnie lndrs h526 2d (EM) Harris Minnie L rl674 3d Harris Minnie M cook r313 Elbert Harris Mollie (wid Moses) r353 Campbell av HARRIS MORRIS (Lola), Insurance and Surety Bonds 210-212 Bibb Bldg, Phone 131, h254 New, Phone 168 (See left top lines) Harris Moses S slsmn r720 2d Harris M E driver Yellow Cab Co Harris Nancy lndrs hll Gas House al Harris Nancy lndrs rl221 3d Harris Nat E (Hattie; Harris, Harris & Popper) 914- 17 Ga Casualty bldg Harris Neal (Mary) farmer hl050 Fort Hill Harris Norman (Bertha) porter h202 Elliott (EM) Harris Normond carp rl09 Bowman Harris Oscar (Mabel L) r715 Ash Harris Oscar (Oneeda) pntr hl83 Grants Harris Oscar L (Juanita) county police h3805 Hous- ton av Harris Paul (Georgia) lab r5 Spring FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 437 Harris Peter (Lizzie) cook hlOO Virgins la Harris Peter lab r26 Malloys al Harris Pless lab Willingham Sash & Door Co r524 Forsyth Harris Queen r203 (303) Mutual av Harris Richd lab r229 Jones Harris Robt lab r261 Chestnut Harris Robt A r Y M C A Harris Robt L (Mildred) ship elk r471 Orange Harris Rosa h787 Nussbaum Harris Rosa B dom r735 Hall Harris Ruby B sten F X Daly Co r215 New Harris Rufus hlpr r449 Orchard av Harris Rufus C (Louise W) tchr Mercer Univ hl06 Oak av (I) Harris Ruth elk Mose Miles h rear 519 1st Harris Ruth lndrs r Barracks al Harris Sallie cook h216 Elliott (EM) Harris Sarah (wid Max) r852 Cherry YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Harris Sherman section hd r Shuman Harris Harris Shuman section hd h Railroad Harris Sidney lab hlO Cheatham al Harris Solon (Marie) lab h500 Singleton la Harris Stevie B cook 454 Pine Harris Theophilus I (Winnie; T I Harris & Co) hl20 Boulevard (NH) Harris Theophilus J jr student rl20 Boulevard (NH) HARRIS T I & CO (T I Harris), Loans 517^ 3d, Phone 3500 Harris Ulysses G (Ethel) h529 Flanders (EM) Harris Vie (wid Jas W) hll3 Culver Harris Viney lndrs h235 Watson al Harris Vinie maid rlOO Virgins la Harris Walter (Mandy) carp h524 Maynard Harris Walter (Bessie) lab h421 O'Hara la Harris Walter (Viola) truck driver rl58 (228) Green Harris Walter A (Emily W; Harris, Harris & Popper) h560 College A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 438 (1925) K. L. POLK & CO.'iS Harris Wm (Lizzie) h234 Bartlett Harris Wm (Mittie) blksmith h313 Elbert Harris Wm (Maud) lab hl67 Elizabeth Harris Wm (Ethel) lab rl27 Park Hotel al Harris Wm (Mamie) mach hl50 E Academy (EM) Harris Wm waiter r381 Melrose (EM) Harris Wm B (Ella) car repr hl55 Williams Harris Wm C (Viola) auto mech h Bailey av (CH) Harris Wm H formn Taylor Iron Wks & Supply Co hl674 3d Harris Wm M (Miltilda) farmer h807 Main (EM) Harris Wm W (Laura J) hl336 2d Harris Wilmer A (Ida) car repr hl57 Williams Harris W F lino opr Macon News Harris Zeb (Delia) lab h54 Spring HARRISON ALFRED M (Dayde), Sec Yates Motor Co, hl42 Beverly pi Harrison Calvin M (Florence) hl37 Laurel av (NH) Harrison Clifton r302 Jones av Harrison Clifton elk r567 1st Harrison Danl J buyer rl42 Beverly pi Harrison Dayde M slsldy Reliable Outfitters rl42 Beverly pi Harrison Emily cashr Union Dry Gds Co r308 Amer- ican blvd Harrison Ethel cashr Union Dry Gds Co r J K Harri, son Harrison Eug elk Jarrett Paint & Glass Co rl928 2d Harrison Felton B attdt Gulf Refg Co r554 1st Harrison Florie bkpr Dr C A Yarbrough r308 Amer- ican blvd Harrison Geneva (wid Amzi) r302 Jones av Harrison Geo T mach Oetter Elec Co rl61 3d Harrison Horace K sawyer r J K Harrison Harrison Jas r302 Jones av Harrison Jas E (Rhea) slsmn h403 Montpelier av Harrison Jeff W (Evie) log inspr hll9 American blvd Harrison John B (Helen) opr rl05 Pierce av (V) Harrison John B (Dovie) solr Macon Telegraph h308 American blvd Harrison John B jr msngr r308 American blvd Harrison John E (Theresa) supt shops hl47 Park pi Harrison John G (Alice) flagmn h37 Pio Nono av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 439 Harrison John G (Ruth) tchr Mercer Univ h421 Adams Harrison Jos D (M Annie) edgemn Fowler Lmbr Co r332 American blvd Harrison Jos W r317 American blvd Harrison J Edw (Winona) flagmn r658 Pine Harrison Lena sten Bankers Health & Lite Ins Co r308 American blvd Harrison Lorene cashr Union Dry Gds Co rll9 American blvd Harrison L M traffic officer Police Dept rl25 Rose Pk Harrison Marie cook rl21 2d av (V) Harrison Mary A (wid Robt T) r403 Montpelier av Harrison Mattie (wid Thos) mill hd r835 Main (EM) HARRISON MUTUAL BURIAL ASSOCIATION, L H Burghard Mgr, 718 Cherry, Phone 6 (See page 66) Harrison Orie K slsmn Gulf Refg Co r554 1st Harrison Rosa Indrs h431 Alabama Harrison Ruby sten r210 Buford pi (V) Harrison Sarah E (wid Eug) elk J B Riley Drug Co rl928 2d Harrison Thos (Addie) hlpr hl03 Empire av Harrison Walter L del mn rl03 Empire av Harrison Wm H dept formn r713 Cherry Harrison Wm T linemn h835 Main (EM) Harrold Anna rll2 Courtland av HARROLD BROS CO (E B and W E Harrold), Gen- eral Insurance 321-22-28-24 Macon Natl Bank Bldg, Phone 654 Harrold Chas C (Helen S) surg Middle Georgia Sanatorium h550 Orange Harrold Danl B (Delia) mgr Rogers L W Co hl25 Academy Harrold Edw B (Louise C; Harrold Bros Co) h290 Hill Crest av Harrold Eliz rll2 Courtland av Harrold Helen S Mrs aldermn h550 Orange Harrold Wm E (Harrold Bros Co) hll2 Courtland av Harroll Demorris cook r302 (262) Crisp Harroll Wesley (Mattie) lab h301 Norris Harry David W (Ethel) printer Lyon Harris & Brooks h214 Log Cabin dr The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 440 (1925) R. L. POLK & CO.'S Harry The Tailor (H F Northington, W L Richardson jr) 403 Cherry Harry's Caffe Harry Cally prop 315 Cherry Harshbarger Clarence H (Allie) h520 Orange Hart Arth J (Pearl) h.859 Edgewood av Hart Dock (Lillie) carp L303 Tindall av Hart Edw (Emma) lab h240 (217) Garden Hart Chas E bacon slicer Armour & Co r230 Tatnall Hart Eliz r407 Duncan av Hart Ella (wid John W) h407 Duncan av Hart Emma r9 Alabama Hart E Jackson (Mabel) plmbr h451 Clinton Hart Frances M student r735 College Hart Ike (Mittie) carp hll8 Tindall av Hart Jas (Marigold) porter hl6 Woodliff HART JESSE B (Nena; J B Hart & Bro), Pres Macon Savings Bank and Ga Public Service Corp, YPres J S Schofield's Sons Co Inc, hl03 Yineville av, Phone 760 HART JESSE B JR (Hazel), Asst Cashr Macon Savings Bank, h4, 613 Orange, Phone 3023-J Hart John (Plassie) lab h332 Gilmer Hart J B & Bro (J B and J F Hart) undtks 559 Mul- berry Hart J Freeman (Elsie G; J B Hart & Bro) h378 Orange Hart J Freeman jr student r378 Orange Hart Lizzie lndrs r3 3d st.la Hart Lucy h509 Forsyth Hart Mariab tcbr r316 Corbin av Hart Mary cook r224 Green Hart Oliver J Rev (Mary M) rector Christ Episcopal Ch h355 Orange Hart Orange (Annie) h252 Prince Hart Oscar L lab r458 Hall HART, SCHAFFNER & MARX CLOTHES, Sold by C H Hnnnicutt Clothing Co 317-319 3d, Phones 276 and 943 Hart Walter N (Mamie) cashr h735 College Hart Wyolene E tchr r735 College Hartis Hazel L r2010 3d Hartis John (Mary) night wtchmn r211 Reid Hartis Sami B (Lila) mech W R Finch Motor Co h211 Reid Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, t>ry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 441 Hartis Wm H (Fannie M) wtchmn h2010 3d Hartis Willie L r2010 3d Hartley Guy H (Thelma) mgr Piggly Wiggly rl28 Ells (SM) , ,,,,Ar70. Hartley G Elmer (Vera) elk Piggly Wiggly rl707 2d Hartley H Pate (Dora) wtchmn hl707 2d Hartley Jas M (Ethel C) phys 314 Bibb blk hl04 Courtland av ^ H/w, TT Hartley Lenora slsldy Dannenherg Co rl06 Heard av Hartley Lewis R bkpr Morris & Co r Y M C A Hartley Loraine nurse r756 Mulberry Hartley Monroe (Lucille) elk rl432 2d Hartley Randolph H (Mattie) cotton buyer h202 Coleman av HARTLEY RICHARD E (Ruth), Pres Liberty Savings & Real Estate Corp, Sec-Treas Central City Undertaking Co, h612 Spring, Phone 1156-W Hartley Richd E jr elk Central City Undertaking Co r612 Spring Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Hartley Ruth nurse City Health Dept Hartley Vera Mrs sten Dunlap Hdw Co rl707 2d Hartnoll J F Mrs hemstitcher Lee's Dept Store Hartry Luke (Ida) hl52 (114) Roye Hartwell Thos (Lizzie) plstr h524 (518) 3d av (V) Hartwig Tillie dept mgr Union Dry Gds Co r400 Katherine ct apts . . Hartzog Anderson E (Zula) asst supt h401 Virginia Hartzog L Brooks mach opr Bibb Basket Co r401 Virginia av Hartzog Margarette sten r401 Virginia av Harvey Benj rl053 Oglethorpe Harvey Benj lab h203 (112) Toombs (SM) Harvey Chas (Mammie) lab h401 (8) Crisp Harvey Edw carp r350 Central av Harvey Edw H slsmn h534 (712) Vineville av Harvey Ella M rl053 Oglethorpe Harvey Geo (Ethel) meat ctr h341 Madison FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindt of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 442 (1925) R. L. POLK & CO.'S Harvey Geo R (Florence) clothes clnr 605 Linden av h725 Holt av Harvey Geo R (Lucile) cranemn r594 Duncan av Harvey Henry (Della) pressing club r503 Hazel Harvey Herschell (Mary) pharm rl04 Cleveland av Harvey Irene lndrs h360 Oak Harvey Jack L (Annie L) mgr Wofford Oil Co filling Sta h do Harvey John (Nancy) lab hl97 Division st la Harvey John H (Estelle) elk C of G R R Co h350 Central av Harvey Luther (Mary) lab r239 Tindall av Harvey Mary hl053 Oglethorpe Harvey Melissa millwkr r470 May av Harvey Orin C barber Terminal Sta Barber Shop r418 Mulberry Harvey Polly sten r350 Central av Harvey Sarah cook r341 Madison Harvey Wm prsr King Hill "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuoYarTup.nHrrgdouYdFvmeooe. nlcrsaTatsisathstiarioticlesne.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAlePtbrRrhYulyEegsOeigpgdRUiinsAnNatok'Llns-., Harvey Wm J (Leila) pntr hl635 Broadway Harvey Willie' porter W R & W B Holmes r341 Madi- son Harvey W L Mrs asst matron Masonic Home Harvell Frank (Mamie) lab r432 Coles al Harvill Geo G contr h2222 2d Harvill Mary (wid H E) r!20 Broadway Harvill Melissa A r2222 2d Harvill Virgil G msngr r2222 2d Harvin Jas E (Sallie) mach str hl25 American blvd Harwell Clara sten County Tax Collr rl31 Clisby Harwell Clara M (wid John R) hl31 Clisby Harwell John R slsmn rl31 Clisby Harwell J Wilber (Rosebud) pres Sandefur-Harwell Clothing Co r271 Orange Haskin David slsmn Southern Dry Gds Co r556 Arch Haskin Jos (Southern Dry Gds Co) h229 Adams Haskins Frank D tchr Mercer Univ r Dry Branch R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR BLDG. PHONE Will Remove the CAUSE of Your Disease 4557 MACON CITY DIRECTORY (1925) 443 Haskins Louise Mrs instr Sou Bell Tel Co r451 Duncan av Haskins L M ship elk Am Bakeries Co Haskins Thos (Louise) auto mech r451 Duncan av Haslam Cath dom r484 (84) Bowman Haslam Sami (Viola) lab h535 Calhoun Haslam Wm (Mamie) lab h484 (84) Bowman Haslit Wm (Josie) lab h465 O'Hara la Haster Robt L (Susie) del boy r625 4th av (U) Hasty LeRoy mgr L W Rogers Co r611 2d HATCHER ALBERT S (Susie M), Pres A S Hatcher Co, h422 Forsyth, Phone 3423-J Hatcher Albert S jr slsmn A S Hatcher Co r422 Forsyth Hatcher Anna (wid Robt L) r Mrs Naomi Ehrlicher Hatcher Annie lndrs h259 Cowan Hatcher Arth E (Clara) slsmn hl25 Colquitt Hatcher Arth M call hoy r!25 Colquitt Chero'Cola MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIINSS HATCHER A S CO, A S Hatcher Pres, F S Hull Sec- Treas, Vehicles, Harness, Bicycles and Distributors Stewart Motor Trucks 598 3d, Phones 106107-307 (See front cover) Hatcher Chas C (Geraldine) drugs 1932 2d hl31 Culver Hatcher Emmett A slsmn Wright Auto Supply Co rl25 Colquitt Hatcher F Edgar (Inez) asst formn rl223 2d HATCHER GEORGE E (Kathleen), Pres HatclierTurpin Co, res Rivoli, Phone 3256-J Hatcher Grace R (wid E W) depy elk Superior Court r Log Cabin Hts HATCHER HARDWARE CO, A S Hatcher Pres, R W Hatcher (Milledgeville, Ga) V-Pres, 596 3d, Phone 5157 Hatcher John (Mary) lab hl09 Tindall av Hatcher Leonard lab rl94 Tindall av Hatcher Marion C (Mary) h Melrose se cor Fairmont Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MAECH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. r Detroit, Mich. 444 (1925) R. L. POLK & CO.'S Hatcher Mattie E (wid Robt A) r862 New Hatcher M Felton (Margt P; Hatcher & Smith) h319 Hardeman av Hatcher Robt P (Julia) bkpr Willingham Sash & Door Co h Log Cabin blvd Hatcher Ross L (Maude) slsmn Wofford Oil Co res R F D 1 HATCHER SIDNEY W (Olive), Attorney-at-Law 34-35 Fourth National Bank Bldg, Phone 1179, hl05 Buford pi, Phone 4323-J HATCHER-TURPIN CO, G E Hatcher Pres, W H Turpin Y-Pres, F 0 Schofield Sec-Treas, Beal Estate, Loans and Insurance, Bent Collections a Specialty 523 Mulberry, Phone 77 (See page 82) Hatcher T Ayer collr Hatcher-Turpin Co res Rivoli Hatcher Wm H (Minnie) farmer rll27 Milledgeville rd Hatcher Zollie C '(Maurine) pntr r350 Clinton (EM) HATCHER & SMITH (M F Hatcher, L G Smith), Attorneys-at-Law 20 Fourth Natl Bank Bldg, Phone 811 Hatchett Mattie L dom rl008 College Haten Irene' cook h304 Ward Hatfield Andrew G (Pearl) trav r910 Clinton rd Hatfield Annie Mrs tchr r865 Orange Hatfield Chas W (Appie) carp h61 (326) Dannenberg av Hatfield Etta nurse Macon Hosp Hatfield Geo jr (Willie) barber 313 Broadway r501 Lexington av Hatfield John slsmn rl57 Broadway Hatfield Lemond H mech r308 Cutter's Green Hatfield Lewis (Lula) lab r72 Chappell al Hatfield Lola sec-treas Schofield-Burkett Constr Co rl34 Summit av (NH) Hatfield Luther R gro 248 Main (EM) r308 Cutters Green Hatfield Nadine student r910 Clinton rd Hatfield Mellie (wid T) h219 Reid Hatfield Paul R formn rl08 Newberg Hatfield Rail Joint Mfg Co W T Johnson pres DeWitt McCrary treas 919 Ga Casualty bldg Hatfield Sami purch agt rl2 Nevaro flats KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vt% on Savings MACON CITY DIRECTORY (1925) 445 Hatfield Sami E (Vera) agt Natl Life' & Accident Ins Co h525 Edgewood av Hatfield T Melvin (Annie) billiards 619 Broadway hl35 Middle Hatfield Ulay R (Izora) slsmn h308 Cutters Green Hatfield Wm (Clyde) farmer b750 Hall Hathaway Lula (wid Ellis R) r860 Orange' Hatton Clarence (Mattie) lab h9 Parker av Hatton Wm W (Hulda) hl03 Grady HATTRICH FRED H (Nellie), Auditor Hotel Lanier, hll7 Buckingham pi, Phone 4213 Haven Villa Corp Thos W Troy dist mgr 705-6 Ga Casualty bldg Haverfield Carrie (wid Hal) h.750 Pine Haverfield John E (Friddie M; Haverfield, Smith & Wood) h433 Carling av (HH) Haverfield Paul student r750 Pine Haverfield Smith & Wood (J E Haverfield, W O Smith W A Wood) barbers 303 Cherry S SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES S PI CO p> M o W 5 Havis Laura maid h210 3d av (V) Hawes Hampton h872!/2 Hazel Hawes Jas (Cornelia) florist Idle' Hour Nurseries h 1020 Ocmulgee Hawes Roland R (Leonora B) dentist Colored Pythian Temple hl04 Spring Hawes Wm (Winnie L) carp h242 Church HAWKE S A BARiSUM, Asst Cashr Merchants & Mechanics Savings Bank, r458 Spring HAWKES THERON W (Rubie L), Cashr Merchants & Mechanics Savings Bank, h209 Oak Haven av Hawkins Albert bkpr r869 Elm Hawkins Aldene K h623 Forsyth Hawkins Benion M r419 New Hawkins Chas bldr W F Elder Lmbr Co Lexington av (EM) Hawkins Chas (Josephine) lab h522 (222) Cowan Hawkins David lab r214 (172) Green More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 446 (1925) R. L. POLK & CO.'S Hawkins Eddie brklyr r300 Hawkins av Hawkins Edw millwkr hlO Bellevue rd Hawkins Geraldine r300 Hawkins av Hawkins Gladys nurse r455 Chestnut Hawkins Hattie lndrs rear 426 Main (EM) Hawkins Henrietta (wid Anderson) h462 May av Hawkins Herbert lab r214 (172) Green Hawkins Jas (Christina) carp h455 Chestnut Hawkins John T lab r475 Chestnut Hawkins John W (Isabel) mgr Interstate' Life & Acc Ins Co hl90 Magnolia Hawkins J D trainmn Macon Ry & Light Co hl23^ Cotton av Hawkins Miles (Carrie) carp h300 Hawkins av Hawkins Myrtis nurse 702 Mulberry Hawkins Noble (Emma) h214 (172) Green Hawkins Ola (wid Claude) gro 869 Elm h do Hawkins Oran (Annie) carrier P 0 r300 Hawkins av Hawkins Pearl elk rl44 Piedmont av Hawkins Peter J (Viola) lab h475 Chestnut Hawkins Ralph O mgr Gulf Refg Co Hawkins Ralph W (Mary E) dist mgr Life Ins Co of Va hl25 Pierce av (V) Hawkins Ranee lab h Barracks al Hawkins Ray L r616 Oglethorpe Hawkins Robt lab r214 (172) Green Hawkins Robt carrier P O res R F D 2 Hawkins Sally (wid Etheridge C) r710 Broad Hawkins Thos J (Parrain) carp h390 Clinton (EM) Hawkins Walter (Hazel) slsmn T & T Sausage Co r620 Oak Hawkins Walter H (Mattie) gro h419 New Hawkins Walter T sten r419 New Hawkins Wiley (Janie) driver Gulf Refg Co h200 Coles al Hawkins Wm M brklyr h329 Straight Hawkins Wm M (Minnie) driver Police Dept h450 Vine Hawkins Wm W (Maybelle) barber J R Jordan h.204 Newberg HAWKINS WILLIS A (Carrie; Macon Cliero-Cola Bottling Co), hi N Arlington pi, Phone 4759-J Hawthorn Jas L blksmith rlOO Applewood Hawthorn Susie cashr rlOO Applewood 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 447 Hawthorn Wm carp rlOO Applewood Hawthorne Alma smstrs r212 Hydrola Hawthorne Gladys opr r254 Hydrola Hawthorne Hubert (Fannie) shop eng hll6 Clisby Hawthorne Jas R (Ismal) pntr h202 Hydrola Hawthorne Narcissa (wid Jas) h254 Hydrola Hawton Greene (Annie) lab h212 W Boundary Hay Park L (Maude) pres Bankers Health & Life Ins Co hl84 North av,,(NH) Hay Vivian M student rl84 North av (NH) Hayden Ryley G night opr h208 Napier av Hayes see also Hays Hayes Dennis appr Taylor Iron Wks & Supply Co r Box 14 Columbus rd Hayes Jas (Ethel) lab r322 Glen Hayes Margt C genl sec YWCA r515 College Hayes Victoria nurse h217 1st av (V) Haygood Allen (Johnie) lab r608 (217) Crisp Haygood Choice S (Mattie) formn h764 Oglethorpe MACON OPTICAL COMPANY Yank H. Johnson . Opti-ici ans , ,-. O! pto, metrists SR f.HF.RRY jh.30 PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Haygood Lillie cook rl24 1st av (WH) Haygood Mary tchr rl357 Oglethorpe Haynes see also Haines and Hanes Haynes Arnold H (Clara B) pntr h327 Calhoun Haynes Ellis (Annie) lab h611 Smith (EM) Haynes Fannie rl521 Broadway Haynes Janette M cashr R S Thorpe & Sons r510 Hillyer av Haynes Milton r235 Bartlett Haynes Nanie rl04 (102) Randolph pi Haynes Nora sten r225 Applewood Haynes Obie (Rosa) lab h438 Chestnut Haynes Wm R (Florrie) trav rep Macon Telegraph h510 Hillyer av Haynes Wm R jr trav supvr r510 Hillyer av Haynes Wm T rl21 Holt av (NH) Hays see also Hayes Hays Anna lndrs r311 Norris Drink QszfsXa in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 8 w o U as WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 448 (1925) R. L. POLK & CO.'S Hays Arnold elk C of G R R Co Hays Carl H (Daisy) elk C of G R R Co h871 Cherry Hays Cecil C (Gertrude H) assoc C W Shelverton r 305 Church (EM) Hays Chas G appr Roller & Millirons r209 Newberg Hays Clarence (Eunice) lab hll35 Broad Hays Edw (Vera) lab h.239 Tindall av Hays Emma (wid Frank) rlOl Piedmont av Hays Geneva maid rl27 Railroad av Hays Lee (Annie) truck driver h636 4th av (U) Hays Murry (Martha) h524 Forsyth Hays Oscar W (Minnie) slsmn The Ross Co h256 Appleton Hays Wm C (Mamie) formn h209 Newberg Hayward see Heyward Hayward Josephine spinner r234 Jackson Haywood Lula (wid Cicero H) r406 Ross Hazel Eric F (Florentine B) mgr Barker Bakery h 147 Beverly pi Hazel Liston J hl47 Beverly pi Hazel Street School E E Butler prin 652 Hazel Hazelhurst Ida tchr r514 Linden av Hazelhurst Louise' nurse City Health Dept Hazelhurst Marie tchr rl08 Courtland av Hazelhurst Wm (Edna) yd formn Hammond Oil Co h514 Linden av Hazzard Wm (Mamie) draymn h456 Alabama Head Archie J elk Sou Ry System r7 Rose pi Head Dovie mill hd r2229 2d Head Elias N (Mary V) h2229 2d Head Eliz mill hd r2229 2d Head Geo W (Nettie) agt N Y Life Ins Co hl06 Ran- som av Head Jas D (Juliet) elk E W Tipton h7 Rose pi Head Jas K (Maude; Jones & Head) hl23 Myrtle (SM) Head Juliet N Mrs information sec Jones Park & Johnston h7 Rose pi Healey John (Imer) lab h240 Division Heard Bailey P student rl03 St James av Heard Bros (J M, O M and J H Heard, J L Grace, T H Mosely, W T Millican) cotton factors 350-52 Poplar Heard Chas lab r!5 Gas House al u Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeecatdsqufaorrters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for u copy. R. L. POLK & CO., DETROIT, MICH. The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St MACON CITY DIRECTORY (1925) 449 Heard Hattie (wid Wm) smstrs Happs Factory h814 Elm Heard Jacob F (Eliz) fertilizer hl35 McGee Heard Jas C butcher Fla Fish & Oyster Co Heard John H (Fannie; Heard Bros) h R F D 3 Houston rd Heard J Milton (Susie L; Heard Bros) hl06 Cleveland av Heard J Milton jr student rl06 Cleveland av Heard 0 M (Heard Bros) res Cordele Ga Heard Pearl (wid Virgil E) sten Jones Park & John- ston r3809 Houston av Heard Perry -G (Kate) agt Wofford Oil Co hl03 St James av Heard Sol (Laura) lab r251 (651) Womack Heard Susie student rl06 Cleveland av Heard W J county tax assessor res R F D 3 Hearn Alva T radio opr r204 Park av (CP) Hearn Mary L student r204 Park av (CP) Hearn Paul (Sallie) elk h204 Park av (CP) Hearn Robt W auto mech r204 Park av (CP) Hearn Wm S wtchmn r206 Hartley av (CP) Hearne John M (Ada) steel constr rll5 Madden av Heath Alma cook h918 Atlantic av (SM) Heath A G trainmn Macon Ry & Light Co rl23*4 Cotton av Heath Clifford traffic mgr r206 Hydrola Heath Ella (wid Augustus) rl44 Deborde Heath E B firemn City Scavenger Dept Heath Freddie chauf r219 Jones av Heath Geo H (Dollie) lab r325 Calhoun Heath Geo W (Ida) trainmn Macon Ry & Light Co h325 Calhoun Heath Herman H (Ella) sec-treas E B Smith Lmbr Co r632 Forsyth Heath Hubert W rl44 Deborde HEATH H PERSONS (Cornelia A), V-Pres Macon National Bank, hl304 Vineville av, Phone 3295 Heath Ira (Ruby) driver r2281 2d Heath John H (Bedie) mech h219 Jones av Heath John R lab r325 Calhoun Heath Linda h209 Hydrola Heath Lynn driver r2281 2d Heath Ollie (wid John J) h2281 2d FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 m 450 (1925) R. L. POLK & CO.'S as a Heath Ollie W (Eva) textile opr h.749 Hawthorne Heath Sarah smstrs rl44 Deborde MMEI Heath Wm (Nancie) lab h4 Polk la (HH) Heath Wm E (Julia) asst formn City hl09 Enter- prise PUCE Heath Wm L opr The Wm Carter Co res R F D 2 Heaton A N slsmn Lee's Dept Store rlll4 Walnut I THE Heck Alton P bkpr h359 New Hedden Fannie (wid Kisler) h200 (5) Holt av (NH) DIRECTORY Hedden Hardy H textilemn r200 (5) Holt av (NH) Hedden Mary r200 (5) Holt av (NH) IS THE Hedden Nellie r200 (5) Holt av (NH) Hedemann Edw E (Lennie) mgr McLellan's h421 GREATEST Forsyth Hedgepath Arth L (Janette) slsmn h703 Holt av MARKET Heel Catalonia elk r624 Flanders (EM) Hegman Henry (Mattie) porter r568 Monroe PLACE Heinsohn Robt A (Lillian B) agey organizer New IN THE York Life Ins Co h2, 305 College Helmly B R Mrs slsldy Dannenberg Co rll4 Holt WORLD * Helms Eule E (Lucile) welder r79 Dempsey av Helton Eloise (wid J S jr) r40 Marion pi (HH) Helton Lillie r551 Arch Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * Hembree Frances student rl26 Lawton av Hembree John A (Eleanor) phys 622 Bibb bldg hl26 Lawton av Hemingway Sami M bgemstr rl03 1st Hemingway Sarah L (wid Collins F) rl03 1st Hemingway W Lynn mech Ideal Lndry Co rl03 1st Henderson Alice cook r202 Magnolia la Henderson Alvin C (Nellie) supt h873 Mulberry Henderson Andrew (Louvenia) lab hl68 (147) Green Henderson Annie h218 Wings Hill The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Henderson Arth mgr Arth Hicks rl68 (147) Green Henderson Arth porter r613 Maynard Henderson Buford A student r311 Mikado av Henderson Caldonia' r730 Hazel Henderson Caldonia lndrs rl05 Telfair Henderson Clarence millwkr r72-73 Davis Henderson Clayborne (Leonora) swtchmn h730 Hazel Henderson Dora (wid J Hildreth) h Forest Hill Mtt&Go Henderson D Tillet phys 567 Walnut r Mrs Dora Henderson PUBLISHERS Henderson Geo (Mattie) porter h730 (742) 3d av (V) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 451 Henderson Hanna lndrs h4 Sparks al Henderson Hannah hl41 Forsyth la Henderson Henrietta lndrs rl68 (147) Green Henderson Howell H elk POr Mrs Dora Henderson Henderson Jacob reprmn rl064 Elm Henderson Jay B lab r280 Madison Henderson Jas (Mary) carp h3 Hill Park av Henderson Jesse (Ella) waiter hl39 (137) 4th av (V) Henderson Jessie L farmer r3145 Houston av Henderson John P (Berta) formn car repr h311 Mikado av Henderson J G mgr M E Elliott Whse Co res Swift Creek Henderson Kate music tchr r Mrs Dora Henderson Henderson Leo (Mary) car repr h301 Crisp Henderson Manoh F (Willie) trav h213 Belmont av Henderson Marion (Anna B) porter h422 Northern Henderson Marjorie h854 Elm Henderson Mark (Florence) lab h355 Bay Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Henderson Mary h259 4th av (V) Henderson Mary lndrs r420 Steins al Henderson Mary student r730 (742) 3d av (V) Henderson Mary N maid r259 4th av (V) Henderson Otis (Clara) lab r306 Ash Henderson Porter (Ruth) mech r315 Cutters Green Henderson Porter L (Katie) slsmn h315 Cutters Green Henderson Raymond lab r280 Madison Henderson Rebecca cook r259 4th av (V) Henderson Robt (Sallie) lab hl24 Tindall av Henderson Ruth lndrs r259 4th av (V) Henderson Sami lab h7 3d st la Henderson Sarah lndrs h280 Madison Henderson Susie Mrs millwkr h Railroad Henderson's Grocery Store Mrs W I Stewart mgr 1064 Elm Hendley Jos C (Katie) elk W T Hendley h Melrose DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 fl) c JS ^ UJoJs JJUosJ < d "S H g fig LsJ o 2 H gw < U g X > Q 2 lz >o H>c/h5 Ooas '''az*" < c <5 a copy R. L. POLK & CO., DETROIT, MICH. MORRIS HARRIS ' INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 454 (1925) R. L. POLK & CO.'S Herin & Geeslin (W S Herin, J N Geeslin) gro 702 Broadway Heriot Evelyn rllO Nisbit pi Heriot Florence rllO Nisbit pi Heriot Helen elk City Health Dept rllO Nisbit pi Heriot Mary rllO Nisbit pi Heriot Steph C (Minnie) mech hllO Nisbit pi Herman Edw (Viola) slsmn r310 Randolph Herman Emma (wid Isaac) hi, 818 Cherry Herman Harry lab r26 Wall st la Herman Jerome (Madeline C) sec-treas Limited Credit Corp, h4, 818 Cherry Herman Viola Mrs cashr Central Pharmacy r310 Ran- dolph Herman Wm pres United Credit Corp and sis mgr Happ Co rl, 818 Cherry Herndon Arth B (Mabel) linemn rl30 Willingham Herndon Benj G appr mach r275 Ells (SM) Herndon Chas A (Mary) plmbr T L Wood h757 New Herndon Delbert W (Emegene) mgr Atlantic & Pa- cific Tea Co h711 College Herndon Effie waitress rl21 Cedar (SM) Herndon Eugenia (wid Geo R) hl30 Willingham Herndon Frances rl02 Lamar HERNDON FRANK F (Elizabeth), Attorney-at-Law 219-220 Ga Casualty Bldg, Phone 1056, hl02 Lamar, Phone 2136-W Herndon Geo W (Lula) convict guard hl21 Cedar (SM) Herndon Jas A (Mary) carp r201 St John Herndon John B (Sophronia) hll5 Plant Herndon John G (Cornelia) carp h303 Morgan av Herndon J Albert (Mary) blksmith h275 Ells (SM) Herndon Lewis (Fannie) lab r rear 147 High Herndon Louis (Ella) porter hll4 (139) 1st av (V) Herndon Mamie nurse r69 Davis Herndon Martha rl02 Lamar Herndon Monroe (Leona) car repr r2109 Broadway Herndon Ollie C (Agnes; Broadway Trading Co) h 105 Womack Herrin John E (Pearl) gro 1022 Clinton rd hl020 do Herring see also Herin and Herron Herring Crowell (Tyler) ship elk C E Newton & Bro h 852 Walnut More goods are bought and sold through the Classified Business Lists of the Directory thar any other medium on earth. IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 455 HERRING ERNEST C (Florence), Attorney-at-Law 417 Georgia Casualty Bldg, Phone 2061, h214 Buford pi, Phone 2508-W Herring Fletcher L pottery wkr r535 Telfair Herring Florence' r3035 Houston av Herring Francis (Annie) hl24 Hines ter (V) Herring Fred M (Helen) car inspr h Lanier pi Herring Hannah Mrs hl237 2d Herring Henry F (Amanda) pntr h603 Telfair Herring John F (Pearl) gro 2900 Houston av h3035 do Herring Jos T appr Bibb Ptg Co rl02 Wood Herring J Lawson (Alice) pntr h535 Telfair Herring Laura (wid Crowell L) hl02 Wood Herring Lavinia student rl21 Hines ter (V) Herring Lucile r3, 501 Giles Herring Madeline (wid Jerry M) h3039 Houston Herring Martha tchr r3035 Houston av Herring Mollie Mrs r535 Telfair Herring Otis student rl24 Hines ter (V) Herring Wallace elk r3039 Houston av Herrington see also Harrington Herrington Alice M cashr Midland Pharm r412 Cal- houn Herrington Armour H printer Macon News hl021 Clinton Herrington Burke (Rosa) clo clnr rl Maynard apts Herrington Carrie L (wid Jas W) r2127 Broadway Herrington Chas C r2023 Broadway Herrington Clarence (Annie) lab r455 Army lot Herrington Geo (Georgia) carp hl07 DeWitt Herrington Herbert C (Rose; Nolan & Herrington) h 107 Culver Herrington Homer H (Eliz) mach r2023 Broadway Herrington Horace O (Mary L) condr h726 Pine Herrington Jesse J mach h2023 Broadway Herrington John (Eula) lab h207 Woodiff Herrington John (Addie) capt fire' dept h419 Dun- can av Herrington Mamie Indrs h505 Gilmer Herrington M Augusta r412 Calhoun Herrington Roy E elk C of G R Co r2127 Broadway Herrington Rufus S (Ida) city firemn h432 Beech av Herrington Virginia L h412 Calhoun Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoismeso.eblieSlecetnLdipstrtoso.sHpeeOacudtsrqunfeaowrrcCoaptya.log coRnt.aLin.sPmOLucKh &-vaClOua.,bDleEdTaRtaO.ITA, MskICfoHr. W. R. Finch Motor Co. Eggp Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 456 (19251 R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Herrington Wm r419 Duncan av Herritage' Chas E (Kathleen) slsmn h206 Napier av Herritage E C elk C of G R R Co res Walden Ga Herritage Thelma sten Fourth Natl Bank r Walden Ga Herron see also Herin and Herring Herron Hugh J coml agt Sou Ry System r727 Orange Herron K frt agt r216 Hines ter (V) Hertwig Chas C (Louise) asst treas h493 Hillyer av Hertwig Herman (Emma) dept chief elk M D & S R R h519 Linden av Hertwig Maria (wid E J Lee) h309 Hillyer av Hertwig Mary L elk rl020 Elm Hertz Frank C slsmn P E Hertz rl408 Vineville av HERTZ PRICE (Hermina), Auto Supplies 573 Broad- way, Phone 3627, Pres Independent Laundry Co, li Vineville and Carolina avs, Phone 120 Herzog Caroline rl427 2d Hester Alberta Indrs r339 Cedar (U) Hester Anna Indrs h904 Hazel Hester Cora bkpr S Jones Co rl514 Forsyth rd (V) Hester Dolly r230 Plant Hester Henry H (Lillian) mgr Burton Inc r405 Carling av (HH) Hester Hillyer lab r339 Cedar (U) Hester Jos (Mary) pdlr h339 Cedar (U) Hester Pauline C r354 Spring Hester Robt del boy Godfrey's Gro Store r623 4th av Hester Wm L (Vada) carp r353 Clinton Hewell Everett (Lois) slsmn rl508 Forsyth rd (V) Hewes Caroline anesthetist Macom Hosp r do Hewitt Lucile r822 Walnut Hewitt Robt P (Eva M) tinner h822 Walnut Hewitt Rosa L dom h452 Bay Heysen Minnie h702 Elm Heyser John F (Ada) eng h306 Fort Hill Heyser Julia tchr r306 Fort Hill Heyward Andrew H (Marion S) lawyer 310 Grand bldg h659 (1021) Vineville av Heyward Andrew H jr student r659 (1021) Vineville av Heyward Emory S student r659 (1021) Vineville av Heyward Jas (Ethel) lab h497 Gilmer Heywood Jas D auto pntr Shadburn & Hudson r71f? 3d 536 S. Clark St. Chicago, 111. Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 457 Heywood Gussie Mrs elk John Williams rl63 Hazel Heywood Wm (Gussie) lab rl63 Hazel Hick Norman (Ella) lab hll Short (EM) Hickland Edw lab r60 Davis (NH) Hickland Geo lab r60 Davis (NH) Hickland Marshall lab r60 Davis (NH) Hicklin Walter lab r543 Calhoun Hickman Annie L opr W U Tel Co rl536 Broadway Hickman Annie M smstrs r212 Reid Hickman Bess Mrs bkpr r483 Orange Hickman Brodis mech r207 Reid Hickman Edw r207 Reid Hickman Florence (wid Adolphus) hl536 Broadway Hickman Geo R (Rosa L) h207 Reid Hickman Irene smstrs r212 Reid Hickman Mildred opr W U Tel Co rl536 Broadway Hickman Tressie smstrs r212 Reid Hickman Walter C (Eunice) r207 Reid Hickman Walter C (Alice) carp h212 Reid Hicks Alex (Mattie) cotton mill wkr h Forest av (Bellvue) Hicks Amanda (wid David) h Lawton rd Hicks Arth (Mary) clo clnr 213 1st av (V) hl40 (143) do Hicks Aurora maid h262 Madison Hicks Charlotte (wid Virgil) r340 Long Hicks Cleveland (Sallie) textile mkr r455 Hazel Hicks Duncan (Louise) lab h421 Ward (V) Hicks Duncan jr janitor Federal bldg r421 Ward Hicks Ella (wid John C) h405 Adams Hicks Ellen lab h6 Tracey's al Hicks Emma sten H M Reid & Co r217 Tatnall Hicks Epsie sten r217 Tatnall Hicks Fletcher (SusieM) gdnr hl73 North av (NH) Hicks Florence rl43 Tatnall Hicks Florence maid h222 Dannenberg av Hicks Gladys elk Macon Retail Food Dlrs r217 Tatnall Hicks Henry (Katie) pastor h214 Division Hicks Jack C (Anna) slsmn h276 Ells (SM) Hicks Jackson (Anna) h240 Orange Hicks Jas A driver r276 Ells (SM) HICKS JAMES R JR (Willie M), County Sheriff, Office Court House, Phone 440, hl05 Courtland av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L> POLK & CO. CHICAGO We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 458 (1925) R. L. POLK & CO.'S Hicks John (Adie) carp h Industrial Home rd Hicks John (Ruth) lab hl28 Grants Hicks John C (Effie) lab rl26 Plummer's al Hicks John H gdnr rl73 North av (NH) Hicks Jos lab r728 Nussbaum Hicks Josephine r728 Nussbaum Hicks J Wilson hl363 Oglethorpe Hicks Lawrence carp r222 Dannenberg av Hicks Leroy C (Mary)Nh217 Tatnall Hicks Mariah lndrs hl60 Guernsey la Hicks Marie cook rl62 College Hicks Mary cook r667 Hazel Hicks Maud lndrs r222 Dannanberg av Hicks Mollie r500 Chappell Hicks Neal (Annie B) sta firemn ice plant r852 Broad- way Hicks Richd (Mozella) carp h466 Alabama Hicks Richd B (Edwina) slsmn Murphy-Taylor & Ellis h205 Buford pi M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmgeyAIho,LytLuoYarTpu.nHrrgdouYdFvmeoeo. nlcsraTtasiasthstiaritiocelsen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbRrrhYulyEesgOeigpdgRUiinnsANaotkLl'n-s., 1 H Hicks Root (Mattie) porter hl08 2d av (V) Hicks Roy C r405 Adams L E Hicks R C r Y M C A Hicks Sarah r405 Adams L A Hicks Simon (Louella) carp h709 Dempsey av Hicks Warren (Mary) lab h.78 Bay Hicks Wm (Ola M) firemn h Industrial Home rd I T Hickson see' also Hixon Hickson Bob (Mary) lab hl20 Moore la Higgins Jos (Pauline) lab h606 May av R I Higgins Morris (Susie) lab r220 Pearl (EM) Higginson Construction Co J J Higginson jr pres- 0 N genl mgr 313 Ga Casualty bldg Higgison Bernice r218 Jenkins Higgison Cornelia r218 Jenkins N G Higgison E Gibson (Price) contr h.120 Inverness av Higgison John J (Julia) mgr h906 Napier av S Higgison Jos J (Amarilla) pres Higgison Constr Co res Lorain Ga 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 459 Higgison Louise bkpr T L Wood r218 Jenkins Higgison Rebecca student r906 Napier av Higgison Theo (Leila) mech h ss Forsyth rd (V) 6 w Riley av Higgison Wm R contr h218 Jenkins Higgison Willie r218 Jenkins Higgs Edna rl95 Elizabeth pi (V) Higgs Remer L (Lilie) slsmn hl95 Elizabeth pi (V) Highland Oil Co W S McClellam jr prop 113 North av (NH) Highland Pharmacy J A Key prop 109 North av (NH) Highsmith Dollie file elk Fourth Natl Bank r756 Mulberry Highsmith Ethel waitress r763 3d Highsmith Eurelia cook hll6 (401) Brasyell la Highsmith Homer mech r7 Hill Park av Highsmith J P elk r Y M C A Hight Chas 0 (Cora Z) carp h2130 Broadway Hight Edgar P (Lillie) firemn h2224 Broadway MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Hight Harry flagmn r2130 Broadway Hight Henry caller Sou Ry r2130 Broadway Hight Jessie cook R H Hillman Hight Lillie cook h646 4th av (U) Hight Lois r2130 Broadway Hight Lucious nurse r646 4th av (U) Hightower Albert (Arwillow) lab h503 Prince Hightower Annie student r710 Broad Hightower Bernice Mrs checker Dempsey Hotel r753 Pine Hightower Charlotte dom hl52 5th Hightower Clifford E (Mamie) barber h304 Church (EM) Hightower Effie (wid Jefferson D) hl314 3d Hightower Emory (Letha) draymn h508 Martha (EM) Hightower Geo (Elnora) lab h565 Monroe Hightower Griffin (Ella) h Columbus rd Hightower Jas H (Martha E) gro 406 Church (EM) h do Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answers All Questions as to , WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet R. L POLK & Company LUMBER, SHINGLES, LATH Willingham Sash H Door Co. Office, 457 Third St. Telephones 278 & 3976 460 (1925) R. L. POLK & CO.'S Hightower John M (Mary) blksmith h710 Broad Hightower John W (Carrie) pntr hl24 Grady Hightower John W jr student r710 Broad Hightower Jos mech h319 (325) Main Hightower Josephine lndrs hll4 Moore1 la Hightower Julia opr Sou Bell Tel Co rl314 3d Hightower Leeward (Maggie) agt Life & Casualty In- surance Co r920 Elm Hightower Leonidas (Bernice) agt National Life and Accident Insurance Co h753 Pine Hightower Lois E student rl314 3d Hightower Mae nurse r909 Orange Hightower Major D (Annie) barber 1203 Broadway r 150 Archer av Hightower Mary E (wid John S) h2831 Houston av Hightower M Louis lab h931 Fort Hill Hightower Pitts (Susie) lab h215 Garden Hightower Raleigh B (Sarah) h637 Forsyth Hightower Sami (Willie) chauf hl03 Mitchell Hightower Sami (Leila M) truck driver h529 Middle (EM) Hightower Sami H (Verna) welder h2829 Houston av Hightower Sol carp rl625 Broadway Hightower Sylvester porter r931 Fort Hill Hightower Thos C carp r Griffin Hightower Hightower W H baker Am Bakeries Co rl4 Holt av (NH) Hightower & Co (G W Sullivan) gro 3496 Houston av Hilbon Burt W (Ethel) mach hlOlO Oglethorpe HILBU1V CHARLES A (Alice), Optometrist and Man- ufacturing Optician 620 Cherry, Phone 575, res Rivoli, Ga, Phone 4655 Hilderbrand Laura (wid W H) r Log Cabin Hts Hiles Thompson cashr F E Block Co r Y M C A Hill Ada lndrs h800 Fort Hill Hill Adele dom r800 Fort Hill Hill Agnes nurse rll4 Elliott (EM) Hill Alice lndrs h525 Craft la Hill Annie' r921 Ocmulgee Hill Annie cook rlOl Summit av (NH) Hill Anthony (Exie) porter rll5 Glen Hill Arth r921 Ocmulgee Hill Benj F (Jessie) carp hl807 Broadway Hill Caledonia elk r624 Flanders (EM) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 461 Hill Carrie B nurse Mil Madison Hill Clarence lab r800 Fort Hill Hill Claude (Mammie) lab hllOO (1008) Elbert Hill Clifford cook hl62 Cheatham rd Hill Columbus (Estelle) carp hl61 Green Hill David W (Lizzie) broker 7 Terminal av hl06 Courtland av Hill Della cook h.204 (104) Mutual av Hill Edw (Janie) furn pkr h95 Woodliff Hill Eli W ins agt r515 College Hill Eugenia mill hd rl248 2d Hill E Robt mach r961 Walnut Hill Fannie (wid Jas T) r724 Main Hill Florence cook h703 (424) Colquitt Hill Fred L lab rllOO (1008) Elbert Hill Freddie r921 Ocmulgee Hill Geo (Eula) chauf h765 Glen Hill Geo (Mary) lab h220 Elizabeth Hill Geo lab rl29 Grants Hill Geo F (Bessie) eng hlOO Nelson Hill Geo W (Lela) prof Central City College h920 Ocmulgee Hill Hannah (wid John) h618 Prince Hill.Henrietta cook h311 Blount Hill Henry (Bessie) r603 Henrietta Hill Jas lab r800 Fort Hill Hill Jas (Leola) lab hllO Tindall av Hill Jas A (Eloise) condr h2014 2d Hill Jas H (Pearl) carp hll5 Cedar (SM) Hill Jas T (Carrie Bell) elk r801 Main (EM) Hill Jas T jr collr Dallas Investment Co r801 Main (EM) Hill Jeff H lab rl016 Main Hill John (Kath) driver h222 Carter's al Hill John (Lizie) lab h300 Smith (EM) Hill John (Leola) pdlr h Columbus rd Hill John T (Annie) pipeftr hl31 Stratton Hill Jos (Dora) lndrs h.216 Elm Hill Jos B teller Fourth Natl Bank r200 Grant av Hill Josephine cook hl30 2d av (V) Hill Judd S (Eloise) depy marshall b.706 2d Hill Judson S (Eloise) depy city marshall h706 2d Hill Julian B (Ruth) slsmn S M Solomon jr hl208 Ridge av SJ FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DKTROIT R. L. PORK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Denial Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 462 (1925) R. L. POLK & CO.'S Hill Katie cook r62 Davis la Hill King restr 1011 Broadway r349 Hawthorne Hill Kingman P r2909 Houston av Hill Laura J elk G G Hardeman Co r515 College Hill Lee (Fanny) h822 Ash Hill Leonard S photog h718 Main Hill Louise rl06 Courtland av Hill Lula (wid J T) r401 Walnut Hill L M lab r311 Blount Hill Mach mgr r254 College Hill Mallie (Emma) lab hl04 Hazel Hill Marguerite opr Sou Bell Tel Co r300 Ridge av Hill Mary hl242 Long Hill Mary lndrs h28 Hendrix al Hill Mary J (wid Jas A) h515 College Hill Matt (Emma) h807 Edgewood av Hill Mattie' slsldy Burden Smith & Co h4 Forsyth ter Hill Mattie maid r95 Woodliff Hill Maude S r515 College Hill Maybell maid r674 (507) Douglas av Hill Mildred student r300 Ridge av Hill Moses (A Z) gro 344 Middle (V) r254 Ellis av (V) Hill Nancy (wid Thos) rl913 3d Hill Obie (Annie) sta firemn hl528 1st Hill Otis (Bessie) hll2 Ernest Hill Perry (Hattie) lab hl09 Woodcliff Hill Ralph G (Larie) slsmn r200 Beech av Hill Robt F (Emma) agt Metropolitan Ins Co h961 Walnut Hill Robt F (Estelle) collr h302 Church (EM) Hill Rosa L nurse r354 Ellis av Hill Theo lino opr r961 Walnut Hill Thos (Hattie) butler r rear 200 Roge Hill Thos plmbr h543 Calhoun Hill Thos L (Lina) reprmn h2909 Houston av Hill Virginia H Mrs r531 Jackson Hill Wm C lab rlOll Main Hill Wm E (Mary) h55 Forsyth rd (V) Hill Wm J lab r354 Ellis av Hill Winnie M tchr rl06 Courtland av Hill W Owen (Ivy) carp h531 Jackson Hill Zack (Sallie) model mkr h352 Mutual av Hillard Clarence E r818 3d Hillard Harold B (Mae) h521 Oak E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS d&ncC CAR.S-TR.UCKS -TRACTORS tlf it's a Ford or lfioarve ait.Ford, we PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 463 Hillard Susie M (wid Smith M) h818 3d Hiller Eirne'st L (Olivia) acct h307 Adams Hiller Kath Mrs slsldy Dannenberg Co r307 Forsyth Hiller Louis (Kath) r307 Forsyth Hilley Addie Mrs asst O C Anderson hl64 1st Hilley Dozier A (Louise) solr Crescent Lndry Co h 1130 College Hilley Earl mach rl64 1st Hilliard Annie (wid Jessie) h865 Walnut Hilliard Edw R (Mae) v-pres O'Pry Plumbing & Heat- ing Co r403 Boulevard (NH) Hilliard Harrold J (Ida) collr Willingham Sash & Door Co r865 Walnut Hilliard Marjorie hl206 Broadway Hillman Rena lndrs h213 Elm Hillman Robt elk S E Evens r419 New Hillman Robt H (Myrtle) mgr Bibb Lmbr Co h403 Hillger av Hillman Rose (wid Robt) rl21 Holt av (NH) Hilsman Guy (Martha) hl02 (101) Lawton av Hilsman Myrick (Martha) bkpr W G Lee h741 Ridge av Hilton Ester A (wid E J) matron Ga Industrial Home h Industrial Home rd Hilton R C rll62 Oglethorpe Hime Anna Mrs slsldy Union Dry Gds Co r903 2d Hime Harry mach r903 2d Hime Ora Mae student r903 2d Hines Ellen dom r616 Fort Hill Hines Ethel rl58 High Hines Geo (Grade) lab hl3 Bright al Hines Geo porter h616 Fort Hill Hines Hannah S r247 High Hines Jos M (Edna) carp h331 Clinton Hines Marvin (Annie) driver r331 Clinton Hines Maude hl58 High Hines Richd K (Annie W) lawyer 818 Ga Casualty bldg h247 High Hines Richd K jr stldent r247 High Hines Thos W (Susie) engrh707 2d Hiney David (Louise) h724 Hazel Hinkle Albert B (Hinkle & Rushin) ,r362% 2d Hinkle & Rushin (A B' Hinkle, Herbert Rushin) phys 362% 2d Hinson Blannie phone opr r327 American blvd The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. f &C0. Polk Directory Bldg. Detroit, Mich. zu UUj Ik ww KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 464 (1925) R. L. POLK & CO.'S Hinson Corine opr Sou Bell Tel Co Hinson Doris lndrs r321 Siam Hinson Geo J (Mary) millwkr h Railroad Hinson Jas M elk r813 Main (EM) Hinson Mary hl24 Holt Hinson Mary E (wid Robt J) hl35 Colquett Hinson Wm (Rena) presserrl05 Church (EM) Hinton Chas C (Aline) phys Middle Georgia Sani- torium h Masse apts Hinton Chas J (Bessie M) meat ctr h220 Reid Hinton E Mrs tailoress Jos N Neel Co 520 Cherry Hinton Jas (Mattie) lab r234 Jefferson Hinton Jas C (Emma) tchr Wesleyan College hl05 Lamar Hippie H Harvey (Dot) formn h507 Hillger av Hirsch Isadore (Martha) slsmn Jacob Hirsch h442 New Hirsch Jacob junk dir 352 Plum r605 Georgia av Hirsch Lilly r442 New Hisler John (Julia) lab h208 Reid Hisler Nelson (Belle) rl304 2d Hisler Varley rl304 2d Hitchcock Dewey asst sta mgr Standard Oil Co r Arcadia Hotel Hitchcock Jas L rodmn r608 Main Hitchcock John F lab r49 White Hitchcock Mabel nurse rl31 Rose Park Hitchcock Melvin R (Irene) baker Am Bakeries Co h 1065 Walnut Hitchcock Robt (Rebie) rll9 American blvd Hitchcock Roland M (Eliza) supt h.202 Crescent av Hite Edw E (Mary) mill hd rl4 (112) Randolph pi Hite Ellsworth E (Louise) mill hd hl4 (112) Ran- dolph pi Hite J Emmett (Annie) mill hd r20 (14) Randolph pi Hite Mathew (Lula) lab h618 4th av (U) Hixon see also Hickson Hixon Albert Mrs opr Sou Bell Tel Co r233 Chappell Hixon Martha Mrs hl06 Katherine Court apts Hixon Sarah elk r566 Walnut Hobbs Alonzo r827 Hazel Hobbs Dora (wid John) lndrs h Columbus rd Hobbs Ethel lndrs r967 Ocmulgee Hobbs Eug (Mattie) mill hd h320 (226) Pio Nono av Hobbs Eunice B mill hd r320 (226) Pio Nono av I JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 465 Hobbs E B driver rl21 Army Lot Hobbs Francis r3036 Houston av Hobbs Francis r612 Peeble Hobbs Henry (Pauline) traffic officer Police Dept r 203 College pi Hobbs Homer G (Bessie) h3036 Houston av Hobbs Jas T (Ida) mill wkr h32 Brigham Hobbs Jesse B agt Natl Life & Accident Co rl51 Park Pi Hobbs Leon (Bertha) waiter r328 (240) Roye Hobbs L Frank (Nora) carp r411 Mikado av Hobbs Mary cook r Dora Hobbs Hobbs Mary E r905 2d Hobbs Osa Indrs hl21 Army Lot Hobbs Paul E slsmn Jas N Neel Co r3036 Houston av Hobbs Thos J (Kendal) formn h398 Forest av Hobbs Wm r606 New Hobby Edw L (Alice) h717 Cherry Hobby John P (Dovie) opr h217 Clinton Hodge Burkett lab rl39 Linden av Hodge Fannie Indrs rlO (910) Clayton Hodge Hazel Indrs rlO (910) Clayton Hodge Julian H lmbrmn r408 Forest av (V) Hodge Maggie (wid Walter E) r408 Forest av (V) Hodge Sami (Angeline) carp h468 Broad Hodges Annie r216 2d Hodges Danl (Bessie) chauf h20 Short st la (EM) Hodges David (Bessie) lab hi 179 Broad Hodges Emma Indrs h408 Applewood Hodges Jas O (Hettie) slsmn hl05 North av (NH) Hodges Jas O jr (Lulu) supt Southland Knitting Mills rl27 Summit av Hodges John M (Edwina) ship elk Macon Gro Co Hodges Louise waitress Macon Cafeteria r715 Poplar HODGES MARION W, Asst Mgr Beneficial Loan So- ciety, rl05 North av, Phone 3495-J Hodges M B (Sussie) lab hl65 Phillips Hodges Rex P (Eliz) printer h456 Oak Hodges Robt (Ella) lab h rear 1214 3d Hodges Robt (Jewell) trav slsmn rl05 North av HODGES WILEY M JR (Louise), Y-Pres Yellow Cab Co of Macon, li518 Johnson, Phone 5273-J Hodgkins Mary E prin Alexander School No 1 r714 Napier av Hodo Alex (Hester) lab h313 Walnut FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. T.. POLK & CO. CHICAGO mm PUL THE DIRECTORY IS THE GREATEST MARKET PUCE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kindis of Goods and Service Can Be Had > * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 | 466 (1925) R. L. POLK & CO.'S Hodo Robt (Sarah) lab hl67 Plummer's al Hodo Rozelle r313 Walnut Hoffman Fredk T (Amelia) r202 Beech av Hoffman Kath slsldy W T Grant Co r525 Jackson Hoffman Richd bkpr rll5 Garden Hoffman R Henry (Marie) pntr hl409 2d Hogan Austin (Alberta) electn hl48 Ernest Hogan Belasco (Elvira) porter h8 Short (EM) Hogan Candler r2552 Broadway Hogan Eula M cook r (308) Spring la HOGAN EVERETT B (Hogan & Levie), h289 College, Phone 2568 Hogan Gladys r327 Jackson HOGAN JAMES K (Kathleen), Cashr Fourth Natl Bank, r525 Georgia av HOGAN JASPER T (Martha C), Asst Cashr Fourth Natl Bank, r525 Georgia av Hogan Lena cook r470 May av Hogan Nettie L (wid Thos) h525 Georgia av Hogan Otis H (Lula) slsmn Yates and Tabor Co h 527 Georgia av HOGAN PAUL G, Asst Cashr Fourth Natl Bank, r525 Georgia av, Phone 1841 Hogan Pulaski lab r255 Elliott (EM) Hogan Roy N (Annette B) bgsmstr h244 S College Hogan Ruth cook rl48 Ernest HOGAN & LEVIE (E B Hogan, 0 H Levie), Commis- sion Brokers Pine se cor 3d, Phone 5256-52575258 Hogans Emily h400 Rutherford av Hoge Cath sten rl50 Highland av Hoge Frank W elk Wm L Daniel rl50 Highland av Hoge Gertrude (wid Jos T) hl50 Highland av Hoge Jos S slsmn rl50 Highland av Hoge M Lizzie h408 Ross Hoge Sol (Agnes) trav h271 Orange Hogg Jarrell N (Margt) phys r670 Courtland av Hogg Jarrell N jr mech r670 Courtland av Hoggison Lucile Mrs rl31 Gordon (SM) Hogue Sami B (Annie) elk Jos W Davis h23 Randolph Pi Hoke Edith sten Ga Loan &Trust Co r215 Williams (SM) Holcombe Eliz r341 Hardeman av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656!/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 467 HOLCOMBE J LEROY (Norma), Accountant 610-611 Grand Bldg, Phone 5199, h Massee Apts Holden Douglass lab r408 Thompson al Holden Jas lab r408 Thompson's al Holder Francis J (Isabelle P) tchr Mercer University h912 College Holder Rollo carp r640 Peeble Holder Thos (Margt) lab hl23 Kahn's al Holdman Dee piano tuner rl09 Enterprise Holdridge Laura P (wid Hatsel S) r502 Fort Hill Holland Elbert (Bulah) lab h482 Chestnut Holland Ernest r321 Shamrock Holland Jack M (Ruby) lmbr checker rl04 West End av (HH) Holland Jas porter r223 Orange Holland Jas F (Belle) millwkr h325 Dannsenberg al Holland Jas W (Florence) bkpr Enterprise Packing Co hl21 Summit av (NH) Holland John D (Mary) electn hlOl West End av (HH) Holland Jos (Mary B) driver h5 Moore al Holland Leola student r555 Broad Holland Lillie r321 Shamrock Holland Lillie opr Sou Bell Tel Co r652 Oak Holland Louise lndrs r482 Chestnut Holland Mahala M (wid Jas J) r613 Plum Holland Mattie lndrs h625 Gresham la Holland Minnie cook h2 Harris al Holland Minter E student r325 Dannenberg al Holland Sami horticulturist r550 Orange Holland Steph h612 Hazel Holland Walter F slsmn Macon Chero Cola Bottling Co hl054 Ash Holleman Barnett S farmer h206 Oak Haven av Holleman Cornelius B (Lilia) vulc 461 Broadway h653 Forsyth Holleman Jas C (Vera) elk S Jones Co hll7 Crisp Holleman Lena r325 Vineville av Holleman Linton B (Bessie J) prop Holleman's Pharmacy hl03 Rogers av HOLLEMAN'S PHARMACY, L B Holleman Prop, "Prescriptions Our Specialty" 829 Main, Phone 367 and 9187 Holleman Sadie cook r282 Madison Holley Barney D rl309 2d I Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 468 (1925) R. L. POLK & CO.'S Holley Chas shoe repr John Jordan rl09 Smith (EM) Holley John J eng h2605 Broadway Holley J Frank supt City Scavenger D'ept r321 Mont- pelier av Holley J B driver Yellow Cab Co r Exchange Hotel Holley Manuel H (Emma) millwkr rll Bellevue rd Holley Mildred sten Jones, Park & Johnston rll6 Cleveland av Holley Mollie (wid John S) rl309 2d Holley Sylvester (Winnie) rl309 2d Holley Willie L rl309 2d HOLLIDAY PETER 0 (Martha), Attorney-at-Law 1011 Ga Casualty Bldg, Phone 2597, h216 Hines Terrace, Phone 3663-.! Holliman see also Holleman and Hollomon Holliman Annie lndrs h343 4th av (V) Holliman Annie L music tchr rl401 (1109) Ridge av Holliman Nancy lndrs r343 4th av (V) Holliman Patk F r343 4th av (V) Holliman Roy B (Myrtle) ship elk Ideal Supply Co h 411 Forest av Holliman Virginia tchr rl401 (1109) Ridge av Hollingshead Frank (Rebecca) h852 Broadway Hollingshead John M (Lilia) lab h560 Broad Hollingshead Willie lndrs r4 Cheatham al Hollingsworth Berry elk Macon Co-operative Store r 134 Colquitt Hollingsworth Dollie Mrs mnder h513 Telfair Hollingsworth Emma C Mrs h767 Walnut Hollingsworth Frank rl34 Colquitt Hollingsworth Henry G (Ethel) sec Zerbal Lodge of Perfection h454 Edgewood av Hollingsworth Jas H (Mary) brkmason hl225 Napier av Hollingsworth Jos (Dollie) rl310 Broadway Hollingsworth Lillian C slsldy J P Allen & Co rl05 Rogers av Hollingsworth Marshall H (Lillie) plmbr Miller Bros h515 Jackson Hollingsworth Sarnl R rl310 Broadway Hollingsworth Sophronia r513 Telfair Hollingsworth Thos F (Mary) meat ctr L W GradJ hl34 Colquitt Hollingsworth Walter (Daisy) farmer res Bellevue Hollins Arletha maid YWCA FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS --- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS Automobile owners are select projects tor many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. FOLK & CO., DETROIT, MICH. p p H MACON CITY DIRECTORY (1925) 469 Hollins Cleveland (Emma) lab h427 Madison Hollis Amos (Lula) lab hl012 Cedar (U) Hollis Arth E farmer r301 Simmons Hollis Chas lab r613 Monroe Hollis Claude elk Mitchell Williams Mack rl63 2d Hollis Edna L r301 Simmons Hollis Harry L (Belle) carp h301 Simmons Hollis Harry L jr sbet metal wkr r301 Simmons Hollis Jas E elk Mitchell Williams & 'Mack rl63 2d Hollis Johnnie tchr r255 4th av (V) Hollis Julian (Callie) rl63 2d Hollis Lillie dom hll4 Bonair Hollis Nellie elk r301 Simmons Hollis Primrose cook h509 Middle (EM) Hollis Thos (Pearl) lab h423 Plummer's al Hollis Thos (Mabel) emp hl07 (152) Lichord (U) Hollis Victoria lndrs r234 Calhoun Hollis Virgil H (Mamie) msngr PO rl07 Carlisle av (LH) P 00 Sa YATES MOTOR 00. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Holliway Sami pntr h208 Coles al Holloman see also Holliman and Holleman Holloman Dora mill hd r2321 Broadway Holloman Eva student r622 Forsyth Holloman Frank (Anna) farmer h417 May av (WH) Holloman Lee M (Emma) sack sewer h619 Middle (EM) Holloman Leonard B (Bessie) h!03 Rogers av Holloman Pearl rl29 Rembert av Hollomon Aaron (Emma) lab h410 Gilmer Hollomon Annie L r302 Corbin av Hollomon Chas lab h282 Madison Hollomon Clarissa r410 Gilmer Hollomon Clinton (Viola) mach h252 Maple Hollomon Collie V bkpr r413 Ross Hollomon Eliz L (wid Jas A) h413 Ross Hollomon Frank lab r282 Madison Hollomon John (Georgia) h501 (400) Charles (SM) Hollomon John jr (Lucile) lab h501 (400) Crisp A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 470 (1925) R. L. POLK & CO.'S Hollomon Sarah lndrs h7 Short st la (EM) Hollomon Simson (Jannie) lab r923 Ocmulgee Hollomon Susie G r413 Ross Hollomon Vernon A (Lula B) meats 1245 Broadway hl782 3d Holloway see also Hollaway and Holliway . Holloway Alice mill hd r305 Pio Nono av Holloway Benj T (Lillie) welder hlOO Hightower Holloway Bost lab h297 1st av (V) Holloway Chas R (Belle) ydmstr h253 Ells (SM) Holloway Clarence brklyr rll9 Sycamore Holloway Clark (Lena) elk Eliza Maddox h319 3d av Holloway Everette elk r771 Walnut Holloway Fannie lndrs hll9 Sycamore Holloway Floyd H (Estelle) h420 Winship Holloway Forrest S (Ruth) swtchmn hl31 Knott Holloway Frank (Cornelia) lab h475 Alabama Holloway Grant (Maybell) porter h213 Henriette Holloway Howard drftsmn r771 Walnut Holloway Jas porter r469 Tindall av Holloway Jas C (Myrtle) trainmn hl08 Montpelier av Holloway Jas M (Rosa) eng h771 Walnut Holloway Jane lndrs rll2 Thomas Holloway John (Nora) hlpr h307 Crisp Holloway J Calhoun (Lillie) carp h260 Ells (SM) Holloway Lillian (wid Jas L) h305 Church (EM) Holloway Lucy sten Union Dry Goods Co r253 Ell (SM) Holloway Maggie r3042 Houston av Holloway Mary Mrs millwkr r41 Manchester qtrs Holloway Mary T (wid Joe) h477 Duncan av Holloway Maurice (Aline) prop Acme Mattress Co h 302 Fort Hill Holloway Mosuri cook rll9 Sycamore Holloway Nettie millwkr r457 Alabama Holloway Ornold (Annie) hlpr rl016 Ocmulgee Holloway Oscar (Mattie) lab r203 Grant City rd Holloway Patk S r3042 Houston av Holloway Paul plainer r3042 Houston av Holloway Percy T Rev (Lilly) pastor hl04 Church Holloway Porter (Lena) butler h920 Ocmulgee Holloway Roland M (Mattie) buttermkr Plummers Creamery h2920 Houston av Holloway Ruby cook h301 (609) Colquitt A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451*453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 471 Holloway Vivian Mrs slsldy Dannenberg Co r253 Eli (SM) Holloway Wm (Mary) cormkr hllO Blount Holly Adam D (Josephine) lab h!64 Bay Holly Delia (wid Danl) cook r523 Craft Holly Laura (wid W S) r321 Montpelier av Holly Mildred sten r321 Montpelier av Holly Olin G (Katie) overseer h Millrose Holman N E speeder r27 Holt av (NH) Holmes Alex lab rll4 Bonair Holmes Alex (Mary J) lab h331 Gilmer Holmes Alicia smstrs r351 Douglas Holmes Alphonsa porter r351 Douglas Holmes Ann M tchr r503 Napier av Holmes Anna T Mrs h426 Johnson av Holmes Benj (Fannie) car greaser h200 (704) Hem- lerson Holmes Byrd (Hannah) lab rll6 Fifth Holmes Carrie E r687 College Holmes Carrie L tchr r648 Forsyth Holmes Cecelia pdlr hl014 Cedar (U) Holmes Chas B (Mammie) elk h475 Monroe Holmes Chas R bkpr Macon Telegraph res R F D 2 Holmes Cora smstrs r351 Douglas Holmes Cora E (wid Walter T) h869 Orange Holmes Curley firemn r200 (704) Henderson Holmes Doll cook r rear 615 4th av Holmes Dollie Indrs h575 Siam Holmes Bliz r869 Orange Holmes Ethel rl25 Bartlett Holmes Frank (Maria) embahner h2 Tatnall la Holmes Frank F (Kate) eng hl64 1st Holmes Frank S (Minnie R) sec-treas Mansfield Dray Line Co h463 Orange Holmes Fred lab r228 Turpin Holmes Garrett (Sallie) plstr h208 Douglas Holmes Geo (Paralee) lab h245 Division Holmes Geo lab h561 Dunlap al Holmes Harry C appr Taylor Iron Works & Supply Co rll59 Elm Holmes Henrietta h828 Edgewood av Holmes Henry (Mattie) tire repr h466 Coles al Holmes Ida Indrs r582 Monroe Holmes Jas (Lizzie) lab rl8 Frank al "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 472 (1925) R. L. POLK & CO.'S Holmes John (Lula) lab hl!5 Hazel Holmes John lab h302 (304) Mason (SM) Holmes John (Doshia) porter hl30 Jones Holmes John (Irene) cook h914 Hazel Holmes John C (Pearl L) h Mossee apts Holmes John J (Lizzie) hl98 Hightower Holmes John P (Cath) phys 304 Bibb bldg h411 Orange Holmes John R (Annie) prop Hotel Arcadia r do Holmes Jos A (Marie) elk rl31 Viola av Holmes J Clifton (Lula) electn Macon Electric Co r 108 Magnolia Holmes Katheryn sten Macon Natl Bank rl22 Inver- ness av Holmes Ladie maid h206 Elliott (EM) Holmes Leon M (Mazie) mach h201 Newberg Holmes Lewis lab h Bartletts la Holmes Lida rl51 2d Holmes Lizzie (wid Julius) hll Prince Holmes Lauvenia Indrs hl45 Woodcliff Holmes Lucien G slsmn E T Watson rl22 Inverness av Holmes Lucinda (wid John) h Bartletts la Holmes Luther (Mary) lab r80 Bay Holmes Luvenia rl74 W Boundary Holmes Mamie cook r541 Tinsley la Holmes Mark N (Leola) carp hl221 2d Holmes Mary (wid R G) hl22 Inverness av Holmes Mary dom rl40 Bay Holmes Mary Indrs h4 Davis al Holmes Mary Indrs h rear 615 4th av (U) Holmes Mary D Indrs hl03 (123) Mutual av Holmes Mary J cook r459 E Academy (EM) Holmes M L pharm Midland Pharmacy r Y M C A Holmes Nancy Indrs h320 Randolph Holmes Nathan lab h278 2d av (V) Holmes Ola maid Frances Hotel Holmes Oliver C (Mamie) slsmn Odom Realty Co r 117 Lamar Holmes Orce (Nancy) brklyr h515 Plummer's al Holmes Para L Indrs h277 Garden Holmes Pearl smstrs h351 Douglas Holmes Reba rl59 Elizabeth Holmes Sami (Amanda) music hl25 Bartlett Holmes Sophie cook r rear 615 4th av (U) l L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 73 Holmes Taylor r530 Flanders (EM) Holmes Thos (Eliza) lab hll60 Ocmulgee Holmes Till (Henrietta) lab h375 Madison Holmes Victoria tchr r687 College Holmes Walter auto mech r200 (704) Henderson HOLMES WALTER C (Lelia; W R and W B Holmes), Pres The J W Hurke Co, li415 Orange Holmes Wm B (Ethel McK; W R and W B Holmes) h 168 Cherokee av Holmes Wm F insurance agent C M Adams Son r22 Nevarro apts Holmes Willie rl25 Bartlett Holmes W C hlpr r803 Pine HOLMES W R & W B (Walter R and Wm B), Props Macon Dental Depot, Dentists 556 Mulberry, Phone 971 Holse Edith sten r215 Williams Holse Wm A (Edith) car inspr h218 Williams Holsenbeck F Dorsey (Mary) slsmn Fashion Shoe Store hl22 Magnolia Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Holsenbeck Helen E (wid Wiley) h771 Spring Holsenbeck R Ross mgr The Hanover Shoe r771 Spring Holsenbeck Thos R (Maggie) slsmn rl36 Winship Holsey Temple C M E Church 261 Washington av Holston Alice J (wid Elza) hllO Yates av (EM) Holston David (Annie) firemn h441 Douglas av Holston Fredk E (Bertha M) inspr hl20 Bacon Holston Henry G rl074 Walnut Holston Herbert (Fannie) carp rl314 3d Holston Julian formn rllO Yates av (EM) Holston Oliver lab rl60 Madison Holston Sidney (Rezona) lab hl60 Madison Holston Steph student rl314 3d Holt Abner F (Lollie) real est h540 Washington av Holt Abner F jr (Aurelia) real est r540 Washington av Holt Albert S (Mabell) elk h318 Cleveland FOR LISTS OF NAMES * ANY TRADE -- ANY BUSINESS -- ANY PROFESSION (Detroit R. L. POLK & CO. Chicago JS 11^ Your BARRON & REAGAN TAX SPECIALISTS AND ADVISERS J BIBBrRTMEAaLT:YiEBSLtDatGe .Tax Returns GivenT SpeEcLiaEl PAHtOteNnEtio2n13 474 (1925) R. L. POLK & CO.'S Holt Annie M (wid Walter R) h65 Forsyth rd (V) Holt Arlma nurse h219 Pear (EM) Holt Aslean lndrs hlO Orchard av City w>- "r's' * Directory Answers AH Questions as to WHOM You Are Looking For ami ^'wasWngllS1^ (AUrel`a; HOlt & Haabcrr'> r2" H0LTJ A HT olltfCS'eA c-TFreHaso,lt RPreeasl, 0EsLtaM te aratnind YR-Pernetsi,ngJ Agents 569 Mulberry, Phone 22 (See right top lines and page 82) ^ p Holt Benj caller rl336 2d Holt FTMSratlniecri.sMt,rcshsrlsrJld0y9 UCnuiolvnerDry Gds Co rl40 Baconn Holt Frank H co-op student r Y M C A Holt^Giasco blksmith Harrison Huff res Unionville Holt Harriet r427 Hardeman av Holt Harris (Eula) truck farmer h226 Patterson "A 75c Bottle Makes a Quart" WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet I PYORAL flight provoeation. THEY ARE UN? THE BEST MOUTH WASH HDeAeILyYou.r^Fdeonrtissat^leANatDyouuIer *DerVugogfliAstL's Holt H Wrey student r540 Washington av Holt Ida L h322 Orange Holt Inez elk McLellans Store Co r606 Main (EM) Holt Ira C (Alma; Exchange Hotel) chmn Bibb County Tax Assessors h321 New Holt Isaiah r208 Nussbaum Holt Ivison F (Kath) rl40 Bacon Holt Jack (Fannie) gro 208 Nussbaum b do Holt Jas porter rll57 Olgethorpe HOlt(EM)H (ra V) She rePr 291/2 Wal1 h606 Main HOLT JAMES T, Sec-Treas A T Holt Co, hl09 Cul- ver, Y HOltw bldgf\he2w 47 Hardemaffniceav521 Citizens & Sou Bank Holt Jesse R jr reporter R G Dun & Co r247 Harde- man av Holt John H lab hl72 W Boundary Holt Jos soft drinks 210 (166) Green R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 475 Holt Lillian sten Macon Gro Co r Mrs A M Holt Holt Lillian W (wid Benj W) r617 Orange Holt Louis (Ella) ice ctr h340 Tindall av Holt Mamie prin Newberg Sch h728 Napier av Holt Miles F (Ester) supplymn rl40 Bacon Holt Minnie maid bl Damour la Holt Priscilla Indrs r610 Fort Hill Holt Raymond P elk Piggly-Wiggly r247 Hardeman av Holt Rebecca cook r753 Broadway Holt Sarah (wid Richd) rl07 Capitol av Holt Silos (Fannie) presser h339 Monroe Holt Terrell tchr r728 Napier av Holton Archie D (Ina) mech Central Ga Automotive Co h617 2d Holton Geo driver T & T Sausage Co Holton Thos A (Dora) h613 Adams Holt Thos W (Estelle) broker 307 7th r540 Washing- ton av MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Holt Walter (Fannie) lab r612 Peeble Holt Wardine r728 Napier av Holt Wm F r322 Orange Holto Hanberry (A F Holt jr, R L Hanberry) printers 318 Broadway Holton Henry B (Mattie) furn repr h9 Myrtle (EM) Holton John H (Lula) prssr Terminal Tailor & Haberdasher h755 Fort Hill (EM) Home Art Supply Co H A Steinhilper mgr house furngs 306% 2d HOME DEMONSTRATION BUREAU, Rosa McGee Dist Agt, Frances C Lowe County Agt, Ossie Lee Graham Sec, 419 Broadway Home for the Friendless Eva Woodruff matron 266 Maple Homes Leusendie maid L Berg Honea Sylvester V (Jessie V) agt Life Ins Co of Va r258 Maple Hood Cleon L (Ruth) car inspr rl20 Piedmont av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by L POLK 476 (1925) R. L. POLK & CO.'S Hood Edgar M chauf rl02 Whitehead Hood Frank (Exie) lab h712 3d av (V ) Hood Jewell smstrs rl02 Whitehead Hood Marshall H (Marian) eng h873y2 Orange Hood Maude Mrs stmstr Union Dry Gds Co r206 Washington av Hood Ruth sten r850 Courtland av Hooke Maud maid r361 Boardsman al Hooker Ernest 0 (Sadie) dep elk Municipal Court h 167 Ells (SM) Hooker Henry msngr r2104 2d Hooker Jesse C (Mary) pntr h354 Center Hooker John P r2104 2d Hooker Lucille opr Sou Bell Tel Co r2104 2d Hooker Raymond baker Am Bakeries So r2104 2d Hooker Wm E P (Lucy) mldr h2104 2d Hooks Ethel Indrs h777 Reynolds al Hooks Hollie J Mrs h725 Hawthorne Hooks Issie cook r213 Ocmulgee Hooks Jas B (Janie) textile opr h725 Hawthorne Hooks Jas F (Annie) h216 Hydrola Hooks Lavinia dom r4 Harris row Hooks Mattie Indrs h213 Ocmulgee HOOKS THOMAS TV, Prop Central City Hotel and Resident Prop Hotel Lanier, r do Hooks Wm (Mamie) lab r360 Oak Hooks Wm (Anna) lab hl58 Lynwood av Hooks Wm flremn h3 Davis al Hooten Clifford marker Independent Lndry Co r218 Ross Hooten Jewel elk McLellan Stores Co r218 Ross Hooten Lucius B (Annie) agt National Life & Acci- dent Ins Co h494 Orange Hooten Wm F (Mary) furn repr 1123 Oglethorpe h218 Ross Hoover Carl A (Sadie) elk rl974 3d Hopkin Lewis lab hlOO Roberts Hopkin Liza r301 Blount Hopkin Lizzie pdlr rlOO Roberts Hopkins Agustus (Susie) lab h630 Prince Hopkins Alma maid r300 Penn Hopkins Annie lab r248 Morgan av (WH) Hopkins Clarence (Natie) lab h456 Chestnut Hopkins Ernest (Mary) driver h301 Blount Hopkins Frank (Kate) lab hl04 Steins al &C0. Polk Directory Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 477 Hopkins Hattie M (wid Jas R) h255 Orange Hopkins Lemuel E (Camill B) mach h766 New Hopkins Mary cook Phoenix Cafe rl04 Stines al Hopkins Moody plmbr hl21 Park Hotel al Hopkins Richd firemn r355 Elm Hopkins Thos A (Lillian) carp h.103 Washington av Hopkins Wm lab r707 (446) Charles (SM) Hoppendeitzer Hans B (Jewel) mgr Macon Sand Co r Belmont apts Hopper Chas F (Bertha) h364 Spring Hopper Laura C (wid Wm J) r364 Spring Hoppy's Place A S Boynton mgr 320 2d HORGAN DANIEL C (Edith), Prop Idle-Hour Nur- series, Rivoli, Ga, Phone 875-J Horn Billy sihpner r234 Calhoun Horn Eug (Velda) lawyer r463 Napier av Horn Mary lndrs r529 Maynard Horn Stewart (Carrie) greaser hl004 Cedar (U) Hornbuckle Aymer P (Bertha) electn h!22 Birch s pn co vg SOUTH'S LEADING FLORISTS fS o IDLE HOUR NURSERIES Hornbuckle Carol student rl22 Birch Hornbuckle Chas lab rl22 Birch Hornbuckle Ruth sten rl22 Birch Horne Adeline rl012 Clinton rd Horne Augustus E mill wkr r41 Manchester qtrs Horne Alex J carp r2531 2d Horne Buford waiter r279 Ells (SM) Horne Celeste bkpr Fourth Natl Bank r267 High Horne Chas H (Narsis) nursery 114 Ells (SM) h do Horne Chas L (Rosa) millwkr h41 Manchester qtrs Horne Clara rll4 Ells (SM) r Horne Danl W (Harriet) slsmn Macon Coca-Cola Bottling Co rll63 Milledgeville rd Horne Dozier (Amanda) h321 3d av (V) w 0 Horne Edgar rl21 Rutherford av Horne Eliz r358 Madison QP1 *3) Horne Elmer upholmn rl21 Rutherford Horne Emanuel E (Jennie) pdlr h279 Ells (SM) >i Horne Florence (wid John) hl07 Brief ss I . >OR LISTS OF NAMES o" ANY TRADE a-- ANY BUSINESSrANY PROFESSION Detroit R. L POLK & CO. cpicago Horne Frank H (Pearle) elk h420 Cleveland Horne Hammon W (Eula) formn hl21 Rutherford Horne Henrie (wid Arth J) rl26 Knott Horne Jas slsmn Macon Coca-Cola Bottling Co res Route 4 Horne Jas B (Margt) eng h805 Orange Horne Jas E (Velda) lawyer Washington bldg r463 Napier av Horne Jas M (Mary K) r430 Jackson Horne John lab rl07 Brief Horne John D (Margt) bellmn r204 Lynwood av Horne Jos E (Annie) farmer hl!63 Milledgeville rd (EM) Horne Kath opr Sou Bell Tel Co r430 Jackson Horne' Laura missionary rl59 Jeff Davis Horne Leila r2531 2d Horne Lewis r349 Middle (V) Horne Lillie cook 103 Clayton Horne Lonnie H slsmn Ga-Carolina Oil Co r279 Ell (SM) Horne Mamie E (wid Edw) h257 High Horne Mary tchr r257 High Horne Mary E (wid Wm F) h2531 2d Horne Myrtle cook r289 1st av (V) Horne Phillip lab r262 Bright Horne Phillip (Louise) flremn h262 Bright Horne Ruth cook r289 1st av (V) Horne Wm F r358 Madison Horne Wm H h358 Madison Horne Wm M (Lucy) mach Taylor Iron Wks & Supply Co h430 Jackson Horne W Fredk (Irene) carp hl06 Ells (SM) Hornsby Jas P elk r301 Center Hornsby Leo (Pearl) opr h38 Hydrola Hornsby Paul (Annie) mill hd h22 Lake City Hornsby Sami P (Fannie) slsmn h301 Center Hornsby Wm O (Pearl) cond r2007 2d Horton Ada Mrs slsldy L F M Store r448 New Horton Allee sten Jones Park & Johnston r517 Ridge av Horton Barney (Mary) hl531 1st Horton Chas R (Lillian) auto mech r G E Horton Horton David J (Florine) millwkr r Wm Peeler av Horton Dicil Mrs slsldy Dannenberg Co r605 y2 1st 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 79 Horton Ellis millwkr r3-4 Payne av Horton Estes firemn r255 Cedar Horton Frances smstrs h255 Walnut Horton Genie slsldy Dannenberg Co r623 Oglethorpe Horton Geo E (Myrtle) mech h Bailey av Horton Geo R (Alice) eng h610 Duncan av Horton Georgia Mrs rll Bellevue rd Horton G E slsldy W T Grant Co rl35 Gordon Horton Jack B (Sarah H) slsmn Macon Supply Co h 1607 Forsyth rd Horton Jesse C r555 Pine Horton Jos L pdlr r287 Roff Home av (V) Horton Lathie vulc r605)/2 1st Horton Lucius J (Katie; W O Kinney & Co) h517 Ridge av Horton Malissa (wid Ezebuel r21.7 Log Cabin dr Horton Mary (wid E S) r Log Cabin Horton Mary (wid Harry) elk G P Fuller r213 North av (NH) MACON OPTICAL COMPANY Frank H. Johnson Optometrists Opticians 'Jf1 v.,.\ 468 CHERRY PHONE 321 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Horton Marion (Mary) lab h255 Cedar Horton Pauline rG E Horton Horton Pearl mill wkr r3-4 Payne av Horton Polly rl02 Holt av Horton Richd lab r754 Chappell al Horton Tom D (Miranda) house wtchmn Dempsey Hotel rl020 Walnut Horton T Clarence (Ada) flagmn r448 New Horton W D (Ada) mill wkr h3-4 Payne av Horton Wm H mill wkr r3-4 Payne av Horton Wm I (Elrma) welder hl53 3d Horton Wm J (Carrie) opr h662 Hawhtorne Horton Wm K (Dicie) dept mgr Dannenberg Co h 6051/2 1st Horvitz Jos ship elk r215 New Hose Felton H (Clara M) carp rl05 Yates av (EM) Hose Kate lndrs h253 Walnut Hose Leila B (wid Stonewall J) hl89 Magnolia Hotel Arcadia 663 Mulberry Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 480 (1925) R. L. POLK & CO.'S HOTEL DEMPSEY, H M Block Mgr, Cherry ne cor 3d, Phone 4750 HOTEL LANIER., T W Hooks Resident Prop, 525 Mulberry Phone 2771 (See page 69) HOTEL LANIER CIGAR STAND, George W Burr Propr, Cigars, Cigarettes and Newsdealers, Lobby Hotel Lanier 525 Mulberry, Phone 2771 HOTEL MACON, Louis M Rossignol Propr, 815 Mulberry, Phone 4600 HOTEL PHOENIX, See Phoenix Hotel HOTEL SOUTHLAND, A E Weems Prop, H E Weems Mgr, 569-571 Broadway at Plum, Phone 3047 Hougabook Square pdlr r26 Woodcliff Hough Ralph blmn r247 5th House Earl J (Marie) millwkr h27 Manchester qtrs House Jennie lndrs hl04 DeWitt House Leo (Lillie) pntr hl521 2d House Mitchell P (Essie) wtchmn h210 Willingham House Sarah student r210 Willingham Houser C asst ship elk Armour & Co r Central City Hotel Houser Emily 239 Bond Houser Fannie lndrs h218 Hilliard al Houser Ida cook r218 Hilliard al Houser Mary A (wid Wm) h755 Cherry I Houser Peter (Lonnie) driver h722 Daisy X CO Houser Reginald elk Standard Brick & Tile' Co h239 Bond HOUSER WALTER E (Lula), Y-Pres Jos N Neel Co, < h236 Hardeman ay, Phone 2198 Houser F r653 Oglethorpe HOUSER W ERWIN, Treas Macon Ry & Light Co, Treas Macon Gas Co, h755 Cherry Houston Eugenia P Mrs rll2 Cleveland av Houston Frances (wid Wm B) rl5 Willingham Houston Maria lndrs r4 Parker av Houston Thos r812 Edgewood av Houston Wm (Maud) porter hl24 Fatnall la Hovey Edw R (Nina) slsmgr A E Rood Lmbr Co 5B Massey apts Howard Ada lndrs rl27 Raiload av Howard Adell tchr r216 Pond Howard Albert student rl29 (329) Neal av Howard Alex lab rll3 Bonaire Howard Allen (Winnie) opr h!14 Garden Automobile owners are select prospects for many kinds of merchandise. Send to Headquar* ters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH, STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 481 Howard Allie M maid r230 Park Hotel al Howard Alvesta student rl29 (329) Neal av Howard Anna lndrs 321 Hammond Howard Annie lndrs hl04 Holmes av Howard Annie lndrs hl606 1st Howard Arrie maid r411 Douglas av Howard Arth elk L W Rogers Howard Aubrey S asst pressmn Macon Telegraph r W 24 Howard Howard Banister lab rll5 Sycamore Howard Berry (Ola) farmer h444 Alabama Howard Charity lndrs h334 Boardsman al Howard Chas carpenter r411 Douglas av Howard Chas (Ollie) lab h619 4th av Howard Chas slsmn r603 Plum Howard Chas W Rev (Esther) h405 Ward (V) Howard Clifford lab r728 Reynolds al Howard Collins (Louise) headblack setter r Nancy Howard Howard Corley lab r Willie Howard Howard Crystal Mrs supvr Sou Bell Tel Co rl32 Ells (SM) Howard C H mech Dunlap Huckaber Auto Co r860 2d Howard Daisy sten r222 Ayers rd Howard Edw (Mary) driver hl59 Elizabeth Howard Edw jr ice ctr rl59 Elizabeth Howard Ellis lndrs r6 Woodcliff Howard Eliza lndrs h718 Hawthorne Howard Eliz student r592 Duncan av Howard Eliz r594 Duncan av Howard Elsie lndrs hi Davis al Howard Emma lndrs h321 McLearn al Howard Estell maid rl515 Dempsey av Howard Estella r2 Dempsey av Howard Eug pntr r222 Ayers rd Howard Fannie nurse h3 Gunn's al Howard Felton (Occie) porter r920 Ocmulgee Howard Fleming lab hll5 Mosley Howard Florence (wid (Willis) r242 Roye Howard Florence h551 Ward (V) Howard Frances (Howard Produce Co) rl07 Culver Howard Frances C Mrs mgr Howard Produce Co hi Maynard apts FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION dktroit R. I.. POLK & CO. Chicago CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable Cn h-.4- 3n a. Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 as a Ml PUCE THE DIRECTORY IS THE GREATEST MARKET PLACE 482 (1925) R. L. POLK & CO.'S Howard Frank J (Sarah) carrier PO hl29 (329) Neal av Howard Frankie student rl29 (329) Neal av Howard Fred pdlr rl54 Hill Crest av Howard Geo (Martha) lab h314 Mutual av Howard Geo (Edna) chauf r505 Monroe Howard Green (Annie) lab h8 Sparks al Howard Harriet student r W H Howard Howard Harvey (Mattie) carp r419 Douglas av Howard Hattie h808 (202) Pio Nono av Howard Hattie lndrs h398 Johnson's al Howard Haynes lab r57 Davis la Howard Hays (Luvania) lab h43 Virgins la Howard Hays jr lab r43 Virgins la Howard Hazel r342 Madison Howard Henry (Laura) lab h216 Pond Howard Hesiciab lab r726 Nussbaum Howard Horace (Mary) lab h213 Yates al Hward Isaac (Bertha) farmer h217 (230) Roosevelt HI THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year PIMHEBS Howard Jas r813 Daisy Howard Jas (Dora) lab hi Plant al Howard Jas porter A G Rhodes & Son Howard John (Georgia) h72 Plummer's al Howard John (Mattie) auto mech h2 Dempsey av Howard John (Mamie) lab h2 Main (S) Howard John (Mattie) lab hl515 Dempsey av Howard John plstr hl25 Coleman al Howard John B r611-15 2d Howard Jos lab rl28 Curd al Howard Jos W (Esther) mach Wade & Co h771 New Howard Josephine cook A G Spener Howard Josh blksmith r318 Hammond Howard Julian P bkpr J M Dasher Lmbr Co rl30 Appleton av Howard J Robt (Sarah) elk Piggly Wiggly h690 Col- lege Howard J Henry (Willadel) mech hll9 McGee Howard Laura cook hll5 Sycamore Howard Lee (Sadie) chauf h342 Madison Howard Leila lndrs h205 Kitchens Howard Leola cook r4 Tinsley la Howard Lillian cashr Chapman's Pharmacy r664 Elm Howard Lillian student r435 Douglas av Howard Lily lndrs h!26 Holmes av PoUtDuscbi'uSK A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 Vz CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 483 Howard Lizzie cook Mil Douglas av Howard Lizzie maid r rear 123 Broad (EM) Howard Love lab r334 Boardsman al Howard Maggie lndrs r456 Hall Howard Maidie student r W H Howard Howard Marie lndrs r530 Sparks al Howard March (wid Lee) lndrs r224 Green Howard Martha rll5 (121) Green Howard Mary h592 Duncan av Howard Mary lndrs rl9 Kahn's al Howard Mary sten r612 Oglethorpe Howard Mattie lndrs h474 Chestnut Howard Mattie F nurse r314 Mutual av Howard Melton (Lilia) pool room h304 Telfair Howard Milton H (Lillie) mgr Star Billiard Parlor h 304 Telfair Howard Mollie maid r402 (302) Charles (SM) Howard Morris (Mary) lab hl07 Movie la Howard Munn r959 Oglethorpe Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service DOORS SASH, DO ggs tn s * ** a- SCREENS Howard Nancy (wid Henry) h Morris (B) Howard Norman R mgr United Auto Co r592 Duncan av Howard Ola maid r522 Fulton la Howard Oscar (Martha) brkmason h419 Douglas av Howard Peggie cook h262 3d av (V) Howard Perry (Geneva) h606 (300) Crisp Howard Peter (Lonnie) driver S Jones Co r722 Daisy Howard Produce Co Mrs F C Howard mgr 346 Poplar Howard Ralph auto mech r592 Duncan av Howard Robt (Mary) b.903 Ash Howard Robt (Carrie) lab r309 Campbell av Howard Robt (Mary) lab h341 2d av (V) Howard Roberta L student r690 College Howard Rody lndrs h206 Massee la Howard Rosa B maid R S Thorpe & Sons Howard Rosetta lndrs h620 Hammond Howard Roxie lndrs h456 Hall Howard Roy lab r43 Virginia la A E* I DAYS I rYLE I U 1 JI CREDI1 406 THIRD ST. TEL. 3026 0 c o Jfl ^ J0wJ2 wJJ02 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. < d 13 H I/I fig yj o * g .s h gy * M M^b-. o02 aZ < < ox 0. 484 (1925) R. L. POLK & CO.'S Howard Sami lab lil53 (100) Neal av Howard Sami butler rllO Bell av Howard Sarah dom hll3 Bonair Howard Sarah slsldy W T) Grant Co r426 Jackson Howard Sidney P electn H B Lowe Electric Co r359 Church (EM) Howard Steph P (Mary) hl30 Appleton av Howard Sylvia lndrs hl28 Curds al Howard Sylvia nurse r262 3d av (V) Howard Thos (Ida) lab hl6 Short st la (EM) Howard Thos lab r79 Craft la Howard Thos H (Lela) blksmith h222 Ayers rd Howard Tobe housemn Wilson & Co Howard Trunia r959 Oglethorpe Howard Walter (Lucie) lab h Morris (B) Howard Walter C (Lula) police h359 Church (EM) Howard Wesley W (Mary) slsmn Singer Sewing Mach Co h592 Duncan av Howard Wilber lab r Walter Howard Howard Wm (Bertha) chauf h612 4th av (V) Howard Wm (Mannie) lab h rear 1315 2d Howard Wm (Eula) porter h214 Short (EM) Howard Wm F (Martha) porter r254 Middle (V) Howard Wm H (Lula) agt Interstate Life & Acc Ins Co h Log Cabin hts Howard Wm S sexton rlOl North av (NH) Howard Willie (wid Wm) h Industrial Home rd Howard Winton lab r359 Hawthorne Howell Adam (Susie) h867 Edgewood av Howell Albert M chf eng and electn r715 College Howell Allie r38 Shell av Howell A Veazy slsmn Remington Typewriter Co Howell Connossie (Ethel) barber 1:61 Fifth h415 Middle (EM) Howell Forrest (Lula) trainmn Macon Ry & Light Co h229 Telfair Howell Henry L (Bessie) agt Bankers Health & Life Ins Co hl42 Laurel av (NH) Howell Hubert D (Irene) auto repr 611 3d h551 Main (EM) Howell Jas student rl36 Highland av Howell Jas H cond r616 Arch Howell John P (Kate) blrmkr hl36 Highland av Howell Katie lndrs h428 Monroe Howell Martha (wid Starling) r647 Ash Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 485 Howell Marvin (Anna) mill opr b.40 Shell av Howell Myrtle h38 Shell av Howell Orbin D (Annie) elk C of G R R Co za Howell W Dan elk City & Sou Bank r763 Poplar TTnwinsrtoxi Curran H macli rl23 Knott Howington Lehman M (Lurline) stmftr r603 Plum Hnwineton Wm M (Pauline) pntr hl23 Knott Ksef Nathan (St'ella) lab H201 Elliott (EM) Howton Wm C (Stella) contr (cement) h653 2d Hoyal Jas C (Alma) mill wkr r72-73 Davis Hoyt Edw W Rev (Addie) pastor Antioch Ch h307 Henderson Hoyt Jas hlpr r307 Henderson Hoyt Laura r307 Henderson Hoyt Joe hlpr r307 Henderson Hoyt Louise smstrs r307 Henderson Hoyt Nellie sch tchr r307 Henderson Hub Amanda lndrs h268 Pear (EM) Hub Fish & Oyster Co J K Gooding Mgr 349 7th 2 ? o 3 OQ a3 sr DC w C 3 cn O > G OVERLAND 0 FRANKLIN YATES MOTOR CO. WILLYS-KNIGHT 707 THIRD ST. PHONE 1446 AUTOMOBILES P** (D Hub Spehman cook r268 Pear (EM) Hubanler Willie (wid. Oscar) maid r603 Prince Hubbard Benj (Minnie) carp h648 Peeble Hubbard Chancy M (Lucy) police h805 Woolfolk Hubbard Clara elk r206 Amos Hubbard Cora L sten rl78 Palace av . Hubbard Dallis (Pearl) clo clnr 38 Wall rl51 Frank- n ro H Hubbard Edinburgh (Susie) gro 609 Fort Hill h607 do Hubbard Edinburgh jr lab r607 Fort Hill Hubbard Edw lab h555 Chestnut la Hubbard Edw B flagmn r805 Woolfolk Hubbard Elbert lab r436 Chestnut Hubbard Euginia r310 Cedar (SM) Hubbard Fenie' M (wid Chas W) h258 Orange Hubbard Frank h200 W Boundary Hubbard Guy carp rl78 Palace av Hubbard Hercules (Mary) lmbr stacker r2 Ross st pi oc h O CO H O FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1 a* . CP MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 486 (1925) R. L. POLK & CO.'S Hubbard Jessie L auto mech r310 Cedar (SM) Hubbard Josie nurse r436 Chestnut Hubbard Leola drsmkr rl03 Cleveland Hubbard Nellie r310 Cedar (SM) Hubbard Peter J (Mamie) lab hl76 Palace av Hubbard Robt A (Arrie) slsmn h301 Hanson Hubbard Robt H (Emma) mech hll7 McGee' Hubbard Rosebud student r4 Gunn's al (V) Hubbard Sami (Janie) carp h436 Chestnut Hubbard Sonnie (Sallie) soft drinks h436 Chestnut Hubbard Terrell auto mech r310 Cedar (SM) HUBBARD UNDERTAKING CO THE, C Ei Berry Propr, C E Singleton Mgr, Undertakers and Em- o83i8n4?earnsd 468 Cotton 1495-J (See apva,geP6h6o)nes Day 997, Night Hubbard Viola lndrs h418 Hawthorne Hubbard Wm H lab r4 Gunn's al (V) HUt>*(SM)Wm J electrical eng h310 Cedar Hubbard Wilson H (Georgia) wtchmn hl78 Palace av HubbeH Geo W (Eveline) sec-treas Macon Cooperage Co h663 Napier av & Hubert Wm (Minerva) lab h21 7th HUCKABEE LEO B, (Marjorie), V-Pres Dunlap- Huckabee Auto Co, li Osborne pi, Phone 4802-J Huckaby Edw (Mary) carp h Rockledge av nr Robin- mson rd Huckaby Laura (wid Jeff) h Robinson nr Rockledge Huckaby Thos lab r Edw Huckaby Huckaby Wm M (Dora) pdlr r rear of 330 Dempsey av Hudgmgs Chas. (Myrtle) pntr h244 Willingham Hudgmgs Harriett C dietitian Wesleyan College r do Hudgmgs Wm G (Willie) mldr Taylor Iron Wks & Supply Co h665 Ash Hudson see also Hutson Hudson Alice maid r426 North Hudson Beauty Mrs opr Sou Bell Tel Co r206 Center Hudww^n-it?eenj F mech DunlaP Huckabee Auto Co r340 Hudson Bessie Mrs opr Sou Bell Tel Co r206 Center Hudson Carrie lndrs h203 Elm HUDSON CARS, Sparks Motor Co Distributors, 550 Broadway, Phone 4787 A^atura! by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. L. P0Lk & CO., Octroi IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 487 Hudson Chas (Johnnie) carp hl005 Ocmulgee Hudson Chas D student r Clinton rd Hudson Chas N (Flossie) contr h Clinton rd Hudson Clifford F (Beauty; Shadburn & Hudson) r 206 Center Hudson Cornelius (Zeda) carp h225 Patterson Hudson Danl E (Abbie) eng r721 Oak Hudson Gwendolyn slsldy Burden Smith & Co r356 Hanson Hudson Harry C (Ola) mach h316 Giles Hudson Harry H (Juanita) U S PO inspr h429 John- son av Hudson Henrietta lndrs r608 Broad Hudson Industrial School B S Ingram prin Monroe and Jefferson Hudson Ivey ship elk r667 Mulberry Hudson Jas (Sally) lab h245 Whitlock Hudson Jas (Abbie) porter h532 Inlanders (EM) Hudson Jas C (Bessie) pntr h206 Center Hudson Jerry F truck driver r334 Ross Hudson Jesse (Lula) lab h213 Frank al Hudson John barber r255 (155) Center Hudson John E (Eunice) eng h353 Center HUDSON J RICHARD (Adelaide), Mgr The Letter Shop, hlOl Yineville av, Phone 110 Hudson Lavorja lab r556 Henrietta Hudson Leila lndrs h7 Cherokee av (SH) Hudson Leila maid hl09 (7) Braswell la Hudson Louise sten Adam Bros Co r373 Clinton Hudson Luther T (Lona I) fnshr Muecke & Sons Co Inc r467 Cotton av Hudson L A slsmn Carstarphen Whse Co res R F D 5 Hudson Mattie h611 4th av (V) Hudson Melerela maid r556 Henrietta Hudson Mollie (wid Thos) h706 Pine Hudson Ned (Sara) agt N C Mut Life Ins Co r449 Broad Hudson Nicholas C (Mary) truck driver h334 Ross Hudson Otis M r316 Giles Hudson Pearl (wid John) rl25 Nottingham dr Hudson Rich (Maggie) rl65 Hazel Hudson Richd (Adelaide) rlOl Vineville av Hudson Richd lab hi 18 Powell (EM) Hudson Robt B (Bertha) edgemn h241 American blvd FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 488 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Hudson Robt W (Eliza) cabinet mkr res Lorane rt 1 Hudson Rosa student r556 Broad Hudson Rupert C (Ida M) electn H E Lowe Electric Co rl065 Walnut Hudson Ruth mgr Barker's Bakery E M br r317 Main (EM) Hudson Sarah G sten Atlanta Life Ins Co r449 Broad Hudson Schiller R (Sarah) pntr h402 Church (EM) Hudson Wm (Lula) lab h556 Henrietta Hudson Wm (Laura) lab h502 (501) Chappell Hudson Wm (Everlene) lab h453 Johnson's al Hudson Wm A (Evie M) firemn h613 Adams Hudson Wm R (Roxie) carp h.356 Hanson Huette Mack D (Auddia) barber Dempsey Barber Shop h240 Chestnut Huette Maggie Mrs r212 Jackson Huey John O (Lillian) v-pres Bankers Health & Life Ins Co hl24 North av (NH) Huey L M agt Bankers Health & Life Ins Co Ellis Howard rd (WD Huey Virgil O (Iris) agt Bankers Health & Life Ins Co rl36 Cole Huff Ben H (Bertie) contr h3308 Houston av Huff Clark lab 1x22 Wall st la Huff Fannie nurse h3011st (EM) Huff Geo lab r22 Wall st la Huff Harrison blksmith 996 Columbus rd res Union- ville Huff Jas (Ella) mach h203 Telfair Huff Jas B hlpr r3308 Houston av Huff Lawrence (Lulabell) lab h2 White al Huff Lucius P (Mamie) car repr 302 Newberg Huff Mary maid r260 Madison Huff Sami (Lula) janitor hl23 Rock Hill la Huff Sidney delivery boy r301 1st (EM) Huff Vandavill (Lottie) plstr h327 2d av (V) Huff Wilford G (Mae) slsmn J B Riley Drug Co hl95 Boulevard av Huff Wm bakers Am Bakeries Co Huff Wm L mgr L W Rogers Co 456 2d av Huff Wm P (Ruby L) bldg contr 26 S College h do Huff Wnider C (Lucille) barber Palace Barber Shop h863 Elm Huffman see Hoffman Hugeley Emory (Charlie) shoe repr r724 Campbell av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 489 Huggins Essie student r208 Middle (V) Huggins Mary cook r208 Middle (V) Hughes see also Hewes Hughes Arrie rl92 (333) Neal Hughes Augustus L (Hattie) lieut MFD No 6 hl069 Hazel Hughes Benj (Effie) lab h270 Madison Hughes Caroline nurse r714 New Hughes Clarence opr rl50 Hydrola Hughes Cora B phone opr rlOl St John Hughes Estel do mrll2 (10) Jordan Hughes Eug lab r528 Grant Chapel al Hughes Florence maid rl42 Carling av (HH) Hughes Fredk lab rll2 (10) Jordan Hughes Geo opr rl50 Hydrola Hughes Hayward C pharm Palmetto Pharmacy r804 Orange Hughes Horace lab hl64 Plummer's al Hughes Jack driver M El Elliott Whse Co Hughes John (Lovancy) lab h302 Penn (V) Hughes John (Sallie) shoe mkr hl92 (333) Neal av Hughes John S (Pauline) lawyer 513 Bibb bldg hl200 (1136) Edgewood av Hughes John H (Margt H) mldr Taylor Iron Wks & Supply Co hl57 Magnolia Hughes Kittie C (wid Edward W) hlOl St John Hughes Lela maid hl25 (150) Green Hughes Lizzie lndrs hl42 Carling av (HH) Hughes Lovie (Ellen) chauf h272 Madison Hughes Margt student rl92 (333) Neal av Hughes Mose (Bessie) lab h604 Ross Hughes Mannie maid r rear 220 High Hughes Percy (Ruby) lab h71 Schofield Hughes Richd (Rosa) ice slsmn h426 Flanders (EM) Hughes Sami E (Mary) h301 Ells (SM) Hughes Taylor carp rl92 (333) Neal av Hughes Tillman (Isabelle) lab hll2 (10) Jordan Hughes Wess (Fannie) lab h807 Elbert Hughes Zac driver W F Elder Lmbr Co res R F D 1 Hughley Anna cook h204 Gant City rd Hughley Chas (Pearl) lab h614 4th av (U) Hughley Marie cook r204 Gant City rd Hughley Wesley lab r204 Gant City rd Hughes Walter (Lucile) hl73 Dempsey Huguenin Ed (Mary) r71 Arlington pi A natural by-product of the Directory! Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do If Right BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 490 (1925) R. L. POLK & CO.'S R P Huguenin Mary R (wid E D) h71 Arlington pi Huguley Mary tchr rl08 Montpelier av 0 L Huguley Minnie (wid M L) rl08 Montpelier av Huguley Chas M (Claire) lawyer r736 College Huguley Rebecca student rl08 Montpelier av L U Huguley Virginia rl541 2d Huguley Wm (Annie) b.431 Forest av (V) L M Huhn Christian (Annie; C Huhn & Son) h452 Walnut Huhn C & Son (Christian and M W Huhn) hdw 408- 10 Mulberry E B Huhn Frank firemn r452 Walnut Huhn Henry R (Margt; H & H R Huhn) hll03 Wal- R I nut Huhn Herman (Sadie; H & H R Huhn) h243 Duncan av N Huhn H & H R (Herman and Henry R) locksmiths 422 2d Huhn Julius H elk C Huhn & Son r452 Walnut & G Huhn Nell student r243 Duncan av M 1 L L i R 0 N S "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuYoarTup.nHrrgdouYdFvmeoeo. nlcrsaTtasisathstiaritoiclesen.A,niaNsoTtIDtafHyaEUotdhhuYaSerenEyagDAlePtbrRrhYulyEegsOeigpdgRUiinsAnNatok'Llns-., H Huhn Walter M (C Huhn &Son) r452 Walnut Hulburt H M solr Independent Lndry Co h Fairview E av cor Appleward Hulgan Jos L (Margt) electn rl519 3d A HULL FRANK S (Edith), Sec-Treas A S Hatcher Co, lil85 English av, Phone 4770-W Hults Clarence shoe repr Geo Bostock r Ga Industrial T Home Hummel Albert bkpr Happ Bros Co r501 Forsyth Hummel Albert N slsmn Jos N Neel Co h501 Forsyth I Hummel Bernard elk Jos N Neel Co r501 Forsyth Hummel Lucian archt r501 Forsyth N Hummel Lucy r501 Forsyth Hummel Willie r501 Forsyth Humphrey Mary cook h317 (335) 1st av (V) G Humphrey Robt L (Pearl) hl333 2d Humphreys Birdie student r200 Ridge av Humphreys Chas H (Mary) city elec eng h681 College Humphreys Cora cook Masonic Home 415 Third Phone 5113 FOR LISTS, OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION C DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 491 Humphreys F Henry (Mattie F) coml agt Sou Ry System h200 Ridge' av Humphreys John (Ida) h652 4th av (U) Humphries Annie smstrs h415 Monroe Humphries Chas C (Mattie) pres So Box & Basket Co h728 Ridge av Humphries Chas L (Ida) farmer hl014 Clinton rd Humphries Eug slsmn Sou Dry Gds Co r361 1st Humphries Homer W (Ruth) bkpr Fourth Natl Bank h204 Plant Humphries Ida R Mrs florist hl040 Clinton rd Humphries Jas elk RMS r606 2d Humphries Josie' h513 Forsyth HUMPHRIES J CHARLTON (Annie), Humphries Sheet Metal Works, res R F D 3 Humphries Lassie student r728 Ridge av Humphries Lorena student r261 Orange1 Humphries Louis (Miltie) pipeftr hl31 Telfair Humphries Mamie slsldy Snyders Ready to Wear r 569 1st MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Humphries Matilda maid r768 Ocmulgee Humphries Medie (Marie) lab h321 Williams Humphries Patsy maid rl31 Telfair Humphries Sarah Indrs rl35 Hazel HUMPHRIES SHEET METAL WORKS (J C Humphries), Tin, Tile, Slate, Cornice, Skylights, Ventilators, Gutter Conductors 517 8d, Phone 985 (See page 85) Humphries Spencer (Bessie) swtchmn h450 Martha (EM) Humphries Wm lab r26 Malloy's al Humphries Wm lab r349 Hammond Humphries Wm C student r728 Ridge av Hunley Lee carp r la Violet av Hunnicutt Annie (wid T F) hlOl Nelson Hunnicutt Bessie student r246 Ellis ((SM) Hunnicutt Burney elk rl25 Gates av (EM) Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERL They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work R. L. POLK & Company CABINET MANTELS, TILE, GRATES, ETC. _ co CO a S-i 492 (1925) R. L. POLK & CO.'S Hunnicutt Carrie B> cashr Union Dry Gds Co h403 Main HUNNICUTT CHARLES H (Irma T), Pres C H Hunnicutt Clothing Co, h535 Yineville av, Phone 3208-W Hunnicutt Clarence H msngr boy rol6 Montpelier av Hunnicutt Clifford J (Mildred) cond hl07 3d av (WH) Hunnicutt Cliffiord J jr student rl.07 3d av (WH) Hunnicutt Cornelia housekpr r422 Vineville' av HUNNICUTT C H CLOTHING CO, C H Hunnicutt Pres, Men's and Young Men's Clothing, Hats, Hart, Schaffner & Marx Clothes 317-319 3d, Phones 276 and 943 (See right side lines and page 58) Hunnicutt Edw R (Maud) mill wkr Dixie Roll & Cot Co hl24 Garden Hunnicutt Geneva bkpr rl25 Yates av (EM) Hunnicutt Harry chauf rl24 Garden Hunnicutt Hattie opr r214 Hydrola Hunnicutt H Dalton r246 Ells (SM) Hunnicutt Jacob I (Gladys) flagmn h518 Giles Hunnicutt Jas P (Emma) gro 516 Montpelier av h do Hunnicutt Jas T (Estelle) macb hd Macon Lmbr & Mfg Co h328 Shamrock Hunnicutt Jasper pipe ftr rlOl Nelson Hunnicutt John W (Clara) blksmitht h454 New Hunnicut Jos W (Anna) firemn h403 Main (EM) Hunnicutt J Frank (Lennoh) mech h243 Belmont av Hunnicutt Kath cashr rl068 Ash Hunnicutt Lucile student rl07 3d av (WH) Hunnicutt Luther H (Annie) pntr hl25 Yates av (EM) Hunnicutt Mary L student r403 Main (EM) Hunnicutt Mollie (wid Howell C) hl068 Ash Hunnicut Noami slsldy Leis Dept Store r811 Oak Hunnicutt Ola slsldy Barker Bakery rl068 Ash Hunnicutt Robt W (Eliz) h861 Oak Hunnicutt Rosary sten rl24 Garden Hunnicutt Sarah lndrs h426 Lawton av Hunnicutt Wm 0 (Florence) city firemn h246 Ells (SM) Hunnicutt W Sidney (Wyline) flagmn rll27 Walnut Hunp Nicie lndrs h355 North Hunt Albert (Lillie) truck driver h.278 4th av (V) Hunt Bertha lndrs r49 White | FOR LISTS OF NAMES j ANY TRADE -- ANY BUSINESS -- ANY PROFESSION j DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vz% on Savings MACON CITY DIRECTORY (1925) 493 Hunt Byron J (Annie) contr h412 Winship Hunt Clara lndrs hl58 Glen Hunt Dossie elk r463 Napier av Hunt Edw D wtchmn r818 Oak Hunt Edward D jr hlpr r818 Oak Hunt Eliz elk Yates and Tabor Co r Oak and Ridge av (I) Hunt Emma cook 266% Broad (EM) Hunt Eunice J Mrs bkpr Yates and Tabor Co r Oak and Ridge av (I) Hunt Fred r207 Holt av Hunt Geo basket mkr r Clinton rd Hunt Geo (Florence) lab hl3 Malloy's al Hunt Jas sawyer r58 Spring Hunt Jas R Rev (Mattie) pastor Free Will Baptist Ch h!59 Jeff Davis Hunt Jeff B (Lucia R) eng h520 Orange Hunt John (Lucious) porter h342 Maynard Hunt John jr r342 Maynard Hunt Levi (Hattie) carp hl72 Aston (EM) Hunt Lizzie maid rl21 New Hunt Lonnie r412 Winship Hunt Ludelle student rl416 Oglethorpe Hunt Lula lndrs hll6 Cowan Hunt Maggie hlpr S M Grimes Hunt Melvin lab r348 Maynard Hunt Melvin L (Eula) hl37 Rembert av Hunt Mollie rlOO Corbin av Hunt Nannie E elk Murphy Taylor & Ellis ^14% Rogers av Hunt Robt (Leola) pdlr hl25 Phillips la Hunt Robt H (Lucie) trav slsmn hll4i/2 Rogers av Hunt Rufus B (Alice) overseer h207 Holt av Hunt Susie' lndrs hl26 Reynolds al Hunt Thos E (Dossie C) trav slsmn h463 Napier av Hunt Thos J (Elnora) barber 413 Cotton av h705 3d Hunt Virgil (Flora) pdlr h6 Phillips la Hunt Wallace P (Jennie F) yd supt h28 S College Hunt Wm G (Annabelle) eng h516 Oglethorpe Hunt Wm H (Mary) lab h348 Maynard Hunter Aaron (Hattie) lab h3 Center (EM) Hunter Albert (Mattie) barber J A Braswell r7 Chap- pells al Hunter Bertha lab h206 Turpin Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke POLK'S dental !WRsCteea"gn,asidstaatteers ^'TH"fIRmflTRtEiDoEYNnTEHA L1.up,90L2k *5co. f^ECIOUS PSjeERYtaFOlRsM Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 494 (1925) R. L. POLK & CO.'S Hunter Eug (Hattie) eng Willingham Sash & Door Co r208 Elliott Hunter Fannie (wid Adams) cook h224 Hill Crest av Hunter Florence maid r224 Hill Crest av Hunter Georgia lndrs h210 McLean al Hunter Hollis Rev (Annie) pastor Unionville Baptist Ch r324 Elizabeth Hunter Howard 0 (Mary L) regional scout executive POLK'S Mercer University h496 Hillyer av Hunter John (Fannie) lab r312 (306) 1st av (V) Dental Hunter John R (Victoria) farmer hlOl Tindall av Hunter Josie cook r813 Ocmulgee Hunter Laura r75 Ernest Register Hunter Lou (wid C) r234 Waterville rd OF THE Hunter Mamie cook C Nottingham h6 Dishroom la Hunter Mariah cook h821 3d UNITED Hunter Pars C (Florine) mgr hl08 Delaware av STATES AND Hunter Reuben (Jimmie L) lab h620 Chapman al Hunter Sami B (Kitty; Hunter & Daly) h329 North av (NH) CANADA Hunter Susie dom r46 Massee' la Hunter Sylvester (Missie) section hl67 Waterville rd Hunter Victoria maid r30 Woodliff 1925 Hunter Wm (Mary) h324 Elizabeth Hunter Wm gdnr h Burton av Hunter & Daly (S B Hunter Augustin Daly) lawyers The Splendid 5 Hardeman bldg Hurlbert H M solr Independent Laundry Co Features of Hurlbert Jack (Bertha) chauf rll5 Fairview Past Editions Hurley Amos (Fannie) plstr hl02 Mutual av are retained, Hurley Lelia lndrs hl49 2d av with much New, Useful and Hurley Madge rl27 High Hurley Margt Ei (wid John) hl27 High Hurlev Rofot W (Ruth) electn 452 Cotton av h Forest Hill av Interesting Hurley Thos A (Mary) phys 420 Bibb bldg h Jackson Data added. Spring dr Hurndon Essie lab hl22 Edison Hurse Morgan (Rachel) lab hill Penn Hurst Belle (wid R L) hl09 Academy R. L. Polk Hurst Bernice tchr r203 Ridge av Hurst Carolyn student r203 Ridge av & Go. Hurst Ellis r812 y2 2d Publishers Hurst Inez opr Sou Bell Tel Co r812% 2d 536 S. Clark St. Chicago, 111. E. R. PEARCE TOPS BUILT anCdARRSEPAANIRDEDT.RTUACIKLSORp-MaiAnDteEdSEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS - TRUCKS - TRACTORS hIffoarviet'asit.aFoFrodr,d woer PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 495 Hurst John J (Lula) mech Beeland-Conrad Motor Co h812% 2d Hurst John P (Clyde) elk P 0 hl4 Marion pi (HH) Hurst Lois tel opr Dempsey Hotel r812i/2 2d Hurst Lula instr Sou Bell Tel Co r812% 2d Hurst Needham W (Ethel tchr h203 Ridge av Hurst Oliver (Mollie) lab r750 Sparks al Hurst Robt F rl09 Academy Hurst Roy L Rev (Ruby) h252 Oakland av Hurst Ruth cashr L K Liggett Co rl32 Piedmont av Hurston Ora lndrs h415 May av Hurt Paul W (Payton) mgr Macon Brokerage' Co h252 Orange Hutchens C P (Ruby) h647 Forsyth Hutchings Ben (Eliza) draymn r283 Raye HUTCHINGS CHARLES H (Eliza; C H Hutchings & Sons), li239 2d av (Y), Phone 1528 HUTCHINGS C H & SONS (C H, W P and F J Hutch- ings), Undertakers and Emhalmers 510 Cotton av, Day Phone 2044, Night Phones 1528 and 8728 (See page 67) HUTCHINGS FRANK J (Carita; C H Hutchings & Sons, r239 2d av (Y), Phone 1528 Hutchings Jacob (Zelphia) ice ctr h506 Cedar (Unionville) Hutchings Janie P (wid Sami W) h303 Milsado av Hutchings Lucy r2434 Strayers al Hutchings Lucy cook r2436 Strayers al Hutchings Ralph (Janie) lab h2436 Strayers al Hutchings Virgil R rural carrier P 0 r303 Mikado pi Hutchings Wm (Willie) hlpr h665 Ash HUTCHINGS WM P (Essie? C H Hutchings & Sons), h206 Madison, Phone 3728 Hutchings Willie Mrs b.424 Johnson av Hutchins Alma r426 (23) Short (EM) Hutchins Daisy lndrs h426 (23) Short (EM) Hutchins Eug (Lucy lab h521 Maynard Hutchins Geo K opr r 4Gustin pi Hutchins Jas r426 (23) Short (EM). Hutchins Jas (Lillie) chauf rll3 Kitchens Hutchins Janie cook h539 (530) 3d av (V) Hutchins J S collr Sou Ry r652i/2 Cherry Hutchins Lena lndrs h.3 Mitchell la Hutchins Nettie r851 Ash Hutchins Roxie lndrs r521 Maynard More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by f R.LP0LK &C0. Polk DirectoryBldg. Detroit, Mich. U CLLT3 KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 496 (1925) R. L. POLK & CO.'S Hutchins Ruth sten Sou Bell Tel Co r237 Carling av Hutchins Sally lndrs hll3 Kitchens Hutchins Willie r851 Ash Hutchinson Annie (wid Benj F) r240 Chestnut Hutchinson Harry L (Claudia) real est rl005 3d Hutchinson Letitia cook Bartlett Crosby Hutchinson Wm carp r409 Elm Hutchison A Leon (Elsie) sta mgr Flournoy Auto Co hl22 Magnolia Hutchison Elsie Mrs opr Sou Bell Tel Co rl22 Mag- nolia Hutchison Inez dom rl52 College Hutchison John H (Carrie) mill hd hl6 Bibb av Hutchison Raymond E optician Macon Optical Co r 318 New Huthnance' Edna M tchr r747 College Huthnance Edw D (Alice) trav slsmn h747 College Huthnance Eliz sten U S Vet Bureau r2322 2d Huthnance Francis A elk P O h2322 2d Huthnance Francis A (Anna) elk P O h2322 2d Huthnance Guy (Evelyn) bkpr Ga Loan & Trust Co r404 Napier av Huthnance Jodie r800 Orange Huthnance' Lena slsldy Union Dry Goods Co r800 Orange Huthnance Marcarius sten r2322 2d Huthnance Mary student nurse r2322 2d Huthnance Melba A sten Bagley Willett & Paine r747 College Hutson see also Hudson Hutson John H (Connie) trucker h232 Jordans al Hutson Noll carp r221 Chappell Hutson Tom (Jannie) auto mech h Gordon Hutt Robt (Maggie B) lab rl4 Park Hotel al Hutto Eliza (wid Elve) rl325 Broadway Hutto Jas J (Clyde) mill wkr h.32 Manchester qtrs Hutto Jas W mech h421 Lawton av Hutto John C carp r American blvd Hutto L C blksmth J W Gunn rl325 Broadway Hutto Riley B (Adeline) h American blvd Hutto Wolsey D mill hd r American blvd Hyatt Hadie (Katie) mill opr h419 Shell av Hyatt Jas P (Susie) cond h.2403 2d Hyatt Jas P jr sten Cit & Sou Bank r2404 2d Hyman Carmen r!35 Winship Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r tcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,ibleDleELdTisaRttsaO..ITOA, uMsrkInCfeHowr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 497 Hyman Geneva rl436 2d Hyman Geo (Eva) carp -r320 Ellis av Hyman John H (Gussie) bldg contr hl35 Winship Hymes Emanuel lab h855 Smith row Hysler Evelyn E (wid Tom) r907 Elbert Hysler Geo (Nora) r442 Lawton av Hysler Wm H (Marie) custodian hl25 Dixie av I 0 0 F Building 515 2d I 0 O F Hall 509 Mulberry IDEAL BATTERY CO, E E Smith Mgr, Repair, Sales and Service 256 2d, Phone 4951 (See right top lines and page 52) Ideal Creamery Abner L Mims mgr 603 Linden av IDEAL LAUNDRY CO ,J T Moore Pres, T I Harris Y-Pres, R W Moore Sec, R A Moore Treas, E M Moore Mgr, Ocmulgee ne cor 1st, Phone 584 Ideal Storage Service (Mrs M M Massey) 415 Mulberry Ideal Supply Co W T Turlington pres-genl mgr T E Young v-pres J T Stewart sec-treas plmbrs supplies 521 Mulberry Idette Leola lndrs h542 3d av (V) Idette Wm (Lula) lab h258 4th av (V) Idle Hour Country Club 0 J Massee pres A F Wilson mgr 7 miles n of city on Forsyth rd IDLE HOUR NURSERIES, D C Horgan Prop, 109 Cotton av, Phones 228 and 224, Greenhouses Rivoli, Phone 875-J (See right center lines and page 65) Imperial Loan & Real Estate Corp Mrs H M Tabor pres 406 Poplar Independent Chemical Co 0 H Fox supt O H Fox supt Polpar near 12th INDEPENDENT LAUNDRY CO, P E Hertz Pres, Isaac Flatau Y-Pres, A W Voight Sec-Treas, C H Campbell Snpt, Sanitary Dry Cleaners and Dyers 452 2d, Phone 1000 (See page 73) Industrial Life & Health Insurance Co J F Lazenby supt 151 Cotton av INDUSTRIAL LOAN & INVESTMENT CO, J W Ramsey Pres, 0 R Tharpe Sr V-Pres, C B Griffin Sec-Treas, 153 Cotton av, Phone 2883 Ingam Earl lab r244 Division st la FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALF,TECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 Dim as a MMLT PUCE THE DIRECTORY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where AH Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Mm&Co PIMM 498 (1925) R. L. POLK & CO.'S Ingham Ralph E (Annie) rep F S Royster Guano Co h549 Boulevard Ingle Jas B (Eliz) eng hl7, Nevaro flats Ingle Mildred student rl7 Navaro apt Ingleside Methodist Church 428 Ridge av Inglls Mary A (wid John) h508 Walnut Ingram Azee r Jas Ingram Ingram Beryl S (Marie) prin Hudson Industrial Sch h200 Douglas av Ingram Burrell (Nora) chauf h707 3d av (V) Ingram Chas (Willie) carp h.852 (854) 3d av (V) Ingram Chas jr student r852 (854) 3d av (V) Ingram Clara lb r504 Elbert Ingram Davis (Annie) farmer h240 North av (N H) Ingram Edw lab h rear 223 Orange Ingram Ellen T Mrs cashr Dempsey Hotel r771 New Ingram Emma smstrs h218 (212) Farguson Ingram Fredk M (Geraldine) dentist 472 2d hll5 Rembert av Ingram Fronia cook r Jas Ingram Ingram Geo slsmn r400 Forsyth Ingram Hattie mill wkr r Jerry Collins Ingram Henry (Cath) lab r211 Ocmulgee Ingram Jas (Dollie) carp h Columbus rd Ingram Leila tchr r356 Monroe Ingram Levi (Emma) agt Guaranty Life Ins Co h227 4th av Ingram Margt Indrs hl60 Coles al Iingram Melissa Indrs h9 Gas House la Ingram Morton S porter r5 (105) Wise av (V) Ingram Phronie cook (820) Montp) r311 Napier av Ingram P Emily drsmkr hl20 Broad (E M) Ingram Reese M dept mgr Burden Smith & Co r400 Forsyth Ingram Rostom R (Viola) barber A L Glasco hl05 Wise av Ingram Thos (Lula) firemn hl316 1st Ingram Wm r Jerry Collins Ingram Wm (Annie B) rl09 Mulberry Ingram Wm H (Zelma) carrier P O h226 Powell Ingram Wm H (Addie) bellmn rll2 Ward Ingram Webb (Lottie) janitor hll2 Ward (V) Ingram Willie Indrs h504 Elbert _FOR LISTS OF NAMES ANY TRADEsk--m ANY BUSINESS -- ANY PROFESSION DETROIT R. L. PbLK & CO. CHICAGO TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUK MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656J/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 499 INSURANCE CO OF NORTH AMERICA OF PHILADELPHIA, PA, Morris Harris Agent, 210-212 Bibb Bldg, Phone 131 International Correspondence Schools S L Pritchard mgr 563% Mulberry Interstate Life & Accident Insurance Co J W Haw- kins mgr 612-13 Grand bldg Interstate Lumber Co G B Meier pres 601-3 Bibb bldg Iola Watson mill hd r23 Lake City Irby B Ray (Ruby) plmbr hl09 Harrold Irby Carlisle A (Sue) slsmn Standard Oil Co r412 " Yineville av Irby Celista (wid John) rl50 Williams Irby Frances B (Willie) plmbr Miller Bros h269 Bll Irby F Marian (Mattie) watcbmn hl81 Cedar (S M) Irby Evatna Mrs slsldy Lee's Dept Store rlOl Park av (CP) Irby Henry C (Evatna) formn rlOO Park av ( CP) Irby Janie M (wid Gilbert) rl985 3d Irby Nora (wid Homer F) h2215 Broadway Irby Ray (Ruby) plmbr 565 Mulberry hl09 Harrold Irby Robt M hlpr Ray Irby rl81 Cedar (SM) Irby Robt M plmbr rl81 Cedar (S M) Irby Wm 0 (Mary) macb hl50 Williams Irby Wm W (Katie) hi Violet Irby Wilson D (Sarah) eng h960 1st Irons Annabel r350 Hines ter Irons Lewis A (Phoebe A) v-pres and mgr United American Insurance Co h350 Hines ter Irvan Sidney R (Alberta) rll5 Jones Irvin Charlie (Marzella) farmer h Industrial Home rd Irvin Danl (Mary) porter Burden Smith & Co h441 Chestnut Irvin Ellen cook hl5 Tinsley la Irvin Eliz maid r441 Chestnut Irvin Jennie r419 Elizabeth Irvin Lonnie lab r419 Elizabeth Irvin Maud tchr r441 Chestnut Irvin Sylvester (Anniebelle) mill wkr h Industrial Home rd Irvin Wallace (Ida) firemn h239 Calhoun Irvin Wm (Anna) firem h419 Elizabeth Irvin Wm presser r538 Army Lot Automobile owners are select prospects tor many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. SO 30 v POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 500 (1925) R. L. POLK & CO.'S Irvine Hazel cook rl33 (111) Mutual av Irvine Lee h651 Forsyth Irving Anna (wid Allen) h rear 225 Academy (E M) Irving Deland lndrs r317 Short (E M) Irving Henrietta lab r317 Short (E M) Irving Laura maid Union News Co Irving Sallie M rll3 Tatnall Irving Susie h422 Elizabeth Irving Thos porter h rear 523 Academy (E M) Irving Zefran lndrs r211 Elliotte (E M) Irwin Jas D elk Piggly Wiggly res RFD 2 Irwin Kitty Mrs slsldy J P Allen & Co r209 Log Cabin dr Irwin Leon G (Kittie) priner Macon News h209 Log Cabin dr Irwin Mary elk Burden Smith & Co r209 Log Cabin dr Irwin Ralph L interne Macon Hospital Irwin Vera phone opr rl56 Williams Irwin Wm J (Anna) carp r209 Log Cabin dr Irwin Wm M (Buna) formn hl56 Williams Isaac Mehala r2106 Broadway Isaacs Edw A (Jessie B) v-pres Otto-Isaacs Harness Co rl49 Pierce av (V) Isaacs Edw A jr elk rl49 Pierce av (V) Isaacs McAllister (Eloise) slsmn h706 Ridge av Isabela Jas (Polly) lab r703 Hammond Isaf Betrus (Annie) shoe repr 650 Poplar hl998 3d (S M) Isaf Jos cashr Lowry & Lowry rl998 3d Isaf Nagweb T (Emily) shoemkr 236 Main (E M) h 165 Pierce Isaf Petros B (Annie) shoe repr hl998 3d Isenhour D B auto mech Dunlap Huckabee Auto Co r 860 2d Ison Sami (Lizzie) lab h410 Thompsons al Israel Geo M (Lillie) slsmn Morris & Co hl237 Col- lege Iverson Robt L (Allice) lino opr h520 Ocmulgee Ivery Dennis r422 Long Ives Alma student r345 Clinton Ives Claudie (wid Walter D) r345 Clinton Ivey Alf C (Zadie) elk Am Ry Exp Co hll4 Highland av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 501 Ivey C T slsmn I Kessler Commission Co Ivey Chas P (Susan) carp h735 Anderson Ivey Cato R (Anna) auto mech rl20 Log Cabin dr Ivey E Norman elk r735 Anderson Ivey Hewey (Lillie) lab h337 Monroe Ivey Hugh D elk Am Ry Exp Co rll4 Highland av Ivey Iva Mrs gro 2106-8 2d Ivey Jewell S (Susie) elk hll8 Habersham av (L P) Ivey Leila (wid Damascus P) screens 767 3d h do Ivey Lucy lndrs r406 Thompsons al Ivey Otis P (Alice) carp h2009 2d Ivey Paronella (wid Robt D) rl23 Highland av Ivey Porter (Rosa) stock kpr h654 New Ivey Hugh D elk Am Ry Exp Co rll4 Highland av Ivey Iva Mrs gro 2106-8 2d Ivey Jewell S (Susie) elk hll8 Habersham av (L P) Ivey Leila (wid Damascus P) screens 767 3d h do Ivey Lucy lndrs r406 Thompsons al YATES MOTOR GO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Ivey Otis P (Alice) carp h2009 2d Ivey Paronella (wid Robt D) rl23 Highland av Ivey Porter (Rosa) stock kpr h654 New Ivey Robt E student r735 Anderson Ivey Rosa lndrs h368 Collins la Ivey R L trainmn Macon Ry & Light Co r517 Giles Ivey Shelton B (Ray) signal inspr h802 Spring Ivey Wm C (Gladys) sec-treas Dixie Ice Cream Co h 118 Crisp Ivey W Luke (Irene) exp msngr rl015 Walnut Ivory Frank lab rl09 Linden av Ivory John (Mattie) lab h550 Smith row Ivory Nancy lndrs hl09 Linden av Ivory Silas (Sallie) barber 638 Washington av h39 Woodliff Ivory Thos ins agt rl32 Grants Ivory Thos T Rev (Beatie) pastor hl32 Grants Ivy Mattie maid 550 Smith la A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 502 (1925) R. L. POLK & CO.'S Jabo Jas cigar mkr r805 Main (E M) Jabo Mamie elk r805 Main (E M) Jabo Thos (Mary) gro 670 Poplar h805 Main (EM) Jabo Toney cigar mkr r805 Main (E M) Jabovitz Sadie r961 Cherry Jabovitz Sarah (wid Jacob) h961 Cherry Jacks Lee H (Alice) asst supvr signals C of Ga rll3 Corbin av Jacks Oscar (Mary) lab hl57 Green Jackson Abner (Rita) h773 Edgewood av Jackson Ada E (wid Wm A) h200 Burton av Jackson Alberta lndrs h257 Walnut Jackson Alex (Hattie) ice ctr h602 Ross (T F) Jackson Alice cook rl205 1st Jackson Alonza (Mollie) lab hl45 Grants Jackson Amanda mill hd rl413 1st Jackson Amanda student rlOlO Clinton rd Jackson Andrew (Mattie) carp h Robinson rd near Rockledge av Jackson Andrew lab r367 Madison Jackson Anna cook h441 4th av (V) Jackson Anna cook h42 Harris al Jackson Annie r596 (504) Smith (E M) Jackson Annie ins agt rl21 2d av (V) Jackson Annie lndrs h457 Barracks al Jackson Annie B student r227 Grants Jackson Anne L hlpr W A & J A Spiller r7 Post Office la Jackson Annie L lndrs hl31 Moore av Jackson Annie S cashr J P Allen & Co r763 2d Jackson Arth L (Eliz C) sec Willingham Loan & Tr Co hl93 Boulevard av Jackson Austin (Susie) car clnr h526 Calhoun Jackson Belle cook r362 Bookers al Jackson Bertha hlpr rl80 Wings al Jackson Blacksmith Shop Richd Hammock mgr 1274 Broad Jackson Carrie (wid Jesse) h Industrial Home rd Jackson Carrie cook h234 (220) Lynwood av Jackson Chas (Alice) hl79 4th av (V) Jackson Chas jr driver rl79 4th av (V) Jackson Chas (Roberta) h(810) 120 Pio Nono av Jackson Chas (Nora) brklyr h6 Gunns al (V) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth* CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) . 503 Jackson Chas draymn rlOl Texas Jackson Chas (Inez) lab hl52 Clara (E M) Jackosn Chas (Johnnie M) lab r234 (220) Lynwood av -- Jackson Clarence lab rl79 4th av V Jackson Clarence student r200 Burton av Jackson Clarence E (Lula) draymn h822 Ocmulgee Jackson Clarence E jr lab r822 Ocmulgee Jackson Danl (Hattie) firemn r766 Ocmulgee Jackson Danl (Leila) lab h201 Orchard av Jackson David (Mamie) lab hl060 Hazel Jackson Dolly h324 Burnett (E M) Jackson Dolsie nurse Middle Georgia Sanatorium r Jackson Dora cashr Ellis Motor Co r367 New Jackson Doris sten r325 North av Jackson Dorothy tchr r46 S College Jackson Dosa J (Lillie) carrier P O hl55 (156) Lincoln av Jackson Durward L (Nell C) insurance agt r721 Pine Jackson Eddie M mgr Sparks Circus r Hotel Macon Jackson Edna r200 Burton av Jackson Edw r367 Madison Jackson Edw (Nellie) chauf Goldgar Furn Co r221 Green Jackson Edw (Grace) lather h330 Elizabeth Jackson Elbert (Liza) carp hl59 Grants Jackson Elijah (Frances) carrier P O h522 Calhoun Jackson Ella lndrs hll65 (327) Woolfoik Jackson Ellen maid r256 North Jackson Eloise (wid R T) hl416 Oglethorpe Jackson Elouise maid 159 Grants Jackson Emma (wid Litt) h948 Columbus rd Jackson Emma cook 753 Oak Jackson Emma lndrs h 2d av (Bellevue) Jackson Emma maid r231 Gant City rd Jackson Emma maid Mrs Williams r rear 750 2d Jackson Emma L (wid Idus) h411 Jackson Jackson Emmet L (Jackson & Jackson) hll7 Vir- ginia av Jackson Ena E spooler r234 Jackson Jackson Ethel lndrs h227 Grants Jackson Ethel sten Jackson Middlebrooks r JG Jack- son The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of Ail Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually SMEAPTRECMHBaEnRd by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains muck valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 504 (1925) R. L. POLK & CO.'S Jackson Eug (Anna) baker Central Ga Baking Co r 302 Tindall av Jackson Eug (Claudia) cook h69 New Jackson Eug (Annie) lab r Monroe Schely Jackson Eulise bell boy rill Moore la Jackson Evelyn maid r4 (904) Clayton Jackson E Blanche nurse r446 Spring Jackson E Walter (Nora) miller h620 Plum Jackson Fannie h313 2d av (V) Jackson Fannie B bkpr r443 Jackson Jackson Fannie P smstrs H Johnson r514 3d av (P H) Jackson Floinall lab h229 Green Jackson Frank (Katie) lab h586 Monroe Jackson Fred lab r217 Green Jackson Fred A (Bessie) mach h w s Parkwood av 1 s Forsyth rd Jackson Geo G (Lois) pipeftr hl411 3d Jackson Geo W rl27 Wyche Jackson Geo W Rev h542 (442) Mitchell Jackson Georgia Mrs r240 Chestnut Jackson Gertrude G tchr r306 Madison Jackson Gladstone r200 Burton av Jackson Gordon L student GAB College r200 Burton av Jackson Grace Mrs r323 Dannenberg av Jackson Grace rl44 Adams Jackson Gracie lndrs rl26 Coleman al Jackson Hattie phone opr Sou Bell Tel Co r863 Amer- ican blvd Jackson Henrietta lndrs r407 (306) Bowman Jackson Henry (Ruphert) firemn hllO Pringle Jackson Henry (Lucy) hlpr r454 Pine Jackson Henry (Minnie) janitor h521 Ross Jackson Henry (Gertrude) lab h331 (531) Hall Jackson Henry lab hll Tinsley la Jackson Henry (Mary) musician h340 Middle (V) Jackson Henry G (Mattie) mech h325 North av Jackson Hubbard lab r311 Division Jackson Isabelle lndrs r543 (541) 3d av V Jackson Isaiah (Lucy) lab hl65 Telfair Jackson Jas lab rill Moore la Jackson Jas (Carrie) lab h901 Williams Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 505 T^kM920 Broadway Jackson Jas C (Emma) carp h5 King Taokson Jennie cook h813 Ellert Jackson Jesse (Annie K) firemn HenritftT Taekson John (Clara) ice ctr h539 Henrietta Jackson John (Hattie) pdlr h32l Smith (E M) Jackson John (Mattie) track wlkr hl004 College Jackson John (Ruby) orderly hl34 Army Lot Jackson John A (Lena; Jackson-Wynn Co) hi Jackson ?ohnP (Mattie) detective Police Dept h443 JacksonMohn W (Mamie) wtchmn h734 OtfdW Jackson John W (Roda) janitor Federal bldg h367 Madison Jackson John W lab r201 Orchard av Jackson Jos rll4 Holt av (N H) Tackson Jos E tinner r296 Belmont . . Jackson Jos G (Belle) lieut Police Dept hll7 Virginia av Trucks and Auto Repairing $ Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 (IQ Jackson Josephine lndrs r240 4th av (V) Jackson Josephine maid r773 Edgewood Jackson Josie mill opr rl04 DeWitt Jackson Julia lndrs rlOl Mutual av Jackson J Guy (Jackson & Middlebrooks) r200 Buiton Jackson J Millard (Jackson & Jackson) rll7 Virginia av Jackson j Wiley (Emma) carp h.940 Columbus rd Jackson Katherine Mrs tchr r46 S College Jackson Larkin (Florine) carrier P O h232 3d av Jackson Laura rl3 Turpin la Jackson Laura M cook r201 Ocmulgee Jackson Lazuri (Thelma) carp rlOl (403) Randall al Jackson Lee (Myretha) brickmason h536 Ocmulgee la Jackson Leila smstrs h4 Orchard av Jackson Lena lndrs r!79 4th av (V) FOR. LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO CD cn pi -1 j8rwef dd LO r Z BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Ksndc of Merchandise and Service Meet (1925) R. L. POLK & CO.'S Jackson Lena B rll7 Virginia av Jackson Lenus (Sallie) lab hlOl (403) Raindall al Jackson Leonard (Annie) peddler hl50 Ernest Jackson Lewis (Sallie) brklyr h223 (220) Green Jackson Lewis (Hattie) eng h850 Courtland av Jackson Liddie maid hl57 Nussbaum Jackson Lillian r944 Columbus rd Jackson Lillian h525 Forsyth Jackson Lillie lndrs hll5 Tindell av Jackson Lizzie lndrs r701 Hammond Jackson Lizzie lndrs r211 Lynwood av Jackson Lonzo (Mollie) lab hl45 Grants Jackson Louis (Hattie) eng h846 Courtland av Jackson Louise h39 Manchester qtrs Jackson Louise cook rill Moore la Jackson Lucendy rlOl Texas Jackson Lucile cook W E Markwalter r do Jackson Lucile student r822 Ocmulgee Jackson Lucy r W W Jackson "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH If your gums are not a healthy pink SnD?HlLAiAFTMeAI||Lh,5T ItYav.UnHvr F7i'oeenlraJts,shs`alitlsc,A e- 1NaSTtMDaHyUEotdhuSYaernEygDAePbrRrYulEegsOeiggdRiUnsAtaNo'Llns-. Jackson Lucy lndrs hl22 Rock Hill la Jackson Lucy furnished rms h518 New Jackson Lula (wld Robt W) rl411 3d Jackson Lula r263 Madison Jackson Lula r rear 200 Roye Jackson Lula, nurse rl23 Chestnut Jackson Luvinia lndrs r419 Short (E M) Jackson Mabel lndrs r202 Plumtree Jackson Madge lndrs h256 North Jackson Mahala lndrs hll65 (327) Woolfolk Jackson Mamie Mrs rl236 College Jackson Marcelous C (Sally) gro 641 P'ort Hill h639 do Jackson Margt h306 (206-) Charles Jackson Maria A (wid Wm W) rl09 Highland av Jackson Marie r426 Forsyth la Jackson Marion lab rill Moore la Jackson Martha (wid Rand) r662 Hawthorne R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND !^p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 507 Jackson Mary (wid Frank) rl7 Spring Jackson Mary (wid Robt) r920 Columbus rd Jackson Mary cook r225 Patterson Jackson Mary lndrs h609 Hazel Jackson Mary smstrs h200 Elliotte (E M) Jackson Mary A sten r206 Peachtree Jackson Matt (Ellen) h915 Ash Jackson Matt lndrs r rear 257 Ocmulgee Jackson Mattie Mrs smstrs Union Dry Goods Co r325 North av Jackson Maude cook Mollie Hudson r217 Green Jackson Maude maid r453 Douglas av Jackson Mildred elk Cherry Hat Shoppe r303 Henley av Jackson Michl driver rl23 Chestnut Jackson Mitchell (Mary) truck driver hlOlO Clinton rd Jackson Mitchell jr delivery boy Highland Pharmacy rlOlO Clinton rd Chero-Cola MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIINSS Jackson Monroe (Locressa) porter r220 Plant Jackson Moose (Lula) r Jas Davis Jackson Mose (Rosa L) pedler h Robinson rd cor Rockledge av Jackson Mose jr r Mose Jackson Jackson Moses (Matilda) lab hl23 Chestnut Jackson Myrah (wid W W) r Highland av Log Cabin Hts Jackson Myrick porter rl59 Grants Jackson Nancy lab r602 (1280) Elbert Jackson Nancy maid h310 Campbell av Jackson Nancy E (wid John) r654 Hawthorne Jackson Nannie r852 Ash Jackson Neal porter r457 Bird Cage al Jackson Ned delivery boy rl04 Robert Jackson Nehemiah (Bessie) firemn r242 2d av (V) Jackson Nellie h221 Green Jackson Newton (Leona) lab hl30 Monghon Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Poik Directory Bldg. r Detroit, Mich. 508 (1925) R. L. POLK & CO.'S Jackson Norman (Alice) car clnr h439 Tindall av Jackson Ola r863 American blvd Jackson Oscar P (Rosa M) mech h217 Duncan av Jackson Otis lab r910 Elbert Jackson Otis M (Eulalia) mech h79 Dempsey av Jackson Percy lab r310 Campbell av Jackson Peter (Frances) lab hl20 Elliott (E M) Jackson Peter J (Mary) firemn hl226 Broad Jackson Queen elk King Hill r356 Hawthorne Jackson Rentha Indrs r4 Alabama Jackson Rich H (Julia) carp hl04 Roberts Jackson Robt (Emma) driver hl025 3d Jackson Robt (Lula) firemn h201 Ocmulgee Jackson Robt (Annie) lab h805 (100) Columbia rd Jackson Robt lab h306 Mason Jackson Robt lab rill Moore la Jackson Robt (Mattie) lab hl217 3d Jackson Robt (Katie) truck driver h413 E 1st (E M) Jackson Robt L lab r416 Bay ' Jackson Rosa cook hl04 Johnson av Jackson Roy (Anice) elk h601 (667) Edgewood av Jackson Sallie cook r659 Napier Jackson Sallie Indrs h543 (541) 3d av Jackson Sami (Willie) r773 Edgewood av Jackson Sami (Addie) lab hl42 Evergreen la Jackson Sami A (Mary) farmer h863 American blvd Jackson Sarah E sten r325 North av Jackson Shuler L Rev (Ella) h522 Calhoun Jackson Simeon (Della) carp h3 Frank al Jackson Simon (Fannie) carp hl21 Gordon Jackson Sol (Cenia) lab h357 Bay Jackson Sol (Tee) tchr r298 Craft la Jackson Sophia rll7 Virginia av Jackson Stokely shoe shiner rl21 Middle (V) Jackson Susie K Indrs r307 Edgewood av Jackson Teb (Anna) lab h Industrial Home rd Jackson Terrell J (Cornelia) gro 1026 Main rl270 Broad E M Jackson Terrell J jr elk Terrell J Jackson rl008 Broad Jackson Tillie M r541 E 2d (E M) Jackson Tink clo clnr 621 Broadway hl58 Virgin Jackson Tossie L Indrs h523 Monroe Jackson Viola Indrs h311 Short (E M) KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTpN AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY (1925) 509 Jackson Wade H (Dora; Jackson & Gordy) h360 New Jackson Walter miller Birdsey Flour Mills Jackson Walter waiter r714 3d Jackson Wiley J (Emma) h944 Columbus rd Jackson Wilkins W v-pres Union Dry Goods Co h ns Forsyth rd nw cor Belvedere dr Jackson Wm (Mary A) carp h407 (306) Bowman Jackson Wm cook rlOl (335) Braswell la Jackson Wm (Emma) cook h283 Orchard av Jackson Wm (Beulah) draymn h267 3d av (V) Jackson Wm (Clara) hlpr h624 Chapman al Jackson Wm (Ollie) lab h6 Buckner al Jackson Wm lab h605 Gilmer Jackson Wm (Mamie) lab h324 Smith (E M) Jackson Wm lab Try-Me Bottling Co Jackson Wm E (Katherine) driver M F D No 6 h46 College Jackson Wm G sec-treas Macon Milling Co r200 Bur- ton av SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Jackson Wm J (Ethel) barber h7 (5) Spring la Jackson Wm P (Laura) lab h266 Brief Jackson Willis (Opal) hl023 Edgewood av Jackson Wylie (Minnie) lab h607 (958) Charles (S M) Jackson Wynn Co (J A Jackson, G 0 Wynn) wooden- ware wholesale 301-07 Poplar Jackson W Elmer tchr r46 S College Jackson & Co W W Stewart mgr loans 512% 3d Jackson & Gordy (W H Jackson, L E Gordy) bar- bers 650 Cherry JACKSON & JACKSON (J Millard and Emmet L Jackson), Attorneys-at-Law 201 Bibb Bldg, Phone 2241 Jackson & Middlebrooks (J Grey Jackson, Edgar H Middlebrooks) insurance 305-6 Citizens & Sou Bank bldg Jackson Zeb D (Leona) porter h247 3d av (V) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. for lists of names ANY TRADE ^ -- ANY BUSINESS -- ANY PROFESSION \ DETROIT R- L.. POLK & CO. CHICAGO 510 (1925) R. L. POLK & -CO.'S Jacob Marjorie student r509 Adams Jacob Peyton (Maggie) tchr Mercer University h624 Adams Jacobovitz Abr (Nettie) mgr Jake's Shoe Store rl31 Rose Park Jacobs Bernard (Lena) tailor 416 Cherry h818 2d Jacobs Dinkey (Clara) lab h422 O'Hara la Jacobs Edw G (Virginia) pres Midland Pharmacy h 318 Vineville av Jacobs Noah C (Phamie) printer Masonic Home Jacobs Thos A (Alice) clothier hll5 Buford pi (V) Jacobs T Arnold jr (Mildred) lawyer 10 Washington bldg hl26 Buford pi Jaffe Elias Rev (Ida) h C4,. 261 Georgia av Jake's Shoe Store Abr Jacobovitz mgr 568 Poplar Jamar Nina M (wid Henry W) r201 Oak Haven av James Anna lndrs h320 Ellis av James Annie r340 Vineville av James Annie lndrs r315 Burnett (E M) James A Warren bkpr N E Pace hl018 Vineville av James Beulah lndrs r417 Bright al James Braymon (Hattie) lab hl62 Sycamore James Carl (Ida M) mach opr h.444 Lawton av James Carrie lndrs r417 Bright al James Chas mill wkr hl8 and 19 Manchester qtrs James Cora lndrs rl242 Broad James Derice (Zilphia) lab h379 Boardman al James Estelle r444 Lawton av James Eva lndrs h209 (258) Roosevelt (V) James Fannie (wid Charlie) r820 Walnut James Fredk (Hennie) lab h37 Dixie row James Genie (Cora) lab rl20 (17) Smith James Geo (Jeanie) mill wkr hl7 Manchester qtrs James Henry (Marzella) firemn h Industrial Home rd James Herbert mill wkr rl8 and 19 Manchester qtrs James Homer (Mattie) lab hl4 Frank al James Homer E (Bessie) h920 Walnut James Howard (Tommie) lab h211 Ellis av James John mill wkr rl7 Manchester qtrs James John R carp h cor Gordon and Ernest James John T (Minnie L) tires 451 2d h215 Virginia av 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 11111 MACON CITY DIRECTORY (1925) 511 James John W (Minnie) vulcanizer h215 Virginia av James Kath mill wkr rl8 and 19 Manchester qtrs James Laura lndrs h316 Burnett (E M) James Lizzie r755 Elm James Lizzie L lndrs h690 Center James Louise r340 Vineville av James Mary lndrs r209 (258) Roosevelt (V) James Moses S (Ella) carp h cor Gordon and Ernest James Nannie h755 Elm James Noble (Mary) blksmith h261 Cowan JAMES OTIS D, Mgr 0 I) Janies Granite & Marble Works, r920 Walnut JAMES 0 D GRANITE & MARBLE WORKS, 0 I) Janies Mgr, Granite and Marble Works, Monuments and Slabs 207 Jones, Phone 4687 (See left bottom lines and page 68) James Parry sten r8 Balkcom av James Rafe (Mary) lab hl025 College MACON OPTICAL Frank H. Johnson Opticians 468 CHERRY COMPANY Optn om' et rists PHONE 3213 James Raymond L (Effie G) textile wkr hl23 Oak Haven av James Robt (Mary) lab h311 Hazel James Sharper lab r209 (258) Roosevelt (V) James Silver cook hl60 E Academy (E M) James Thos (Donnie) lab h251 Whitlock James Thos C (Mabel) supt h903 Cherry James Valena h cor Gordon and Ernest James Walter W (Leila A) traffic officer Police Dept h245 Winship James Warren E box mkr r209 (258) Roosevelt (V) James Wm (Beddie) plstr h224 Woodliff James Wm A (Eliz)) h234 (231) Roosevelt (V) James Wm A (Lucy) bkpr Burdin Smith & Co h8 Balkcom av James Wm A jr carp r8 Balkcom av James Wm E (Annie) lmbrmn h340 Vineville av James Wm G firemn r271 Winship James Wilmer cook r306 Craft la POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. CJ u U O' WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 512 (1925) R. L. POLK & CO.'S Jamison Chas (Mamie) lab h284 Orchard av Janes Alice (wid Jos) h430 Alabama Jaques Building 407 Broadway Jaques Sami R (Veanor B; Juliette Milling Co) pres SR Jaques & Tinsley Co h221 Forsyth Jaques Sami R jr (Kathryn; Juliette Milling Co) h Nottingham dr (SH) ' Jaques S R & Tinsley Co (Inc) S R Jaques pres T D hn'lvfZTsl J T Dent sec-`reas Sros Pop- Jarratt ^ DevereauMBeSSie, aud Crescent Laundry Jarrell Albert A (Nora) eng h421 Chappell Jarrell Annie F pupil nurse Oglethorpe Private In- firmary r204 Tatnall Jarrell Frances (wid John) r417 Chappell Jarrell G Edw (Mary) h310 Reid Jarrell John L elk W A & J A Spiller r212 Broadway Jarrell Mary phys 525 Bibb bldg r520 Johnson av Jarrell T Randolph (Ollie) cond hl07 Latta pi Jarreftt TAsdlrmceIkdoCmudralb3y TPuarcpkiinnglaCo r Washington av Arth (LeoIa) carP h Log Cabin blvd CC2K , Fp(oIrdsayLthJradr,rPethtonPeai2n9t40&-JGlass Jarrett Jas P h701 Walnut JJAfR^eRtElL TuTIaPAC0IN0kTh&LGSLACSaSbinCOMv(Hd (KBeJlalrerveutet)), Home of Sun-Proof Paint and Proof Products 312 3d, Phone 2606 (See page 78) Jarrett Walter lab r Lula Jarrett Jarvis Elmer L (Nelle M) veterinarian hl27 Crescent clV Jason Jas (Lucinda) cook hl50 Middle Jearrell John (Mary) elk r221 Broadway Jeffers Ethel rl03 Stratton Jeffers Eug C (Lula) cond hl03 Stratton Jefferson Anderson (Mattie) lab h242 Thompson's al Jefferson Ann r266 Madison Jefferson Elbert lab r44 Virginia la Jefferson Ellen lndrs rl45 Grants Jefferson Enious lab r266 Madison Jefferson Georgia cook r7 Ellis av mAuatnoymkoibnidles oofwmneerrcshaanrdeises. eleScetndntroosHneeacdtsoufaor-r cCoaptya.l*o0gr ac1o1Rnkt.ainindsspomOfLuAcKhut&ovmaClouQbaiblelm eL,dTisaKttsao..V,OAAuwsrkWnferow,,rr The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St. MACON CITY DIRECTORY (1925) 513 Jefferson Jos H (Anna) lab h611 Peeble Jefferson Laura smstrs rll32 Broadway Jefferson Louis (Bertie) lab r611 Peeble Jefferson Mary lndrs r611 Peeble Jefferson Millie dom h2 Turpin Jefferson Georgia cook r7 Ellis av Jeffersn Jos H (Anna) lab h611 Peeble Jefferson Laura smstrs rll3 Broadway Jefferson Louis (Bertie) lab r611 Peeble Jefferson Mary lndrs r611 Peeble Jefferson Millie dom h2 Turpin Jefferson Nancy lndrs h228 Wright's al Jefferson Ronie lab h4 Brewery al (P H) Jefferson Sidney lab r321 Turpin Jefferson Standard Life Insurance Co G A Rankin mgr 404 Georgia Casualty bldg Jefferson Wiley (Lessie) lab rl59 Bright al Jeffreys Edw G h360 College Jeffreys-McElrath Mfg Co R M Jeffreys pres W H Jef- freys v-pres H M McElrath sec and treas box mfrs Forsyth rd at C of Ga tracks Jeffries J Bryan (Rosa L) mgr Wm Carter Co h409 Mikado av Jelks Albert (Doris) h ns Vista cir 7 e Ridge av Jelks Eliza (wid Jos J) rl04 Culver Jelks Emma lndrs h450 Womack Jelks Henley F Rev (Flynt) h43 S College Jelks Leonora music tchr rll4 Hines ter (V) Jelks Mollie S (wid Jas) hll4 Hines ter (V) Jellner Beatrice cashr Terminal Hotel Cafe r930 Wal- nut Jemison Frank butcher r321 Douglas av Jemison Georgia r641 Peeble Jemison Grant (Sarah) draymn h621 Middle (E M) Jemison Michl (Lizzie) lab h7 Harris al Jemison Robt W (Lannie H) h687 College Jemison Wm (Carrie) janitor hl94 Woodliff Jenkins Annie r255 Plant Jenkins Annie lndrs rl05 Bay Jenkins Annie L r2220 Broadway Jenkins Berta r2555 Broadway Jenkins Chas J (Fannie M) soft drinks 523 Cotton av h428 North Jenkins Charlie (Bessie) h280 Whitehall FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION Detroit R. L. POLK & CO. Chicago Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 514 (1925) R. L. POLK & CO.'S AH Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job'* 365 Days Every Year RLPoffiifo PUBLBHEGS Jenkins Dock (Donnia) lab hll8 Green Jenkins Donie cook rll8 Green Jenkins Earl F (Maude) cond r452 Elm Jenkins Edgar B (Ann) ship elk T C Burke Inc h.201 Beech av Jenkins Elbert E (Rita) h202 Appleton av Jenkins Elisha lab h rear 858 Cherry Jenkins Eliza Indrs h257 Chestnut Jenkins Eliz marker Independent Lndry Co rl022 Oglethorpe Jenkins Emma r2555 Broadway Jenkins Ernest A (Eula) formn hl924 Broadway Jenkins Estelle cook h7 Alabama Jenkins Fannie h485 Chestnut Jenkins Frank M h452 Elm Jenkins Fred A (Minnie) driver r723 Daisy Jenkins Gussie (Annie) lab h220 Johnson av Jenkins Hannah maid rl5 Tinsley la Jenkins Harmon (Lovey) carp h6 Myrtle Jenkins Henry A (Bertie) cond h2134 Broadway Jenkins Homer L (Mattie H) barber 308 Cherry h401 Montpelier av Jenkins Jas (Mabel) lab r308 Edgewood av Jenkins Jas H (Gussie) lab r24 Williams la Jenkins John (Allie) lab h206 Douglas Jenkins Jos H inspr h2555 Broadway Jenkins Josephine rl71 Wings Hill Jenkins Julia Indrs h307 (5) Wood al Jenkins Laura dom r47 Massee la Jenkins Lewis firemn h711 (606) Charles (S M) Jenkins Lonnie W (Daisy) r New Columbus rd Jenkins Lula Indrs h278 Madison Jenkins Luther A (Frances) postmstr hl03 Kenmore Pi (C P) Jenkins Maggie nurse r831 3d av (V) Jenkins Major (Sanora) lab r904 Elbert Jenkins Mamie maid rl71 Wings Hill Jenkins Martha (wid Jos W) h405 Carling av (H H) Jenkins Mary cook r!08 Moore la Jenkins Mary cook r831 3d av (V) Jenkins Mary A (wid D E) h620 Spring Jenkins Martha (wid Lit) r3608 Houston av Jenkins Mattie cook r29 Tinsley la PoUtDirecbmE DETfiorr MICH- A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 515 Jenkins Oscar J (Maude) mech hl016 Oglethorpe Jenkins Pink L (Lucy) car inspr h273 Ells (S M) Jenkins Pink L jr appr G F Yetter r273 Ellis (S M) Jenkins Pinkie r2555 Broadway Jenkins Robt H (Pauline) foremn h512 Clinton (E M) Jenkins Rufus F (Aileen) solr Crescent Laundry Co r 246 Winship Jenkins Sami (Winnie) barber r332 Gilmer Jenkins Sami G (Josephine) wtchmn r2220 Broad- way Jenkins Simon (Virginia) lab h304 Watson al Jenkins Thos A (Winnie) foremn rl924 Broadway Jenkins Walter mill hd hl226 1st Jenkins Walter B (Mary) bkpr Empire Candy Co h cor Cherry and Winton av Jenkins Wm h782 Nussbaum Jenkins Wm (Rosa) driver hl02 Randall al Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Jen&ins Wm (Carrie) lab h47 Massee la Jenkins Wm J (Leila) cond hl46 Charles (S M) Jennings Albert H (Nora K) mgr Adams Buchanan Motor Co h Riverdale dr 1 n Ridge av (I) Jennings Carrie maid rll6 2d av (V) Jennings Clarence mech r814 Elm Jennings Frank H (Eva) janitor hl09 2d av (V) Jennings Hoge formn r814 Elm Jennings Mansfield M dep elk Municipal Court rl49 Magnolia Jennings Nona M r270 Hillyer av Jennings Susie hl62 College Jennings Theo electn r814 Elm Jennings Walter M (Rosalind) cond h270 Hillyer av Jerkins Lula sten rl21 Willingham Jerkins Offie carp rl21 Willingham Jerkins Robt L (Agnes) h250 Willingham Jernigan Erie student r555 2d dress IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 R SCREENS DOORS SASH, Central Sash & Door Co. ? 3 tno- US C2D Q- tJJoos JIoJds < d m h gy o Hcn OOOS OzQS < < More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 516 (1925) R. L. POLK & CO.'S Jernigan Ralph B elk Pan American Sou Petroleum Co r555 2d Jernigan Troy (Chloe R) reporter Bradstreet Co r555 2d Jessup Beulah M sten rl25 Peachtree Jessup Coley H (Mary) mldr Taylor Iron Works & Supply Co hll4 Pierce (E M) Jessup Green rl02 Blount Jessup J B mech Flournoy Auto Co h Camp Wheeler rd Jester Lee (Cath) lab hl35 Ritchey al Jester Minnie r Starling Womble Jesup Stella (wid Wm M) r49 Marion pi (H R) Jeter Danl W (Mattie) pres Ga Quincy Granite Co h 110 Magnolia Jetton H Clayton (Lomie) mgr hl30 Rogers av Jewett Felix C (Martha I) cond h312 Carling av (H H) Jewett Geo B (Katie) ins h771 1st Jewett Geo B jr r771 1st Jewett Howard C (Lucile) elk h302 Corbin av Jewett Mamie r771 1st JEWETT MOTOR CARS, Beeland-Conrad Motor Co Distributors 560 2d, Phone 2813 Jimerson Euella nurse Macon Hospital Jimmerson Jas lab rl06 Moore la Jinks Janie lndrs hl238 1st Jinks Lula lndrs r921 Fort Hill Jobson Arth B (Lilly J) electn hl07 McGhee (C P) Jobson Chas A hl87 (607) Oakland av Jobson Lily J Mrs slsldy Burden Smith & Co rl07 Ingleside pi (C P) John B Douglas r317 Mulberry Johns Carl W (Louise) real est r316 Linden av Johns Emma (wid) r520 Ocmulgee Johns Flora E (wid Jas E) hl53 Huguenin av Johns Julian C formn S M Solomon jr h327 Hydrola Johns J Clyde (Beatrice) mech h327 Hydrola Johns Mabry O city firemn r430 Winship JOH1VS-MANVILLE ROOFING, Schwartz & Phaul Agents, 452 Plum, Phone 340 Johnson Adam lab r320 Hammond Johnson Addie lndrs rl02 Division st la Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 . HUNNICUTT CLOTHING CO. A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 517 Johnson Albert meat ctr rl39 Forest av (V) Johnson Albert R (Frankie) mech hl07 Short Johnson Alice lndrs h244 Collins la Johnson Alice smstrs h2436 2d Johnson Alice O sten J B Clements r Masonic Home Johnson Allen D (Tempie) firemn hll08 Napier av Johnson Allie cook r407 (504) Colquitt Johnson Amanda lndrs h Barracks al Johnson Amil gro 501 Cowan r do Johnson Andrew L (Rosa) plstr h36 (536) Clayton Johnson Andrew T carp r336 American blvd Johnson Anna h527 Forsyth Johnson Anna lndrs h48 (2) Cemetery la Johnson Anna lndrs h240 Harris al Johnson Anna lndrs h218 Lee Johnson Annie r506 Fort Hill Johnson Annie h638 Prince Cfl Johnson Annie cook 124 Merritt av (M A) r do Johnson Annie cook 213 North av r252 Orange st la YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Johnson Annie dom rl02 Division st la Johnson Annie dom h259 Walnut Johnson Annie K lndrs r539 E (E M) Johnson Annie K mach hd Bibb Bag Co r248 Clinton Johnson Annie L (wid Thos) cook h401 (501) Col- quitt Johnson Anthony (Mattie) lab h537 (114) Smith (E M) Johnson Archie waiter r58 Spring Johnson Arth (Jessie) lab rl2 Randolph pi Johnson Arth lab r622 Williams CaJ Johnson Arth (Mozie) mech hlpr hl04 Grant City rcl Johnson Arth student r220 Ellis av Johnson Arth B (Johnson's Carpet & Rug CIng Wks) r865 Orange Johnson Arth L (Jessie) h Branch (C H) Johnson Arth M (Lucinda) real est hl05 PaJk av (C P) Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Ui Catalog contains much valuable data. Ask for a copy n. L. POLK & CO.. DETROIT, MICH. 210-212 INSURANCE SURETY BONDS Bibb Building Telephone 131 518 (1925) R. L. POLK & CO.'S Johnson Arth R (Janie L) carp hl79 Woodliff Johnson A Albert (Lula; Johnson Bros) hll8 Rogers av Johnson A Jackson jr (Clevie) slsmn Peeler Hdw Co rl303 Vineville av Johnson Beeman Mamie) hll8 Franklin Johnson Belle (wid Henry C) h760 1st Johnson Benj (Carrie) mldr h667 Hazel Johnson Benj A student rll8 Rogers av Johnson Bertha h227 Jefferson Johnson Bessie Indrs h965 Clinton rd Johnson Bessie sten J B Riley Drug Co r760 1st Johnson Bitha h rear 218 Spring Johnson Bonnie hl28 Knott Johnson Boysey (Mabel) lab h4 Short (E M) Johnson Bromer mill hd rl2 Randolph pi Johnson Bros (A A Johnson) furn 461 2d Johnson Bud (Della) hlpr hll Davis la Johnson Buster (Annie) lab h407 (504) Colquitt Johnson Calvin Rev (Bennie) pastor Turner Taber- nacle A M E Church h466 Hawthorne Johnson Camilla rlOl Pio Nono av Johnson Carpet & Rug Cleaning Co Arth B Johnson mgr 853 Elm Johnson Carroll student rl28 Knott Johnson Carther r522 Hawthorne Johnson Cath (wid Simon) h205 Forest av (V) Johnson Chas lab r753 Broadway Johnson Chas (Marie) lab h225 Ellis av Johnson Chas (Pearle) lab r28 Long la Johnson Chas (Eliza) lab hi Main (Stinsonville) Johnson Chas (Susie) lab hl22 Shamrock Johnson Charlie peddler r527 E 2d (E M) Johnson Chas C mgr Beneficial Loan Society Inc r811 Walnut Johnson Chas W sec Peeler Hardware Co hl04 Ala- J0H1VS01V CHARLES W (Bonnie), Sec-Treas Johnson, Durham & Burke, h518 Napier av JOHNSON CHILES C, Mgr Beneficial Loan Society, r811 Walnut, Phone 8671-J Johnson Clara Mrs slsldy Union Dry Goods Co rl09 Ponce de Leon av Johnson Clarence E firemn r257 Peachtree More goods are bought and sold through the Classified Business Lists of the Directory thaf any other medium on earth. Macon Transfer & Storage Company HEAVY HAULING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor <1 REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. 0t1o MACON CITY DIRECTORY (1925) 519 o.U Johnson Claude elk McDaniel Hdw Co H Johnson Clayton T (Dovie) starter Yellow Cab Co h 364 Spring o 8Q* Johnson Columbus (Hannah) porter h364 Elm Johnson Comentha cook h rear 1054 Ocmulgee Vt03! Johnson Cora cook rl05 Rose Crest av Johnson Curtis student rl28 Knott Johnson Daisy lndrs r357 Maple Johnson Darral M bkpr Dannenberg Co rl045 College Johnson David (Laura) r326 (208) Pio Nono av Johnson David (Beulah) lab rlOl Pio Nono av Johnson Doris slsldy S H Kress & Co r602 Main Johnson Dovie Mrs sten Happ Bros Co r364 Spring Johnson Down Rev (Fannie) h601 Norris JOHNSON, DURHAM & BURKE, E B Durham Pres, C W Johnson Sec-Treas, Furniture and House Furnishings 365 2d and 168 Cotton av, Phone 3826 (See left top lines and page 67) Johnson Edgar orderly r321 3d av (V) Johnson Edgar (Minnie) porter Union Dry Goods Co hl75 (205) Lincoln av (V) Johnson Edgar M (Bertha) h718 Oak Johnson Edw (Phylis) lab h456 Bay Johnson Effie Mrs mill wkr r37 Mellrose Johnson Eliza lndrs r5 Shoals al (EM) Johnson Eliz h531 Monroe Johnson Eliz dom rl46 Bay Johnson Eliz lndrs h305 Norris Johnson Ella Mrs r3608 Houston av Johnson Ellen mill hd hl543 1st Johnson Ellis (Lenett) lab hl39 Bright al Johnson Emma h361 Elm Johnson Emma lndrs hlOO Elm Johnson Emory L bkpr hl225 Vineville av (V) Johnson Esther phone opr Sou Bell Tel Co rll5 Mad- den av Johnson Ethel lndrs hi Harris row Johnson Eug (Mammie) deliverymn h955 Ocmulgee la Johnson Eug (Lillie) lab h400 (300) Charles (SM) Johnson Eug lab r624 Chapman al Johnson Eugenia (wid Rosser M) hl24 Balkcom av Johnson Eugenia sten rl24 Balkcom av *T3 MOVING STORAGE Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeactdsqufaorrters for all kinds of Automobile Lists. Our new (9 w o cCoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, sMkICfoHr. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 520 (19251 R. L. POLK & CO.'S Johnson E LeRoy (Jessie) bkpr Union Dry Goods Co r809 Vineville av (V) Johnson E Roy (Sadie) deliverymn hl23 Robinson rd Johnson Ferrell N bkpr Maxwell Bros & Bridgers r 620 1st Johnson Fleming (Annie) hl526 2d Johnson Fleming (Fleta) broker h Nottingham dr Johnson Floyd lab r500 (471) Crisp Johnson Floyd L (Clara) sausagemkr Enterprise Packing Co h460 Burton ay Johnson Forster chauf W T Anderson Johnson Frances (wid T H) h Burton av Johnson Frances student r404 E 2d (EM) Johnson Frances D M sten Harris, Harris & Popper r321 Adams Johnson Frank (Martha) r257 Peachtree Johnson Frank (Mattie) h32 (532) Clayton Johnson Frank (Lizzie) lab rl33 Jones Johnson Frank oculist h61 Arlington pi JOHNSON FRANK H (A Belle; Macon Optical Co), r61 Arlington pi, Phone 4609 Johnson Fredk (Lula) lab h80 Spring Johnson General (Ellie) truck driver h804 (405) Charles Johnson Geo hlpr r201 Elliott (EM) Johnson Geo lab r802 Amos Johnson Geo F (Julia) mech h222 (298) Reid Johnson Geo R student rl22 Washington av Johnson Georgia (wid Jas C) r214 Jackson Johnson Gladys dom rl07 Main (S) Johnson Gladys W maid r357 Maple Johnson Grace Indrs r240 Church la Johnson Grams r239 Thompson's al Johnson Grant lab h rear 113 Main (S) Johnson Gussie cook hl9 Gas House al Johnson Hal J (Jessie B) meats 452 Ballard h802 do Johnson Hanna cook rl5 Elbert la Johnson Hazel (wid Julius) h815 Amos Johnson Henry (Martha) carp h502 Mitchell Johnson Henry (Elnora) checker hl30 Sycamore Johnson Henry cook hll62 Ocmulgee Johnson Henry (Lillian) lab r62 Davis la Johnson Henry (Rebecca) lab h5 Short (EM) Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 521 Johnson Henry millwkr Dixie Roll & Cot Co Johnson Herbert (Willie) lab h310 Hanson Johnson Hercules S (Iradella) shoe repr 170 New h Route 5 Box 140 Johnson Herschel L (Bertha) barber 456i/2 Clinton r320 (720) Lexington av Johnson Herschel W tailor 1227 Broadway r321 3d av Johnson Homer A flagmn r257 Peachtree JOHNSON H HERBERT (Wilhelmina), Dentist 19- 22 Macon Savings Bank'Bldg, Phone 519, h Hines ter cor Anola av, Phone 518 Johnson Ida Mrs drsmkr 525 Jackson h do Johnson Ida lndrs r8 Phillips la Johnson Ida B sten r472 Broad Johnson Inez waitress rl34 Roosevelt av Johnson Isaac firemn h.506 Fort Hill Johnson Isaac porter Sanitary Barber Shop No 2 r902 Everett av Johnson Jacob (Rachael) shoemkr Zelik Wolf h718 3d Johnson Jas elk r812 3d Johnson Jas hlpr E R Pearce rl8 Berthadale Hts Johnson Jas hlpr Dunlap-Huckabee Auto Co res Un- ionville Ga Johnson Jas lab r239 Thompsons al Johnson Jas mill hd rll32 Broadway Johnson Jas porter rlOO Elm Johnson Jas A baker Am Bakeries Co rl22 Washing- ton av Johnson Jas C (Jane) lab r4 Polk la (HH) Johnson Jas L furniture repr 416 Main r737 College (EM) Johnson Jas R (Ruth) barber Stallworth Barber Shop Johnson Jas T welder Wade & Co res Holton Ga Johnson Jane nurse rl43 (142) 1st av Johnson Jennie h613 Hawthorne Johnson Jessie M r427 Peacock Johnson Jewell slswmn Burden, Smith & Co rl07 1st Johnson Jas W farmer r303 Flanders (EM) Johnson Jas W (Rebecca) meat .ctr h77 Wilder (SM) Johnson Jas W jr (Ruth) bkpr Macon News rl55 2d Johnson Jas W (Madaline) slsmn h519 Walnut Johnson John (Ida) h226 Green Johnson John (Ella) lab h535 Coleman al FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO We Do If Right R BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 522 (1925) R. L. POLK & CO.'S Johnson John (Lucy) lab r317 Hammond Johnson John C (Ethel) mech h294 Belmont av Johnson John D (Nettie) police h257 Peachtree Johnson John H trucker Swift & Co r80 Spring Johnson John W (Ernest) slsmn H H Sapp rl09 Mad- den av Johnson Jos gard r826 (830) 3d av (V) Johnson Jos porter h718 3d av (PH) Johnson Jos D (Nora) rll2 Dixie av Johnson Jos E (Emmie) carp rl707 Forsyth rd Johnson Jos L (Ida) coremkr Taylor Iron Works & Supply Co h764 Anderson Johnson Jule lab G H Parrish Johnson Julia cook rl50 (147) Sycamore Johnson Julia B r852 1st Johnson Julius truck driver rl50 (147) Sycamore JOHNSON J A (Ruth), Dist Agt Bibb County Farm Bureau, h707 Holt av (NH) Johnson J D cabtmkr Macon Lumber & Mfg Co "A 75c Bottle Makes a Quart" PYORAL the best mouth wash fIifrmyo, uarngdumelsasatrice. noItt athheeyaltbhlyeepdinokn, SHHePEeAAy1L;oT^uHrvoYdce. naTttiihsotisnA,iNsTDaHEUdYaSnEgAePRrYEsOigRUnANaLl-. DAILY. For sale at your Druggist's Johnson Kate rl2 Randolph pi Johnson Katheryn tchr rl006 Cedar (U) Johnson Laura cook h208 Pio Nona Johnson Lee (Emma) h738 Hammond Johnson Lee (Clifford) hlpr hlOl Texas Johnson Lee slsmn McCommon Bros r271 Winship Johnson Leila Indrs hl07 Main (S) Johnson Leila pdlr hl006 Cedar (U) Johnson Leila student rll2 Dixie av Johnson Leonard elk Hammond Oil Co r454 Pine Johnson Leonard hlpr r316 5th Johnson Leonard lab rl35 Hazel Johnson LeRoy (Oreda) farmer h427 Peacock Johnson Lewis (Hattie) carp h802 Amos Johnson Lillie (wid Wm F) hll Hill Park av Johnson Linwood K (Elsie) designer Idle Hour nurseries hl27 High Johnson Lizzie (wid John) r477 Alabama 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 523 Johnson Lonnie G millwkr r3 Lake Johnson Louise student rill Jefferson Johnson Louise J student rl49 Laurel av (NH) Johnson Luberta maid r321 (224) Roye Johnson Lucile lndrs hll7 (3) Braswell la Johnson Lucile lndrs h3 Cherokee al (SH) Johnson Lucile student rl58 4th av Johnson Lucius deliverymn r309 Middle (V) Johnson Lucy K chaperon Wesleyan College r do Johnson Luevonia lndrs rlOl Telfair Johnson Lula M r607 Telfair Johnson Luther (Lula) mech h.500 (471) Crisp Johnson L K elk Sou Bell Tel Co rllO Magnolia Johnson Mabel pupil nurse Oglethorpe Private In- firmary r204 Tatnall Johnson Malcolm M copy rdr Macon Telegraph rll4 Coleman av Johnson Mamie rl39 Ellis av (V) Johnson Mamie cook h907 (910) Ocmulgee MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Johnson Mamie dom rlOO Elm Johnson Mamie dom r321 Turpin Johnson Margie student rl28 Knott Johnson Marion W (Catheryn) carp h203 Glen Cove dr Johnson Mark storekpr rll05 Napier av Johnson Martha (wid R E) r212 Burton av Johnson Martha (wid Wm) h404 E 2d (EM) Johnson Martha cook 715 Pine r410 E 1st (EM) Johnson Martha lndrs r205 Forest av (V) Johnson Martha lndrs hllO New Johnson Martha C sten Dickey Auto Supply Co r807 2d Johnson Martha F (wid J Marshall) h221 Georgia av Johnson Martha L maid r410 E 1st (EM) Johnson Marvin rl50 Hydrola Johnson Mary cook h513 Coleman al Johnson Mary lndrs h rear 908 Cherry Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company LUMBER, SHINGLES, LATH 0) 0) CU CM Sen 0) fl o is X Sn ' ^ Q- t** "3 ^ CM H ^ CD >> o s rd JC a, CD s a u ctf pJC H WllSingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 524 (1925) R. L. POLK & CO.'S Johnson Mary J (wid John L) r Mrs C B Walker Johnson Mary L (wid Chas) h2084 3d Johnson Mary M (wid Zachariah T) r336 American blvd Johnson Maryland V r807 2d Johnson Matilda smstrs r539 (530) 3d av Johnson Mattie (wid Jas) rl331 Broadway Johnson Mattie cook h563 Monroe Johnson Mattie dom hl04 Elm Johnson Mattie L (wid Chas F) h4 Albion apts Johnson May rl02 (105) Applewood Johnson Mildred student r620 1st Johnson Millie smstrs hl04 Elliott (EM) Johnson Minnie (wid Fate) h4 Alabama Johnson Minnie maid Middle Ga Sanatorium r224 Jackson Johnson Mittie cook hl32 Coleman al Johnson Mollie rl02 (105) Applewood Johnson Moses lab rlOO Elm Johnson Myrtis baker Am Bakeries Co r521 Main (EM) Johnson Nell G sten The J W Burke Co r525 Jackson Johnson Noah W (Thelma) optician C A Hillburn h 792 Holt av Johnson Nora Mrs slsldy Burden Smith & Co r558 Edgewood av Johnson Obie (Ambrosia) hlpr h.502 (481) Charles (SM) Johnson Odessa C lndrs r697 (127) Hall . Johnson Ola lndrs r445 Douglas av Johnson Orine sten Grand Lodge of Ga F & A M Johnson Oscar (Effie) farmer r240 Mitchell Johnson Patsie nurse rl70 Roye Johnson Paul D (Sallie) pipemn MFD Sta No 5 hlOfi Harrold Johnson Paul M (Pearl) eng r440 Ross Johnson Pollard P (Hattie) firemn h472 Broad Johnson P Wheeler student r H Herbert Johnson Johnson Raymond A (Jimmie) asst sec-treas Nye Odorless Crematory Co res RFD 3 Johnson Riley (Lillie) lab h345 Nussbaum Johnson Robt (Minnie) h3, 559 Orange More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 625 Johnson Robt (Carrie B) hlpr 21 Berthadale Hts Johnson Robt (Mattie) lab h697 (127) Hall Johnson Robt E (Mary J) pharm Chapman's Phar- macy h209 Ridge av Johnson Robt P (Fleta H) sec-treas Ruan & Co h Shirley Hills Johnson Robt H (Ethel) trav slsmn h D4, 261 Geor- gia av Johnson Robt L (Alice) lab h275 2d av Johnson Robt P (Lena) pharm h808 Oak Johnson Rosa (wid Chas) r409 May av Johnson Rosa lndrs h309 Middle (V) Johnson Ruby G cashr Natl Life & Accident Ins Co r 920 College Johnson Russell (Sindie) lab r376 Melrose Johnson Ruth Mrs slsldy Lee's Dept Store rl55 2d Johnson R Gladys bkpr r4, Albion apt Johnson Sallie (wid Lewis) lndrs hl67 Craft la Johnson Sami (Sallie L) brickmason hl05 Rose Crest av Johnson Sami (Mamie) lab h445 Douglas av Johnson Sami lab h20 Gustin av (V) Johnson Sarah cook hl34 Roosevelt (V) Johnson Sarah lndrs h305 Grant av (V) Johnson Shelton M (Rachel) slsmn Jackson-Wynn Co hll9 Buford pi Johnson Simon J (Inez) mach h504 Telfair Johnson Stanford (Ethel) mill wkr r Buck Farrell Johnson Steven (Susie) lab r7 Stripling al Johnson Sunnie (Mary) truck driver hl04 Moore's la Johnson Sylvester B (Eva) mill wkr h48-49 Davis Johnson Sylvia (wid Wm) rl23 Robinson rd Johnson Thos (Nellie) lab hl02 Division st la Johnson Thos (Bessie) lab h205 Yates al Johnson Thos C (Daisy) slsmn h605 Forsyth Johnson Thos J (Mary) emp Cudahy Packing Co h620 1st Johnson Thos M (Mary) r429 Ward (V) Johnson Thornton yd mn Wesleyan College r do Johnson Tyree G student r466 Hawthorne Johnson T Wesley (Evelyn) auto mech h302 Fair- mont av (Bellevue) Johnson Vernon r423 (453) Edgewood av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS . -- ANY PROFESSION DETROIT R. T,. PORK & CO. CHICAGO c/i of !! S3 flf l S'* W gsr 3% 1f?f s e. z --q p& O Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 526 (1925) R. L. POLK & CO.'S Johnson Victoria lndrs h214 Jefferson Johnson Viola dishwasher Hotel Lanier rl57 Ben- netts la Johnson Virginia student r808 Oak Johnson Walker farmer h523 Craft la Johnson Walker (Martha) lab h361 Hawthorne Johnson Walter (Mary) plstr h256 4th av (V) Johnson Walter J elk r859 Cherry Johnson Walter N (Letitia) tailor 429 Cotton av hlOl Calhoun JOHNSON WALTER T (Clare), Attorney-at-Law 919 Georgia Casualty Bldg, Phone 1119, hill Jefferson, Phone 5385 Johnson Wayman J student r466 Hawthorne Johnson Welbert (Mary) collr h765 Pine Johnson Wilbur rl05 Park av (C P) Johnson Wilbur H S (Jessie) rl06 Rogers av Johnson Wm (Daisy) h469 Douglas av Johnson Wm (Ellen) r228 McLean al Johnson Wm (Leola) firmn h97 Bay Johnson Wm (Louela) chauf r211 Ocmulgee Johnson Wm lab r415 Bay Johnson Wm lab rl206 Broadway Johnson Wm (Maggie) lab h443 Chestnut Johnson Wm (Stella) lab r201 Elliott (E M) Johnson Wm (Minnie) lab h224 Jefferson Johnson Wm lab r514 Short (E M) Johnson Wm (Annie) mach hd r24 (20) Randolph pi Johnson Wm A (Bennie) farmer r372 3d ax (W H) Johnson Wm A (Josephine) mach hl49 Laurel av (N H) Johnson Wm A (Willie) lab hl08 Ruby (V) Johnson Wm G ship elk Am Bakeries Co res Route No 4 Johnson Wm J (Lilia) carrier P 0 h609 3d av Johnson Willie rll22y2 Broadway Johnson Willie maid Dr Ernest Corn rll22y2 Broad- way Johnson Willie maid Union Dry Goods C r357 Maple Johnson Willie M rl39 Ellis av Johnson Winnie rl04 Alabama av Johnson Winnie lab r!50 (147) Sycamore E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS -TRACTFOoRrSdsorvihffoavrPietH'asOitN.aFEoFr1od5r,9d1woer JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 527 Johnson Wyatt T (Josephine) slsmn Peeler Hardware Co'rl28 Rodgers av Johnson Zebedie orderly Middle Ga Sanatorium r421 3d av Johnson W B orderly rl02 Empire av Johnson W M elk J S Schofield Sons Co Inc Johnston Addie (wid Frank) hl22 Washington av Johnston Albert ctr r2480 Broadway Johnston Benj B (Jennie) news editor Macon Tele- graph hl29 Rogers av Johnston Benj B tchr Wesleyan College h203 Clisby Pi Johnston Chan M agt National Life & Accident Ins Co res Dames Ferry Ga Johnston Claude R (Ella) firemn h632 (624) Mont- pelier av Johnston Edw P (Rosa; Jones Park & Johnston) h 105 Vineville av Johnston Florine bkpr Fashion Shoe Store r221 Hines ter (V) Johnston Frank M agt Life Ins Co of Va r357 1st Johnston Hattie nurse r805 Orange Johnston Hazel M phone opr Sou Bell Tel Co r333 Hines ter (V) Johnston Henry r345 Clinton Johnston Jas R (Ruth) barber h345 Clinton Johnston Jewell elk rl07 1st Johnston John B (Mary) slsmn hll44 Milledgeville Johnston Jos T (Emma) mgr h221 Hines ter (V) Johnston Lena B (wid Walter M) h312 Napier av Johnston Lillian F Mrs slsldy Barker Bakery rll Hill Pk Johnston Lillie M (wid John W) r Mrs A M Holt Johnston Lora H (wid John) rl07 1st Johnston Mary student r Mrs A M Holt Johnston Mary L tchr r714 Forsyth Johnston Maurice nurse r805 Orange Johnston Myrtice student rll44 Milledgeville rd Johnston Newton B (Etta) pntr h2480 Broadway Johnston Nora M (wid Wm L) h558 Edgewood av Johnston Oliver student r2480 Broadway Johnston Prentiss W elk Hub Fish & Oyster Co rll44 Milledgeville rd The most comprehensive reference work on me banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. , &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 528 (1925) R. L. POLK & CO.'S Johnston Robt L (Fannie B) gen mdse 618 Poplar h 7161/2 Plum Johnston Ruth r Mrs A M Holt Johnston Ruth sten Barron & Reagin r321 1st Johnston Sarah student r Mrs A M Holt Johnston Sarah E student rll44 Milledgeville rd Johnston T Allen (Frances D) sec Macon Paper Co h221 Adams JOHNSTON WALTER T (Ann S), V-Pres Jones Mo- tor Co, li206 Corbin ay, Phone 2578 Johnston W Leon (Fannie) elk Workinman's Store h862 3d JOHNSTONE BENJAMIN L, Asst Treas Willingham Sash & Door Co, rl06 Lamar, Phone 2933-J Johnstone Lizzie (wid Walter T) hl06 Lamar Johnstone Walter T (Anna) v-pres Jones Motor Co b 206 Corbin av Johstono Herbert r255 Oakland av Johstono Hugh E (Eva) insurance agt h255 Oakland av Johstono Mary r255 Oakland av Joiner see also Joyner Joiner Annie L rl21 Laurel av (N H) Joiner Asa G auto mech Dunlap-Huckabee Auto Co r320 Spring Joiner A Ross (Fadie) mgr rl65 2d Joiner Bennett A (Evelyn) slsmn hll3 Inverness av Joiner Charlie D (Gertrude) h314 Belmont av Joiner Chas O pntr h3311 Houston av Joiner Chas O jr pntr r Chas 0 Joiner Joiner Claude jr rll3 Inverness av Joiner Della (wid Jas E) rl02 Center Joiner Eliz rl21 Laurel av (N H) Joiner Ella slsldy Southern Dry Goods Co rl50 Dixie av Joiner Emanuel (Epsie) janitor h83 Hazel Joiner Florence Mrs hl65 2d Joiner Henry (Jennie) carp h224 Chappell Joiner Homer sten rl65 2d Joiner Jas (Mary) carp h325 Ward (V) Joiner Jas (Fannie) cond r822 1st Joiner Janie M student r210 Middle (V) Joiner John R butcher r763 Cherry AmtcCeoauarpsttnyaoy.lfmookgoribnacidlloelsRnkot.aiofnLiwndm.snsPeeormOrcfsLuhAcaKaknurdt&eovismaeClso.uOeba.l,ibeSleclDeetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtsMsrkqInuCffeaooHwrrr-. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 529 Joiner Jos B (Julia) carp h511 American blvd Joiner Maggie (wid Prank) r233 Ayers rd Joiner Maggie (wid J Prank) r305 Fairmont av Joiner Mary P student rll3 Inverness av Joiner Maude student r811 Poplar Joiner Maybell nurse r247 Railroad av Joiner Myrtis smstrs r322 Chappell Joiner Nancy B (wid Thos J) h322 Chappell Joiner Princess P auto mech r233 Ayers rd Joiner P Prances auto mech r305 Fairmont av Joiner Richd (Freda) eng hl21 Laurel av (N H) Joiner Robbie L maid r325 Ward (V) Joiner Sarah student r325 Ward (V) Joiner Wilhelmina rl21 Laurel av (N H) Joiner Wm r421 Oak Joiner Wm carp rl701 Broadway Joiner Wm mech r322 Chappell Jollay Ralph C pharm L K Liggett Co r607 2d Jolley Jos J chauf h319 Hazel Jolly Carrie (wid T P) rms 121 Broadway h do Jolly Henry T (Lula) driver h304 Ellis av Jolly Herman (Hazel) lab rl60 Plummer's al Jolly Jas B mach opr rl21 Broadway Jolly Mary millwkr r Minnie Freeman Jones Aaron (Elizabeth) lab hl27 Forest av (V) Jones Ada tchr h716 3d av (V) Jones Addison D (Elva) gro 1402 Broadway hl517 3d Jones Albert (Genie) carp rl85 Grants Jones Albert (Beulah) hlpr Wm Brown h539 Plant al Jones Albert E (Eula; S Jones Co) h655 1st Jones Alberta lndrs h324 Bright al Jones Albertha dom r778 Reynolds al Jones Alex (Hattie) lab hl64 4th av Jones Alice maid h263 Tatnall la Jones Alice nurse r433 Chestnut Jones Alice W (wid Geo T) h629 Forsyth Jones Allen (Mary E) barber H W Williams hl44 Piedmont av Jones Allen (Pollie) mech h637 4th av (U) Jones Allen A (Fannie M) bkpr h5 Gustin pi (V) Jones America (wid Thos) rooms hl521 Broadway way Jones Angeline cook rll9 Pio Nono av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. R. PORK & CO. CHICAGO HERBERT SMART . WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 as a MMU PLACE THE DIRECTORY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had > * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Milk&G) PUMHEBS 530 (1925) R. L. POLK & CO.'S Jones Anna B r718 (200) Woolfolk Jones Annie elk rlOl Freeman Jones Annie dom rlOO Kitchens Jones Annie maid r250 Park Hotel al Jones Annie L Indrs h202 Lexington av Jones Anson S (Margt) flagmn hl03 1st Jones Arnold (Ella) lab h23 White Jones Arth F h Forest Hill av Jones Arth R (Mattie E) swtchmn hl22 Green Jones Arth S eng r317 Ross Jones Attieus (Sue B) hlpr h312 Monroe Jones Augusta (wid Toliver M) h633 Telfair Jones Augustus J (Eliz) barber Clinton Brantley h 810 3d av Jones Augustus T (Lilia) lab h225 (25) Stewart Jones A Harman (Alpha) slsmgr rl08 Delaware av Jones Bailey r387 Monroe Jones Baxter (May C) broker 32 Fourth Natl Bank bldg hl28 Hines ter (V) Jones Beacher (Lula) lab rl23 Ash Jones Benj (Sallie) carp h557 Ward (V) Jones Benj C (Sarah) elk hl06 St John Jones Bertha r633 Telfair Jones Bertha rooms 619 y2 Broadway h do Jones Bessie dom r515 Smith row Jones Bessie phone opr Postal Tel-Cable Co r814 2d Jones Bessie J slsldy r259 Church (E M) Jones Bessie L nurse rl51 (149) Lincoln av (V) Jones Bobbie Indrs h251 Hilliard al Jones Brannan J (Anna) porter h522 Ross Jones Bruce C (Mabel M; Jones, Park & Johnston) h 626 Forsyth Jones Burry auto mech r Wellston Ga Jones Carl (Bertha) flagmn h612 Elm Jones Carlton (Mattie) gro 385 Monroe h387 do Jones Carlton jr lab r387 Monroe Jones Carrie Indrs hl59 Coles al Jones Carson L bkpr Cit & Sou Bank rl07 Ponce de Leon av Jones Cath r247 Dempsey av Jones Cath nurse Middle Georgia Sanatorium r do Jones Cath sten C M Adams & Son r226 High Jones Chas barber M D Hightower Jones Chas (Louise) cook hll6 Tindall av PolkBirecfowHD DETROIT r More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President 605TM6J/2 MCOHTETROR:Y DAY AND NIGHT '`TSTH.OROUGHNESS'P' HONE 3041WRITE FOR INMFAOCROMNA,TIGOAN. MACON CITY DIRECTORY (1925) 531 Jones Chas lab h424 Peachtree Jones Chas (Mary) tailor h207 Ocmulgee Jones Chas D sis promotor W S Dickey Clay Mfg Co r314 Belmont JONES CHARLES S (Aileen; Jones & Coney), h458 Winton av (CH) Jones Chas W (Nannie B) car repr h2017 3d Jones Chas W (Georgie) city firemn hl33 Oakland av Jones Chas W (Ruby) garage 858 Hazel h860 Hazel Jones Charme H (Margt) loans 4 Jaques bldg h Ingle- side av (I) Jones Chester W (Fannie) contr 25 Wall hl03 Lawton av Jones Clara lndrs hlO Bright al Jones Clara B cashr City Water Wks r271 Winship Jones Clara J h273 1st av (V) Jones Clarence B chf elk rl08 Napier av Jones Clarence G elk r706 Broad Jones Clarence J cotton broker r3 College Hill apts Jones Clark (Annie) carp b.264 Brief Jones Claude E (Ivy) city firemn hl23 Tenney Jones Claude R (wid Stewart D) r320 Orange Jones Claudius R elk Guaranty Life Ins Co r264 Ellis av Jones College E slsmn Solomon Motor Co h901 Cherry Jones Collins C (Millie B) auto slsmn r5, 475 Orange Jones Connie E tchr r271 Winship Jones Cooper (Anna) lab r317 Hammond Jones Cornelius (Susie) lab hl58 2d av (V) Jones Crittle (Bessie) mgr Hampton Garage h664 Hall Jones C Baxter (Carolyn C; Jones, Park & Johnston) hl29 Buford pi Jones C J huckster rlOl Long Jones Daisy (Daisy) cementwkr h919 Hazel Jones Daisy lndrs h524 Hawthorne Jones Dalton (Leila) clo clnr 809% Broadway h616 Prince Jones Danl lab rl58 2d av (V) TOON^eE|S^DrA,YdrIrD(?S1!(iEer)mgaroC)47C5itDy oCulgerlaksaanvd hP4u7r3chdaosing Agent City Hall, h666 College, Phone 3192-W Jones Delie cook r rear 554 Orange Jones Della lndrs h3 Railroad av (T Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R, t. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. r 532 (1925) R. L. POLK & CO.'S Jones Delmar P r99 Jeff Davis Jones Delphus student r99 Jeff Davis Jones Dennis (Sussie) carp r301 (609) Colquitt Jones Dennis lab r320 Hammond Jones Dewey W (Carrie) formn r653 2d Jones Donie maid h417 Ward (V) Jones Dorothy r535 Grant Chapel al Jones Earl P student rl06 Napier av Jones Early C (Gussie; Jones & Head) hl06 Napier av Jones Edith r247 Dempsey av Jones Edw r324 Chappell Jones Edw L (Myrtle) car inspr h243 Jeff Davis Jones Edw L elk rl06 St John Jones Eleanor elk J B Riley Drug Co r629 Forsyth Jones Elijah (Annie) lab hi Mitchell la Jones Eliza (wid Alex) h Industrial Home rd Jones Eliz r339 Hardeman av Jones Eliz lndrs h306 Curds al Jones Eliz lndrs hll3 Magnolia la Jones Eliz tchr rll7 Corbin av Jones Ella lndrs rl31 Cedar (U) Jones Ella lndrs h23 Malloy's al Jones Ellen lndrs rlOO Kitchens Jones Ellena maid r244 Ellis av (V) Jones Elmo (Nancy) h204 Alabama Jones Elsie cook r330 Madison Jones Emily student rl25 Cole Jones Emma cook h243 Thompson's al Jones Emma lndrs hl54 Coles al Jones Emma L rll20 Oglethorpe Jones Emmett (Gussie) lab h617 Prince Jones Emory F phys hl08 Crumps Park av (C P) Jones Emory R slsmn W R Finch Motor Co h5 Gus- tin pi (V) Jones Eric cook r200 Park Hotel al Jones Erin maid rl02 Price Jones Ernest (Bessie) lab h458 Bay Jones Ernest iab h320 Monroe Jones Ernest B pntr r Clarence Fitchett Jones Essie tchr rl85 Grantse (V) Jones Essie M maid rl02 Ernest Jones Ethel dom r606 Fort Hill Jones Eugenia cook rll8 Moore la Jones Eugenia C tchr r666 College FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 533 Jones Eva r237 College Jones Evelyn cook r229 Jones Jones Everett E (Mary) pipeftr h665 Elm JONES EWELL C (Laura M; Hardeman Avenue Pharmacy), h824 Curd (S M), Phone 3576- W Jones Ezell cook r387 Monroe Jones E lab Dixie Ice Cream Co Jones E S ins agt r318 Walnut Jones Fannie (wid Burdette) h552 Oak Jones Fannie lndrs hl7 Hazel Jones Fannie nurse h466% Cotton av Jones Felix (Lizzie) firemn h311 Monroe Jones Fletcher (Rosa) h Industrial Home rd Jones Florence cook r387 Monroe Jones Florence tchr r256 Elliott (E M) Jones Florrie soda dispr S M Wright r918 Walnut Jones Frances cook r651 Ross Jones Frances C sten r629 Forsyth Jones Frank lab r522 Fulton al YATES MOTOR 00, 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES p p *o5 f g oHn W >3z " sn 3 > O 73 s Q> pn 20 Z 0 173-, rzn CZl z> S HO) I>---1TC] z,>s1^>ho (39 r> zs r "SS m Jones Frank F (Mary C) osteopath 406 Macon Natl Bank bldg res Clinton Ga Jones Frank R (Eliz) asst sis mgr hl08 Park av (OP) Jones Qeo elk Ideal Creamery r629 Forsyth Jones Geo (Bessie) lab hll9 Pio Nono av Jones Geo jr rll9 Pio Nono av Jones Geo D (Lillian) elk r259 Church (E M) Jones Geo M (Willie A) slsmn Empire Furn Co h753 3d Jones Geo S (Allie; Jones, Park & Johnston) h339 Hardeman av Jones Geo T rl08 Napier av Jones Geo W mach h718 (200) Woolfolk Jones Geo W (Viola) mach hd h732 Oglethorpe Jones Georgia (wid J R) h818 Walnut Jones Gladys lndrs r215 Elliott (E M) Jones Grace sten r!29 Curry pi (N H) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit "F0>UH> n >> O r Z 3a in r > mB0 > z T3 dPat-r HO nm> z MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 534 (1925) R. L. POLK & CO.'S Jones Grover C (Florence) osteopath 316 Bibb bldg h212 Corbin av Jones Grover J (Mary) gro 3481 Houston av h3007 do Jones Hannah Indrs r230 Orange Jones Harley W (Audrey R) agt National Life & Ac- cident Ins Co rl51 Park pi Jones Harry M (Lizzie) mldr h607 Telfair Jones Harry O supt O'Pry Plumbing & Heating Co h669 Courtland av Jones Hattie cook r518 Ross Jones Helen r535 Grant Chapel al Jones Helen rl08 Heard Jones Henry (Priscilla) lab hl58 Phillips Jones Henry A (Missouri) farmer hl29 (N H) Currv dI * y Jones Henry F mach rl29 Curry pi (N H) Jones Henry O (Evelyn) formn h669 Courtland av Jones Henry P slsmn S M Solomon Co hill Jefferson ter Joes Homer (Annie) janitor h361 Madison Jones Homer (Hattie) mach h99 Jeff Davis Jones Hazel lab rl02 Ernest Jones H Harvey (Jewell) printer hll2 Lamar Jones Ida (wid Aaron) hl95 Hawkins av Jones Ira bootblk Union News Co Jones Irene dom hl48 Turpin Jones Isaac E (Amy) soft drinks 1703 Broadway hl05 Freeman Jones Jacob (Lulu) plstr r264 Brief Jones Jas (Jennie) carp h247 Dempsey av Jones Jas (Mary) lab hl45 Dempsey av Jones Jas (Cora) lab h702 Ocmulgee Jones Jas lab rl Plant al Jones Jas D (Claude) formn h654 Plum Jones Jas E (Eliz) barber h701 Anderson Jones Jas L auto mech r302 Winship Jones Jane B student r666 College Jones Janie cook r232 Stewart la Jones Janie Indrs h910 Broad Jones Janie L student rl03 Richard Jones Jeffie E tchr r557 Ward (V) Jones Jella cashr r654 Plum Jones Jennie (wid W F) h239 Washington av A^ natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 535 Jones Jere C agt Bankers Health & Life Ins Co rl20 Curry pi (N H) Jones Jerry L mail elk Sou Ry rl03 1st Jones Jesse (Lillie) lab h535 Grant Chapel al Jones Jesse jr lab r535 Grant Chapel al Jones Jettie cook r261 Chestnut Jones Jimmie L phone opr r814 2d Jones John (Carrie) h316 Walnut Jones John carp r523 Craft la Jones John (Florence) hlpr hl6 Orchard av Jones John (Estelle) lab h827 Hazel Jones John (Ellen) lab h619 Monroe Jones John A (Nettie) train dispr h569 1st Jones John A jr msngr r569 1st Jones John C (Laura) elk rl06 St John Jones John C (Sophie) lab h202 Cedar (U) Jones John C (Sally) nurserymn h304 Fort Hill Jones John C (Harriette) yardmstr r317 Vineville av Jones John E lab r518 Ross Jones John H barber 711 Broadway h713 3d av (U) Jones John H gdnr r360 Oak Jones Jos carp h247 Dempsey av Jones Jos (Bessie) lab h322 Glen Jones Jos lab r201 Kitchens Jones Jos (Annie) lab rl07 Smith (E M) Jones Jos H (Floried) mach h555 Arch Jones Jos J jr (Odessa) slsmn Pan-American Sou Petroleum Co hl40 Piedmont av Jones Jos N (Annie) blrmkr h221 Chappell Jones Josephine hairdrsr h518 Ross Jones Josephine sten Bankers Health & Life Ins Co rl20 Curry pi (N H) Jones Josephine L (wid B L) r Massee apts Jones Josie Indrs r612 Fort Hill Jones Julia Mrs ftr Union Dry Goods Co r620 Walnut Jones Julia Benevolent Home Lilia Morel matron 512 Walnut Jones Julia rl04 Heard Jones Julia F (wid Rufus W) hl04 Heard Jones J Andrew (Anna) mldr h409 Elm Jones J Blount (Adel) bkpr Central Ga Baking Co hl22 Habersham av (L P) Jones J Duffie wtchmn r304 Fort Hill Jones J Henry student r701 Anderson "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 536 (1925) R. L. POLK & CO.'S Jones J Norwood jr ship elk Belle Millinery Co r307 Napier av Jones J Paul student r99 Jeff Davis Jones J Rufus elk r240 Ells (S M) Jones Kate cook hll5 Spring Jones Lamar mech r258 Hydrola Jones Lamar trainmn Macon Ry & Light Co hl02 Ponce de Leon av Jones Laura dom rl35 Hazel Jones Laura Indrs hl05 Spring Jones Lawrence (Mattie) lab h619 Prince Jones Lawrence J (Jennie B) caller Sou Ry h324 Chappell Jones Lee J (Lena) eng h240 Ells (S M) Jones Lela M cook hlOO Collins la Jones Leola cook h29 Tinsley la Jones Leone r302 Winship Jones Lewis B elk C W Jones rl03 Lawton av Jones Lewis P (Alma) metermn h815 Courtland av Jones Lige (Roberta) mech h620 4th av (U) Jones Lillie cook r rear 107 3d av (W H) Jones Lillie Indrs rl04 Rock av Jones Liza rl30 Jones Jones Lizzie (wid Calvin) cook hl02 Ernest Jones Lizzie waitress Union News Co Jones Lois slsldy Lees Dept Store rl08 Napier av Jones Lonnie A (Mattie) tailor 571 Mulberry h264 Ellis av Jones Louis tchr r201 Hines ter (V) Jones Louisa h Curd (U) Jones Lucille sten W S Dickey Clay Mfg Co r757 Pine Jones Lucy rl25 Cole Jones Lucy Indrs h927 (955) Hazel Jones Lula drsmkr 656 Pine h do Jones Lula maid hl03 Richard Jones Lula A (wid Walter H) phone opr City Hall h302 Carling av JONES L MONROE (Clara), Chief Fire Dept, r Hotel Lanier Jones Maggie smstrs rl22 (119) Log Cabin dr Jones Malcolm D (Rosalie) judge Superior Court h58 Arlington pi Jones Malcolm D jr (Marian) solr N W Mut Life Ins Co h208 Hines ter (V) R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY ' DIRECTORY (1925) 537 Jones Mamie (wid Thos J) hl27 Culver Jones Mamie W tchr rll7 Corbin av Jones Margt Mrs music tchr 620y2 Cherry h Ingleside av (I) Jones Margt cook rl02 Ernest Jones Marian music tchr 494 Orange r do Jones Marie student rll5 Washington av Jones Marion student rll2 Lamar Jones Marion (Lilie M) hlpr h7 Wise av Jones Mark carp rl33 (300) Neal av Jones Martha elk r352 Clinton (E M) Jones Martha E (wid T H) r271 Winship Jones Marvin J student rl08 Napier av Jones Mary (wid Henry) rlOO Cedar (U) Jones Mary (wid Thos) h350 Cedar (U) Jones Mary Mrs gro 45 White h do Jones Mary cook h350 Spring la Jones Mary lndrs h201 Kitchens Jones Mary lndrs h789 Reynolds al Trucks and Auto Repairing Authorized lor White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Jones Mary student rl08 Crumps pk av (CP) Jones Mary Anna cook r236 Collins la Jones Mary C student rl28 Hines ter (V) Jones Mary E (wid John E) hl318 3d Jones Mary L mill hd rl248 2d Jones Marybell r302 Winship Jones Mattie (wid Virgil G) smstrs r627 Main (E M) Jones Mattie cook r340 Tindall av Jones Mattie lndrs hl02 Johnson's al Jones Mattie phone opr City Hall r302 Carling av Jones Mattie L cook r387 Monroe Jones Melissa R (wid Marshall) r827 Hazel Jones Milas (Lizzie) pntr h342 Douglas Jones Minnie cook hl6 Magnolia la Jones Minnie E Mrs genl mgr Belle Millinery Co h5 (305) Napier apts Jones Minnie L phone opr Sou Bell Tel Co r769 Mul- berry FOR LISTS OF NAMES * ANY TRADE -- ANY BUSINESS -- ANY PROFESSION JOKTUOIT II. L. POLK & CO. CHICAGO City Directory Answers AH Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 538 (1925) R. L. POLK & CO.'S Jones Moses (Ada) janitor h440 Chestnut JONES MOTOR CO, W H Jones Pres, W T Johnstone V-Pres, Authorized Dealers Ford, Fordson, Lincoln o57-559 Plum, Phone 1591 (See right top lines and page 53) Jones Nancie lndrs r305 E 2d (E M) Jones Nancy rll06 Oglethorpe Jones Nellie smstrs rl318 3d Jones Nettie lndrs rl252 2d Jones Nona tchr r264 Ellis av Jones Norwood student h3, 301 Napier av Jones Olin mach r5 Gustin pi (V) Jones Owen E (Lettie) cabtmkr Macon Lumber & Mfg Co r930 Woolfolk JONES, PARK & JOHNSTON (G S Jones, 0 A Park, E P Johnston, B C and C B Jones), Attorneys- at-Law 6th FI Citizens & Southern Bank Bldg, Phone 98 "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH Ifsiflrimgyho,tuarpnrgdouvmoelcsaasattiriocen. ,noTItfHaEthhYeeyaAltbRhlyEeedpUinNokn-, SDHeAEeAILyLYoTu.Hr YFdeo.nrTtishsatilseAiaNstDayUoduaSrnEgDePrrYugsOiggRinsAat'Lls. Jones Peyton W (Gertrude) sec-treas Bankers Health & Life Ins Co hl70 North av (N H) Jones Philip (Bessie) janitor Jones, Park & Johnston hl51 (149) Lincoln av (V) Jones Phoebe hlpr W A & J A Spiller Jones Pies restr 120 Edgewood av rl62 Elm Jones Prentiss apr Beeland-Conrad Motor Co rl019 Ash Jones Randolph W pres Ga-Carolina Oil Co r338 Car- ling Jones Raymond (Pauline) lab h rear 1528 1st Jones Rebecca (wid Wm D) h706 Broad Jones Rebecca J (wid Paton W) hl019 Ash Jones Reuben shoe repr r John Hill Jones Reuben E elk r240 Ells (S M) Jones Richd elk Jones, Park & Johnston r339 Harde- man av Jones Richd (Leola) lab h612 Fort Hill Jones Richd C trav slsmn hll7 Corbin av L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-6X8 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 539 Jones Richd E ins agt rl22 Green Jones Rilla Indrs h373 Plummers al Jones Robt brickmason rl85 Grans Jones Robt (Georgia) lab h954 Broad (E M) Jones Robt lab rl02 Fort Hill (E M) Jones Robt (Mary) lab h614 Fort Hill Jones Robt jr lab r614 Fort Hill Jones Robt (Lilie M) lab r3 Gunn's al (V) Jones Robt (Ruth) lab h.201 Hazel Jones Robt lab h8 Orchard av Jones Robt (Frances) plmbr h710 Hazel Jones Robt H mgr R H Jones & Co r339 Hardeman av Jones Robt L (Mary) mech hl21 Steele Jones Robt T (Lucy) mgr Georgia Grocery r412 Fort Hill (E M) Jones Roberta slsldy S H (Kress & Co rl22 (119) Log Cabin dr Jones Roberta L student r339 Hardeman av Jones Roger (Mary) gro 226 Dempsey av h224 do MACON Chero-Cola Bottling Co. WJ.. ftJ.. HWAWILKLIISNS Jones Rosa cook h4 Cheatham al Jones Rosa Indrs h322 Boardsman al Jones Rosa M r387 Monroe Jones Rosa M matron Methodist Orphans Home r do Jones Roschele cook r920 Ocmulgee Jnes Rose C (wid Henry) r218 Georgia av Jones Ruben carp r350 Hanson Jones Ruby cook r361 Madison Jones Rudolph W (Gladys) pres Ga-Carolina Oil Co h333 Carling av (H H) Jones Rufus W jr driver rl04 Heard Jones Ruth nurse r567 Walnut Jones Ruth sten rl06 St John Jones Ruth C student rl28 Hines ter (V) Jones R Bruce (Elsie H) r378 Orange Jones R Clem (Annie M) bkpr Union Dry Goods Co r436 Carling av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work 9he. Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 . 540 (1925) R. L. POLK & CO.'S JONES E FEANK (Annie W), Sec Macon Ey & Light Co, Sec Macon Gas Co, hl25 Eogers av Jones R H & Co R H Jones mgr miners 31 Fourth Natl Bank bldg Jones Sallie r2420 2d Jones Sallie elk Durward Davis r335 Ross Jones Sallie lndrs hl06 Rock av Jones Sam (Bliz) brkmn r586 Monroe Jones Sam carp r301 (609) Colquitt (S M) The most | Jones Sami (Lula) carp hl33 (300) Neal av comprehen- | Jones Sami cook r355 Wall sive refer- Jones Sami H rlOl Freeman ence work Jones Sami L farmer hlOO Kitchens on the banks of the world Jones Sami P mech rl04 Heard Jones Sarah millwkr h Industrial Home rd Jones Sarah C (wid Rumney) rl019 Ash Jones Seabie student r814 2d Contains Condensed Statements of All Banks, Lists of Jones Seaborn farmer rlOO Kitchens Jones Silas lab rl68 Coles al Jones Silas (Sallie K) r248 Powell (E M) Jones Stanley (Myrtle) r J M Schelling Jones Stewart Mrs prin Gresham School Jones Sula (wid Wm C) hl018 Elm Officers of Jones Susie dishwasher r83 Cheatham al All Banks, Jones Susie lndrs r218 Woodliff Digest of Jones Susie L cook r535 Grant Chapel al State Banking Jones S Co (A E Jones A M Williams) grocers 310 3d Laws -Jones Tabernacle C M E Church Rev A H Tyrus pas- and Much tor cor Jackson and Maynard Other Data Jones Thos (Annie) farmer h506 Fulton (E M) related to Jones Thos G (Ada) mach hl435 Broadway Banking Jones Thos M (Helen) slsmn Murphey, Taylor & Ellis h603 Hillyer av Price $20 Jones Timothy r387 Monroe Published semi- annually Jones Tommie lndrs rl54 Coles al Jones T Callaway appr Taylor Iron Works & Supply Co rl29 Curry pi (N H) Jones T Frank elk rlOl Freeman MARCH and SEPTEMBER Jones Viney soft drinks h215 Elliott (E M) Jones Virginia student r.706 Broad ky Jones Vivian sten rl33 Oakland av Jones V B (Clara B) lab h225 Mutual av Eis Jones Wallace r324 Chappell L. POLK Jones Walter Mrs asst tchr Mercer University &CQ. Polk DirectoryBldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 ELLIS MOTOR COMPANY LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Yz% on Savings MACON CITY DIRECTORY (1925) 541 Jones Walter h3 College Hill apt Jones Walter (Mary) rl92 English av Jones Walter (Mattie) lab h962 Ocmulgee Jones Walter porter r916 Ocmulgee Jones Walter J (Sallie) baggage mstr h352 Clinton (EM) rooj Jones Walter L collr Globe Furn Co r753 3d Jones Walter P (Berta) supvr pnn Lanier High Sch hl03 Laurel av (N H) Tones Warren (Kitty) r658 (1018) Vmeville av Jones Watson (Della) lab hl08 (404) Randall al Jones Wesley (Anna) meatctr h88 Bay Jones Wiley F farmer r5 Gustin pi (V) Jones Wm (Minnie) h256 Plummers al Jones Wm (Estella) brkmn h315 Division Jones Wm (Willie) canvasser r817 New Jones Wm carp r247 Dempsey av Jones Wm (Mary( carp hl02 Mitchell Jones Wm (Sarah) r870 1st SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Jones Wm r555 2d Jones Wm (Anna) gro 241 Cedar b do Jones Wm (Lillie) hlpr hi 3d St la Jones Wm (Loraine) lab h498 Bowman Jones Wm (Martha) lab hl65 Coles al Jones Wm (Mary) lab h290 1st av (V) Jones Wm (Gertrude) lab h539 Monroe Jones Wm (Annie) lab h441 Patterson Jones Wm (Hattie) lab h621 Prince Jones Wm (Rosa) lab h316 2d av (V) Jones Wm (Lucinda) hl07 (487) Short al Jones Wm (Mary) mill hd h.33 Taylor av Jones Wm (Mary) opr r33 Hydrola Jones Wm (Emma) opr h203 Hydrola Jones Wm (Earlie) huckster r40 Dempsey av Jones Wm porter College Hill Grocery r Maple Jones Wm C (Beauty) carp r308 Ernest k i AJ NY TfRo ADEr lists of names ANY BUSINESS r y-- ANY PROFESSION I Detroit' R. iL POLK & CO. Chicago Lincoln Fordsoiv k FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 42 (1925) R. L. POLK & CO.'S Jones Wm C (Maude) inspr City Water Wks hl25 Cole Jones Wm C jr asst prsmn Macon Telegraph rl25 Cole Jones Wm E (Lizzie) gro h302 Winship Jones Wm G firemn Fire Dept r271 Winship Jones Wm G linemn rl318 3d JONES WM H (Laura L; Jones Motor Co), h760 An- derson Jones Wm J (Edna) eng r757 Pine Jones Wm J gro 209 5th r759 Walnut Jones Wm J repr r324 Chappell Jones Wm M (Eva) hl08 Heard Jones Wm M student r302 Carling av (H H) Jones Wm N (Beulah) trainmn Macon Ry & Light Co hl08 Napier av Jones Wm O pricer rl08 Napier av Jones Wm P (Leona) collr Empire Furn Co hllO Yates av Jones Wm W slsmn Peeler Hardware Co r College Hill apts Jones Willie lndrs r45 Railroad av Jones Wostein lab r535 Grant Chapel rd Jones W Henry (Emma) formn W E Dickey Clay Mfg Co h326 Hanson Jones W Henry Mrs r201 High Jones W L r302 Belmont av JONES & CONEY (Charles S Jones, Charles L Coney) , Commercial Printers 411 Broadway* Phone 3087 (See page 80) Jones & Head (E C Jones & J K Head) gro 3705 Houston av Jordan Ada Mrs opr h658 Hawthorne Jordan Alice dom h597 (503) Smith (E M) Jordan Anna lndrs r326 3d av (V) Jordan Annie M dom rl07 Bowman Jordan Ashbury (Lizzie) lab h466 Railroad av Jordan Augusta rll2 Lawton av Jordan Carrie M r312 Vineville av Jordan Chas (Ida) firemn hl322 1st Jordan Chas porter r364 2d av Jordan Chas (Lavern) porter r441 Craft la Jordan Chas J (Sarah J) firemn h2503 Broadway Jordan Chas V bkpr Armour & Co r Y M C A 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 543 Jordan Clifford rllO Powell (E M) Jordan Doctor (Carrie) cook h726 Ash Jordan Edw driver H L Barfield Jordan Edw lab rl07 Bowman Jordan Edw (Ella) lab h6 Elm Jordan Eliz student r267 Boulevard Jordan Ella gro 8 Elm h6 do Jordan Ellen cook hl38 (141) Sycamore Jordan Esther A hlpr r261 Elliott Jordan Ethel cook r712 Elbert Jordan Eug r Y M C A Jordan E H collr Cit & Sou Bank rl4 Magnolia Jordan E Ross (Caroline) mgr h521 College Jordan E Ross jr collr r521 College Jordan Fleming P (Alpha) pntr h23 Holt av (N H) Jordan Fred cotton broker hl2 College Hill apts Jordan Geo (Lynda) auto mech hl72 Ells (S M) Jordan Geo W (Dollie) pntr h308 Rutherford av Jordan Gladys spinner r23 Holt av (N H) MACON OPTICAL COMPANY Frank H. Johnson O Optometrists Opticians 468 CHERRY ..X PPHHOONNEE 332211!3 POLK'S ENTAL I^'RWihECtBtiAGerTINTtHdIeAIISR.OeDsDTNntAYatEhEtAReRs ml 'g'i 1.1l/o9lk25* co. PRECIOUS mjyeYtaFOlRsM fiiUpECNATTAIOLN POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Jordan Hamp (Sallie) h319 (170) Roye (V) Jordan Hattie (wid Wm) h708 Crisp Jordan Hattie cook 221 Forsyth Jordan Hattie Indrs rl07 Bowman Jordan Henry lab h218 Ellis av Jordan Insurance Agency R G Jordan mgr 354 1st Jordan Jacob (Rachel) draymn hl27 Telfair Jordan Jas (Mary) lab hl07 Bowman Jordan Jas mech r615 4th av (U) Jordan Jas R (Cora) barber 2105 2d hl60 Williams Jordan Jennie cook h265 Chestnut Jordan Jessie J (Maud) millwkr hl59 Corner ter Jordan John (Mary L) cook hl28 Moughon Jordan John (Susie) barber and shoe repr 161 5th h 109 Smith (E M) Jordan John C mill wkr rl59 Corner ter Jordon Jonnie Indrs h676 Tinsley la Jordan Jos F r2503 Broadway Drink 'n Dottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. K u u DQ WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 544 (1925) R. Li. POLK & CO.'S 3 Jordan Jule A with J M Cutler jr r Y M C A Jordan J Riley (Cora) barber cor 2d and Williams h 160 Williams Jordan Lavinia lndrs hl08 Smith (EM) Jordan Lee butler r265 Georgia av Jordan Lucille Mrs elk Womans Exchange r717 2d Jordan Lula Mrs h406O'Hara la Jordan Madge L r521 College Jordan Mamie lndrs hl53 Middle Jordan Mandy nurse rl70 Roye (V) Jordan Marian C student r Jackson Spring dr (SH) Jordan Mattie lndrs rl07 Bowman Jordam Minnie lndrs h297 Massee la Jordan Minnie L bkpr rl24 Cleveland av Jordan Nancy (wid Mosely A) lndrs h552 Broad Jordan Ned r768 Ocmulgee Jordan Ollie lndrs hi Fulton al Jordan Ollie maid hi Bears al Jordan Opal spinner r23 Holt av (NH) JORDAN REALTY CO, R Gr Jordan Pres, R G Jordan Jr Sec, Real Estate, Loans, Investments 354 1st, Phone 1136 (See page 82) Jordan Richd student r312 Vineville av Jordan Richd C (Marian) judge City Court h Jackson Spring dr (SH) Jordan Robt (Mattie) crane opr r308 Rutherford Jordan Robt (Lula) lab hl09 Jones St la JORDAN ROBERT 6 (Corinne L), Pres Jordan Realty Co, V-Pres Macon National Bank, h312 Vineville av, Phone 1362 JORDAN ROBERT 6 JR (Wynelle), Sec Jordan Realty Co, h217 Buford pi, Phone 2868 Jordan Rosa ftr Union Dry Gds Co hll2 Lawton av Jordan Sami (Beatrice) lab h712 Elbert Jordan Sarah lndrs r259 Garden Jordan Shepard lab r552 Broad Jordan Susie elk r519 Fort Hill Jordan Steph (Henrietta) mech h615 4th av (U) Jordan Thos (Mary) lab h308 Edgewood av Jordan Troy (Willa) lab hl03 Telfair Jordan Ursery lab r954 Ocmulgee la Jordan Vasco r Y M C A Jordan Wiley M (Mattie) sis mgr Cotton States Fert Co h267 Boulevard (N H) Automobile owners are select prospects for many kinds of merchandise. Send, to Headquar-* ters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 545 Jordan Wiley M jr student r267 Boulevard (NH) Jordan Wm lab r718 Campbell av Jordan Wm (Biliner) lab h420 Lawton av Jordan Wm B lab h6 Spring Jordan Wm B (Irene) lab r23 Spring Jordan Wm K student r267 Boulevard (NH) Jordan Willie Indrs h559 Smith row Jordan Willis (Susie) lab h219 Paul Jordan W Harry (Lucile) plmbr 561 Mulberry h717 2d Jordan W O mach P B Yates Mach Co res Butler Ga Jordon Apts 930 College Jordon Jackson Rev pastor Mt Temah Primitive Bap Ch res Reynolds Ga Jordon Jas C (Eva) city firemn r219 Reid Jordon John H (Eula) lab r225 Chappell al Jordon Josephine drsmkr 527 Calhoun h do Jordon M Bartow (Clara) carp h215 North Jordon Robt janitor r527 Calhoun Jorgensen Axel J chemist r G H Tharpe Joseph Marie (wid Thos) gro 410 Poplar h402y2 Mulberry Joseph Mary (wid Jos) r404i/2 Mulberry Josephson Dorris nurse r296 Belmont av Josephson Inez r296 Belmont av Josey Alex A (Mary) inspr hl31 Charles (SM) Josey Andrew D (Bertie) farmer hll4 Heard Josey Clifford M mech rll4 Heard Josey Henry (Mattie) lab hl274 Cheatham al Josey Lake (Mabel) lab hll (652) Tatnall la Josey Leila rll4 Heard Josey Mack (Liza) lab h2 Cheatham al Josey Mary Indrs rl41 (2) Carling av (HH) Josey Thelma slsldy Snyders Ready to Wear r Lyn- more av Jossett Jos (Viola) oiler h21 Bibb av Jossey Clara (wid J T) r852 1st Jossey Wm J slsmn r852 1st Joyner see also Joiner Joyner Chas S (Julia) asst mgr Metropolitan Ins Co hlOl Summitt av (NH) Joyner Ella (wid Walter) rl50 Dixie av Joyner Hattie (wid Chas) h815 Cherry Joyner Marianna (wid Huel) rlOl Summit av (NH) FOR. LISTS OF NAMES ANY TRADE ^-- ANY BUSINESS * -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MffiiCo PUBLKHEBS PolRRirectamE DETROIT 546 (1925) R. L. POLK & CO.'S Joyner Mary sten G E Amspoker r815 Cherry Joyner Mary L sten r815 Cherry Joyner Ruth r810 Broadway Joynton Harry D (Helen) asst treas Coml Credit Co h606 (608) Montpelier av Juhan Elise G (wid E Moultrie) slsldy Union Dry Gds Co r331 Vineville av Juhan Louise M (wid Wm J) hl357 Oglethorpe Juhan Wm J jr (Leah) v-pres Union Dry Goods Co h es Riverside dr 3 n Ridge av (I) Juhlin Esther rl33A Oakland av Julia Jones Benevolent Home Lilia Morel matron 512 Walnut Juliette Milling Co (S R Jaques J N Birch S R Jaques jr) cottom mills 413-15 Broadway Jung Anna M rl08 Holt av Jung A F slsmn Corbin Supply Co res Lorane Ga Jung Blandina slswmn Burden Smith & Co res Lo- raine Ga JUNIOR CHAMBER OF COMMERCE, A R Menard Pres, Elizabeth Clark Sec, J Kenneth Bryant Treas, 419 Broadway Just A Minute Lunch Fannie Thornton mgr 556 New Justice Ella mill hd rl248 2d Justice Sidney (Carrie) porter hll38 Broadway Justus Arth student r219 1st av (V) Justus Daisy lndrs r219 1st av (V) Jutt Alf lab r332 Madison Juvenile Court Bridges Smith judge basement Court House Juvenile Detention Home J A Knox supt Smithsonia 6 mi east of city nr Swift Sta Kah Lewis L (Alice) merchant h99 Daisy Park KAIGLER HATTIE J (wid Edwin L), Prop KaigleFs Business College, h237 College, Phone 2420-J Kaigler John (Mattie) firemn hl6 Hazel Kaigler Nancy dom r235 Division KAIGLER'S BUSINESS COLLEGE, Mrs H J Kaigler Prop, Night Classes Monday, Wednesday and Friday, 211 Cotton av, Phone 8517 (See left top lines and page 57) Kaigley Lizzie cook r606 New Kaler Wm C (Corinne) mus tchr 251 New h do A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 ij CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 547 Kaley Wm cigar mkr r367 Walnut Kalish J N r322 Bond Kamp Albert cook r518 Ross Kane see also Cain Kane Agnes r240 Washington av Kane Lawrence J bkpr r240 Washington av Kane Mary P (wid John H) h240 Washington av Kannan see Cannon Kaplan Frieda student r671 2d Kaplan Henry (Julia H; Southern Sport Supply Co) pawn broker 552 Poplar h67i 2d Kaplan Hyman D (Fannie) h6, 818 Cherry Kaplan Irving elk Southern Sport Supply Co r671 2d Kaplan Michl M (Esther) mgr American Furniture Co h334 Hill Crest av Kaplan Pearl r6, 818 Cherry Karesh Eva student r400 Washington av Karesh Jean student r400 Washington av Royal Corona Typewriters SCOTT-PARKER CO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Karesh Moses, elk United Barber Supply So r400 Washington av Karesh Sami (Annie) gro 115 Hardeman av h400 Washington av Karmas Nick elk Tony Tsitas rll2 Academy Karsten Paul D (Eliz P) pres Karsten & Denson Co pres Macon Hatchery h347 Hardeman av Karsten & Denson Co P D Karsten pres J W Denson sec-treas seeds and dairy supplies 519 3d Kash & Karry Markets 410 Broadway 653 Poplar 412 2d Katherine Court Apartments 855 Mulberry Kavanaugh Fannie M (wid J F) r759 Poplar Kaylor Clara ins agt r517 Georgia av Kaylor Jas T elk Fourth National Bank r360 College Kays Sylvester H (Hazel) formn hl7 Marion pi (SH) Keating Eliz h441 Madison Keaton Arke mach opr r7 Jordan 406 THIRD ST. USE YOUR CREDIT TEL. 3026 V More goods are bought and sold through the G O OuJJS JJoOSj Classified Business Lists of the Directory than any other medium on earth. v^ < d 13 H ev8a$ 8 C/I 0H* K yj o zK--H H C UJ S S a c [zrl s u> Q I< 2 Z < p o 2 tasftc MO 2 M is U S--.Ss'-1 3E Oh ^ JS5 o z H ^W C5/2 ^^ c>WH/M2 o z H ^a C5/2 !c;>/>2 cHW/2 5ig xH E< U "S <5 -* < Is --IJ hJwZ U3= .u3 WJ O. W E** Otf U UCO3 b O CO X w X D H U D 2 < s MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 550 (1925) R. L. POLK & CO.'S Kelly Luise J (wid John S) tchr Ga-Ala Business College r M R Schuster Kelly Marvin lab Hammond Oil Co r Murrays al Kelly Mary E (wid J L B) h721 Main (EM) Kelly Nettie M nurse r531 Calhoun Kelly N A city firemn Fire Dept r407 Virginia av Kelly Russell M mgr Gt Atlantic & Pacific Tea Co r 212 North av (NH) Kelly Ruth cashr Dempsey Hotel r859 Cherry Kelly Sarah P h212 North av (NH) Kelly Silas A (Corine) traffic mgr r348 American blvd Kelly Thos (Ada) lab h73 Craft la Kelly Thos E (Nellie May) h345 Columbus Kelly Virginia student r567 1st Kelly Wm L acct Terminal Ticket Office r212 North av Kelly Winnie elk rl03 Richard Kelly W Frank K (Lillian) elk S Jones Co hl57 Laurel av (NH) Kelm Redie lab rl08 Gantt City rd Kelman Willie elk David Fleischer r419 New Kelpen Walter C (Rosa) eng hl20 Broadway Kelsall Clara Mrs slsldy Union Dry Goods Co r204 American blvd Kelsall Sami A (Clara) h204 American blvd Kelsey Chas E (Nora) blksmith h Georgian pi nr Log Cabin Kelsey Eliz r526 Edgewood av Kelsey Mattie (wid Zeek) r607 Ernest Kelsey Viola nurse r607 Ernest Kelsey Wm (Lilia M) waiter hl77 Park Hotel al Kemball Tempie rll4 (631) Colt av (NH) KEMME JOHN C (Eugenia), Sec-Treas Willingham Sash & Door Co, r329 College, Phone 884 Kemp Alice (wid Oscar) r424 Long Kemp Arth (Gertrude) ice ctr h703 Cedar (U) Kemp Geo collr Mozo-Cater Co rl432 2d Kemp G Hugh (Mertie M) slsmn r908 Napier av Kemp R L lino opr Macon News r Houston rd Kemp Wm R (Clara) carp r321 Ellis av Kemp Winton C (Ethel) slsmn h423 New Kemper Gussie sten r403 Cleveland Kemper Herschel student r403 Cleveland A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our ree List of Mailing Lists." R. L. POLK & CO., Detroit IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 551 Kemper Lamar student r403 Cleveland Kemper Margt I dom h2604 Broadway Kemper Margarette student r403 Cleveland Kemper Marvin seal elk r403 Cleveland Kemper Mary (wid D P) h403 Cleveland Kemper Reba M r2604 Broadway Kemper Taylor elk r403 Cleveland Kenan Lillie smstrs hl09 Brief Kendall Annie elk rl02 Madden av Kendall Effie cook h473 Chestnut Kendall Fitzallen r311 Bond Kendall Fitzallen W (wid H C) h311 Bond Kendall Harry C r311 Bond Kendall Jas D (Mary) carp hl02 Madden av Kendall Jennie P r217 Carling av (HH) Kendall John (Emma) lab h722 (422) Steins al Kendall John jr lab r722 (422) Steins al Kendall John B (Mattie) contr h463 Burton av Kendall Leonard J (Etta) contr h285 Masonic Home rd Kendall Margie lndrs h537 Sparks al Kendall R Palmer (Novah) police capt Sou Ry Sys- tem h217 Carling av Kendrick Anthony D gro 333 Monroe h325 Ellis av Kendrick Chas L (Mattie) gro 108y2 Ward hl08 do Kendrick Dodie (Leona) brklyr r226 Ernest Kendrick Dollie (wid Prince) h226 Ernest Kendrick Edw r226 Ernest Kendrick Eliz mach opr h263 Willingham Kendrick Ella (wid Ed Lewis) lndrs r Industrial Home rd Kendrick Gladys tchr rl08 Lamar Kendrick John C (Louise) mill hd h4 Ford la Kendrick Lucile tchr rl08 Lamar Kendrick Lucinda lndrs h303 (583) Hall Kendrick Mamie cook h224 Ernest Kendrick Mamie maid r224 Ernest Kendrick Mamie W (wid Allison N) hl08 Lamar Kendrick Mittie cook rl05 Spring Kendrick Richmond (Fannie) draymn h228 Ernest Kendrick Sarah L student rl08 Ward Kendrick Veleria r216 Hawkins av Kendricks Lizzie maid hi Frank al Kennedy Annie (wid Jos P) h817 New FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION \ DETROIT W. R. Finch Motor Co. mm Nash Leads the World in Motor Car Value - Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 552 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through Kennedy Edw L (Mary) h Forest ay (B) Kennedy Edw L jr sheet mtl wkr r Edw L Kennedy Kennedy Ella mill opr h3 Lake City Kennedy Elmer pntr r316 Belmont av Kennedy Emmet C (Leila) flremn h316 Belmont av Kennedy Georgia (wid John F) r467 Spring Kennedy Henry T carp r467 Spring Kennedy Jessie C weaver r Edw Kennedy Kennedy John F (Gladys) flremn r760 New Kennedy Julian V elk Am Ry Exp Co r467 Spring Kennedy Louise W (wid Francis M) r507 College Kennedy Robt lab r306 Peacock Kennedy Roy L (Gladys) electn r312 Cherry av Kennedy T Minta elk Am Ry Exp Co r467 Spring Kennedy Wm E (Effie) real est h303 Katherine Ct apts the Ken^nfidmy1!B6i-1r1d^ie waitress r20P6trEnllm iokttr h418 Jackson Classified Kennington Britt (Viola) car repr hl436 2d Kennington Eleanor rill Appleton av Business Lists of the Kennington Godfrey A (Parmie) elk H A Kennington Gro Co r404 Napier av (NH) Kennington Henry A (Josie; H A Kennington Gro Co) hill Appleton av Kennington H A Grocery Co (H A Kennington) 340- Directory Than Any 342 Main Kennington Jas T (Sou Investment Co) rl436 2d Kenny C B interne Middle Ga Sanatorium r do Kenny C D Co J F Brumback mgr teas etc 212 Cotton av Other Kensey Pollie nurse h Lawton rd Kent Claude elk Bennett Chanin rl03 Telfair Medium Kent Ellen Mrs gro 120 Emory hll8 do Kent Emmett C (Lynette) mgr Modern Grocery Co h On ill Inverness av Earth" Kent Eric A (Chrystal) inspr hl96 Edna pi Kent Geo student r465 Duncan av Kent John F (Mattie) boilermkr h240 Jeff Davis Kent Lena (wid A) rl96 Edna pi Kent Lillian student r240 Jeff Davis Kent Myrtle nurse r240 Jeff Davis Kent Robt G (Ellen) wtchmn hll8 Emory Kent R C mech Ellis Motor Co rllO Log Cabin dr Kent Sami E (Ida M) eng hll34 College Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 553 Kent Wm R (Ida B) firemn h465 Duncan av Kenyon Geo W student r316 American blvd Kenyon S Olin (Bessie E) auto repr 557 3d h316 American blvd Keough Selester r377 Monroe Keppler Louis saddle mkr Otto-Isaacs Harness Co r Log Cabin Hts Kerchen Dosie maid h207 4th av (V) Kerchner Delbert H tchr Mercer University h421 Adams Kerns Adeline Mrs r659 Oak Kerns Josephine student r659 Oak Kerry Marshall student r669 Courtland av Kerry Mary (wid Geo M) r669 Courtland av Kerry May nurse r669 Courtland av Kessler Chas sten H Kessler & Co r241 Boulevard av (NH) Kessler Edw student r241 Boulevard (NH) Kessler Hyman (Fannie; H Kessler & Co) h241 Boulevard av (NH) Kessler H & Co (W H and Hyman Kessler) dry gds 508 Poplar Kessler I Commission Co J C Walker pres M H Kessler and Claude Schneider v-prests C L Sloan sec- treas 356-358 Cherry Kessler Mark (Ida) dry gds 153 5th hl24 2d Kessler Max H (Lena) v-pres I Kessler Commission Co hl77 Boulevard Kessler Oscar M (Central City Iron and Metal Co) r 124 2d Kessler Sarah (wid Isaac) h453 Georgia av Kessler Sylvia student r241 Boulevard (NH) Kessler Walter H (Lillie; H Kessler & Co) h854 Cherry Kessler W Walter r453 Georgia av Kessler's D M Garage L H Chapman mgr 419 Mulberry Ketch Jas (Louise) bellmn r211 Ward Ketchie Lora smstrs rl21 Myrtle Ketchie Robt L (Jessie) car repr h2341 2d Ketchie Wm L (Mary) carp hl21 Myrtle (SM) Key Davis lab h453 Shoals al (EM) Key Homer A (Marjorie) collr hl06 English av A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit We Do It Right SI P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 554 (1925) R. L. POLK & CO.'S Key Jas A (Pay) prop Highland Pharmacy hl97 Laurel av (NH) Key Leila A (wid Thos J) rl210 Ridge av Key Mattie (wid John) turn rms 155 Broadway h do Key Wm A (Mary B) mach hl02 Rembert av Kicklighter Chas H tchr Mercer University Kidd Jas H (Nannie; Kidd & Taylor) h626 (618) Montpelier av Kidd & Taylor (J H Kidd & J P Taylor) clo clnrs rear 626 (618) Montpelier av Kilgro Annie M dom r309 Edgewood av Killebrew Eug (Minnie) r711 Ash Killebrew John G r515 (557) Edgewood av Killebrew Minnie L (wid John G) h515 (557) Edge- wood av Killebrew Rembert mach r515 (557) Edgewood av Killen J Timothy (Georgia L) pres Union Dry Goods Co hl46 Georgia av Killen Margt student rl46 Georgia av m "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmgeyIAho,LytLuoYarTup.nrHrgdouYdFvmeoeo. nlcsraTtasiasthstiaritioclesen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAlePtbrRrhYulyEegsOeigpdgRiUinsAnNatok'Llns-., 1 H Killens Chas M porter r279 2d av (V) L E Killens Minnie Indrs hll5 Moore av Killens Willie C elk Atlanta Life Ins Co r211 Ward Killgore Chas student r437 Trudell av L A Killgore Walter (Ella) lab h437 Trudell av Killian Edith R (wid Lewis M) r611 Holt av I T Killian Georgia Indrs h511 Hazel Killings Rebecca (wid Wm) Indrs h269 Prince Killins Keziah Indrs h251 (257) Ellis av R I Killins Louise student r251 (257) Ellis av Killman Virgil firemn W S Dickey Clay Mfg Co rl92S 0 N 2d Killman Wm C formn rl928 2d Kilpatrick Annie r812 3d N G Kilpatrick Claude C (Mamie L) weigher W O Kin- ney & Co h501 Beech av (CH) S Kilpatrick Helen student r79 Arlington PI Kilpatrick Mary r467 Elm 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ENGLAND THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 555 Kilpatrick Wm C (Louise) farmer h79 Arlington Kilsey Lena r526 Edgewood av Kimball Chas M (Eunice) mstr mech h852 Orange Kimball Eva cook r473 Chestnut Kimball Ezell lab r473 Chestnut Kimball Geo (Lillie) lab h226 Jones Kimball Jas (Berline) lab rl425 Broadway Kimball John J (Mabel) bkpr Adams-Buchanan Mo- tor Co h867 1st Kimball Jos R slsmn J B Warfield r552 Oak Kimball Sarah opr h76 Short (PM) Kimble Wm W (Anna) collr Taylor Furn Co h823 Curd (SM) Kimbra Julius (Alice) lab li437 Chestnut Kimbra Marg nurse r437 Chestnut Kimbrew Ada T (wid John W) hl35 Ross Kimbrew Emmett Y elk T M Donnelly Co rl35 Ross Kimbrew Lutie L elk Independent Lndry Co rl35 Ross MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Kimbrew Nancy (wid Thos M) r331 American blvd Kimbrew Sherman C (Lasse) h912 Napier av Kimbrough Evans (Hattie) janitor hl02 Gustin av (V) Kimbrough Ida R (wid Benj C) rl23 Oak Haven av Kimbrough John rl02 Gustin av (V) Kimes Albert R (Maude) miller Birdsey Flour Mills h 139 McGee Lynmore pi Kimsey Broward inspr Macon News r520 Johnson av Kimsey Geo Rev r Mercer Campus Kimsey Mercer F (Leila) police Sou Ry System r520 Johnson av Kincaid F M v-pres Florida Real Estate Co res Rivoli Ga Kinchen Nannie L (wid Henry C) hl22 Inverness av Kinchen Natha (Nannie) porter hl24 Green Kind Elisha (Rosa L) lab h Tinsley la Kindall Sallie r473 Chestnut Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Ans.?rs All Questions as to WHOM You Are Looking For and WHERE They Can Be pound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L. POLK & Companyj CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. ^ Office, 457 Third St. Telephones 278 & 3976 co 556 (1925) R. L. POLK & CO.'S Kindle Annie B lndrs r861 Broadway Kindle Dolphus lab r310 Bay Kindle Bug lab r310 Bay Kindle Rentz (Hattie) lab h310 Bay Kindley Richd linemn r418 Calhoun King Adeline lndrs r210 Clara (EM) King Annie cook r328 Madison King Archie M dom r205 Elm King A Rawson (Mamie) embalmer J B Hart & Bros hl09 Academy King Benj H jr whse mgr G Bernd Co r613 Arch King Bertha O tchr r520 Broad King Blanche Mrs slsldy Union Dry Goods Co r273 Hillger av King B B exp agt r457 New King Campbell T (Stella O H) supt Riverside Ceme- tery h290 College King Carrie r21 Williams la King Chas L (Ethel) lab r308 Edgewood av King Clyde R (Gertrude) r218 Georgia av King Duffy (Dora) confr 122 2d h314 Cutter's Green King Edw r21 Williams la King Edw (Mary) lab h501 (1311) Colquitt King Edw lab rl Rock Hill la King Edw (Emma) lab h310 Straight King Edw M (Irene) hl54 Nesbaum av King Effie' slsldy J P Allen & Co r314 Cutter's Green King Eliz r657x/2 Plum King Eliz lndrs hl24 Rock Hill la King Ella nurse r21 Williams la King Emanuel (Ina) lab h453 E Academy (EM) King Erastus student rll5 American blvd King Essie M nurse r21 Williams la King Esther opr Sou Bell Tel Co r309 Mikado av King Eva lndrs h520 Broad King E A wkr r Y M C A King E D Rev (Eliza) h Burton av King Fannie cook r5 Ross St pi King Geo (Josie) lab hl36 Bay King Georgia lndrs h361 Bay King Green Louise) lab rl59 Coles al King Griffin D (Mildred) agt Atlanta Life Ins Co h Straight and 3d _ | FOR LISTS OF NAMES j' ANY TRADE -- ANY BUSINESS -- ANY PROFESSION j DETROIT R. L. POLK & CO. CHICAGO R LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4i/2% on Savings MACON CITY DIRECTORY (1925) 557 King Gustave (Lula) lab h230 Calhoun King Harriet (wid Jas) r408 Church King Henrietta (wid R Cuyler) h320 College KING HENRY C (Minnie), Cashr Macon National Bank, li33 Arlington pi King Henry P (Sarah V) r817 Poplar King Hines E Rev (Eliz) pastor h239 Jefferson King Homer J sausage mkr Enterprise Packing Co ( King Hosie B elk Vineville Packing Co rl95 Belmont av King Inez r Lanier pi King Ira lab r21 Williams la King Jas (Callie) lab h52 New King Jas pdlr h615 Hazel King Jas weaver r32 (24) Randolph pi King Jas E(Susie D) slsmn Gulf Ref Co h806 Court- land av King Jas M pdlr h Burton av King Jas R fnshr Sou Duco Enameling Co r725 Wal- nut King Jas R waiter r596 Boulevard av (NH) King Jean (Larutha) lab r213 Frank al King Jesse C (Annie) mach hd Macon Lumber & Mfg Co h219 Appleworth King Jewell sten r314 Cutter's Green King Joe C (Alma) buyer hl38 Oakland av King John (Essie) porter h407 E 2d (EM) King John A ship elk r Y M C A King John H driver r202 Magnolia la King John 0 (Laura) driver h224 Pio Nono av King John T (Mary) caretkr h538 Telfair King Jos (Bettie) farmer hl040 Clinton rd King Jos jr lab rl040 Clinton rd King Jos F (Macie) formn h Lanier pi King Jos R (Ruby) city firemn M F D 6 h323 Dan- nenberg av King J Allen (Clara) h203 Henry (SM) King J C lab r974 Columbus rd King J Lonnie (Grace) phys 206-7 Grand bldg hl39 Pierce av King Lillian maid Union News Co King Lizzie dom hi Rock Hill la King Lizzie maid hll9 (9) Penn King Lucille emp Hotel Lanier rl032 Broadway o * 17 iL Automobile owners are select prospects for many kinds of merchandise. Send, to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains muck valuable data. Ask for a copy It. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 55S (1925) R. L. POLK & CO.'S King Lucille phone opr Sou Bell Tel Co r613 Arch King Luvenia r660 Oglethorpe King Margt lndrs hl020 Fort Hill King Marie Mrs h2839 Houston av King Marion J Rev (Harriet L) pastor Log Cabin Heights 7th Day Adventist Ch rll7 Lawton av King Mary r310 Straight King Mary cook h5 Ross St pi King Mary mill wkr r Richard Belknap King McDuffie (Blanche) elk r407 Forest av (V) King M T formn W U Tel Co r Cross Keys King Ned lab h202 Magnolia Lane King Olden (Mattie) lab h Industrial Home rd King Ophelia sten hl71 Long la King Oscar (Della) lab h.1060 Dempsey av King Oscar H (Ester) plmbr Roller & Millions h309 Mikado av King Ponder W (Florence) asst eng Kinnett-Odom Co h323 Dannenberg av King Rufus lab r4 Cheatham al King Rufus T wood wkr r538 Telfair King Sarah maid r427 North King Sarah opr r59 Clinton King Vetunia (wid Rex) r596 Boulevard (NH) King Viola rl99 Patterson King Virginia lndrs rl040 Clinton rd King Wade H rll5 American blvd King Walter wtchmn r32 (24) Randolph pi King Wilbur S electn r520 Broad (EM) King Wm rl35 Charles (SM) King Wm (Mammie) janitor h21 Williams la King Wm Jessie) lab r420 Bay King Wm (Anna) lab h778 Reynolds al King Wm (Mary) lab.h231 Straight King Wm shoe shine rl52 College King Wm (Susie M) porter r4 Woodliff King Wm Rev (Corinne) hl99 Patterson King Wm H (Lula) wood wkr h549 Telfair King Wm I sausage mkr T & T Sausage Co 767 Wal- nut King Wm L (Linnie) farmer hll5 American blvd King Wm M slsmn Gulf Ref Co King Wm 0 (Ruth) whsemn r!336 2d E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln dfcied; Fordsorv CARS - TRUCKS TRACTORS hIffoarviet'asit.aFoFrodr,d woer PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 559 King Wm T (Ruby) inspr City Health Dept h702 Brodd King Willie rl35 Charles (SM) King Willie asst Dr P G Gates rl35 Charles King Willis Mrs (King & Elder) h596 Boulevard av King Woodrow mech r314 Cutter's Green King W O condr r560 Plum King & Elder (Mrs Willis King & E R Elder) gro 915 Clinton Kingman Percy rl05 Stonewall pi (V) Kingman Robt D student r218 High Kingman Robt H jr (Mary D; Kingman & Everett) pres Georgia Seed Co h218 High Kingman Virginia (wid Percy) tchr rl05 Stonewall pi (V) Kingman Thos student r218 High Kingman & Everett (R H Kingman jr M E Everett) gros 471 3d Kinley Chas (Virginia) emp Bibb Mill No 2 r306 (304) Pio Nono av Kinley Richd phone repr r323 Calhoun Kinman Clarence W elk Fourth Natl Bank r7 Dessau Pi Kinman Geo K teller Fourth Natl Bank 7 Dessau pi Kinman Henry W (Nezzie) electn h620 Duncan av Kinman Russel B trav slsmn r7 Dessau pi Kinman Walter K (Mamie) aud City Realty Co h7 Dessau pi Kinnett Coal & Ice Co Jas D Kinnett pres Vineville Sta Kinnett Doris student r463x/2 (515) Vineville av Kinnett Isabelle tchr Wesleyan College r530 College KEOETT JAMES D (Catherine), Pres Kinnett- Odom Co, and Kinnett Coal & Ice Co, h515 Vineville av,Phone 5162 Kinnett Jas D jr r463^ (515) Vineville av Kinnett John (Mildred) rllO Clayton KEYNETT-ODOM CO, J D Kinnett Pres, R L Sparks V-Pres, M J Redmond Sec, Evans Robson Treas, Mfrs Kinnetts Velvet Ice Cream 6th ne cor Cherry Phones: Ice Cream Dept 362, Ice Dept 186, Coal and Wood Dept 771-772, President's Office 1496 (See page 70) Kinnett Robt r415 Georgia av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually SMEAPTRECMHBaEnRd hy R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 560 (1925) R. L. POLK & CO.'S Kinney Alice Mrs rl97 Ridge av Kinney Clara G Mrs (Guerry Kinney & Co; Kinney Realty Co) h305 Cherokee av Kinney Clara V r305 Cherokee av Kinney DuPont G (Guerry Kinney & Co; Kinney Realty Co) r305 Cherokee av Kinney Fletcher M elk r418 Jackson Kinney Francis r305 Cherokee av Kinney Francis D (Eunice) cotton r415 College Kinney Fredk r305 Cherokee av Kinney Guerry student r305 Cherokee av Kinney Guerry & Co (Mrs Clara G D G and W O Kin- ney jr) real est and ins 9-10 Macon Sav Bk bldg KINNEY G R CO INC, W H Lewis Manager, Footwear for the Entire Family, Quality Not Price 570 Cherry, Phone 431 Kinney Matilda cook rill Forest av (V) Kinney Realty Co (Mrs Clara G D G and W O Kinney jr) 9-10 Macon Sav Bk bldg Kinney W Oscar (Clara G; Guerry Kinney & Co; Kinney Realty Co) h305 Cherokee av Kinney Wm O jr r305 Cherokee av Kinney W 0 & Co (W O Kinney and L J Horton) cotton factors h457 Pine Kinsey Bee (Rosa) h Lawton rd Kinsey Chas saw filer r716 2d Kinsey Fletcher (Annie M) chauf h319)4 3d av (V) Kinsey Louis h Lawton rd Kinsey Marcus (Ida) barber Geo Hatfield h900 Fort Hill Kinsey Mercer F (Lela) h520 Johnson av Kinsley Emma lndrs r210 Moughon Kinsley Georgia cook hl24 Elliott (EM) Kintchen Betty lndrs r238 (212) Green Kirby Harry C (Lottie M) supt Macon Chero Cola Bottling Co r840 College Kirby J D asst supt Consolidated Natl Detectives Agcy r800 Cherry Kirby Lottie M Mrs sten Coml Credit Co r840 College Kirby Reuben N (Lucille) proof rd Macon News r608 2d Kirk Beatrice mill wkr rl02 Heard Kirk Cora V (wid Wm) rl02 Heard Kirk Lonnie L mech rl02 Heard Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ters for all kinds of Automobile Lists. Our new cCaPtya-log contains much valuable data. Ask for R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE MACON CITY DIRECTORY (1925) 561 Kirk Lula opr r359 Clinton Kirk Webster student rl02 Heard Kirk Wm L rl02 Heard Kirkpatrick Prank M (Julia) tlr Cit & Sou Bank r24 1424) Lawton av Kirks John (Mamie) barber h546 Board (EM) Kirkus John W (Mary) mill wkr h (222) Pio Nono av Kirkus Oscar (Pearl) mill hd h9 Lake City Kirven L Clyde (Beatrice G) eng h237 College Kissel Corinne dom r305 Gilmer Kissie Witt (Alma) lab h304 Madison Kitchen Jos B agt Atlanta Life Ins Co rll7 Bostick's la Kitchens Alex C (Nettie) blksmith J A Sims h218 Maynard E Macon Kitchens Alton msngr P O r668 Cherry Kitchens Andrew C (Lavivian) agt Ind Life & Health Ins Co h349 Log Cabin dr Kitchens Andrew C (Daisy) barber H L Jenkins h801 Clinton Kitchens Annie L ja-nitress rl24 Green Kitchens Arnold r321 Pio Nono av Kitchens Blanche lndrs r4444 Pulton al Kitchens B Grady elk Dunlap Hill Pilling Station r Dry Branch Kitchens Camilla rl04 Adams Kitchens Chas N (Alice; Nu-Style Delicatessen) r Jeffersonville rd Kitchens Cohen B (Mae) prop Falkner Tin Shop res R P D 4 Kitchens Coleman H (Kitchens & Stevens) rl315 3d Kitchens Delia lndrs rll5 Kitchens Kitchens Edna tchr r469 Elm Kitchens Eliz (wid Geo W) r820 Main Kitchens Ella (wid Lock) h711 (821) Columbus rd Kitchens Ellis E (Morine) ctr rl525 3d Kitchens Ernest elk Jacob Lazarus res R P D 4 Kitchens Estes flagmn r469 Elm Kitchens Eunice elk rl04 Stratton Kitchens E H baker Am Bakeries Co res Griswold- ville Ga Kitchens E Mack (Gladys) solr J B Parker h417 Win- ship Kitchens Florence (wid Jas M) h229 Cedar (SM) 2 P DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIMM 562 (1925) R. L. POLK & CO.'S as a MET place THE DIRECTORY IS THE 6RE1TEST MARKET Kitchens Frances rl04 Stratton Kitchens Hillis A (Idelle) agt Ind Life & Health Ins Co rl06 Montpelier av Kitchens Homer barber r321 Pio Nono av Kitchens H Mitchell (Otelia) slsmn Singer Sewing Machine Co h469 Elm Kitchens Ida Mrs opr The Wm Carter Co rl04 Strat- ton Kitchens Jas r819 Ash Kitchens Jas r321 Pio Nono av Kitchens Jas (Willa) chauf hll54 Milledgeville rd Kitchens Jas (Annie) gro 290 Garden rl04 Center Kitchens Jas B (Katheryne) h555 1st Kitchens Jas E (Annie) opr h837 Main (EM) Kitchens John B (Alice) butcher hl04 Center Kitchens John H (Esther) blksmith W S Dickey Clay Mfg Co r241 Belmont av PLACE Kitchens John T cabt mkr Macon Lumber & Mfg Co r 229 Cedar (SM) IN THE WORLD * Kitchens Jos T (Mattie P) formn h204 Cole Kitchens Julia Indrs rl020 Main Kitchens J Arth mach hd Macon Lumber & Mfg Co r 229 Cedar (SM) Every Day in the Year the Directory Tells Where All Kinds of Goode and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year RLPoffi&fo PUBLISHERS Kitchens J D elk Dunlap Hill Filling Sta r Dry Branch Kitchens Lee D (Kate) firemn h556 Edgewood av Kitchens Louis rl04 Stratton Kitchens Lum (Bessie) hl315 3d Kitchens Marie rl04 Stratton Kitchens Marvin O (Mary) pntr rl26 Holt Kitchens Mary opr The Wm Carter Co rl26 Holt Kitchens Milton r229 Cedar (SM) Kitchens Myrtle rl04 Stratton Kitchens Nathan lab rl24 Green Kitchens Nellie opr Wm Carter Co r218 Maynard Kitchens Odessa r341 Columbus Kitchens 0 L baker Am Bakeries Co rl25 Fort Hill (EM) Kitchens Ross L prop Dunlap Hill Filling Station r Dry Branch Kitchens Ruben rl04 Stratton Kitchens Simeon L (Hattie) swtchmn h305 Newberg Kitchens Troy (Eliz) exp msngr r516 Montpelier av Kitchens Wm L truck driver rl04 Stratton Kitchens Wm W (Ida) dray h!04 Stratton FOR LISTS OF NAMES ANY TRADE,--t ANY BUSINESS -- ANY PROFESSION DETROIT R. L. Ft)LK Sa CO. CHICAGO 23."" 1 TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656J/2 CHERRY ST. PHONE 3041 MACON. GA. MACON CITY DIRECTORY (1925) 563 Kitchens & Stevens (C H Kitchens, J T Stevens) confrs se cor Pine and 3d Kite Jesse (Lucile) opr h232 Hydrola Kizzie Anderson (Mary) lab h505 Fulton Kizzie Madison (Hattie) carp h216 Fulton (EM) Kizzie Rufus (Louise) carp r505 Fulton (EM) Klarpp Frank S (Minnie) ship elk Empire Candy Co h2, 813 Poplar Klarpp Frank S jr elk Empire Candy Co r2, 813 Poplar Klein see also Cline Klein Floy I tchr Wesleyan College r520 College Klein Sami (Louise) cond h.932 Columbus rd Kline Louise Mrs h Columbus rd Kline Wm R (Lauro J) mgr J P Allen & Co h ws Albe- marle pi 1 n Ridge av Kneeee Cecil elk J D Boatwright Gro Co r3 Randolph Pi Kneeee Clara mach opr Wm Carter Co r212 Shamrock Knight Benj (Josephine) textile wkr r266 Pierce (EM) Knight Brozie D (Gladys) cond h204 College pi Knight Chas W (Mabel) mgr Georgia Grocery r604 Main (EM) Knight Clarence E (Minnie) slsmn Dixie Ice Cream Co hl23 Highland av Knight Clarence E jr (Esther) slsmn rl23 Highland av Knight Davis (Beatrice) lab h39 Dixie Row Knight Eliz sten r759 Cherry Knight Eug prsr r206 Tindall av Knight Hezekiah Rev (Emma) h303 (203) Charles (SM) Knight Jas H lieut Police Dept h436 Carling av H H Knight Jos emp Reis & Armstrong r270 New Knight Less L (Margt) linemn h Log Cabin blvd Knight Levi J (Lila J) chemist J B Riley Drug Co h 121 Stonewall pi (V) Knight Otis D tchr Mercer University h301 Linden av Knight Pearl maid r638 Prince Knight P Leon (Mary F) signal dept hl238 College Knight Rosa K r436 Carling av (HH) Knight Wm C (Gussie) slsmn Macon Grocery Co h 428 Carling av (HH) i 50 SO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog- contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. . TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 564 (1925) R. L. POLK & CO.'S Knighton Louise (wid Jas) r M F Griffith Knights of Columbus Hall 567 Mulberry Knights of Pythias Hall (col) 556 New Knott Jas A tchr Ga-Ala Business College r772 Wal- nut Knowles Benj F (Mattie) barber R G Stripling h2110 2d Knowles Fannie (wid A B) h409 Virginia av Knowles Hulda r2110 2d Knowles Mattie Mrs r2110 2d Knowles Susie r207 Rogers av Knowles Urel elk Paragon Pharmacy r2110 2d Knowles Wm M (Mattie) hll7 Dixie av Knowles Willie P emp Hupp Bros r2110 2d Knowlton Ruby lndrs rl43 Middle (V) Knox John A (Rosa) supt Juvenile Detention Home h300 Pierce av (V) Knox Mary opr h217 Jones av Knollenberg Julius G (Ella W) tobacco h470 Orange Koplin Henry M (Sarah) h312 Cherokee av Kornegay A B baker Central Ga Baking Co Koshkin Boris tailor 574 Cherry 818 2d Kress S H & Co H R Christian mgr 450-454 3d Krewson Luther H (Bessie) belting 1507 Broadway hl511 do KRIEBEL HORACE A (Florence), Asst Cashr Fourth Natl Bank, h304 Cherokee av Krim Chas R Lumber Co D N Cartledge repr 9 Jaques bldg Kurtz John H (Mamie) pastor h506 Broad Kurtz LeRoy rl310 Broadway Kuttner Lena (wid Jacob) r301 Katherine Ct apt Kyle Jas G (Euphrasia S) propr Kyles's Drug Store h435 Chestnut KYLE'S DRUG STORE, J G Kyle Prop, Drugs, Candies, Cigars and Tobacco, Toilet Articles, Fountain Drinks, Prescriptions a Specialty 527 Cotton av, Phone 2427 Kyles Frank B (Katheryn) brk mason h357 North L F M STORE, Leonard Fitzpatrick & Mueller Props, B Earl Mathews Mgr, Dry Goods and Ladies' Ready-to-Wear 558 Cherry, Phones 4871-4872 L & N Drug Co (E D and E D Leonard jr) 603 3d FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 565 Lackay Edw P elk Lackay & Lackay r3033 Houston av Lackay Jas (Ada; Lackay & Lackay) hllO Cedar (S M) Lackay John F (Eva M; Lackay & Lackay) h3033 Houston av Lackay & Lackay (John F & Jas Lackay) gro 1502 Broadway Lackay's Hall 1502% Broadway Lacy Howard (Marie) farmer rear 1143 Milledgeville rd Ladd Betsie lndrs r6 Woodliff Ladd John porter r6 Woodliff Ladney Jack (Susie) firemn r2526 Broadway Lain Lee (Ethel) carrier P O h528 Monroe Lafferty Maggie (Lafferty's Mlnry Parlor) rl04 Mag- nolia Lafferty Mary (Lafferty's Mlnry Parlor) rl04 Mag- nolia YATES MOTOR GO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Lafferty's Millinery Parlor (Mary and Maggie Lafferty) 652% Cherry Lain Lee (Ethel) carrier P 0 h528 Monroe Lain Parks L (Ida) carrier P O h562 Monroe Laird Christopher H (Dorothy) mach h754% New Lake Alex (Lula) cook h354 Madison Lamar Annabel lndrs rl45 College Lamar Annie lndrs h526 Plant al Lamar Annie L cook r525 3d av (V) Lamar Eliza cashr rl College Hill apt Lamar Eliza lndrs hl33 4th av (V) Lamar Emmett (Lucile) lab rl227 (514) Woolfolk Lamar Flardie opr Sou Bell Tel Co rll7 Summit av Lamar G B slsmn Dunlap Huckabee Auto Co Lamar Jack (Carrie) lab h344 Hammond Lamar Jas (Callie) plstr h326 3d av (V) Lamar Jasper hlpr rl08 Dempsey av Lamar Jerry (Lucy) carp h317 Nussbaum A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit MORRIS HARRIS I JlS* INSURANCE SURETY BONDS T-Unkn- r?1 | TelePhone 1<51 566 (1925) R. L. POLK & CO.'S Lamar Julia S (wid Jack) h530 College Lamar Lavina lndrs h218 (18) Mutual av Lamar Lavosia (Hattie) eng hlOl Cabiness av Lamar Lillie' M hl31 Curry pi (NH) Lamar Macklie driver r525 3d av (V) Lamar Mariah matron Methodist Orphan Home r do Lamar Mattie (wid Albert) h774 Nussbaum Lamar Melrose A (Nellie) atty h390 Sewanee av Lamar Mollie rl017 Oglethorpe Lamar Pierce (Eliz) cook h236 Fargason Lamar Robt clnr M L Fleming r Moore av (SM) Lamar Robt (Clara) gro 305 Campbell av h do Lamar Seaborn (Faustine) lab hl94 Virgin Lamar Susie L elk Sou Bell Tel Co rll7 Summit av Lamar Thos waiter rllO Franklin Lamar Walter D (Dollie) office' 205 Grand bldg h238 Georgia av Lamb Alice sten r413 Spring Lamb Anthony (Mollie) lab h321 E 3d (EM) Lamb Eug mill hd r35 Bibb av Lamb Georgia smstrs r304 Flanders (EM) Lamb Henry K (Lizzie) trucker r228 American blvd Lamb Henry S (Lillian) eng hl26 Napier av Lamb John M (Daisy) elect eng hl45 Laurel av (NH) Lamb J Herman technician Macon Hosp r821 Mul- berry Lamb Lillian G Mrs sten H L Barfield rl26 Napier av Lamb Louise' Mrs r409 Elm Lamb Monroe (Sallie M) mill hd h35 Bibb av Lamb Perry PI (Iona) asst county coir hl04 Pierce av (V) Lamb Sallie boxmkr rl233 Second Lamb Sarah F student r!26 Napier av Lambertson John (Ruby) mech hll7 Lee Lambkin Robt (Lizzie) lab h801 Curd (SM) Lamis Harry mgr Arcadia Billiard Parlor r Francis Hotel Lamis Jas (Zachary) mgr N Y Hat Cleaning Co r261 Columbus rd Lamis Peter elk Arcade Billiard Parlor r J L Roberts Lamm Herman (Alva) dispenser r821 Mulberry Lamon Allie' rl39 Tenny Lamon J Danl (Lucie) eng h309 North av (NH) Lamon Sarah student r309 North av (NH) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG autoCOMpMaEinRCteIArL aTnRdUCtKopBObDuIEiSlder 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 567 Lamon S Corinne (wid Homer N) hl39 Tenny Lamor Laurena cook r71 Schofield Lamor Sam (Mattie) plstr h320 (274) Roye Lancaster Clinton chauf rl05 Willingham Lancaster Fannie (wid Clinton C) hl05 Willingham Lancaster Mary smstrs rl05 Willingham Lancaster Vera sten Grand Lodge of Ga F & A M rl05 Willingham Lancaster Wilhur C elk rl05 Willingham Lancaster Wm G (Belle) eng h604 1st Lance E Warren (Alma) elk h322 Linden av Land Aaron J jr elk Bibb News Co r Y M C A Land Arth S D r324 Cleveland Land Elmer J (Viola) driver Ga Banana Co hl20 Cut- ter's la Land E Morgan saw filer r423 American blvd Land Fort E (Sue) state supt Public Schools h240 College Land Fred L r423 American blvd Land Hazel smstrs rl06 Enterprise Land Irene smstrs rl06 Enterprise Land Jas L (Josephine) cond h324 Cleveland Land John H slsmn Texas Co h Log Cabin blvd Land J Robt (Eula) sawyer h423 American blvd Land Mattie (wid Cull) h47 Holt av (NH) Land Thos A (Eva) hl06 Enterprise Land Thos A jr msngr rl06 Enterprise Land Wm 0 dept mgr Dunlap Huckabee Auto Co rl25 Ross Park Land W Herman linemn r411 Arch Landis Alvin S Rev (Lois) pastor h613 Woolfork Lane Adolphus plmbr h41 2d av (V) Lane Andrew W (Adaline) sec-treas Bibb Basket Co h520 Washington av Lane Anna B (wid Lewis B) hl44 High Lane A E (Bertha) r963 Walnut Lane Benj r!95 Hendley (N H) Lane Carrie S r345 North av (NH) Lane Chas mach r258 Washington av Lane Chas Rev (Ellen) hll2 Holt av Lane Claybon B barber 613 Broadway hll5 (121) Green Lane David (Kate) rl41 Academy Lane Filmore B depy sheriff r Edgerton Hotel The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile lists. Our new Catalog contains muck valuable data. Ask for a copy It. Jj. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 568 (1925) R. L. POLK & CO.'S Lane Harry (Sallie) lab hl638 1st Lane Harry M sten r316 Hardman av Lane Harvey T (Norma) formn hl30 Magnolia Lane Hattie M (wid Andrew W) h316 Hardman av Lane Helen C (wid Herbert) mgr Edgerton Hotel r do Lane Henry farmer h601 Plumtree Lane Horace lab rl211 3d Lane Inez student rll5 (121) Green Lane John (Jessie) lab h542 Henrietta Lane John W hrkmn rll2 May av (Unionville) Lane Jos rll2 May av (Unionville) Lane Josephine sten r601 Plumtree Lane Leona Indrs hl206 3d Lane Lucius (Carrie) lab h216 Plant Lane Margt student r316 Hardeman av Lane Martin L (Lucile) printer h608 Plum Lane Mary (wid Frank) dom h Simmons av LANE MILLS B, Pres Citizens & Southern Bank, res Savannah, Ga Lane Mittie Indrs h7 Stripling's al Lane Mamie (wid Thos) r258 Washington av Lane Nick (Essie) lab h305 Plant Lane Palmer (Kattie) lab h316 Monroe Lane Sarah (wid A) r Highland av Log Cabin Hts Lane Thos R (Eva) h860 Pine Lane Virginia student r316 Hardeman av Lane V McKibben (Linda A; Turpin & Lane) hlOO Cleveland av Lane Willie F lab r216 Fretwell al Laney Annie Indrs h228 Jefferson Laney Chas H (Agnes L) collr Macon Telegraph rl704 2d Laney Emma Indrs h305 Short (EM) Laney John F (Annie) formn Macon News h504 Dun- can av Laney Lucius cook r228 Jefferson Laney Maud E tchr rl45 Middle (V) Lang Geo G slsmn Burden Smith & Co r673 Mulberry Lang Hazel nurse Macon Hosp Lang Jonnie lab r356 Church al Langford Carlton (Pearl) baker h2 (11) Myrtle (EM) Langford Clem (Lillie) mill hd r23 Bibb av Langford Danl F printer The J W Burke Co r859 Elm Langford Geo C (Lillie) mill wkr h60 Davis Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 569 i^^dG^riMAn^rcikTw Ramsey Coal Co r 859 Elm Langford Harvey hlpr r232 Jackson Langford Jas r452 New Langford John (Sallie) janitor h236 Bell av Langford LeRoy appr J W Burke Co r859 Elm Langford Margt S artist 3 Nevaro flats r do Langford Mary (wid Chas) r601 Main (EM) Langford Minnie Mrs h.232 Jackson Langford Mozell mach opr r232 Jackson Langford 0 G Mrs pkr Armour & Co r452 New Langford Tilden appr The J W Burke Co r859 EJm Langley Louis (Janie) orchestra leader Rialto Thea- tre h708 Napier av Lango Lucretia cook r59 Spring Langston Alex T (Edith) sten h402 Beech av Langston A Ray ship elk Bibb Mfg No 2 rl40 High- land av Langston Chas r717i^ 2d Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Langston Chas E (Daisy G) eng hl408 2d Langston Emmaline rl408 2d Langston Frank porter h Ross Langston Gertrude r714 3d Langston Henry slsmn Central Ga Baking Co r R D 1 Highland av Langston Hugh F elk Macon Telegraph r!408 2d Langston Inez (wid Walter D) slsldy Union Dry Goods Co h717i/2 2d Langston Jas carp rl701 Broadway Langston Jas L (Ollie) slsmn hlOO North Langston Martha E slsldy Burden Smith & Co rll59 Elm Langston Myrtle opr Sou Bell Tel Co rl408 2d Langston Wm W (Carrie) police h350 Columbus Langston Wm W jr r350 Columbus Lanham John mech rl05 Balkcom av Lanham Lawrence sten r!05 Balkcom av IFOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kind; of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 570 (1925) R. L. POLK & CO.'S Lanham Virginia student rl05 Balkcom av Lanham Wm A (Clifford) printer hl05 Balkcom av Lanier Bert (Ollie M) auto mech r506 Orange Lanier Chas F (Sarah) mgr Exchange Pharmacy r L B Huckabee Osborne pi (Ingleside) Lanier David W (Edith) mgr Gulf Refining Co hl20 Ninadell av Lanier Eilleen H (wid D B) r694 Ridge av Lanier Hattie lndrs r302 Hanson Lanier High School W P Jones supv-prin 126 Forsyth LA1VIER HOTEL, see Hotel Lanier Lanier H L pntr r J B Marshall Lanier Jack R slsmn Builders Lumber Co h708 Pine Lanier Jefferson D (Minnie) h6 Fredonia apts Lanier Julia cook r407 Campbell av Lanier Lizzie (wid Lib) r321 Pio Nono av Lanier Mattie rl05 Bell av Lanier Myrtle elk rllO Newberry Lanier Otis (Fannie) driver rll6 Middle (V) "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmegyAIho,LytLuYoarTup.nHrrgdouYdFvmeooe. nlcrsaTtasisathstiaritoilcesen.A,niNasoTtIDtafHyaEUotdhhuYaSeernEyagDAletPrWRrhuYyEgeOsegigRpdiUnsiAntaNo'kLlns-., Lanier Robt C (Ollie) blksmith hllO Neuberg Lanis Wm (New York Hat Cleaning Co) h261 Colum- bus rd Lankford Dan composer r859 Elm Lankford Felder bkbndr r859 Elm Lankford Geo H (Alice) slsmn h859 Elm Lankford Leroy bkbndr r859 Elm Lansing Ada B (wid Oscar) h426 Calhoun Laramore Lee (wid Lewis) h24 (1424) Lawton av Laramore Rose Mrs sec R L Carter jr rl93 Magnolia Larkin Emma O- (wid Benj G) r720 1st Larkin Zerline sten A E Rood Lmbr Co r Nevarre apts Larry Andrew (Carie) h541 Elizabeth Larry Marian (Jeanna M>swtchmn h309 Womack Larsha Mack porter r243 4th av (V) Larshale Wm carp h243 4th av (V) Larshale Wm jd carp r243 4th av (V) Lashea Nettie h313 Forest av (V) R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ra ENGLAND ^ THE CHIROPRACTOR Will Remove the CAUSE of Your Disease RE- ALT * 4557 MACON CITY DIRECTORY (1925) 571 Lasher Albert C (Edyth) asst eng h777 Courtland av Lasseter Horace S (Marian) tchr r453 Carling av (HH) Lassetter Nannie E (wid Robt L) h555 Pine Lassiter Evelyn elk Guaranty Life Ins Co rl60 2d av Lassiter John draymn hl60 2d av (V) Lassiter Jonnie Mrs smstrs rll5 Cedar (SM) Lassiter Robt L gro 907-909 Clinton r911 do Lassiter Wm G student h6, 478 College Laster Reuben J (Annie Laurie) trav hl37 Magnolia LaTaste John J (Ella) cabtmkr h268 Maple Latham Benj C (Sarah) auto mech r817 New Latham B McKay asst mgr h Forest av (Bellvue) Latham H Alton (Alice) chauf r John Arnett Latham Robt S (Helen) brkmn h316 Washington av Latham Sarah (wid Wm T) h Forest av (Bellvue) Latham Wm T jr (Leah) chauf r Sarah Latham Latimer Adolphus (Mary) lab h!56 Sycamore Chero-Cola MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIINSS Latimer Albert T (Hazel) shoemkr 447 Clinton hll2 Thomas (EM) Latimer Camilla emp R M Schelling r333 Middle Latimer Edw C (Eula F; Latimer's Pharmacy) hl06 Hartley av (CP) Latimer Emma h486 Clinton (EM) Latimer Florine tchr rill Cleveland av Latimer Gower (Reva) asst tchr Mercer Universitv hll33 College Latimer Ida E (wid C M) hill Cleveland av Latimer Nellie E tchr rill Cleveland av Latimer Viola maid r403 Chestnut Latimer Zeke clo clnr r486 Clinton (EM) Latimer's Pharmacy (E C Latimer) Forsyth rd (V) Latimore Dulie (Effie) lab h74 Spring Latimore Isaac (Exie) lab h333 Middle (V) Latimore Mary lndrs h203 Holmes av Latimore Matilda lndrs h649 Elm al Latson Leonard L (Jessie) r756 Spring Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world- Contains Condensed Statements of All Banks, Lists of Officers of AH Banks, Digest of State Banking Laws and Much Other Data related to " Banking Price $20 Published semi- annually ' MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. - Detroit, Mich. (1925) R. L. POLK & CO.'S Lattimore Dosia (wid Thos) r227 Daisy~ Lattimore Lem lab r752 Center Lattimore Leo (Ida) lab h752 Center Lattimore Ulysses (Genevia) lab h271 Brief Lauley Jessie' concrete wkr rll9 Daly Laurence Geo elk rl4 College Hill apts Laurine Apartments 559 Orange Laud Jas P D student r324 Cleveland Lavender Alma opr Sou Bell Tel Co rl47 Rose Pk Lavender Clint D (Hattie) inspr h219 Tatnall Lavender Clyde cabtmkr Macon Lmbr & Mfg Co r813 Woolfolk Lavender Columbus P (Ardelia) mill opr h32 Shell av Lavender Dugan D (Mattie) lab h211 Middle' (V) Lavender Ellis M (Beulah) lab r411 Jackson Lavender Ernest pntr r211 Middle (V) Lavender Prank carp h324 Clinton Lavender Horace W (Minnie) blksmith h813 Wool- folk Lavender Hubert (Maud) driver hl26 Grants Lavender Ida mill opr h30 Shell av Lavender Jas A lab r411 Jackson Lavender Jos (Sarah) driver h244 Ellis av Lavender Leonard (Geneva) lab hl29 Grants Lavender Lonnie mill opr r30 Shell av Lavender Louise sten r219 Tatnall Lavender Marcus L lab rl29 Grants Lavender Mathie mill opr r30 Shell av Lavender M Dawson (Gussie) porter hl78 (180) Lin- coln av (V) Lavender Oscar T (Myrtle) eng h656 New Lavender Richd (Ethel) opr h202 Hydrola Lavender Ruth student r813 Woolfolk Lavender Thos mach hd Macon Lmbr & Mfg Co Lavender Vera student r813 Woolfolk Lavender Walton mill opr r30 Shell av Lavender Wm (Jennie) mach hl36 Ells (SM) Laverne Rosa rl061 Ash Lavine Lewis S slsmn rl06 Park pi Lavine Lillian rl06 Park pi Lavister Perry (Annie) lab h403 Chestnut Law Annie (wid Jarrett) rl31 Maynard Law Jos harness mkr Otto-Isaacs Harness Co hl31 Maynard KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 573 Law Leman carp rl31 Maynard Law Robt lab h236 4th av (V) Lawless Jas I (Levenia) pntr hl06 Emerald (EM) Lawless Wm H (Bessie) furn r364 Spring Lawrence Ambes (Ella) lab hl05 (107) Mutual av Lawrence Belle Mrs bkpr Askins r208 2d Lawrence Edgar lab rl04 Empire av Lawrence Ella lndrs h519 E Academy (EM) Lawrence Frank C (Annie) elk h.208-12 2d Lawrence Geo brklyr r519 E Academy (EM) Lawrence Geo (Julia) lab h532 Maynard Lawrence Geo S slsmn Burden Smith & Co rl3, 478 College Lawrence Henry lab r519 E Academy (EM) Lawrence Henry student rl46 Deborde Lawrence Henry G (Addie) slsmn hl41 Pierce av (V) Lawrence Inez r208 2d Lawrence Jas (Nellie) firemn h220 Roosevelt av (V) Lawrence Jas (Leola) lab h299 Craft la SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Lawrence Jas B (Clara) car repr hl305 2d Lawrence Jennie rl716 3d Lawrence' Julia drsmkr 161 3d h do Lawrence Laura hl44 Adams Lawrence Louise lndrs hl4 Plant al Lawrence Mamie car clnr rl04 Empire av Lawrence Millie cook h2 Barfield al Lawrence' Morton J (Lula B) slsmn r208 2d Lawrence Richd (Alice) lab h9 Sparks al Lawrence Rosela hlpr Askins r208 2d Lawrence Sami (Matilda) lab h490 Virgin Lawrence Sophie r653 Oglethorpe Lawrence' Tempie smstrs hl04 Empire av Lawrence Vera car clnr rl04 Empire av Lawrence Viola cook r519 E Academy (EM) Lawrence Wilbur F (Annie) slsmn J H Bailey Coffee Co hl26 Coleman av Lawrence Wm rl4 Alabama More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. O H O 73 n o FOR ANY TRADE L AINSYTBUSSINO ESSF NAMES -- ANY PROFESSION DETROIT R. L. POLK & m. nWTO A 574 (1925) R. L. POLK & 0.'S Lawrence Wm lab r465 Alabama Lawrence Wm H (Emma) brk mason h2921 Houston av Laws Robt lab h236 4th av (V) Lawson Andrew L (Rosa) h302 Cherokee av Lawson Armstead lather h2 Park Hotel al Lawson Esther L (wid Westley) h287 Masonic Home rd Lawson Geo (Mary) lab r978 Long Lawson Henry B (Frankie E) elk P 0 hl506 2d Lawson Henry W (Sallie) carp h232 North Lawson Hollis E student rl506 2d Lawson Jonnie mill wkr rl71 Wings Hill Lawson Jos porter r232 North Lawson Julia (wid Columbus) r25 Marion pi H H Lawson Lettie lndrs hl60 Brief Lawson Lillian bkpr Burtons Inc rl506 2d Lawson Nellie tchr r232 North Lawson Noal H (Mary) mach r287 Masonic Home rd Lawson Norma sten r287 Masonic Home rd Lawson Oswell T (Sara M) contr h760 New Lawson Pearl lndrs h212 (225) Fargason Lawson Ruby Mrs phone opr Hotel Lanier r778 Wal- nut Lawson Rufus Louvenia) truck driver hl92 Woodliff Lawson Thos S chf elk S A L Ry r202 Clisby Lawson Warren P (May) elk P O h506 Carling av (HH) Lawson Wm carp h232 North Lawson Wm M (Annie) carp hill Tatnall Lawson Wm S (Mattie M) slsmn Macon Grocery Co h 202 Clisby Lawson W M real est hl6 Marion pi (HH) Lawton Emily student r415 Vineville av Lawton Furman D (May) h415 Vineville av Lawton Jas L lawyer 15 Washington bldg r502 Fort Hill (EM) Lawton 0 P (Gladys) slsmn r325 Adams Layfield Allen B (Minnie) overseer h230 (24) Clinton Layfield Edw R (Pauline) cond h874 1st Layfield Ella cook hl45 College' Layfield Henrietta r28 Bellevue rd Layfield Flynne elk r874 1st Layfield Jas W (Annie) tchr h632 Orange 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 575 Layfield Jefferson L (Lena) mill wkr h28 Bellevue rd Layfield John C (Fannie) flagmn h217 Chappell Layfleld Mary C tchr r632 Orange Layfield Oliver D (Margt) police hl31 Ross Layfield Wm opr r230 (24) Clinton Laythan Jas (Alberta) waiter r455 Martha (EM) Layton Babbie' (Anna) bkpr h cor Cherry av and Win- ton av Lazarus Gertrude rl20 Buford pi (V) Lazarus Jacob (Madeline) furn 364 3d hl20 Buford POLK'S *1 f iljUfl DENTAL urWeCTAgDNiASsTDAtAeTErS i/m miPrfl ,mht>W*uTTIONNTmHu *1-P9OU2A5Cl 1 I S ;. ^**c a a 73 2tn w so 5 & IaJ o5 2 ^ Pgw Sf X tt> Q !< 2 !2 Ca- pH o lb 2NH o MS LiJ Sir p 3 * a a s 0 o2 o2 H H ^UCgOU^jCg/3 S2xk,, EooW-QO2c;?>oS,ccH>oo < < Xhy Lewis Arth E pntr r E M Lewis Lewis Benj (Carrie) h603 Prince Lewis Bernard M (Lilia) bkpr Johnson Bros h854 Oak Lewis Bertha Mrs h859 3d Lewis Bertha lndrs rl62 College Lewis Bertha maid r336 Woodliff Lewis Bessie cook h309 (1021) Wood al Lewis Callie M maid r258i/2 Broad (EM) Lewis Carey (Belle) lab h311 Coles al Lewis Carrie hi Ellis av Lewis Carrie cook h88 (126) Forest av (V) Lewis Cath lndrs hl30 Ross LEWIS CHARLES B (Tecoali Y), Pres Fourth Natl Bank, h630 Vineville av Lewis Clarence B (Alice) driver Yellow Cab Co rl07 Broadway Lewis Chas H (Ida) pntr hl90 Virginia Lewis Claude M gro 315 Nussbaum h640 Pebble n Automobile owners are select prospects for many kinds of merchandise. Send to Headquar- ters for all kinds of Automobile Lists. Our new Op Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 582 V (1925) R. L. POLK & CO.'S Lewis Cleone r665 Ash Lewis D Edgar (Marie L) reprmn Natl Cash Register Co r527 Montpelier av Lewis Edw (Sallie) hl64 Whitehall Lewis Edw (Ina) fnshr h.106 Empire av Lewis Edw C (Annie C) mach rl26'y2 Washington av Lewis Eliz student rlOO Grand av Lewis Ellen lndrs h668 Hawthorne Lewis Elman R student r E M Lewis Lewis Elwin M (Nellie) farmer h Church Lewis Esther lndrs hl4 Gas House al Lewis Eula (wid Geo) cook h Industrial Home rd Lewis Eulis (Viola) blksmith hl29 Clark la Lewis Eva cook r530 (541) 3d av (V) Lewis Fannie dom h339 Gilmer Lewis Frank porter r559 Mulberry Lewis Geo lab r257 Ocmulgee Lewis Geo (Dallas) plmbr G F Yetter h273 Ells (SM) Lewis Georgia lndrs h558 Hammond Lewis Harvey Rev (Laura) pastor hl23 Thomas Lewis Hazel B student r854 Oak Lewis Henrietta (wid John) r236 (244) Ferguson Lewis Henry (Estella) carp hll Tinsley la Lewis Henry (Bessie V) cook hl50 New Lewis Ida dom 3 Turpin Lewis Jas (Bertha) carp h620 Pebble Lewis Jas (Mabel) gasmkr h217 Orange Lewis Jas hlpr Macon Coca-Cola Bottling Co r Clinton rd Lewis Jeff lab h Industrial Home rd Lewis Jelks r634 (934) Vineville av Lewis Jennie nurse r209 Middle (V) Lewis Jesse (Rena) lab h220 Railroad Lewis Jessie rl44 Elizabeth Lewis Jessie Mrs slsldy Union Dry Gds Co r620 Walnut Lewis John (Magnolia) carp rl035 Clinton rd Lewis John hat clnr r433 Forest av (V) Lewis John (Lillian) hlpr h3 (2) Spring la Lewis John (Lena) lab h750 Center Lewis John (Minnie) porter 426 Flanders Lewis John E (Julia) pntr h640 Peeble Lewis John F (Martha) barber hll4 Tatnall Lewis John S Rev (Kate) hlOO Grand av (B) More goods are bought and sold through the Classified Business Lists of the Directory thar any other medium on earth. IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 583 Lewis John W (Ruby) hl73 Virginia ay Lewis Jos (Jannie) lab h80 Schofield Lewis Julian S (Johnnie L) dept mgr Fourth Natl Bank h541 (717) Vineville av Lewis J D hlpr Miller Bros Lewis Laura h914 Elm Lewis Lee butler 103 Vineville av Lewis Lenzo (Ebbie) lab hl03 Moore la Lewis Leonard (Inez) lab hl23 Glen Lewis Lethia lndrs h446 Flanders (EM) Lewis Levi (Inez) slsmn hl327 1st Lewis Lizzie maid r446 Flanders (EM) Lewis Lorn W asst tchr Mercer Univ Lewis Loyd lab r80 Schofield Lewis Lucile maid h258% Broad (EM) Lewis Lydia lndrs h543 Moore av Lewis Maidelle asst F W Farmer rl97 Edna pi Lewis Margarette rl97 Edna pi Lewis Mary lndrs h205 Holmes av Lewis Mary student r E M Lewis Lewis Mattie (wid Ernest) elk G P Rankin & Co r821 Oak Lewis Mildred r548 Ocmulgee Lewis Moodie bellmn rl06 Empire av Lewis Myrtle sten Sou Ry System r911 Orange Lewis Nelson (Willie) lab h208 Forest av (V) Lewis Ola Mrs gro rl55 Broadway Lewis Paul r E M Lewis Lewis Perry (Maggie) firemn h325 Middle (V) Lewis Press (Clara) lab h210 Turpin Lewis Raburn lab r446 Flanders (EM) Lewis Ray C (Annie Laurie) slsmn r912 Napier av Lewis Robt (Ellie) farmer hl041 Clinton rd Lewis Robt (Emma) farmer h Industrial Home rd Lewis Robt (Sadie) lab hl06 Lynwood av Lewis Robt porter Roughton Haliburton Co Lewis Robt porter Stewart Oil Co Lewis Robt (Gertrude) porter h310 2d av (V) Lewis Robt L elk G R Kinney Co Inc r452 New Lewis Robt W tel opr h911 Orange Lewis Runett h640 Peeble Lewis Sarah maid hl40 E Academy Lewis Sebon lab r303 1st av Lewis Sophie maid 471 Walnut Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ters for all kinds of Automobile Lists. Our new cCoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfHor. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. Lewis S Henry (Ella) r854 Oak Lewis S T pntr r317 Jackson Lewis Texas maid hl2 Spring Lewis Walker M driver Yellow Cab Co r922 Walker Lewis Walter mill opr r22 Shell av Lewis Walter F (Ellen) CPA hl97 Edna pi Lewis Walter H (Clara E) mgr G R Kinney Co Inc r364 Hines ter Lewis Wilford prsr r446 Flanders (EM) Lewis Wm (Eliz) r922 Walnut Lewis Wm C (Florence) slsmn h Belvedere dr Lewis Wm M (Louise) carp h890 Williams Lewis Zachariah lab r339 Gilmer Liberty Pressing Club (J T Bishop) 558 Mulberry LIBERTY SAYINGS & REAL ESTATE CORPORATION, R E Hartley Pres, T R Epps Y-Pres, A H Hendricks Sec-Cashr, J R Webb Chairman Finance Committee, 453 Cotton av, Phone 4691 (See page 55). Lideman Arth (Bulah) lab h978 Long Lidsey Dempsey (Sussie) carp r303 Morgan av Life Insurance Co of Virginia R W Hawkins mgr 508-10 Grand bldg Life Jas brklyr r457 E Academy (EM) Life Obie (Belle) soft drinks 452 Martha (EM) h357 E 2d (EM) LIFE & CASUALTY INSURANCE CO OF TENNESSEE, Ernest L Moore Hist Mgr, 315-18 Bibb Bldg, Phone 4821 Lifsey B Perry (Almedia) aud rl50 Holt Lifsey Clyde r312 Johnson av Lifsey Emma A (wid John A) h312 Johnson av Lifsey Inez slsldy Union Dry Gds Co r312 Johnson av Lifsey J Clinton electn hl33 Charles (SM) Lifsey M Leondus (Irene) singer hl09 1st av (CP) Lifshey Anna (wid Isaac) h5, 559 Orange Lifshey Barney (Southern Duco Enameling Co) r5, 559 Orange Lifshey Larry L (Southern Duco Enameling Co) r5, 559 Orange Liggett see also Leggett LIGGETT LOUIS K CO, A L Green Mgr, Druggists 512 Cherry, Phone 2931 Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 585 Liggett & Myers Morrison Thomas div mgr whol tobacco 415 Ga Casualty bldg Lightfoot David lab hll? Moore av Ligbtfoot Ellen (wid Robt J) r W E Hill Lightfoot Floyd F elk X V Clothes Shop r763 Poplar Lightfoot Geo (Ruth) waiter r763 Poplar Lightfoot Henry G (Edna) dairymn rll08 Main (EM) Lightfoot Jas (Katie) carp h306 Wood al Lightfoot John lab r48 Tracey's al Lightfoot Robt (Ola) barber H L Lee h48 Tracey's al Ligon Hugh L (Georgia) pump repr h615 Anderson Ligon Marion L r615 Anderson Ligon Roy W (Ruby) auto mech r615 Anderson Lile Eug (Emma L) wtchmn h207 Roosevelt (V) Liles see also Lyles Liles Bessie housekpr r827 Main (EM) Liles Cora mill opr h235 Flanders Liles Dannie' (Ruby) barber S O Brockman hl03 Newberg av Liles Jas D (Julia) formn Willingham Sash & Door Co hl24 Fort Hill (EM) Liles John A contr h827 Main (EM) Liles Marion H mgr Trust Co of Ga r258 College Liles Wiley W (Lilia) elk H A Kennington Gro Co r812 Woolfolk (EM) Liles Wm C gro 828 Main (EM) r827 do Lillis Stella lndrs h222 Orange Lilly Josh (Mattie), lab h701 Hammond Lilly Robt brkmn r760 (766) 2d Lin Louise' tchr Wesleyan College r66 Arlington pi Linch see also Lynch Linch Erion E bkpr r612 Oglethorpe Linch Talulah h612 Oglethorpe LINCOLN AUTOMOBILES, Ellis Motor Co Dealers, 362-378 1st, Phones 46-723-724-1846 LINCOLN AUTOMOBILES, Jones Motor Co Authorized Dealers, 557-559 Plum, Phone 1591 Lindley Cliff S bkpr Sou Loan & Real Est Corp r767 Cherry Lindsay Geo A cond r852 New Lindsay Jack lab r318 Wall Lindsay John T jr window decorator r243 Ross Lindsay Lydia (wid Victor) h852 New Lindsay Thos (Lucinda) firemn h362 Bookers al FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 586 (1925) R. L. POLK & CO.'S Lindsay Wm G (Lena) bus driver r335 Ross Lindsey Benj (Ola) h256 Jeff Davis Lindsey Charity lndrs h308 Burnett (EM) Lindsey Geo W (Martha) traffic officer Police Dept hll06 Oglethorpe Lindsey Henry C porter r3 (102) Clinton Lindsey Herbert (Lou) slsmn h767 Poplar Lindsey Jas (Mildred) porter h3 (102) Clinton Lindsey Jas A mech Jones Motor Co r767 Poplar Lindsey Jas W elev opr r308 Plant Lindsey John T (Ida W) wtchmn h.243 Ross Lindsey John T jr elk Dempsey Haberdashery r245 Ross Lindsey Jos (Georgia) mill hd hl8 Bibb av Lindsey J Layton (Ida) lab h460 New Lindsey Manuel trucker M D & S R R Co r520 Flanders Lindsey Mary r303 Morgan av Lindsey Minnie lndrs r3 (102) Clinton M 1 L L I R 0 N S "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH SIfsDHiflerAiEmegyAIho,LytLuYoarTup.nHrrgdouYFdvmeooe. nlcrsaTtasisathstiaritoiclesen.A,niNasoTtIDtfaHyaUEotdhuhYaSerenEyagDAlePtbrRrhYulyEegsOeiggdpRiUnisAntaNo'kLlns-., H Lindsey Naomi r767 Poplar Lindsey Thos A (Pearl) h308 Plant E Lindsey Virginia r308 Plant Lineberger Clarence (Mary J) carp rl53 New A Lineberger Eli J routing aide W U Tel Co rl53 New Linenkohl Boyce (Vida B) mech hlOl Troup T Lines Rayfield (Gertrude) h415 Virginia av Lingo Annie M sten Central Bedding Co r34 S College Lingo David (Estelle) farmer hl016 Main I Lingo E Inez (wid Wm B) h34 S College Lingo Genie (wid Jessie L) r2024 Broadway N Lingo Geo W (Maude) hll05 Walnut Lingo Lovick P (Kath) slsmn H L Barfield r465 Orange G Linton Clara cook r505 (409) Crisp Linton Isiah (Anna) lab h507 (409) Crisp ' Linton Jas porter rl24 Green Linton Lovett delmn r505 (409) Crisp 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO aENGLAND T"p THE CHIROPRACTOR * Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 45S7 MACON CITY DIRECTORY (1925) 587 Linton Walter r505 (409) Crisp Linwood Asbury jr lab r516 Waterville rd Linwood Delie r516 Waterville rd Linwood Lena cook r516 Waterville' rd Linwood Wash lab r516 Waterville rd Linwood Wm h602 (1280) Elbert Liose Ruben (Minnie) lab hll6 Roff Home av (V) Lipsey Jos (Leola) mech h207 Forest av (V) Liptrot Jos (Anna) baker Central Ga Baking Co h 800 Daisy Liptrot Ned (Angie) lab hllO Mdsley Lisfey Clinton elec opr hl33 Charles Lisle Grover C (Willar) millwright h220 Calhoun Litman J W (Annie) ice ctr h320 Campbell av Little Aaron (Bettie) hll3 Moore la Little Albert lab r205 Jones Little Andrew lab r215 Fretwell al Little Anna Indrs hll5 Elliott (EM) MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAIWLKLIISNS Little Annie Indrs h.4 Plant al Little Annie Mae Indrs r567 Henrietta Little Baron (Sensina) lab r315 Telfair Little Benj (Annie) lab h567 Henrietta Little Carrie r401 (301) Charles (SM) Little Cath lab h203 (703) Henderson Little Cath Indrs rl08 Jordan Little Chas C r339 Vineville' av Little Claude H (Mary) gro 453 Clinton r207 Thomas Little Claudia E student rl05 Forest av Little Clyde rl07 Lamar Little Dorothy dom rl30 Grants Little Douglas student rl05 Forest av Little Edith tchr rl26 Summit av (NH) Little Eliz student r339 Vineville av Little Ella B dom rl08 Jordan Little Emma Indrs h254 2d av (V) Little Estella r315 Telfair Little Eug (Mary) cook hl30 Grants Telephone 2687 J. T. MOLTON, Mgr., 348 Oak 0. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work CM 0) c o 13 ^ CM H ^ <> u a 2-. ctf pJC CL, CO K a Sm (6 jd H LUMBER, SHINGLES, LATH Willingham Sash & Door Co, Office, 457 Third St. Telephones 278 & 3976 588 (1925) R. L. POLK & CO.'S Little Frank (Ossie) brick mason r4 Tinsley la Little Geneil smstrs r232 4th av (V) Little Geo (Annie) blksmith hl08 Jordan Little Geo B student rl05 Forest av Little Howard A (Mina) elk Sou Ry System rl26 Sum- mit av (NH) Little Ida lndrs h608 (308) Smith (EM) Little Idrola lndrs h7 Buckner al Little Jarrell student rl05 Forest av Little Jenkins D eng hl26 Summit av (NH) Little Jos (Dollie) lab rll3 Moore la Little Kath r401 (301) Charles (SM) Little Leslie H (Ammie B) chf elk M D & S R R h405 Forest av Little Lewis lab r608 (308) Smith (EM) Little Lewis (Alzada) lab hl9 (17) Wise av (V) Little Lona J student r308 Buford pi (V) Little Martha cook h4 Tinsley la Little Mary lndrs hll3 Moore av Little Mattie lndrs rll Malloys al Little Mattie M (wid Jas M) h594 Duncan av Little Oscar (Carrie) lab hi Gunns al (V) Little' Peter S (Cortez) frt agt M D & S h503 Georgia Little Pinckney S agt M D & S R R Co h501 Georgia Little Richd hlpr r527 E 2d (EM) Little Rock Baptist Church 400 Nussbaum Little Roy (Frances) firemn h215 Fretwell al Little Walter A (Annie) h308 Buford pi Little Wm lab rl2 Malloys al Little Wm lab rll3 Moore la Little Wm J (Mary C) phys 518 Citizens & Sou Bank bldg h339 Vineville av Little Wm J jr farm mgr r339 Vineville av Little Wm L (Myrtle) lino mach Macon News r421 Forest av Little Wm N student rl05 Forest av Little Willie M tchr rl26 Summit av (NH) Little Willis shipper Wilson & Co res R F D 2 Littlefield Coleman C (Eliz) mono opr The J W Burke hl06 Jeff Davis Littlejohn Chas R (Nannie L) slsmn r320 Bond Littlejohn Nannie L Mrs slsldy Union Dry Gds Co r 320 Bond More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4% % on Savings MACON CITY DIRECTORY (1925) 589 Littleton Chas H (Mattie) slsmn Goldgar Furn Co hll9 Williams Littleton Jas mech h557 Siam Littleton Massie cashr rll9 Williams Littman Robt (Cornelia) lab h443 Flanders (EM) Lively Wm r Adams Bdg House Lake Livingston Eug H (Lula) h776 Walnut Livingston Eug H jr student r776 Walnut Livingston Lula Mrs buyer Burden Smith & Co r776 Walnut Livingston Rebecca Indrs r453 Bay Livingston Wm (Ara) janitor r814 Ocmulgee Livingston Wm C (Bessie) sec Sou Ry h Log Cabin Hts Lize John (Leila) lab hl53 Moore la Llerens E B mech Dunlap Huckabee Auto Co r905 Cherry Lloyd Adam mech Macon Cycle Co r511% Cotton av Lloyd Carrie rl24 Holt Lloyd Geo T mach opr Bibb Basket Co rl60 Broadway Lloyd Horace C (Mary) carp hl04 Montpelier av Lloyd John F (Lillie M) sign pntr 422% 2d hl071 Walnut Lloyd Lois hkpr rl014 Ash Lloyd T trainmn Macon Ry & Light Co rllO Calhoun Lock Basban Mrs r23 Blosfleld av Lock Harvey K (Alice) millwkr r23 Blosfleld av Lock Leonard T (Mary) wtchmn h23 Blosfleld av Lockart Charlie lab rlj33 Broad (EM) Lockart Wm (Zella M) lab hll6 Middle (V) Lockett Emmett (Marie) porter hl4 Spring Lockerman Andrew J (Willie) solr Crescent Lndry Co rl27 Violet av Lockerman Ernest C (Alma) inspr American Optical Co r721 Main (EM) Lockerman Ethel Mrs supvr Sou Bell Tel Co rl27 Violet av Lockerman Paul S (Frances) grinder American Op- tical Co hll05 Oglethorpe Locket Susie (wid Robt) r778 Nussbaum Lockett Arth (Mary J) carp h203 (303) Mutual av Lockett Bertie r433 Carling av (HH) Lockett Chas J (Sammie) mech rl45 ,4th av (V) Lockett Daisy maid r778 Nussbaum FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS , -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO X CO X > o co c pa H O SO CO H g ci/as 5 C/3 Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. 590 (1925) R. L. POLK & CO.'S Lockett Edgar (Sarah) gro 243 Tindall av h241 do Lockett Efferet mech r414 Lawton av Lockett Eula student r227 Patterson Lockett Ephraim (Fannie) carp hl45 4th av (V) Lockett John lab r322 4th av (V) Lockett Johnie (Mattie) r260 Bartlett Lockett Leary cook r778 Nussbaum Lockett Lit lab rll9 Rock Hill la Lockett Lois lndrs hl22 Clark la Lockett Lucile r865 Edgewood av Lockett Mandy lndrs rll9 Rock Hill la Lockett Mariah nurse rl2 Railroad av Lockett Marie lndrs rl22 Clark la Lockett Martha lndrs hl28 Sycamore Lockett Mary cook r265 Georgia av Lockett Mary maid h268 3d av (V) Lockett Minnie cook r722 Railroad av Lockett Ophelia cook r924 (460) Columbus rd Lockett Otis (Willie) r236 Bell av Lockett Robt r830 Edgewood av Lockett Sallie h260 Bartlett Lockett Sarah cook h322 4th av (V) Lockett Sarah dom rl22 Clark la Lockett Thos (Agnes) janitor hl63 Grants Lockett Willie cook h227 Patterson Lockett Willie B lndrs r301 Coles al Lockey Gloria Mrs bkpr J T Shropshire r Y W C A Lockey Jos (Tena) mech r633 4th av (U) Lockhart Fay rll4 Napier av Lockhart Gelston P (Claudia) trav pass agt C of Ga r501 E Napier av Lockhart Geo W (Alice) plstr hl04 Woodliff Lockhart Jas (Mittie) hlpr h318 Madison Lockhart John W (Alice) farmer h225 Knott Lockhart Leah G (wid Lafayette T) rll4 Napier av Lockhart Mittie music tchr rl33 2d av (V) Lockhart Richd B acct rll4 Napier av Lockhart Robt hlpr r830 Boundary Lockhart Ruby weaver rl04 (102) Randolph pi Lockhart Sandy A (Fannie) plstr hl33 2d av (V) Lockhart Thos lab r318 Madison Lockwood Joel C (Mollie) carp r616 Walnut Lofere Paul (Delia) lab r4 New st la Lofton Lena lndrs h307 Edgewood av E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED , DEALERS Lincoln rOrClSOIVlf it's a Ford or for a Ford, we ____ have it. CARS*TRUCKS "TRACTORS PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 591 Lofton Wm (Clara) h303 Roye Los Cabin Heights Seventh Day Adventist Church Rev M J King pastor cor Montpelier and John- Log Cabin Presbyterian Church 194 Log Cabin dr Logan Alvin L (Sally) agt rlOll Clinton rd Logan Claudia drsmkr 528 Calhoun h do Logan Emma lndrs h226 Moore av Logan Louis (Leila) lab r257 Ocmulgee Logan Robt M (Martha) gro 311 (312) 2d av (V) h257 3d av (V) . , Logan R A agt Life & Casualty Ins Co r Clinton rd Logan Wm D (Cornelia) mech h251 Peachtree Logans Benj lab r404 (256) Pio Nono av Logue C Leonard (Willa) gdnr r452 Hazel Logue Louise maid rl56 4th av (V) Lob. Edw restr 514 Mulberry rl05 Cotton av Loh Julius E (Mary) asst sec-treas Fourth Natl Bank h Vista cir (I) es from Riverdale dr Loh Julius L elk Loh's Cafe rll3 Callaway Loh Laurence M (Vivian B) mgr J P Allen & Co h es Riverdale dr 2 n Ridge av Loh Mary E Mrs r748 College Loh Verna tchr r748 College Lokes Jas (Julia) lab r954 Ocmulgee la Lokes Sylvester (Viola) hlpr r954 Ocmulgee la Lokey Geo A (Sarah B) whsemn h470 Orange Lomax Edw (Amy) lab h22 Wise av Lomax Jack (Realious) rl427 3d LONDON ASSURANCE CORP OF LONDON, ENGLAND, Morgan & Morgan Insurance Agency Agents, 606 Georgia Casualty Bldg, Phone 4147 London Edw D blksmith 322 Clinton h204 Hazel London Georgia dom r219 Hazel London Gertrude hl30 Cleveland av Long Augustus J (Katie) sis mgr Macon Grocery Co hl09 Heard av Long Augustus J jr slsmn Macon Gro Co rl09 Heard av Long Barney L (Marion) formn hl08B Holt av Long Carroll E (Mary) millwkr hllO Green (Payne Mill) Long Chas student r!09 Heard av The most comprehensive reference work on tne banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. ' &C0. Polk Directory Bldg. Detroit, Mich. yj g--% lid GO < KAIGLER S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 592 (1925) R. L. POLK & CO.'S Long C H sis agt Remington Cash Register Co r530 Washington av Long Easter lndrs h507 Gilmer Long Eldora opr r246 Hydrola Long Frank E (Margt M) eng h ss Vista Circle 5 e Ridge Long Henry B (Inez) asst supt h245 American blvd Long Jack (Minnie) h.760 Oglethorpe Long Jas R (Myrtis) auto mech hll5 Crisp Long John rl32 Holt Long Luther L (Cleo) millwkr h36 Manchester qtrs Long Mack (Gertrude) lino opr Macon News r240 Washington av Long Margt lndrs h51'7 Gilmer Long Margt E (wid Geo H) h.203 Clisby Long Mary (wid Freeman) lndrs r236 (244) Farga- son Long McK Robbins Rev (Mary) pastor Vineville Pres Church hl02 Culver Long Minnie cook rl39 Linden av Long Oscar L (Kate H) mgr h429 Ross Long Oscar L jr student r429 Ross Long Rebecca rl09 Heard Long Robt lab rl027 Broadway Long Rose sten rl09 Heard Long R Arnold agt Am Natl Insurance Co r429 Ross Long Vietta R (wid Ross M) opr Sou Bell Tel Co rl37 Cole Long Walter C (Vera) pipeftr h200 Katherine ct apt Long Wesley H elk C of Ga r429 Ross Long Wiley H filtermn City Water Wks Long Wm student rl09 Heard Long Willie M maid 869 Oak Lorance Katie lndrs h25 Magnolia la Lord Albert r460 Mulberry Lord Chas r215 College Lord Earl V student rllO West End av (HH) Lord Francis O (Lois) pipeftr Macon Water Wks h 416 Montpelier av Lord John E (Lois) slsmn Burden Smith & Co h238 American blvd Lord Lois sten Bateman-Freeman Co rl014 Ash (Ota Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r tcCeoarpstya.lfoogr aclolRnkt,ianLind.ssPoOmfLuAKch.ut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeHowr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 593 Lord Loten E (Maggie) slsmn rllO West End av (HH) Lord Marguerite sten Sami S Chandler & Co r803 Pine Lord Pauline (wid Horace) h803 Pine Lorraine Shop The (J D McMurray) mlnr 411-13 Cherry Losey Hazel dom rl09 Bonaire Losey John D (Mattie) lab hl09 Bonaire Lott Alice tchr r808 Walnut Lott Florida (wid Wm B) rl23 Violet av Lott Grace tchr r816 Walnut Lott Jas T h816 Walnut Lott John T (Daisy) tailor 808 Walnut h do Lott Leonard lab Armour & Co r316 Belmont av Louder Wm (Rosa) porter hl08 Gustin av (V) Lougee Bessie r Jas Anderson Louisville & Nashville R R Co A L Burnet coml agt 501 Bibb bldg Louther Walter (Lillie) lab r636 4th av (U) Lovall C musician Rialto Theatre rl22 New Love Laura h371 Monroe Love Leila cook h rear 1232 3d Love Lizzie (wid John) hl69 Elizabeth Love Ozell cook rl604 1st Love Pauline smstrs h229 Grant Chapel al Love Robt L (Maude) mach hl5T2 Forsyth rd (V) Lovein Chas M (Nannie) asst formn h520 Ash Lovein Lucile r520 Ash Lovein Norman M (Eunice) h813 Orange Lovelace Edw (Annie) brkmn hl06 New Lovelace John W (Daisy T) dentist 605x/2 Cherry r3 Fredonia apts Lovelace John W jr slsmn S M Solomon jr r Ellison- ian apts Lovelace Thos B (Carrie V) lmbr mfr hl44 Hines ter (V) Lovelace Wm millwkr r Olin Holly Lovelace Wm L formn h228 Knott Lovelace Willie A tel opr h226 Edna pi Lovell Carrie H (Helen) musician h.903 Clinton Loverin N M h613 Orange Lovett Arth (Elouese) lab r768 Ocmulgee Lovett Lena maid h455 4th av (V) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. 17. POLK & CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 594 (1925) R. L. POLK & CO.'S as a Lowe Ada lndrs h217 Elm Lowe Alice lndr r438 Hammond MMET Lowe Allie (wid Ellis H) hl31 Piedmont av Lowe Alma mill opr rl09 (1) Flanders Lowe Alton R hlpr rl31 Piedmont av PUL Lowe Annie maid h215 Bright al Lowe B Columbus (Savannah) lab hl43 Sycamore THE Lowe Cornelius (Anna) lab h612 Hammond Lowe Edna cook r71'8 Hazel DIRECTORY Lowe Ellis H soda dispr rl31 Piedmont av Lowe Essie D r215 W Boundary IS THE Lowe Ethel elk F A Guttenberger r456 Cherry av Lowe Fannie hlpr J D Corr r Hilliard al GREATEST LOWE FRANCES C, County Agt Home Demonstration Bureau, r456 Cherry av MARKET Lowe Francis J elk hl57 Hines ter PLAGE Lowe Geo (Leila) lab rl018 Ocmulgee Lowe Geo (Narcissus) lab hlOO Plummer's al IN THE Lowe Green (Cora L) trucker h40 (10) Woodliff Lowe Hattie lndrs r667 Hall WORLD * Lowe Henry E (May; pres-gen mgr H E Lowe Electric Co) h463 (511) Vineville av Lowe Henry E jr elk H E Lowe Electric Co r463 (511) Every Day in the Year the Directory Vineville av Lowe H E Electric Co H E Lowe pres-gen mgr 131 Cotton av Tells Where Lowe Jas (Mary) cook hll'57 Oglethorpe All Kinds Lowe Jas grocer 1037 Clinton rd r do of Goods Lowe Jerry G (Ottie B) elk Kingman & Everett h456 and Service Cherry av Can Be Had Lowe John (Dolly: ) lab h750 Stein's al Lowe John (Mary) plstr h315 E 2d (EM) The Directory is the Natural Source of Information and is "On the Job'' 365 Days Every Year Lowe John A jr elk r254 Jeff Davis Lowe John A (Essie) tel opr h254 Jeff Davis Lowe John H (Lula; Clinton Road Cash Grocery) hllOl Clinton rd Lowe Lize (Florence) wrecker h62 New Lowe Lucile lndrs r723 (122) Cowan Lowe Martha r506 E 2d (EM) Lowe Martha r463 (511) Vineville av Lowe Mattie lndrs h723 (122) Cowan Lowe Mattie lndrs h221 7th Lowe Nimrod (Minetta) grocer Industrial Home rd PUBLISHERS h Bellevue Ga PoUtDirecbiuHl) ^DETGOIT f MICH- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OTTR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 595 Lowe Otelia tchr r458 Mitchell Lowe Peter (Love) lab r615 Division Lowe Randall grocer 497 Mitchell r do Lowe Raymond lab h616 Gilmer Lowe Rena maid hl33 McKay's al Lowe Richd lab rl71 Hazel Lowe Ruey elk r254 Jeff Davis Lowe Sami (Mabel) lab h667 Hall Lowe Seaborn (Marmy) lab hl7 Turpin la Lowe Stanley (Pearl) lab h229 Wright's al Lowe Thelma student rl31 Piedmont av Lowe Wm (Mattie) h249 Morgan av (WH) Lowe Wm (Alma) chauf h611 Port Hill Lowe Wm elk Clinton Road Cash Grocery rllOl Clin- ton rd , Lowe Wm (Laura) lab h229 Roosevelt (V) Lowe Wm (Annie) mill opr hl09 (1) Flanders Lowe Wm P lino opr rl07 Masonic Home rd Lowe Wyman C elk Fourth Natl Bank r Sherwood Hall (Mercer Univ) Lowery Genie (wid J O) rl525 Broadway Lowery H Cleo slsmn T C Burke Inc r Southland Hotel " Lowery Wallace (Fannie) cook J D Carr r Maynard (EM) Lowhorl Lucile nurse Middle Ga Sanatorium r do Lowrey Jas A jr lawyer Jones Park & Johnston r323 Georgia av Lowrance Jas L (Minnie; Dixie Roll & Cotton Co) h667 Courtland av Lowry Genie Mrs slsldy Lus Dept Store rl525 Broad- way LOWRY THOMAS S JR, Mgr Union Central Life In- surance Co, 901-2 Georgia Casualty Bldg, Phone 258 Lowther Virginia r512 Walnut Loyall Jennie tchr Wesleyan College rl79 North av (NH) Loyall Thos D (Eliz) elk hl79 North av (NH) Loyd Albert A (May) blrmkr h862 Cherry Loyd Calvin B lab r456 Womack Loyd Geo carp h207 Main (EM) Loyd Mary lndrs r456 Womack Loyd Mattie lndrs h456 Womack Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. Ij. POLK & CO., DETROIT, MICH. OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 (1925) R. L. POLK & CO.'S Loyd Thos (Sallie) mtrmn hllO Calhoun Loyd. Thos E (Ethel) elk hlOl 1st Loynd Agnes sten rl07 Stonewall pi (V) Loynd Gertrude rl07 Stonewall pi (V) Loynd Herbert (Alice) elk hl07 Stonewall pi (V) Loynd Lillian B sten Smith & Smith rl07 Stonewall Pi (V) Lucan Rosa Indrs r359 Bay Lucas Annye L Mrs sten Empire Products Co h502 Walnut Lucas Celia S sten Fourth Natl Bank r88 Arlington Pi Lucas Chas (Nettie) chauf h323 Gilmer Lucas Chas J (Susie) agt Atlanta Life Insurance Co h321 Middle (V) Lucas Chas P (Wilhelmina) real est h652 New Lucas Cornelia Indrs rl218 3d Lucas David A formn Cotton States Fertilizer Co r Frances Hotel Lucas Ella cook rl05 Vineville av Lucas Henry W (Emma) carrier P O hl'15 Neal av Lucas Jas (Minnie) lab r3 Chestnut la LUCAS JAMES H (Linda), Asst Cashr Citizens & Southern Bank, r628 Orange, Phone 552 Lucas Lee brkmn h Industrial Home rd Lucas Lee (Lurena) lab h416 Hammond Lucas Lee lab hl20 Hazel Lucas Lucile supt The Clinic Hosp r567 Walnut Lucas Lueinda dom h9!/2 Cherokee av (SH) Lucas Luvenda Indrs rl07 (9) Braswell la Lucas Mary cook rl07 (9) Braswell la Lucas Moses lab h452 Dunlap al Lucas Robt E (Annie A) supt Cotton States Fertilizer Co h502 Walnut Lucas Wm (Vacele) carp h Robinson rd nr Bond Lucas Willie gdnr r316 Corbin av Luckie Eug presser Tink Jackson r224 Jordan's al Lucus Abr (Lila) carp r302 Craft la Lucus Chas grocer 353 Campbell h do Lucus Chas (Ella) lab h732 Nussbaum Ludlow Ralph P (Selsie) formn City St Sweeping Dept r231 Grant Chapel al Ludwig Rene r817 Walnut FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSIO( N DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS f Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lilsts. Our new Catalog contains much valuable data. Ask for a copy H. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 597 Lugand Albert C slsmn Macon Gro Co r Milledgeville Ga Luke Minnie Indrs h625 Gilmer Lumdy Wm (Lulu) pdlr h Simmons av Lumpkin Daisy (wid Geo) rl53 Pine av (V) Lumpkin Emalyn student rl016 Ash Lumpkin Geo (Hazel) cotton buyer hl23 Buford pi (V) Lumpkin Geo B (Mattie) blksmith h516 Elm Lumpkin Jack elk Hotel Lanier r do Lumpkin Jas A (Louise) eng h280 Hillyer av Lumpkin Lila V sten W S Dickey Clay Mfg Co rl53 Pierce (V) Lumpkin Reuben D (Willie) mill hd h33 (22) Ran- dolph pi Lumpkin Thos A supvr grand chf G U O M of E hl58 Middle (V) * Lundy Andrew (Osa) driver r341 3d av YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES p H o oHPzi 02Q oW i3f- Zo>< 2 o z c 2pzi > z D iri>0nn3 Lundy Bright W(Iva) ship elk h348 Pierce av (V) Lundy Evelyn student r230 (234) Fargason Lundy Hospital (J W Lundy) 602 3d av (V) Lundy Iva Mrs drsmkr Dannenberg Co r348 Pierce av Lundy John (Ida) lab h rear 123 Washington (EM) Lundy John W (Lundy Hospital) phys 602 3d av (V) h do Lundy John W(Amanda) lab h212 Roosevelt (V) Lundy Joshua (Claudy) lab hl006 Main Lundy Julia nurse r578 Monroe Lundy Laura dom h5 Turpin Lundy Mary Indrs r600 Pringle Lundy Mary Indrs r rear 123 Washington (EM) Lundy Mary L Mrs r451 Spring Lundy Myles L (Queen) glazier h230 (234) Farga- son Lundy Myles L jr (Eva) plstr rl73 (223) Green Lundy Naomi Indrs r rear 123 Washington (EM) A natural by-product of the Directory Business is the compilation of Mailing lists. If interested, ask for our Free "list of Mailing Lists." R. L. POLK & CO., Detroit in tOu r > r >po pSiHni 2 H r > CtL "4 s 0) O Z MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 598 (1925) R. L. POLK & CO.'S Lundy Robt (Oveda) lab h307 (205) Charles (SM) Lundy Violet E boxmkr rl23 Yates av Lunsford Marie maid r362 Pine Lunsford Mortie (Ella M) porter r243 (236) 3d Lunsford Moses lab h243 (236) 3d av (V) Lunsford Permon (Mattie) bell hop h216 Nussbaum Luster Jos lab r511 (401) Crisp Luther Williams Bank Building 617 Cherry Lutheran Church of the Redeemer Rev L W Strickler pastor 723 Holt av (NH) Lutsky Benj elk Dempsey Haberdashery r820 2d Lutsky Bessie sten Macon News r820 2d Lutsky Isadore I student r820 2d Lutsky Myer (Annie) tailor h820 2d Lutsky Sol H mgr Dempsey Haberdashery r820 2d av Lutz Ernest M (Bessie) slsmn Macon Chero Cola Bottling Co h312 Cherry av Lyle Andrew r555 2d Lyle Benj F (Julia) rllO 3d Lyle H Grady (Jessie) elk C of Ga rl'27 High Lyles see also Liles Lyles Alice r203 Hydrola Lyles Benj H (Julia; Turner & Lyles) rllO 3d Lyles Coral mill hd h35 Taylor av Lyles Duke (Susie) lab hll49 (349) Woolfolk Lyles Jack mill hd r23 Bibb av Lyles Jas F (Alma) carp h820 Woolfolk Lyles Jas G (Mattie) linemn hl529 3d Lyles Nathaniel (Attie) carp h293 Hydrola Lyles Nora (wid Wm) h.23 Bibb av Lyles Otho L (Talmus) flagmn hl31 Fort Hill Lyles Robt E (Maud) mech r276 Willingham Lyles Robt W (Frances) carp h705 Adams Lyles R'ube r203 Hydrola Lyles Wm mill hd r23 Bibb av Lyles Wm J oiler r413 Jackson Lyles Wm N (Ella M) carp hl241 College Lynch see also Linch Lynch Annie Mrs hll8 Piedmont av Lynch Bernice tchr rll8 Piedmont av Lynch I Roger (Ina) supt h212 (62) Holt av Lynch Lois tchr r!18 Piedmont av Lynch Lucile tchr r!18 Piedmont av A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 599 Lynch Walter H (Mellie) truck driver h321 Dannen- berg Lynch Wilber L (Letitia) swtchmn hl05 Kemper av Lynch Willie T rll8 Piedmont av Lyndon Andrew J (Annie M) mgr H M Smith & Co h322 Georgia av Lynes I mach r815 2d Lynn Ella G Mrs slsldy Burden Smith & Co Lynn Foy D (Dessie) mech h3 Union av Lynn Jacob (Lucy) ice cream mkr h322 Dannenberg av Lynn Mary h322 Dannenberg av Lynwood Cemetery (colored) n end Lynwood av (V) Lyon Alvin L (Bedell) r318 Linden av Lyon Carrie G (wid L L) sten r Log Cabin dr Lyon Harris & Brooks (W J Lyon, H E Harris, R F Brooks) printers 21 Wall Lyon Ruth Mrs elk Sou Bell Tel Co r Log Cabin dr Lyon Wm J (Ruth; Lyon Harris & Brooks) h220 Log Cabin dr Lyons Clarence S (Mary) carp h205 Mikado Lyons Jas M (Rosa) electn hlOO Piedmont av Lyons Jos J (Ruth) meter rdr rlOO Piedmont av Lyons Wm A (Sara) rlOO Piedmont av Lysle Amanda Mrs cook r528 Telfair Lyster John T (Ida) mech hill Cabaniss av Lyster Wm W (Annie) carp hi' Dannenberg av McAbee Annie millwkr rl Lake McAbee Augustus N (Isabelle) hi Lake McAbee Noyes W millwkr rl Lake McAdams Ernest (Anne) h350 Pierce av McAfee Amelia r J C McAfee McAfee Augustus r J C McAfee McAFEE JOHN C (Eula), V-Pres Ga Casualty Co and Physician 310 Ga Casualty Bldg, Phone 5217, h Forsyth rd nw cor Albemarle pi, Phone 682 McAfee Linton C phys 319-20 Ga Casualty bldg r577 Orange McAfee Louise sten rl75 Hendley (NH) McAfee Oscar H (Frances) mgr Atlantic & Pacific Tea Co hll9 Corbin av * McAfee Robt K (Maude) bkpr hl75 Hendley McAlister Andrew T student r312 Adams "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prosjiects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK &. CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 600 (1925) R. L. POLK & CO.'S McAlister Chas A (Fannie) v-pres Taylor Iron Works & Supply Co h312 Adams McAllison John (Kate) lab r rear 321 Hammond McAllister Daisy lndrs r712 Plummer's al McAllister Willie D maid r318 Bright's al McArthur Earl F (Mae) ship elk r871' Walnut McArthur Eric P cond hl6, 811 Poplar McArthur Purcell A (Lucille) phys dir Y M C A h302 Katherine Ct apts McArthur Sylvester porter r755 Elm McAuliffe Frank B (Agnes) inspr U S Insecticide Bu- reau rl4 Nevaro apts McAvoy Margt prin r926 College McBane Geo A uphol rl22 Daly McBrearty Chas (Ruth E) prop Dempsey Barber Shop hl20 Washington av McBrearty John (Margt) h849 Pine McBride Alonzo (Mary) lab h803 Elbert McBride Bemon G (Ethel N) elk Georgia Grocery r 1238 College McBride Eliz Mrs supvr W U Tel Co r202 1st McBride Frances E student r202 1st McBride Frank (Eleanor) hlksmith 528 Cotton av hl34 Grants McBride Geo hl20 Lynwood av McBride Geo (Celia) woodwkr C W Stroberg h229 Jefferson McBride Gilsie maid hl53 College McBride Howard G (Ada) contr h315 Forest av McBride Jas (Silvy) lab h222 Division McBride John E (Eliz C) credit mgr Dannenberg Co r202 1st McBride L Fannie (wid John M) h202 1st McBride Mary r2T25 Broadway McBride Sidney (Laura) carp r227 Norris McBryant Lear opr Sou Bell Tel Co r504 Oak McCabe Madeline M (wid Michl A) hl05 Masonic Home rd McCaff Robt (Rosa) carp h520 Maynard McCahill Tinus (McCahill & Abraham) r2233 2d McCahill & Abraham (Tinus McCahill, Welham Abra- ham) gros 2243 2d McCaleb Dee (Myrtice) emp Cent Ga Ry h201 Log Cabin dr R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 601 McCall Clarence L (Sallie) carp hl04 Cabaniss av McCall Cottage 1353 (353) Edgewood av McCall John (Carrie) hlpr hl018 Oglethorpe McCall Leo H elk Frances Hotel rl42 Beverly pi McCall Lucy (wid Hawkins A) rll7 Buckingham pi McCalql Nina M nurse Macon Hosp McCall Robt (Pennie) carp h419 Short (EM) McCall Wm (Mary) barber A J Brown h Taylor (EM) McCall Wm (Bertha) barber h804 (404) Williams McCallister Terrel T (Eunice) elk Dunlap Hdw Co h221 Duncan av McCallum Chas H pipeftr r C L McCallum McCallum Chas L (Mattie) blksmith Forsyth rd h Forest Hill av McCallum Clinton driver rl707 2d McCallum Homer C (Ida) blksmith rl005 Walnut McCallum Leola D (wid Robt A) h9 Hill Park av McCallum Thos R (Eula) h Ayers rd McCallum Vernon LrC F McCallum ED lire Trucks and Auto Repairing 1i l1&4 XiltlM A65u7th-6o5ri9zedTHfIoRrD WShTi.te MPHotOorNETr4u8c4k6s McCamy Jos R (Eva) bge mstr hl30 Virginia av McCann John W (Marie) auto trmr A S Hatcher Co h 2136 2d McCann Xillo Y (Maude) v-pres Williams Mfg Co res Doctortown Ga McCants Emma r753 Pine McCants Jas A (Edith) carp h753 Pine McCants Ruth grill cashr Dempsey Plotel r753 Pine McCard Floyd D (Willie) collr Georgia Investment Co h267 Orange McCardel Jas B (Nina) carp h465 Woolfolk McCardel Jas P (Julia) wood pdlr h542 Jackson McCardle Jas slsmn r226 North av (NH) McCartha Delia r568 Monroe McCarthy Bertie cook r62 Schofield McCarthy Chas (Ella) farmer hlll3 (222) Wool- folk FOR LISTS OF NAMES * ANY TRADE -- ANY BUSINESS -- ANY PROFESSION Jietrqit R. L. POLK & CO. Chicago Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BiBB REALTY BLDG. TELEPHONE 213 602 (1925) R. L. POLK & CO.'S McCarthy Clarence J (Clifford) carrier P 0 h263 3d av (V) McCarthy Gordon (Sallie) lab h548 Hazel McCarthy Henry lab hl021 Woolfolk McCarthy John F (Florence) trainmn Macon Rv & Light Co h521 New McCarthy Marie cook hl50 Orchard av McCarthy Mattie dom r rear 331 (393) Hill Crest av McCarthy Polly Indrs r511 (411) Hall McCarthy Reddick (Mary) pdlr h62 Schofield McCarthy Robt (Mattie) farmer hllOO Broad McCarthy Walter L lab r62 Schofield McCarthy Wm D lab rlll3 (222) Woolfolk McCarty Mattie h568 Monroe McCarty Maud Indrs hl68 Glen McCarty Robt B asst tchr Mercer University r31 S College McCaw Eliz student r274 Georgia av McCaw Jas N (Dellie R) h274 Georgia av "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfSsDHiflerAiEmegyIAho,LytLuYoarTup.nHrrgdouYdFvmeooe. nlcrsaTtasisathstiaritioclesen.A,niNasoTtIDtafHyaEUotdhhuYaSeernEyagDAletPbrRrhYulyEegOsegigdRpiUnisAntaNok'Llns-., McCaw Mary D r274 Georgia av McCaw Sami (Lula) lab hl35 Malloy's al McCay Rufus E (Rosa) millwkr rl04 Green McClain Jos A tchr Mercer University McClain Lou J dom rl28 Kahn's al McClain Otis (Lorena) sec hd h Railroad McClanahan Beatrice r F J McClanahan McClanahan Frank J (Lottie) carp h Bailey av McClanahan Geo A (Leona) carp h Burton av (CH) McClanahan Jas lab r G A McClanahan McClary Remus hlpr Loh's Cafe McClelland Wm T cashr r514 Pine McClellan see also McLellan McClellan Chester A (Belle) elk h557 New McClellan Wm A (Frazier) lawyer No 8 Washington bldg h227 North av (NH) McClellan Wm A jr prop Highland Oil Co r227 North av (NH) R. L POLK & Company FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGL AN D T"p THE CHIROPRACTOR Will Remove the CAUSE of Your Distease 613-618 BIBB REALTY BLDG. PHONE 45S7 MACON CITY DIRECTORY (1925) 603 McClellan Wm H (Mary) flagmn rl702 3d McClelland A P (Hattie) woodwkr h321 Ross McClelland Carlton L elk r321 Ross McClelland Clovis H (Beatrice) flagmn hl515 2d McClelland Hushell baker Am Bakeries Co r321 Ross McClendon see also McLendon McClendon Benj B (Minnie) blksmith h217 Telfair McClendon Dorothy student rl27 Nottingham dr McClendon Irma student r John M McClendon McClendon John M (Miriam) elec eng h Mellrose McClendon Josie rl27 Nottingham dr McClendon Ozell (Mattie) ice mkr r319 Dannenberg McClendon Pearl asst W R and W B Holmes r217 Telfair McClendon Rachael lab r268 Division st la McClendon Victor (Emma) r404 Crisp McClendon Walter (Pearl) blksmith hlpr r217 Tel- fair MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS McClenney W J mgr Hatcher Hdw Co r Y M C A McClinton Lula cook r201 Orchard av McClinton Wm P (Izola) lab r222 Division McCloud see also McLeod McCloud Bryant (Lizzie) firemn r358 Bay McCloud Lewis carp rl03 Douglas McCloud Preston (Nannie) plstr hl03 Douglas av McCloud Susie tchr rl03 Douglas av McCloud Wash (Blanche) truck opr hl8 Wise av McClung Plennie J (Florence) trainmn Macon Ry & Light Co hlOO Rebecca McClure Albert H (Lena) gro 819 Broadway r560 Arch McClure Andrew W (Julia D) pres-treas McClure Office Equipment Co hllO Cleveland av McCLURE OFFICE EQUIPMENT CO, A W McClure Pres-Treas, C W Baldwin V-Pres, R F Briggs Sec, Agts Globe-Wernicke Co, Genl Fire Proofing 560 Mulberry, Phone 903 Telephone 2687 J. T. MOLTON, Mgr., 348 Oak o CD > S3 * Pi 73 c+ O n z pi n r O H X p Pi S3 0. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK 604 (1925) R. L. POLK & CO.'S McCluskey Rebecca (wid J D) r203 Duncan av McCluster Frankie (wid Chas) r705 Elbert McCluster Sbote (Maggie) lab h224 Carter's al McCollough Edw L (Eula) car repr hll8 Tenney McCollum Laura rl224 Napier av McCollum Mittie (wid Chas) hl224 Napier av McCollum Wm J (Etta) carp rll3 Willingham McComb Virginia supreme chf rec G U O W M of E hi 55 Middle McComer Queen r227 Jefferson McComick Frances lndrs h65 New McComick Homer chauf r65 New McCommon Bros (Geo W and Robt L) dry gds 502 Poplar McCommon Clarence (Alma) h463 Spring McCommon Geo W (Rebecca; McCommon Bros) h 116 (196) Buckingham pi McCommon Lavonia sten r427 Montpelier av McCommon Robt L (Lessie; McCommon Bros) r706 2d McCommon Sallie R (wid Clayton) h427 Montpelier av McCommon Thos J (Mary J) county jailor h350 Mulberry McConnell Benj T (Willie) gro 607 Main h do McConnell Harriett slsldy Burden Smith & Co h500 Burton av McCONNELL LINCOLN JR, (Laura), Mgr Chamber of Commerce, h494 Hillyer av McConnell Odessa S (wid Harold H) slsldy Simon Moore r605 Carling av McConnell Reynolds (Harriett) poultrymn h500 Burton av McConnell Terrell (May) grocer r308 Jones av McConnell Thos (Visa) carp h605 Main (EM) McCook Clyde F gro h207 3d av (WH) McCook Danl O (Kath) elk h403 Forest av (V) McCoy Danl W (Sarah) police hlll6 Oglethorpe McCook Elsie dom rl Rock Hill la McCook Emma lndrs h419 Applewood McCook Geo N (Watts & Co) h806 Spring McCook Ida Mrs slsldy Federal Clo Store r231 Wash- ington av &C0. Polk Directory Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 ELLIS MOTOR COMPANY LUTHER WILUAMS BANKING & TRUST CO. 'FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% Savings MACON CITY DIRECTORY (1925) McCOOK JAMES W (Essie; J W McCook Lumber Co), hl09 Buford pi, Phone 1609 McCOOK J W LUMBER 0 (J W McCook), Lumber and Building Material Hawthorne bet Broadway and 5th, Phones 4177-4178 (See page 74) McCook Kath R Mrs tchr r403 Forest av (V) McCook Leon B mech Cliff Walker res Lizella Ga McCook Lulu Mrs hll9 5th av (SM) McCook Newsome r230 Tatnall av McCook 0 B mech rl'011 Elbert McCook Sarah tchr r230 Tatnall av McCook Sue tchr r230 Tatnall av McCook Virginia (wid Vera) r231 Washington av McCook Willie lndrs h533 Gilmer McCord Cagar R mech G H Parrish r Crump pk McCord Chas R (Hattie) broker 722 Citizens & Sou Bank bldg h220 Pierce av McCord Chas R jr r220 Hines ter (V) McCord Harriet B student r220 Hines ter (V) SOUTH'S LEADING FLORISTS e IDLE HOUR NURSERIES McCord Jas A (Fannie) tinner hl2 Randolph pi McCord Jos C (Carrie) barber A L Glasco rl57 Eliza- beth , McCord Micaja R (Willie M) auto mech hl07 Crump s Pk av (CP) McCord Rudisill student rl07 Crump's Pk av McCord Susie mach opr h3 3d st la McCord Wesley lab r210 Tindall av McCord Wm E (Zula B) cond hl20 Park pi McCord Wm F collr Cit & Sou Bank r220 Hines ter f! McCormack John E (Jonnie L) formn h416 Forest av (V) McCormack Julius printer r2525 Broadway McCormack Minnie r2 (11) Myrtle (EM) McCormick Eliz lndrs h6 Magnolia la McCormick Frank r341 Madison McCormick John T (Alice) cotton sampler h713 (711) 3d av (V) Lincoln Fordsoxv v Jfor lists of names ANY TRADE( ANY BUSINESS'ANY PROFESSION DETROIT^ R. L. POLK & CO. CHICAGO FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 606 (1925) R. L. POLK & CO.'S McCormick Mary nurse h341 Madison McCormick Sarah r341' Madison McCormick T J (Lillie) carp h225 Orange McCory Donald (Rosa) lab h626 Monroe McCowan Adolphus (Pauline) lab h222 Fargason McCowan Aurelia cook h324 3d av (V) McCowan Edith rl, 811 Poplar McCowan Mamie lndrs r222 Fargason McCowell John H h621 Pine McCowell Lizzie r621 Pine McCowen Clarence D (Lena M) dept mgr Jos N Neel Co h359 Orange McCowen Geo S (Doris) trav slsmn Adams Bros Co r708 Courtland av McCowen Jas C (Ada) metermn Macon Water Works hll5 Calhoun McCowen Joyce r708 Courtland av McCowen Kathleen student r724 Napier av McCowan Mamie lndrs r222 Fargason McCowen Richd B (Margt; McCowen & McCowen) hll36 Milledgeville rd McCowen Richd F (Janie A; McCowen & McCowen) hll36 Milledgeville rd McCowen Roy N (Alta) cond hl02 St James av McCowen Wm r708 Courtland av McCOWEN & McCOWEN (Richard F and Richard B McCowen), General Collection Agency, Claims Taken on Commission for Collection and Handled Through All Courts, We Offer the Public the Services of 25 Years' Experience 01 Grand Bldg, Office Phone 1657, Residence Phone 5392-J McCoy Alice rl6Y Hazel McCoy Beulah r620 Spring McCoy Danl W (Dove E) lawyer 513 Bibb bldg h do McCoy D W police hlll6 Oglethorpe McCoy Florence (wid Dalth) r620 Spring McCoy Greene S (Viola) textile opr h775 Hawthorne McCoy Gus (Rena) firemn hl63 Phillips McCoy Julia h715 2d McCoy Julius bellmn r620 Spring McCoy Mollie r504 Telfair McCoy Nannie cook r424 Ward (V) McCoy Sol (Leola) lab h407 Mitchell McCoy Walter R (Bessie) blrmkr h865 3d Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 607 McCoy Willo T dom r407 Mitchell McCoy Winnie Mrs hl028 2d McCrackery Lula cook r565 Henrietta McCranie Blanche elk r220 Chappell McCranie Rosalie (wid Wm H) h210 1st McCranie Ulmer msngr r210 1st McCrary see also McCreary McCrary Albert (Emily) lab hl38 Cowan McCrary Alex (Nora) lab h310 Railroad av McCrary A J r804 Elm McCrary Carlton L (Leta J) elk Brown Grocery h ss Forsyth rd (V) McCrary Chas H fnshr Sou Duco Enameling Co r750 Walnut McCrary David (Odessa) cook Macon Cafeteria hl009 Oglethorpe av McCRARY DE WITT (Dora L), Pres DeWitt McCrary Drug Co, h304 Hydrola, Phone 1324 McCRARY DE WITT DRUG CO, DeWitt McCrary Pres, B J Balkcom Mgr, Drugs, Candies, Ice Cream, Soft Drinks, Cigars and 'Tobacco 336 Main, Phone 196 (See page 64) McCrary Ella lndrs h268 Division st la McCrary Florence sten rl38 Cowan McCrary Honey cook r rear 131 High McCrary Isaac N (Mamie) contr h456 Waln'ut McCrary Jas (Mary) lab h402 Gilmer McCrary John (Hattie) lab h501 Campbell av McCrary Josephine (wid Calvin) r302 Tindall av McCrary Julia cook r309 Blount McCrary Lena M sten Monroe Calculating Mach Co r 456 Walnut McCrary Lillian carp r440 Liberty McCrary Mamie cook 633 (945) Vineville av McCrary Mary (wid Otis) h301 Tindall av McCrary Milas (Mary) carp h228 Norris POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. MACON OPTICAL COMPANY Frank H. Johnson .-s ^ . ... Opticians X " Optometrists -468 CHERRY PHONE 3213 in Bottles TELEPHONE 287 n. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 608 (1925) R. L. POLK & CO.'S McCrary Nolen (Winifred R) slsmn Coleman- Meadows-Pate Drug Co h348 Hines ter McCrary Raleigh r804 Elm McCrary Robt h262 Forsyth la McCrary Robt E elk Cudahy Packing Co r456 Walnut McCrary Ruby L r rear 633 (945) Vineville av McCrary Susie dom r402 Gilmer McCraw Manuel (Katie) mstr mech hll08 Main McCray Marguerite lndrs r230 Park Hotel al McCray Willie M lndrs r516 Cowan McCrea Wm K (Clyde) merchant hllO 2d McCreary see also McCrary McCreary Adolphus (Essie) h321 % 3d av (V) McCreary Chas (Roberta) lab hl24 Edison (EM) McCreary Duane W (Mary) elk r458 Spring McCreary Henry (Fannie) janitor hll7 Lynwood av McCreary Jas L (Annie) elk T M Donnelly Co h753 Oak McCreary Joe (Eliz) lab r534 Middle (EM) McCreary John J (Teresa) lawyer 353% 3d h753 Oak McCreary Julia A elk City Realty Co r258 Columbus McCreary Lizzie lndrs rl'13 Linden av McCreary Lucile maid r rear 945 Vineville av McCreary Wm T pres-genl mgr T M Donnelly Co h 258 Columbus McCreary Wm T slsmn r753 Oak McCrewel Edw (Emma) lab hl59 Nussbaum McCrewel Irene rl59 Nussbaum McCrey Florence H bkpr Middle Ga Sav & Inv Co r 138 Cowen McCroy Effie sten r410 Belmont av McCuen see also McEwen McCuen Roy L (Mary A) formn hll5 Bibb av McCullins Fred lab r405 Madison McCullough Burel C mech r327 Hanson McCullough Eugenia lndrs r515 Fulton al McCullough Frances student r204 Pierce av (V) McCullough Frank C (Lois) slsmn h204 Pierce av (V) McCullough Geo r327 Hanson McCullough Howard (Lushion) lab r216 Maynard McCullough J Sami (Mamie) auto repr 507 Mulberry rill Garden McCullough Louise student r327 Hanson Automobile owners are select prosjiects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 609 McCullough. Lucy (wid Chas) h327 Hanson McCullough Mathilda Indrs hl55 Lee McCullough Mina Indrs rl032 Clinton rd McCullough Ruth r327 Hanson McCullough Sally dom rl032 Clinton rd McCullough Vina Indrs rl'032 Clinton rd McCullough Wm (Alberta) lab h609 Flanders McDaniel Clifford (Elnora) waiter J D Corr h954 Hazel McDaniel Cottage rl33 College McDaniel Elzie opr The Wm Carter Co r310 Grand av (B) McDaniel Frank slsmn rl02 Colqhitt McDAMEL HARDWARE CO (Julius A McDaniel), 518 3d, Phone 4423 McDaniel H Van (McDaniel & Smith) h237 Winship McDaniel Jas (Alice) lab h301 Magnolia McDaniel Julius A (Ophelia; McDaniel Elardware Co) h205 College pi McDaniel J Bruce (Jewel) watchmkr S L Orr Co r J A Wadsworth McDaniel Mack L (Estelle) carp h213 Applewood McDaniel Martha rl07 Virginia av McDaniel M A office mgr Cable Piano Co res R F D 3 McDaniel Susie 310 Grand av (B) McDaniel Thos B wtchmn Sou Ry r98 Bay McDaniel Warren F (Mattie) carp h310 Grand av (B) McDaniel W Arth (Corine) carp r Lillie Pendley McDaniel & Smith (H V McDaniel & L Smith) gro and meats 237 Winship McDie Louise r432 Coles al McDonald see also MacDonell McDonald Allen M (Laura T) dept mgr Macon Tele- graph hl210 Ridge av McDonald Allice rll61 Napier av McDonald Anna cook r rear 226 High McDonald Clara nurse Macon Hosp McDonald Emory tailor r226 High McDonald Eunice Indrs h555 Moore av McDonald E Edd (Mamie) formn h852 Elm McDonald Florence rll'61 Napier av McDonald Florence spooler r!5 Bibb av McDonald General (Eliza) janitor h257 4th av for lists of names ANY TRADE ANY BUSINESS -- ANY PROFESSION Detroit R. L. POLK & CO. Chicago Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 as a Ml PUCE THE DIRECTORY IS THE GREATEST MARKET PLACE i THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MJkiGi PUBLISHERS PolkDirecbra] DETROIT MICH- 610 (1925) R. L. POLK & CO.'S McDonald Golden (Luetishia) bottler Castarphen Whse Co r443 Alabama McDonald Ida (wid Mack) r505 Pio Nono av McDonald Jas E (Martha) slsmn hl29 Cleveland av McDonald John P (Minnie) h310 Plant McDonald John W (Dora) swtchmn h314 Plant McDonald Julia lndrs h205 Hazel McDonald Lillian r310 Plant McDonald Mason D car inspr r440 Edgewood av McDonald Mattie P Mrs elk r417 Boulevard (NH) McDonald Perry (Lizzie) lab rl05 Bay McDonald Perry (Lizzie) lab h310 Gilmer McDonald Sami H (Eunice) linemn City Elec Dept I 1161 Napier av McDonald Wm H (Ruth) inspr hl907 3d McDonald Wm T (Girlie) formn h440 Edgewood av McDonald W Oscar slsmn h606 Forsyth McDonell W Sutton (Mishie) car inspr hl35 Dixie av McDonnell Raymond elk rl921' 3d McDonnell Teresa (wid John) hl921 3d McDowell Brady (Mary) lab hll4 Roff Home av (V) McDowell Brady (Louise) lab hl22 Ross McDowell Hugh (Jennie) lab hllO Roff Home av (V) McDower C Jas (Addie) hll9 Belle av McDuffie Amanda (wid Wm) rl07 Virginia av McDuffie Margt elk County Tax Collr r593 Carling av McDuffie Wilbur E (Villa) cond h301 Hendley (NH) McEachern Sami P (Nellie) ins agt h504 Walnut McElhaney Robt L (Kate) linemn h61 Pio Nono av McElhenney John W (Nellie) porter O R Sowell h202 Center McElmurray Abbie rl21 Washington av McElmurray Herman (Jeff) city firemn h51'8 John- son av McElmurray Pickens A (Edna) guard 121 Washington av McElrath Emma r650 Pio Nono av McElrath Hugh student r650 Pio Nono av McElrath Hugh M (Florence) gen mgr Jeffreys-Mc Elrath Mfg Co h650 Pio Nono av McElrath John lmbrmn r650 Pio Nono av McElrath Jos student r650 Pio Nono av McElrath Margt student r650 Pio Nono av McElrath Robt r650 Pio Nono av A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 & CHERRY ST. _ TELEPHONE 2391 MACON CITY DIRECTORY (1925) 611 McElreath J Howard (Annie) ins hl08 Hartley av (CP) McElrod Jos R loans 612% Poplar h262 9th av (CH) McElvoy Caroline rl017 Edgewood av McElroy Carrie M rl017 Edgewood av McElroy Chas B (Jennie L) asst postmstr P 0 h201 Buford pi McElroy Eliz student rl5 Progress McElroy Emma rl017 Edgewood av McElroy Frank (Marie) flagmn hl08 Pringle McElroy Jessie lndrs rllO Pringle McElroy John r555 2d McElroy Millie h.1'017 Edgewood av McElroy Sarah student rl5 Progress McElroy Wm J (Emma) trav slsmn hl5 Progress McEvoy Margt J prin Lanier High Sch r412 Vineville av McEvoy Robt P (Mary S) sec-treas Macon Cafeteria h412 Vineville av Royal Corona Typewriters SCOTT-PARKER CO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service McEvoy Wm (Annie E) brklyr h310 Middle McFadden Atlas appr Zellner Garage & Battery Co r Forsyth rd McFadden Avery R mech Zellner Garage & Battery Co r Forsyth rd McFadden Benj T (Lizzie) blksmith h ss Forsyth rd (V) McFallar Chas (Mabel) mach h519 E 2d McFarland Jas F (Margt) slsmn Dannenberg Co h 786 Holt av McFerrin Jas M (Bessie C) acct 409 Bibb bldg hl07 Elizabeth pi McGahee Chas (Lillie) milk opr h34-36 Shell av McGarr Ella lndrs hlOl E 1st McGarrah Agnes rl07 Capital av McGarrah Faulkner E (Alice) metalwkr r314 Plant McGarrah Hazel cashr Union Dry Goods Co r314 Plant DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 612 (1925) R. L. POLK & CO.'S McGarrah Hubbard B (Jimmie) night mgr W U Tel Co r711 (821) Columbus rd McGarrah Oneida rl525 Broadway McGarrah Rena (wid P J) rl525 Broadway McGarrah Wm M (Emma) hl07 Capital av McGaughey Wm C (Rosa) eng hl023 Clinton rd McGaw J M student r309 Georgia av McGee Addison P student r238 Hardeman av McGee Adolphus (Lizzie) lab hlOl Pio Nono av McGee Ambrose (Hattie) lab h600 (119) Charles (SM) McGee A B ship elk Coleman Meadows Pate Drug Co r615 Forsyth McGee A Pox (Marie) h238 Hardeman av McGee Byrne student r238 Hardeman av McGee Chas (Mozella) driver h21 Malloy's al McGee Dorphus (Kattie) lab r936 Elbert McGee Elijah (Emma) lab b.44 Massee la McGee Emma h Robinson rd nr Rockledge av McGee Ennis C (Annie E) traffic officer Police Dept h231 Belmont av McGee E Lee (Ethelyn) lino opr h862 New McGee Geo (Eva) carrier P O r204 Madison McGee Henry (Ellie) carp h479 Chestnut McGee Jesse (Lizzie) lab h209 Division McGee Jesse (Lucile) lab r322 Hammond McGee Jos B city warden r910 Clinton rd McGee Jos S (Lily) h974 Walnut McGee Marie Mrs mgr Macon Assn of Credit Men h 238 Hardeman av McGee Mary lndrs hl07 Elm McGee Mary maid h614 Ross McGee Pearl student r910 Clinton rd McGee Phelix lab r393 Madison McGee Robt B student r238 Hardeman av McGEE ROSA, Dist Agt Home Demonstration Bureau, r405 Adams McGee Wm hl408 Broadway McGee Willie r615 Forsyth McGehee Carrie lndrs h202 Plumtree McGehee Jas T (Nellie S) pres-treas Macon Paper Co hl23 Pierce av McGehee Jas T jr student rl23 Pierce av McGehee John student r!23 Pierce av (V) Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 H. HUNNICUTT CLOTHING CO. but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 613 oq McGehee Nellie S Mrs v-pres Macon Paper Co rl23 Pierce av McGehee Wm slsmn rll3 Habersham av McGehee Wm F ship elk rll3 Habersham av McGehee Wm F jr auto mech r W F McGehee McGerritt Annie Mrs hl27 Steele McGill Franklin T (Emma) mill opr hl4-16 Shell av McGill Jas r217 1st McGinnis A Frank (Lary) carp h523 Jackson McGinnis Chas (Myrtle) hl'543 Broadway McGinty Cottage 1307 (307) Edgewood av McGinty C Lamar (Ruby) tchr Mercer University h 95 Coleman av McGinty Lois A r664 Plum McGinty Thos A (Susie H) boarding 664 Plum h do McGirt Clarence (Lena) lab h934 Broad McGirt Jas L Rev asst pastor First Presbyterian Ch r222 Magnolia YATES MOTOR GO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES McGlocton Johnnie R lndrs r368 Maple McGoldrich Jos P (Annie) aud Kenneth-Odom Co h 666 Oak McGrady Chas W (Laura A) agt Reynolds Tobacco Co r Ridge & Merritt McGrady Idus H (George) cond h2415 2d McGrady Silas M (Lila) cond hl60 Jett Davis McGrath P J florist Idle Hour Nurseries res Rivoli Ga McGraw Ashbey F blrmkr rl27 Lawton av McGraw Geo F (Bird) blrmkr hl27 Lawton av McGregor Danl E (Lula) eng h804 Oak McGregor Kathleen nurse r567 Walnut McGregor Lula h296 1st av (V) McGriff Leon D (Edith B) sec Central Cotton Oil Co r432 Carling av McGriff Marshall lab h212 Short (EM) McGruder Annie nurse Macon Hosp McGruder Miriam driver h321 Douglas av 317-319 Third St. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R> L. POLK & CO. CHICAGO MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 614 (1925) R. L. POLK & CO.'S McGruder Shack (Mary) firemn hll31 Broad McGuire David L (Bettie) supt Natl Life & Accident Ins Co hl22 Stonewall pi (V) McGuire Ida (wid Jas) r200 Hill Crest av McGure John (Minnie) cook h221 Linden av McGuyrt Laura (wid Sami) rl68 1st McGuyrt Wm S lino opr rl68 1st McHan Edgar A (Augusta) sec Grand Council of Ga R & S M and Grand Chapter RAM h240 Boulevard (NH) McIntosh Emma cook 512 Walnut McIntosh R M Mrs asst liousekpr Dempsey Hotel r 555 2d McIntyre Carrie (wid S H) r460 Orange Mclnvale Clarence D (Bessie) carp hl710 3d Mclnvale Jesse R (Mildred) slsmn Home Art Supply Co r203 Simmons Mclnvale Rex (Eva B) flagmn hlll6 Ash Mclnvale Robt V (Carrie) hl07 Cleveland McKay Albert (Ophelia) lab hl35 Phillips la McKay Albert (Harriet) real est hl32 Hines ter McKay Anne L r560 Orange 1 McKay Blythe student rl32 Hines ter McKay Chas (Katie) lab h618 Maynard McKay Clifford A adv solr Macon News r560 Orange McKay Emma dom h438 Hammond McKay Esther r22 Nevaro Flats McKay Evangalee rl24 Edison McKay Harriett F Mrs society editor Macon News h 132 Hines ter McKay Ida millwkr hll Lake City McKay Jack (Lillie) lab r723 Fort Hill McKay Jas W (Lester) dept mgr hl'27 Winship McKay Jefferson D trav slsmn h595 Carling av (HH) McKAY JOHN J (Annie), Insurance 911 Ga Casualty Bldg, Phone 725, h560 Orange, Phone 3518 McKay Kate G (wid Wm H) hl431 3d McKay Leila R (wid Chas S) h719 2d McKay Lillie maid Mrs Alice Easterday McKay Ozzie B elk Hubbard Undertaking Co r371 Monroe McKay Wm (Lula) h612 Johnson av McKay Wm L (Eone) hl07 Applewood McKellar Ella H (wid Henry H) rl75 Magnolia A ^ natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company HEAVY HAULING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE M Phone 4951 258 Second St. MACON CITY DIRECTORY (1925) 615 McKellar Idus E (Anna Belle) tchr Wesleyan College hl75 Magnolia McKenna Anastasia sten Coml Credit Co rl04 Capital av McKenna Mary student rl04 Capital av McKenna Stepli E (Ruth M) sec Macon Retail Food Dealers hl58 Summit av (NH) McKENNA WM A (Mary C), Sec-Treas Kies & Arm- strong Inc, hl04 Capital av, Phone 535-W McKenna Wm A jr student rl04 Capital av McKenna Wm R (Madge) mldr rl707 2d McKenney see also McKinney McKenney Beatrice h804 Elm McKenney Danl (Lila M) driver Parcel Delivery Co r256 Middle A/ fr\ - c? / McKenney Jas T sten rl21 Culver / - . McKenney Louise'sec to pres Macon News Printing Co r665 (1033) Vineville av McKenney Robt driver Parcel Delivery Co MeKENNEY ROBERT L (Odessa), Editor Macon Yews and Pres Macon News Printing Co, h665 Vineville av McKenzie Emmett G (Helen L) pres Central Cotton Oil Co and Macon Fertilizer Co r Nottingham nr Masonic Home rd McKenzie Jas D (Grace) restr 1143 Broadway h do McKervey Agnes slsldy Union Dry Goods Co r215 Spring McKervey Annie slsldy Burden Smith & Co h215 Spring McKervey John r215 Spring McKibben Lane tchr Mercer University rlOO Cleve- land av (V) McKIBBEN THOMAS N (Lillian D), Mgr Frances Hotel, hI23 Stonewall pi McKiney Wm (Minnie) lab h505 Long McKinley Agnes bkpr R S Thorpe & Sons r220 1st McKinley Alice cashr r654 Plum McKinley A elk C D Kenny Co r673 Mulberry McKinley Barnie (Mayo) coml agt h205 Ninadell av McKinley Emmett (Helen) h Nottingham dr (NH) McKinley Helen sten McClure Office Equipment Co r34 S College McKinley Mose lab r215 Jones MOVING STORAGE FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST,, MACON, GA. PHONE 4354 "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On 616 (1925) R. L. POLK & CO.'S McKinley Raymond A (Anna) carp h Mellrose McKinley Rufus (Alene) attndt Highland Oil Co h215 Jones McKinley 'Wm (Idella) firemn hl014 Ocmulgee McKinney see also McKenney McKinney Benj I (Lynn) formn h302 Peachtree McKinney B'ud W (Lizzie) cabtmkr American Nov- elty Wks res Lizella Ga McKinney Carrie tchr rill Forest av (V) McKinney Cleveland butler rill Forest av (V) McKinney Clyde (Florence) lino opr r763 Cherry McKinney Emma rill Forest av (V) McKinney Frank attndt r673 Mulberry McKinney Geo C eng r757 Pine McKinney Henry C (Mary) doormkr h410 Cleveland McKinney Jos O (Leila) engr hl20 Chappell McKinney J Lohman teller 4th Natl Bank r238 Hardeman av McKinney Matilda tchr rill Forest av (V) McKinney Nancy lndrs h385 Madison McKinney Otis lab r362 Pine McKinney Robt E (Helen) deliverymn r71'9 3d av (V) McKinney Ruby Mrs hl704 2d McKinney Walter electn r224 Main (EM) McKinney Walter C (Ola) city firemn h215 New McKinney Walter C (Mattie L) gro 221 2d av (V) h 1411 3d McKinnon Harriett (wid John) r E G Person McKinnon Robt L (Corrine) poultry 121314- Broad- way hl216i/2 do McKinzie Lucile cook h555 Singletons la McKissick Abram L (Annie; Owl Drug Store) h872 Hazel McKmght Gilbert F (Exie B) asst mgr hl05 Oak av Earth" McKoin John (Lena) mgr r220 Hill Crest av McKoone Alma slsldy S H Kress & Co rlOO Capital av McKoone Irvin student rlOO Capital av McKoone Ollie teller Luther Williams Bank & Trust Co rlOO Capital av McKoone Richd M (Mamie) cranemn hlOO Capital av McLain see also McLean McLain J E tel opr r753 Mulberry Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 617 McLaughlin Eleanor C asst sec Am Red Cross r664 College McLaughlin Ellie T elk r664 College McLaughlin Mollie (wid J S) rooms 211 Broadway h do McLean see also McLain McLean Ada T sten Security Loan & Abstract Co r 1234 College McLean Ella (wid Elihu S) hl21 Coleman av McLean E Harvey (Mamie) constr formn hl07 Pierce av McLean Hugh (Lucile) teller Macon Natl Bank h255 Buford pi McLean Ira lab r229 Division McLean I Jewett sten 4th Natl Bank rl234 College McLean J L dispatcher r J B Marshall McLean Louise elk McLean Stores Co rl64 1st McLean Sarah C (wid Wm H) hl234 College McLean Winship (Gertrude) ro33 Vineville av McLellan's E E Hardemann mgr 5 and 10 Cent Store 556 Cherry McLemore A C Levy millwkr r27 Bellevue rd McLemore Claudie millwkr r27 Bellevue rd McLemore Fannie (wid Lee) h27 Bellevue rd McLemore John L millwkr r27 Bellevue rd McLemore Mattie millwkr r27 Bellevue rd McLemore Wilson millwkr r27 Bellevue rd McLendon see also McClendon McLendon Andrew L (Amelia) pntr h314 Calhoun McLendon Angeline lndrs rl30 Army Lot McLendon Cortez H (Bobbie) slsmn Roughton-Halli- burton Co h316 Linden av McLendon Isaac N (Mary) carp hll6 Florence (SM) McLendon Mattie lndrs r228 McLean al McLendon Mattie pharm Macon Hosp r313 Forsyth McLendon Mittie B maid rl30 Army Lot McLendon Pauline student r.1'16 Florence (TM) McLendon Roy L (Daisy) br mgr Flournoy Auto Co h908 Walnut McLeod see also McCloud McLeod Annie M sten Ga Investment & Trust Co r 281 Hillyer av McLeod Geo A blrmkr r712 Walnut McLEOD GEORGE B, U S Marshal, r Hotel Lanier A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 618 (1925) R. L. POLK & CO.'S McLeod John W (Leona) eng h322 Cleveland McLeod John W jr r322 Cleveland McLeod M Carlton deputy IT S Marshall r571 Orange McLester Hortense slsldy Union Dry Goods Co r769 Mulberry McLindsay John H electn Morris Putzel r Macon Hotel McMae Angie Mrs r461 New McMahon Geo rll4 Rembert av McMahon Geo H (Hixie E) mach hll4 Rembert ay McMahon Mary S opr Sou Bell Tel Co rll4 Rembert av McMahon Winnie R student rll4 Rembert av McManamy Harry A (Anna) milk dept Kinnett-Odom Co hllO Holt av McManus Della C mus tchr 209 1st r do McManus Furniture Exchange (L W McManus) 408 Broadway M 1 L L I R 0 N S "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHitleriAEmgeyIAho,LytLuoYarTup.nrHrgdouYdFvmeooe.nlcrsaTtasisathstiaritoiclesen.A,niNasoTtIDtfaHyaEUotdhhuYaSeenrEyagDAletPrbRhruYlyEegOsegigpdRiUinsAntNaok'Llns-., H McMann Leonard W (Dora; McManus Furniture Ex- change) h4 ss Vista Circle (I) E McManus Mamie (wid Leonard) h209 1st McManus Nora millwkr r26 Manchester qtrs McMath Henry mech r249 Belmont A McMath Henry C (Denta) carp h249 Belmont McMath Mary N student r249 Belmont T McMichael Eva (wid J Monroe) bkpr Dr M M Stapler rl06 Capital av McMichael R trainmn Macon Ry & Light Co r421 I Hazel McMickens Benj lab r610 Gilmer N McMickens Wm (Octavia) lab h610 Gilmer McMikel Delia lndrs r610 Fort Hill McMillan Annie Mrs mill wkr h28 Brigham G McMILLAN EUGENE C (Lula), V-Pres-Treas T C Burke Inc, hll9 Rogers av, Phone 8408-W McMillan Geo L (Bertha) city firemn h906 Cherry McMillan Helene sten J J McKay rl93 Elizabeth nl 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ^ENGLAND T"p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 619 McMillan John M (Caroline) slsmn Coral Gables h 193 Elizabeth pi (V) McMillan Kathleen r906 Cherry McMillan Mary Mrs housekpr Mrs Cook r354 College McMillan Mary J elk P O r468 Walnut McMillan Sami S (Ella) slsmn F E Block Co h ss Forsyth rd 1 w Riley av McMillan Vera M rl435 Broadway McMorris Beatrice lndrs r J J McMorris McMorris Joshua J (Cornelia) truck pdlr h Industrial Home rd McMullen Horace C (Grace) slsmn hl03 Davis (SM) McMullen Jos cabtmkr Macon Lumber & Mfg Co r 850 Woolfolk McMullen M Oliver (Ola B) carp h850 Woolfolk McMullen Zeta nurse Middle Georgia Sanatorium McMullin Edgar poultry rl04 Newberg McMullin J Ernest (Mary) mech Jones Motor Co h 104 Newberg av MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS McMurray Jas D (Edith; The Loraine Shop) h723 College McM'urray Jos r723 College McMurry Cicero gard h Columbus rd McMurry Nancy (wid S S) rl'225 Napier av McNabb Emma B r721 Oak McNabb Mary E (wid Lorenzo D) h721 Oak McNabb Ruth maid r222 Woodliff McNair Angus H (Florine) pastor Tatnall Square Presbyterian Ch h426 Carling av (H) McNair Bros (Wiley P and Idus L) cotton buyers 710 3d McNail Eula lndrs r260 Singleton la McNair Farmer lab r458 Hawthorne McNair Idus L (Julia; McNair Bros) h415 Georgia av McNair Jas (Bessie) chauf hlOlO Broad McNair Leola M (wid Danl G) r516 Orange Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Anss.1 irs All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet R. L POLK & Company Tharp's Pharmacy CABINET MANTELS, TILE, GRATES, ETC. _ V Willingham Sash & Door Co. E Office, 457 Third St. Telephones 278 & 3976 CM 620 (1925) R. L. POLK & CO.'S g bp o s"<-i h a sen 0) a> cvj H CD McNair Miriam student r516 Orange McNair Ola h4 Cheatham al McNair Sarah student r516 Orange McNair Wiley P (Nell B; McNair Bros) hi N Arling- ton pi McNair Wm O (Annie M) bkpr The Ross Co h ss For- syth rd (V) 7 w Tyrone blvd McNary Parrnan lab r609 Hazel McNeal John R lab r407 Main (EM) McNeal Lee carp r407 Main (EM) McNeal Morgan (McLizie) gard h Log Cabin hts McNeal Nina Indrs hl09 Hazel McNeas Walter carp rl55 Gordon McNease Eliz cook rl85 Gordon McNease Jennie lab hl'85 Gordon McNeice Louise N student rl24 North av (NH) McNeil Bertha rl052 Oglethorpe McNeil Emory H elk W S Dickey Clay Mfg Co rlOl Coleman av McNeil Jas O (Hattie) ins agt hll6 Lee McNeil John (Ola) ins agt h354 Woolfolk McNeill Cottage 43 S College McNeill Edw B (Nora) h510 Church McNeill Jas N (Lola) aud M D & S R R Co r258 Col- lege McNelis Patk G (Margt; McNelis and Bartlett) h654 1st McNelis and Bartlett (P G McNelis, F W G Bartlett) jwlrs 462 Mulberry McPherson Andrew J (Mamie) lab hl72 Palace av McPherson Calvin N (Docia) restr 278 Main h.711 (710) Woolfolk McPherson Emma h301 Bailey av McPherson Eug L (Susie) farmer h2334 2d McPherson Frank lab r711 (710) Woolfolk McPherson Frank waiter C N McPherson McPherson Inez cashr r711 (710) Woolfolk McPherson Isaac driver Thomas Morgan Inc McPherson Jas L lab rl72 Palace av McPherson Wm M (Eloise) capt MFD Sta No 5 h458 Carling av (HH) McPherson Willis T (Lilia) carp h814 2d McQueen Folsom W electn r664 Plum McQueen Randall L blrmkr r664 Plum FOR LISTS OF NAMES 1 ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO MACON CITY DIRECTORY (1925) 621 McQuirter Lon (Sarah) lab h207 Division McRae Duncan L broker 422 Cherry h453 9th av McRae Mitchell (Estelle) elk h20 Nevaro Flats McRae Roderick D bkpr Standard Handle Co r453 9th av (CH) McRae Rollie cabtmkr Macon Lumber & Mfg Co McRae Ruth bkpr Middle Georgia Sanatorium r453 9th av (CH) McRae Virginia student r453 9th av (CH) McRee Clifford (Lumie) mach h318 Linden av McSwain Hector L mgr Sou Investment Co res R F D 2 McSwain H David (Bessie) millwkr h37 Manchester qtrs McSwain J L county police r Thomaston rd McSwain Lillie rl2 Dannenberg av McSwain Ruby millwkr r37 Manchester qtrs McTheney Ruth r249 Hardeman av McTyier Jas H slsmn The Schwoh Co r716 2d McTyier Wm L (Ruby L) dept mgr Dannenberg Co h 814% Oak McWaters Chas L (Dora) eng h652 Oak McWaters Chas L jr (Eliz) eng r652 Oak McWhorter Jas swtchmn h528 Hawthorne , McWhorter Martha sweeper r513 Hazel McWilliams Annie (wid Sidney) rl05 Buford pi (V) McWilliams Ellen E (wid Wm A) hl65 Magnolia McWilliams G L student r Y M C A McWilliams Henry C (Clara) cond h416 Elm McWilliams Robt F r3803 Houston av McWilliams Robt F genl repr 3707 Houston av h do McWilliams Robt S (Mary) collr Macon Brokerage Co h609 Holt av McWorter Edw lab h221 Middle Maas Addie (wid Jacob) h.253 New Maas Regina r253 New Mable White Mem Baptist Ch 2634 2d Mabry Carrie lndrs r420 Hall Mabry Dennis (Ida) carp h703 (741) Edgewood av Mabry Green lab r420 Hall Mabry Mary sten W J Hamlin r763 2d Mabry Robt H (Eula L) dentist 11 Macon Sav Bk bldg h456 Beech av Mabry Roy (Julia) h705 (749) Edgewood av Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 622 (1925) R. L. POLK & CO.'S Mabry Wm H (Lucy) cond hlO, 811 Poplar Macedonia Baptist Church Rev J R Hunt pastor Ce- dar la se cor Whitehead Macedonia Baptist Church (col'd) 164 Hazel MacElmore Carr rP H Riordan MacEwen Harry L (Suie) sec Case Fowler Lmbr Co h97 Coleman av Macey Geo carp rl30 Grants Macey Myrtle student rl30 Grants Mack Adolphus lab r445 Tindall av Mack Alf L (Jeannette) sec-treas Mitchell, Williams & Mack hi05 Hill Crest av (CH) Mack Benj driver h352 Mitchell Mack Edw M (Annie) blrmkr hl74 Astor Mack Effie cook rl014 Ocmulgee Mack Geo (Rebecca) lab h411- (31) Charles (SM) Mack Gilbert lab r224 Carters al Mack Helen sten rl05 Hill Crest av (CH) Mack Hillery (Rosa) bellmn Hotel Lanier h308 Ward Mack Ida Indrs h Clinton rd Mack John (Tessie) lab h303 Cowan Mack J M r Hotel Arcadia Mack Rhetta student rl05 Hill Crest av (CH) Mack Rhoda (wid Holmes) r511 E 1st Mack Robt hlpr Taylor Iron Works & Supply Co r445 Tindall av MACK TRUCKS, Sparks Motor Co Distributors, 550 Broadway, Phone 4787 Macken Eliz student r804 Napier av Macken John E (Kath) formn h804 Napier av Macken Kath student r804 Napier av MacLemore Carr slsmn Macon Telegraph r Forsyth rd MacLemore D Nesbitt (Barbara) prop Palmetto Pharmacy and Natl Drug Store h ss Forsyth rd (V) 2 w Tyrone blvd Macon Academy Music Co D G Phillips mgr 513 Grand Bldg Mason Advertising Service W G Lee pres G D Plant sec-treas 510 3d Macon Alex (Leila) carp h218 Fretwell al Macon Association of Credit Men Mrs Marie McGhee mgr 207 Macon National bldg E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 - AUTHORIZED Lincoln F"ord'sorvif itD-sEALERS . CARS-TRUCKS-TBACTOHS havpehoit.ne 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 623 Macon Barber Supply Co (C B and R B Smith) 318 3d Macon Baseball Assn R G Williams pres Central City Pcirk Macon Bearing & Parts Co (W H Felton jr, G C Clarke) auto parts 517 Plum Macon Blue Print Co (F R Happ) 22, 4th Natl Bank bldg Macon Bottle Supply House (J J Quinlan) 512 Broadway Macon Brokerage Co P W Hurt mgr 464*/2 Poplar MACON CABINET WORKS, Carl Dohn Pres, Julia K Dohn Y-Pres, P H Dohn Sec, Mfrs Store, Office and Dining Room Furniture Poplar cor 8th, Phone 471 Macon Cafeteria J A Flournoy mgr 415 Cherry Macon Carrie Mrs opr Sou Bell Tel Co cor Ridge and Marshall av MACON CHAMBER OF COMMERCE, See Chamber of Commerce MACON CHERO-COLA BOTTLING CO (J J Willis, W A Hawkins), 618-620 Broadway, Phone 2487 (See right center lines and page 56) MACON CIGAR & TOBACCO CO, L A Walker Pres, C P Millirons V-Pres, R D Sams Sec-Treas, Cigars, Cigarettes, Snuff and Tobacco 656 Broadway, Phone 2436 (See page 58) MACON CITY DIRECTORY, R L Polk & Co Publishers, Woolworth Bldg, 1826*4 3d av N, Birmingham Ala Library Chamber of Commerce MACON COCA COLA BOTTLING CO, Lewis E Thomson Mgr, 418-420 Oak, Phone 287 (See right bottom lines and page 57) Macon Cooperage Co W A Roush pres G W Hubbell sec-treas 620 Division Macon Co-Operative Store Edw Smith mgr gro 2634 Broadway and 2107 2d MACON CREDIT BUREAU, H T Harris Res Mgr, 702 Citizens & Southern Bank Bldg, Phones 883 and 893 Macon Credit & Guarantee Co J M Williams mgr 469 2d Macon Cycle Co J H Walker mgr 513 Cotton av More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. lil o OlL CD < O KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 624 (1925) R. L. POLK & CO.'S MACON DAILY TELEGRAPH THE, Published by Macon Telegraph Publishing Co Every Morning in the Year, W T Anderson Editor, P T Anderson Y-Pres-Genl Mgr, M F Ethridge Managing Editor, It I Neal Ady Mgr, J T Webb Jr Circulating Mgr, 450-452 Cherry, Phones Business Office 76, 521 and 1264, Editorial Rooms 266, 1065, City Editor 65, Composing Rooms 1248 (See page 76) Macon David teller Macon Natl Bank res R P D 4 Macon Dental Depot W R and W B Holmes proprs 556 Mulberry MACON, DUBLIN & SAVANNAH RAILROAD CO, J S Crews Asst Genl Mgr, Phone 489, G M Norwood Sec-Treas, G H Whitaker Traffic Mgr, B M Meadows Coml Agt, M Y Simmons Soliciting Agt, W S Ehney Frt Claim Agt, L H Little Chief Clk, 4th Floor Citizens & Southern Bank Bldg, Phone 441, P S Little Frt Agt, Broadway and Ocmulgee, Shops Wralnut cor 7th, Phone 352 Macon Edgar B pharm r405 Ridge av MACON ELECTRIC CO (J H Starr, F W Reichert, (i B Smith), 367-369 2d, Phone 31 (See page 65) Macon E C city firemn r916 Elm Macon Fertilizer Co E G McKenzie pres E D Black v-pres S D Dodds sec-treas fertilizers 652% 3d MACON FIRE DEPARTMENT, L M Jones Chief, Hdqtrs 1st rear City Hall Macon Flour and Feed Co J H Crawley pres R L Crawley v-pres J H Crawley jr sec-treas 270 5th MACON FOOD CLINIC, L L Gibson Mgr, 666 Cherry, Phone 1047 MACON GAS CO, W H Felton Pres, L A Magraw VPres and Genl Mgr, L S Dure Y-Pres, R F Jones Sec, W E Houser Treas, 220 2d, Phones 4100, 4101, 4102, 4104, Charles Leech Plant Supt, Mulberry ne cor 6th Macon Grocery Co A W Smith pres R CCorbin v-pres A M Erwin sec-treas 100 Mulberry Macon Gun Club D C Morgan sec E end Glenn av Macon Hatchery P D Karsten pres J W Denson sec- treas hatchery (chicks) 519 3d MACON HOSPITAL, C R Massenburg Supt, 820 Pine, Phone 1880 Macon Hospital Nurses Home 700 New Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaorrtCearstalfoogr aclolnktianindss omfuAchutovmaloubaibleleLdisattsa.. OAusrknfeowr copy. R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 625 Macon Hospital (Colored) Nurses Home 720 New Macon Hussars Armory 617y2 Poplar Macon Ice & Cold Storage Co N Bruce Armstrong mgr 305 Bay Macon Josephine Mrs sten A T Holt & Co r414 Ridge av Macon Junius N (Carrie B) car inspr h405 Ridge av Macon Junius N jr elk Am Ry Exp Co r405 Ridge av Macon Lumber and Mfg Co (K F Dunlap) Mulberry and 7th Macon Machine Gun Co Armory (Co D 122 Infantry) J W Barnett Capt armory 655% Poplar Macon Machine Shop (B L Slocumb) 451-53 Wall Macon Mark T elk Am Ry Exp CorYMCA Macon Milling Co R B Dame pres E T Flanders vpres W G Jackson sec-treas 5th nr Oglethorpe Macon Mutual Burial Association J F Hart mgr 559 Mulberry Macon National Bank Building Cherry sw cor 2d MACON NATIONAL BANK THE, Jesse B Hart Pres, H Persons Heath, Frank C Donnelly and Robert G Jordan Y-Prests, H C King Cashr, Bayard Roberts and Roland C Mahone Asst Cashrs, Cherry cor 2d, Phone Connection (See backbone and page 55) MACON NEWS PRINTING CO THE, R L McKenney Pres, R R Wallis Y-Pres, R R Dugger Treas, J C Haire Sec, Publishers Macon News 412-414 Cherry, Phone 764 MACON NEWS THE, Macon News Printing Co Publishers, R L McKenney Editor, R R Wallis Business Mgr, 412-414 Cherry, Phones Editor 2067, Business Office 764, News Dept 442 and 3231, Advertising Dept 774-764, Circulation Dept 1223, Society Editor 1224 (See page 77) Macon Normal and Industrial Institute Pio Nomo av cor Lee MACON OPTICAL CO (Frank H Johnson), Optometrists and Opticians 468 Cherry, Phone 3213 (See right center lines and page 78) MACON ORANGE CRUSH BOTTLING CO, Clyde Daniel Mgr, 900 3d, Phone 2676 (See page 56) jK Pi6*n FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION Detroit R. L. POLK & CO. Chicago HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER E, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 m 626 (1925) R. L. POLK & CO.'S as a Macon Orange and Banana Co C H Bateman pres D C Bateman v-pres E S Hamilton sec-treas 451 5th Macon Paper Co J T McGehee pres-treas Mrs N S PLACE McGehee v-pres T A Johnston sec 311 Poplar Macon Pleating Shop Mrs L. A Allen mgr 620% Cher- ry THE MACON RAILWAY & LIGHT CO, W H Felton Pres, L A Magraw V-Pres and Genl Mgr, L S Bure V- DIRECTORY Pres, It P Jones Sec, W E Houser Treas, Genl IS THE GREATEST Offices 220 2d, Phones 4100, 4101, 4102, 4103, 4104, 4105, T H Williams Supt Transportation 511 Mulberry Macon Ralph (Sarah) elk City Water Wks hl93 MARKET Laurel av (NH) Macon Retail Food Dealers S B McKenna sec 563% PLAGE Mulberry Macon Sami B (Carolyn) inspr hl'429 3d IN THE Macon Sand Co H B Hoppendeitzer mgr 409 Ga Casualty bldg WORLD Every Day in the Year the Directory Tells Where All Kindis of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MJkifc MACON SAVINGS BANK, J B Hart Pres, J W Cannon V-Pres, C C Cunningham Cashr, J B Hart Jr Asst Cashr, Cotton av cor 2d, Phone 941 (See front cover) Macon Savings Bank Building 150 Cotton av MACON SEWER PIPE WORKS, See W S Bickey Clay Macon Shoe Co J C Murphy pres G P Bussey ir sectreas 361 3d Macon Shoe Shop and Army Store (Mrs Esther and Jos Galkin) 422-24 Mulberry Macon Stock Yards J T Molton mgr 348 Oak MACON SUPPLY CO (K F Bunalp), Lime, Cement, Plaster, Sewer Pipe, Roofing, Composition and Metal Building Specialties 7th cor Mulberry, Phones 1400-1406 (See front cover) MACON TELEGRAPH PUBLISHING CO THE, W T Anderson Pres, P T Anderson Y-Pres and Genl Mgr, R R Bunwody Sec and Treas, 450-452 Cherry, Phones 76, 521 and 1264 MACON TELEGRAPH THE, See Macon Baily Tele- PCMHEGS graph PoIltDirecloMjjB DETROIT FOR LISTS OF NAMES ANY TRADE,.--A ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POUIv & CO. CHICAGO Terminal Station Southern Business College E. L. RAY, President DAY AND NIGHT 6O5U6R/a MCOHTETROR:Y "TSHT,OROUGHNESS"PHONE 3041WRITE FOR INMFOARCOMNA,TIGOAN, MACON CITY DIRECTORY (1925) 627 MACON TERMINAL CO, Jacob Reichert Supt, W F Wippler Station Master, E P Bonner Ticket Agent, C E Pearce Baggage Agent, Terminal Station, Phones Station Master 4728, Informa- tion Bureau 4712 and 4713, Baggage Agent 4481 MACON TRADING & INVESTMENT CO, R C Paul Mgr, We Buy Salaries 421J4 3d, Phone 293 MACON TRANSFER & STORAGE CO (W S Herrin, J N Geeslin), Heavy and Long Distance Hauling, Furniture Moving, Packing and Storage 702-704 Broadway, Phone 304 (See right side lines and page 86) Macon Volunteers Armory 468 1st Macon Water Works Shops J J Leslie formn 5th nr Mulberry Macon Wm E (Pearl) slsmn Barker Bakery h801 Adams Macon Woolen Mills J D Renfioe prof 246 Broadway Macy Julian H attndt Dempsey Billiard Parlor Macy Julius (Laura) carp hl30 Grants MADDEN THOMAS D, Pastor St Joseph's Catholic Church, h814 Poplar Maddox see also Mattox Maddox Alex L lab h3 Ellis av Maddox A G r328 Columbus Maddox Barnie B (Flay) blrmkr hT06 Ponce De Leon av Maddox Clara lab r51 Long Maddox Claud C (Verna) boxmkr Tomlinson Paper Box Co h343 Hydrola Maddox Danl M (Hannah) textile opr h761 Haw- thorne Maddox Elbert M (Addie) carp h223 Ellis av Maddox Eliza gro 259 Douglas av h do Maddox Eliz tchr rl44 Magnolia Maddox Fred H elk Morris Hotel r do Maddox Hugo sten r709 Courtland av Maddox Irene cook r51 Long Maddox Jesse E (Ella) carrier P 0 h205 Roosevelt (V) Maddox John (Eva) lab h381 Plummer's al Maddox Josiah A (Kate) cond h709 Courtland av Maddox Lamor plmbr rl37 Lymoore av H Maddox Lizzie (wid Aron) h51 Long 2- Automobile owners are select prospects for ET many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new fp Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. W00 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 628 (1925) R. L. POLK & CO.'S Maddox Lizzie (wid John M) hl44 Magnolia Maddox Lucion A (Clara) farmer hl37 McGee Maddox Lula G (wid Robt) h855 Hazel Maddox Mary sten r307 Hightower Maddox Nathan (Sarah) lab h Morris (B) Maddox Roy L (Allene) agt Ind Life & Health Ins Co h.224 Duncan av Maddox Ruby student r205 Roosevelt Maddox Sami (Dolie) lab h Industrial Home rd Maddox Thos C (Mystice) carp h307 Hightower Maddox Thos L rl37 Lymore av Maddox Thresa spinner r855 Hazel Maddox Wm hlpr J M Cox Filling Station r44 Virgil la Maddux Mamie T (wid Robt D) r413 Spring Maddux Margt (wid M D) r760 1st Maddux Marguerite A sten Martin & Martin r760 1st Maerz Glenn P Mrs tchr Wesleyan College res Not- tingham dr Maerz Jos (Glenn) tchr Wesleyan College r Notting- ham dr MAGRAW LESTER A (Sarah), V-Pres and Genl Mgr Macon Ry & Light Co and Macon Gas Co, h 1133 Vineville av (V) Mahan Knowlton (wid E W) cashr Macon Hosp r702 Ridge av Mahogany Jos lab hll4 Green Mahone Gladys asst F W Farmer r304 Bailey av Mahone Norman A r304 Bailey av Mahone Perry W teller 4th Natl Bank r201 High Mahone Roland (Ruth) bkpr hll4 Courtland av MAHONE ROLAND C (Ruth), Asst Cashr Macon Na- tional Bank, h Massee Apts Mahone Wm P hotel elk h304 Bailey av Mailey Sami F (Daisy) formn hl5 Manchester qtrs Mainard Julius r247 5th Mainor Cath r404 Hillyer av Mainor Jas D firemn r404 Hillyer av Mainor Jas T (Ida) h404 Hillyer av Mainor Julius bellmn Hotel Lanier r Richmond Hotel Mainor Wm elk Union News Co r404 Hillyer av Maise Floyd lab r25 Tinsley la Malson Camilla cook r415 Monroe Maison Geo pntr h Lawson rd FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 629 Maison Marie h2 Bartlett Malabar Annie smstrs Union Dry Goods Co r Houston rd Malard Henry C gard rl52 Lamont Malary Carmalia cook h378 Long Malcom Ernest M linemn Postal Tel-Cable Co r Milledgeville rd Malcom Gug B (Martha B) mech Jones Motor Co r 715 Pine Mallard Emma Mrs button hole wkr r515 Jackson Mallard Ernest L (Louise) trav slsmn hl05 1st Mallard Ernest L jr student rl05 1st Mallard John A (Mattie) carp h 608 Main (EM) Mallard Richd (Estie) gro 117 Tindall av h do Mallary Edgar Y (Mary) pres Georgia Kaolin Co h 634 (934) Vineville av MALLARY NELSON I) (Willie WE), Asst Cashr Fourth Natl Bank, h!17 Callaway YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Mallery Howard (Maggie) lab hll2 Long Mallery Louise (wid Lewis I) rl20 Lamar Malloch John & Co J S Withington mgr cotton buyers 307 Grand bldg Mallory Baptist Mission 220 Roff Home av Mallory Camilla lndrs h402 (302) Charles (SM) Mallory Chapel (Baptist) 239 Roff Home av Mallory Thos (Ada) carp h85 Craft la Malloy Jas M (Olah L) hl85 Boulevard Malloy Olah L Mrs sec American Red Cross hl85 Boulevard Malone Comer K (Nattie M) tinner hl06 Heard Malone Drury R (Annie) elk hllO Pierce av (V) Malone Edw L (Myrtle) h215 Jenkins Malone Grover S sergt Sou Ry System r603 Plum Malone Hodge H collar mkr Otto-Isaacs Harness Co rl26 Stratton Malone Howard E (Lillian) elk Bibb Brick Co r664 Napier av (CH) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 630 (1925) R. L. POLK & CO.'S Malone Ida (wid Thos R) r613 Duncan Malone Jas C (Annie) park tndr hl26 Stratton Malone Jesse F real est rl42 Laurel av (NH) Malone (Trudie M) janitor hl59 Middle Malone Kate C Mrs tchr rl32 HighMalone Mildred student r215 Jenkins Malone Minnie V (wid Oliver) rl06 Heard Malone Robt H (Sara) eng h809 Pine Malone Sarah lndrs hl57 Elm Malone Smith elk rl26 Stratton Malone Wm J jr (Annie C) real est h2834 Houston av Mamie L tchr rl40 Grants Manard Chas (Louise) h432 Alabama Manchester Mfg Co A J Lyndon pres cotton yarns 8 Macon Sav Bank bldg Manchester School 200 Roff Home av Manderson Lucy A (wid Jas F) r250 Willingham Manderson Nellie mach opr r250 Willingham Manderson Otis F mach hd r250 Willingham Manderson Steph student r825 Main (EM) Manderson Wm S (Emma) farmer h825 Main (EM) Mands Hannah r rear 629 Walnut ' Manget Bros Co W C Flewellin mgr cotton buyers 622 3d Mangham David (Lizzie) h83 Ellis av Mangham Frances (wid Robt) r372 3d av (WH) Mangham Jones D brick mason h372 3d av (WH) Mangham Lula Mrs opr Sou Bell Tel Co r6, 109 Washington av _ Mangham Walter C (Lula) h6 Maynard apts Mangrom Jennie (wid Frank) lndrs h424 Long Mangum Herman (Nelle) r Cicero Tharpe Mangum Ruth C (wid Frank) priii Alexander Sell No 3 r213 Buford pi (V) Manley Cottage 1317 (317) Edgewood av Manley Gussie (wid T G) rl508 Forsyth rd (V) Manley Theo G (Lucille) mach hl508 Forsyth rd (V) Mann Adam chauf h264 1st av (V) Mann Annie r323 Georgia av Mann Annie B tchr r242 Middle (V) Mann Bros (Robt E and Chas F) agts Natl Accdt & Health Ins Co 813 Ga Casualty bldg Mann Chas F (Mann Bros) r461 Spring More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 631 Mann Chas H (Mary) wtchmn Builders Lmbr Co h554 Plum Mann Clifford R (Josephine) rll4 Rogers av Mann E LeRoy elk Georgia Grocery r763 Cherry Mann Geo A (Julia) chef h9 Spring Mama Henrietta J (wid Sami F) r909 Orange Mann Jack (Hazel) mech Ellis Motor Co r321 1st Mann Jos W (Ruby) millwkr h30 Bellevue rd Mann Mary F nurse Dr H G Weaver r808 Orange Mann Nannie R Mrs boarding 763 Cherry h do Mann Robt E (Georgia S; Mann Bros) h461 Spring Mann Robt E jr student r461 Spring Mann Rogers H slsmn r554 Plum Mann Sonny (Mary) lab hl02 Massee la Mann Thos B (Pearl) trainmn Macon Ry & Light Co The most comprehensive reference work on the hll7 Ells (SM) banks of MANN WM A (Dasher & Mann), Y-Pres-Sec Security Loan & Abstract Co, r321 New Mannheim Jos formn hll3 Dixie av Mannheim Rachel student rll3 Dixie av Manning Hutto r7 Hill Park av Manning John (Mamie) cook W A & J A Spiller h315 Middle Manning Jos E shoemkr h226 Gilmer Manning Robt lab r444 Bright al Manning Wm lab r318 Walnut Manry Allie E (Lillie) elk h442 Duncan av Mansfield Dray Line Co (Inc) W C Mansfield (New York) pres F S Holmes sec-treas 225 Walnut Mansfield Jas S (Mildred) mgr J C Penney Co hl09 Nottingham dr Mansfield John A brkmn r232 Ross Mansfield W C pres Mansfield Dray Line Co res New the world Contains Condensed Statements of All Banks, Lists of Officers of AH Banks, Digest of State Banking Laws and Much Other Data related to Banking York N Y Price $20 Mansfield W Seab (Ethel) ship elk A G Rhodes & Son h232 Ross Published Manson Annie lndrs rllO Bay semi- Manson John (Hattie) lab h406 Crisp Manson Otie lab rllO Bay Manthos Geo waiter Ellis Cafe r Capitol Hotel Manual Benj (Cora) lab hl052 Fort Hill Manuel Florence lndrs h444 Ballard annually SMEAPTRECMHBaEnRd by Manuel Georgian opr rl (117) Hydrola Mapes Ida (wid S W) hll5 Washington av R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send, to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R, L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 632 (1925) R. L. POLK & CO.'S Maple Orlie B (Pearl A) genl sec Y M C A hl85 Laurel av (NH) Mapp John (Lula) flremn h226 (219) Parguson Mapp Lula (wid Albert) rl20 Rogers av Mapp Moses S barber r224 Lee (EM) Mapp Myrtle dom r498 Gilmer Mapps Pennie Indrs h5 Fulton al Marcbman Eugenia Indrs blOO Smith (EM) Marchman Gus (Leola) h328 (240) Roye Marcbman Robt W trainmn Macon Ry & Light Co r 761 Poplar Marchman S E pntr r217 Bacon Marcus Cyntha (wid Thos) rllO Rutherford av Marcus John R h461 y2 3d Marcus Louise r203 Virginia (WH) Marcuson Isaac E Rev (Rose) h204 Buford pi (V) Marden Christopher (Sophie) lab hl63 Telfair Marian Arth lab h302 Burnett (EM) Marion Henry (Mary) mach r522 E 2d Marion Jas (Mamie) lab hll7 2d av (V) Marion Wm r227 Patterson Markert Edwin L (Eliz) elk Gulf Refg Co rl29 Vir- ginia av Markert F Earle (Emmie) credit mgr R S Thorpe & Sons h315 Beech av Marks Chas (Ray) trav h852 Cherry Marks Lucy (wid Dell) r651 Ross Marks Lucy dom r651 Ross Marks Queenie Indrs r5 New St la Markwalter Rebecca r W E Markwalter Markwalter W Edw (Carrie) cotton broker se cor Pine and 3d h ss Vista Circle 3 e Ridge av Markwalter W Edw jr student r W E Markwalter Marlow Valven M (Ella) elk Burden Smith & Co h 1059 Elm Marlow Viola mill hd r320 (226) Pionono av Maroon Najira elk Tony Maroon r452 Poplar Maroon Tony (Mamie) fruits 452 Poplar h do Marquis Jim (wid Wm R) boarding house 239 College h do Marrin Wm bell boy r668 Hawthorne Marsby Wm lab rl021 Ocmulzee Marsden Alice (wid Geo) h204 Hill Crest av Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 63 Marsden Ethel sten Happ Bros Co h204 Hill Crest av Marsden Hilda r204 Hill Crest av Marsh Geo H (Alice) carp r208 Peachtree Marsh John S (Sally) mech h208 Peachtree Marsh Jos (Maud) lab h305 Craft la Marsh Jos E (Wilhelmina) boilermkr rl09 Harrold Marsh Lucy lndrs h712 Reynolds al Marsh Marvin (Susie) chauf r305 Craft la Marshall Adeline cook h205 (209) W Boundary Marshall Allen W (Pearl) printer hl86 Laurel av (NH) Marshall Allen W jr student rl86 Laurel av (NH) Marshall Annie L r627 4th av (U) Marshall Apartments 232 High Marshall Belle X > a DO c z > o >--3 s ? FOR LISTS OF NAMES j ANY TRADE -- ANY BUSINESS -- ANY PROFESSION cCrn | dktroit R. I.. POLK Sa CO. Chicago Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 654 (1925) R. L. POLK & CO.'S Middlebrooks W Howard (Lillie) formn h260 Jeff Davis Middleton John P (Mary) elk P O hl23 Lamar Midds Andrew B pntr r318 (18) Bowman Midds Mary Indrs rll55 (1134) Woolfolk Midds Thos (Susie) porter h200 Park Hotel al Midds Wm (Lillian) lab hl20 Short (EM) MIDLAND PHARMACY, E G Jacobs Pres, 0 M Mar. shall Sec-Treas 402 8d cor Cherry, Phones 148 and 147 Midley Mary hl51 Franklin Midway Leila Indrs rl68 Astor (E M) Mifflin Wm (Lucile) r Carrie Jackson Might Chas (Rebecca) lab h53 Smith row Mikado Baptist Church Rev J M Sullivan pastor cor Mikado av and Fulton Mikado Realty Co J C Murphey pres Eden Taylor jr sec-treas 470 Cherry Mikael Louise maid r404 E 1st (E M) Mikel Kate r249 Hardeman av Mikel Marion J (Mattie) mgr Pearsons-Taft Co h249 Hardeman av Milan Chas H (Annie) sec-treas Georgia Seed Store h Log Cabin Hgts Milan Leita sten The Bradstreet Co r540 Forsyth Mildred Andrews elk C of G R R Co h501 E Napier av Miles Bettie cook r312 Madison Miles E Henry (Bennie) firemn h451 Martha (E M) Miles Henry (Lucy) farmer h540 Maynard Miles Henry jr (Carrie) lab r540 Maynard Miles Henry (Lillie) lab h505 Telfair Miles Julian lab r224 Fulton (E M) Miles Mollie h730 Edgewood av Miles Moses (Lona) barber 415-17 Cotton ay h265 Wilson (E M) Miles Mosetta student r265 Wilson (E M) Miles Paul C cashr Am Bakeries Co r476 College Miles Paul E (Mary) agt N C Mut Life Ins Co h224 Fulton Miles Pauline indrs r224 Fulton (E M) Miles Thos B cashr h9, College Hill apt Milholland J H r220 1st Milkins Allice Mrs h518 Monroe E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARSTRUCKS -TRACTFOoRrSdsorvhIffoavrPietH'asOitN.aFEoFr1od5r,9d1woer JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 655 Miller Ada cook hl53 Bright al Miller Alice Mrs smstrs rlOl Hightower Miller Anderson (Sallie) h525 E 1st (E M) Miller Anna C dom 1x229 Orange Miller Annie cook r305 Madison Miller A Lawton (Kath) lawyer 357% 3d rl71 North av (N H) Miller Belle (wid Jos M) h457 Arch Miller Boyce E (Eliz) dist mgr Coral Gables hll9 Culver MILLER BROS (Lawrence A and Jos G) Plumbing Steam and Hot Water Heating 171 Cotton av, Phone 474 (See left side lines and page 79) Miller Chas lab r228 Lexington av Miller Chas (Ruth) pntr hll63 Oglethorpe Miller Chas 0 elk H M Smith & Co r323 Georgia av Miller Cornelia (wid Chas) rlO Glynn av Miller Cottage 1132 University pi Miller C Myrick (Alma) elk rl44 Knott Miller David draymn r305 Patterson Miller Della lndrs hl31 Malloy's al Miller Dink lab rll Cheatham al Miller D Clyde elk David Wachtel h6, 356 New Miller Edw lab r362 Pine Miller Elbert (Essie) carp hl46 Astor (E M) Miller Elbert F (Lizzie) lab hll6 Green Miller Eleice slsldy S H Kress & Co r614 Montpelier av Miller Eliz rl38 2d av (V) Miller Ella dom rl06 Cowan Miller Ellene dom r229 Orange Miller Emanuel J (Garnett) supt Massee Felton Lum- ber Co h218 Crescent av Miller Emma gro 176 Hazel h330 Jackson Miller Evelyn (wid Wm M) asst Dr C A Yarbrough h 750 Walnut Miller E M attndt George Coutous r309 Broadway Miller Fannie maid hl4 Bookers al Miller Frank (Mattie) lab h.228 Lexington av Miller Geo porter Maxwell Bros & Bridgers h E 2d Miller Geo T (Kath) phys 515 Citizens & Sou Bank bldg h323 Georgia av Miller Henry brklyr rl38 2d av (V) The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. > &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 656 (1925) R. L. POLK & CO.'S Miller Henry (Emma) carp h228 Log Cabin dr Miller Holmes lab rl46 Astor Miller H Lee student r963 Walnut Miller Jacob A lab r229 Orange Miller Jas O (Annie) trav slsmn h307 Hendley (NH) Miller Jim lab r47 White Miller John lab rl22 Duval (E M) Miller John (Acy) waiter h305 Patterson Miller John L solr Independent Lndry Co Miller John N phys Metropolitan Ins Co rl22 Holt Miller John P (Lena) city firemn h285 Winship Miller John R (Maggie) hl52 Lamont MILLER JOS G (Mary; Miller Bros), h417 Jackson Phone 4498-J Miller Josephine J (wid W C) r Massee apts MILLER LAWRENCE A (Frances; Miller Bros), h 421 Jackson, Phone 4493-J Miller Lawrence M barber Dempsey Barber Shop r620 Pine Miller Leona H (wid Chas) h606 2d Miller Lillie cook hl25 Williams la Miller Luther F (Emma) trav slsmn hl36 McGee Miller Maggie (wid Jos V) r318 Winship Miller Major B (Ada P) r2177 2d Miller Mamie toll instr Sou Bell Tel Co r620 Pine Miller Margt Mrs r374 Clinton (E M) Miller Margt r871 Walnut Miller Marguerite student r225 Lawton av Miller Mary smstrs hl06 Palace av Miller Mary student rl71 North av (N H) Miller Minnie lndrs hi 5th av Miller Minnie maid r44 Virginia la Miller Nellie r748 3d Miller Nina drsmkr 229 Orange r do Miller Olive opr Sou Bell Tel Co r619 2d Miller Paul A (Frances) asst observer U S Weather Bureau r318 New Miller Robt (Martha) inspr Massee-Felton Lumber Co r660 Napier av Miller Robt L (Sallie) mldr h.622 (614) Montpelier av Miller R J (BerthaJ lab h224 Jordans al Miller Sami W (Susie) eng h2108 Broadway Miller Sandy (Mamie) lab r338 May av AmtcCeouaarpsttnyaoy.lfmookgoribnacidlloelsRnkot.aiofnLiwndm.snsPeeormOrcfsLuhAcaKahnurdt&eovismaeClso.uOeba.l,ibeSleclDeetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtsMsrqkIunCffaeHoowr-rr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES. MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 657 Miller Sarah r820 Ocmulgee Miller Talbott (Alma) baker Am Bakeries Co h512 Telfair Miller Thelma L student r225 Lawton av Miller Thos (Helen) lab r621 Middle (E M) Miller Valley (wid Andrew) r245 Tindall av Miller Wallace (Mary) lawyer 353)4 3d hl71 North av (N H) Miller Wm (Bessie) firemn r510 E Academy (E M) Miller Wm lab r247 Cheatham al Miller Wm lab r229 Patterson Miller Wm D (Mary) farmer h869 Walnut Miller Wm E (Annie L) slsm Taylor Iron Works & Supply Co h225 Lawton av Miller Wm Z porter r229 Orange Miller Willie lndrs r518 Plant al Miller Willie maid r271 North Miller W Verdery (Verona) mach hl007 Hazel Miller Z Taylor jr (Sarah L) h963 Walnut Millican Wm T (Louise; Heard Bros) h730 Court- land av Millier Richd W (Mary) h407 Monroe Milligan Junius 0 (Nancy) car inspr hl411 Edgewood av Milliner Gladys lndrs r451 Coles al Millinet Bertha cook rl22 Ross MILLIRONS CLEVELAND P (Mattilee), V-Pres Macon Cigar & Tobacco Co, li507 Pio Nono av MILLIRONS CLIFFORD V (Roller & Millirons), r439 Jackson Millirons Della (wid Chas V) r461 Oak Millirons Gretchen cashr r203 American blvd Millirons John W hl021 Hazel Millirons J L supt Dixie Ice Cream Co h203 American blvd Millirons Marshall (Lizzie) hlpr h300 (7) Mason (S M) Millirons Robt H (Minnie L) elk Roller & Millirons h 439 Jackson Millirons Wm T flagmn r203 American blvd Mills Anna lndrs r337 Boardmans al Mills Douglass lab r454 Pine Mills Ernest (Bessie) driver h!46 Carling av (H H) UK Pi6-i7S FOR LISTS OF NAMES any TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLIv & CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DMM 658 (1925) R. L. POLK & CO.'S as* a r Mills Freeman W farmer hll7 Garden Mills Gordon (Kelley) porter Haverfield Smith & Wood hl52 Middle (V) Mills H C emp Cudahy Packing C Mills John mech r516 Ocmulgee PUL Mills Jos L (Marie) furn h216 (223) Farguson Mills Josh (Beadie) lab r (rear) 203 Williams THE Mills J Hines slsmn C H Hunnicutt Clo Co r560 Plum Mills Lizzie lndrs hl58 Coles al DIRECTORY IS THE GREATEST MARKET Mills Mary Mrs canvasser of perfumes h532 Telfair Mills Mary L r532 Telfair Mills Marzell (Linda) lab h337 Boardsman al Mills Mattie lndrs rl57 North Mills Oscar B W Lewis Pierce rl9 Bellevue rd Mills Raymond (Susie) driver hl54 Middle (V) Mills Robt C (Leila) blr mkr h460 New Mills Roger E (Essie) hl31 Academy PLACE Mills Theo (Aida) waiter hl22 4th av (V) IN THE WORLD * Mills Thos W (Bertha) slsmn Macon Chero Cola Bot Co r910 Oglethorpe Milner Alice (wid R A) tchr r720 Napier av Milner Henry (Annie) firemn h851 Ash Milner Lou lndrs h622 Gilmer Every Day In the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had ) * Milner Mary M matron Y W C A r do Milner Oliver (Willie) carp h804 Edgewood av Milton Lena lndrs h221 Pond Milton Mary L lndrs h520 Short (E M) Milton Missouri r510 Telfair Milton R C electn Macon Electric Co rll62 Ogle- thorpe Mimms Carrie lndrs h S Bookers al Minims Minnie (wid Sol) r382 Simmons av The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Mims Abbie smstrs h28 (528) Clayton Mims Abner L (Carmen) mgr Ideal Creamery hl20 Lawton av Mims Chas (Annie) farmer h303 Gilmer Mims Danl (Mary) lab h342 Middle (V) Mims Danl J jr carrier P 0 r342 Middle (V) Mims Dolphus (Emma) brk mason hl69 Roye Mims Ella B cashr Ideal Creamery rl20 Lawton av Mims Elliott porter Chapman's Pharmacy r342 Mid- R-I:Poik&Go dle (V) Mims Emory (Pinkie) lab h78 (134) Forest av (V) piiBLim blkDirecbniM * DETROIT f More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT 6O5U6K*2 MCOHTETROR:Y "TSHT.OROUGHNESS"PHONE 3041WRITE FOR INMFOACROMNA,TIGOAN~ MAGON CITY DIRECTORY (1925) 659 Mims Ethel maid Hotel Lanier r342 Middle (V) Mims Frances rll05 Oglethorpe Mims Fredk lab r45 2d av (V) Mims John W asst mgr Ideal Creamery rl20 Lawton av (H H) Mims Kath rll05 Oglethorpe Mims Lillie P (wid Wm D) h267 Hillyer av Mims Locket (Carmen) hl20 Lawton av Mims Lucy lndrs hl016 College Mins Lucy lndrs h520 Flanders (E M) Mims Randolph janitor rl69 Roye Mims Rosa lndrs h410 (450) Womack Mims Wm lab h.613 Shoals al (E M) Mims Wm S (Lowe) carp r620 2d Mims Zeb (Janie) mill wkr r426 Flanders (E M) Mincey Elliott F (Hazel) gro 360 Campbell av rl69 Elizabeth Mincey Ruby elk Elliott Mincey rl69 Elizabeth Mincey Shelton (Bertha) barber E Z Piercey r217 Telfair Minday Mathew credit mgr Collins r Lanier Hotel Mingledorff Robt S (Bertie L) hl811 3d Minian Geo (Geraldine) lab hl6 Ford al Minion Obie (Rena) carp hll03 (803) Woolfolk Minisis Nicholos (Inez) r519 Pine Minor Alice opr Sou Bell Tel Co r Bellevue Minor Alvord V msngr r412 American blvd Minor Clara E tchr r753 New Minor Frank L (Etta) elk RMS h412 American blvd Minor Frank L jr (Johnnie) firemn h223 American blvd Minor John (Rosa) h210 Ward (V) Minor John A r768 Oak Minor John D (Bettie) eng h768 Oak Minor John H (Rosa) mgr Chatham Mut Life & Health Ins Co h210 Ward Minor John T (Fannie) elk h753 New Minor John T jr student r753 New Minor Lucius waiter hll3 Tatnall Minor Marguerite r768 Oak Minor Walter H jr elk P O r28 S College Minter Arnold L (Fannie) sawyer h3 Villa av (Belle- vue) Automobile owners are select prospects tor many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog' contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. so 30 TERMINAL TRANSFER COMPANY TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 660 (1925) R. L. POLK & CO.'S Minter Inez r218 Spring Minter Jas bkpr r715 2d Minter Jas W (Sarah V) farmer h218 Spring Minter Lucile nurse Middle Georgia Sanatorium Minter Sara nurse Middle Georgia Sanatorium Minton Jas lab r207 Smith Minton Julius W (Alice) mill wkr h 28 Manchester qtrs Minton Mack B (Mollie) trav slsmn h509 Hillyer av Minton Margt (wid Warren D) rl20 Highland av Minton Morris auto mech r207 Smith Minton Ruth sten r509 Hillyer av Minton Zudie h207 Smith Miot Susie D r512 Walnut Miralgia Agnes slsldy r262 Broadway Miralgia Edw (Frances) gro 404 Mulberry h262 Broadway Miralgia Edw jr student r262 Broadway Missionary Baptist Church Rev Alex Reynolds pastor 143 Bay MISSOURI STATE LIFE INSURANCE CO, H M Sours Director, 802-808 Bibb Bldg, Phone 1710 Mister Mattie (wid Robt) h5, 501 Giles Mitchan Earnest (Willie) lab h.270 Pear (E M) Mitchel John (Ethel) lab h204 (278) Astor (E M) Mitchell Andrew mill wkr rll Alabama Mitchell Anthony student rllO Corbin av Mitchell Arth (Johnnie) carp r967 Ocmulgee Mitchell Arth (Leader) lab h.25 Siam Mitchell Beatrice lndrs r354 Pine Mitchell Caroline h2 Ross st pi Mitchell Charlie (Florence) lab r320 (274) Roye Mitchell Clifford (Pearl) firemn r609 Ross Mitchell Clifford (Mary) flagmn h708 Broad Mitchell David (Alice) carp h.809 Elm Mitchell Della (wid Ivison) h204 Cedar Unionville Mitchell Donald G jr emp Macon Telegraph r Albe- marle pi Mitchell Edith cook r450 Alabama Mitchell Elder (Anna) lab h65 Plummer's al Mitchell Eliz prsr r809 Elm Mitchell Emma Mrs rl783 3d Mitchell Emma millwkr h347 Flanders FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects tor many kinds of merchandise. Send to Headquarters for all kinds pf Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 661 Mitchell Esther (wid Lewis R) asst X-ray r553 Orange Mitchell Florence cook 247 Roye Mitchell Forney D (Jessie) ydmstr h237 Ells (S M) Mitchell Frances opr Sou Bell Tel Co rl20 Piedmont av Mitchell Frank Rev (Anna) h519 Ross Mitchell Frank jr pntr r519 Ross Mitchell Frank B (Mattiebel) phys 318 Ga Casualty bldg hl9 Arlington pi > Mitchell Fred delivery boy r803 Ocmulgee Mitchell Geo elk r356 Woolfolk Mitchell Geo cook r354 Pine Mitchell Gostin elk r356 Woolfolk Mitchell Harrison (Drusilla) porter h337 Maple Mitchell Hattie cook r6 Orchard av Mitchell Henry porter h398 Cowan Mitchell Henry porter r215 Powell (E M) OVERLAND FRANKLIN YATES MOTOR CO. WILLYS-KNIGHT 707 THIRD ST. PHONE 1446 AUTOMOBILES 2 W 3" 3 > O 73 55 3 Q> in sO z go C73 ?>> >r*> % 00 r> zs r tn Mitchell Henry R (Grace) weighmstr r221 Ells (S M) Mitchell Heyward (Mary) lab r398 Cowan Mitchell Homer (Ethel) suit prsr h46 (45) 2d av (V) Mitchell Horace lab r354 Pine Mitchell Horrance N (Agnes; Ouzts Mitchell & Wha- ley) hllO Corbin av Mitchell Isoh r24 Williams la Mitchell Jacob mldr rll7 Maple Mitchell Jas (Susie) lab hl38 Turpin la Mitchell Jerry lab r354 Pine Mitchell Jesse A (Blanche) pres Mitchell Williams & Mack hl47 Summit av Mitchell John (Hattie) lab h256 Elliott (E M) Mitchell John lab hll (7) Spring la Mitchell John C (Myra) barber 1504 Broadway hl716 3d Mitchell Johnnie M lndrs rl53 College Mitchell Josephine nurse rl05 2d av (V ) Mitchell J B (Pearl) mtrmn r204 William A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit a PJC/3 >> O r Z 30 in *o iCnO > z < 12 s2i. O- M H n O z w J o *z--< o < 05 Q O' d zM flu O 0 d 1 > O'" < S5 25 Ja u]Z 00 v e! -Si WJ 0,04 > flU^ 05 04 04 C/l o Oh o cn Q 05 04 05 cn e o 2 o z < MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 662 (1925) R. L. POLK & CO.'S Mitchell J Paul (Leeker) slsmn Macon Chero Cola Bottling Co h659 Oak Mitchell Lewis T (Loise) city firemn r285 Winship Mitchell Lizzie r523 Hazel Mitchell Louis A (Ella C) feed 611 3d hl03 Pierce av Mitchell Lucia drsmkr r610 Clinton (E M) Mitchell Mae drsmkr 652 ^ Cherry h do Mitchell Mary dom r205 Kitchens Mitchell Mary sten r356 Woolfolk Mitchell Minerva cook r20 Gustin av (V) Mitchell Mollie cook r2 New st la Mitchell Mollie maid 127 Washington av Mitchell Nan sten Barnes & Barnes Inc r24 Nevaro flats Mitchell Nanie mill hd h6 Bibb av Mitchell Ophelia (wid Geo C) hl20 Piedmont av Mitchell Orth (Anna) lab hl87 Hatfield al Mitchell Philip (Emmie) cotton sampler h560 Ward (V) Mitchell Philip porter Alex Sprunt & Son Mitchell Phoebe student r708 Broad Mitchell Robt (Mammie) firemn h202 Waterville rd Mitchell Robt P (Bessie) car repr hl504 2d Mitchell Rufus (Mattie) pdlr hl02 (124) Richard Mitchell Sarah Indrs r398 Cowan Mitchell Steven (Beatrice) lab r354 Pine Mitchell Susie cook r (rear) 568 Monroe Mitchell Theretha hlpr Turner & Lylie r354 Pine Mitchell Thos (Hassie) porter G Bernd Co hll5 4th av (P H) MITCHELL THOMAS L, Mgr Loan Equitable Life Assur Dept Society of the US,r Dempsey Hotel Mitchell Viney Indrs h245 Plant al Mitchell Walter L (Gladys) flagmn h502 Giles Mitchell Wm (Louise) h321 Orange Mitchell Wm (Everline) lab rl4 Park Hotel al Mitchell Wm pntr r519 Ross Mitchell Wm H (Ethel) supt W S Dickey Clay Mfg Co h261 Bond Mitchell Wm M (Fort Hawkins C of C Store) h356 Woolfolk Mitchell Wm R (Laura) mech h717 (720) Woolfolk A# natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 663 MITCHELL, WILLIAMS & MACK, J A Mitchell Pres, B G Williams Y-Pres, A M Mack Sec-Treas, Drugs, Two Stores 376 2d, Phones 3947-3948 and 401 Cherry, Phones 1941-1942 Mitchum Jas E (Mary E) carp h314 Shamrock Mixon Benj F (Kizzie M) carp h291 (56) Maynard Mixon Ellis T trainmn Macon Ry & Light Co r820 Main Mixon Harris (Lillie) h2220 Broadway Mixon Hilda elk McLellan Stores Co r822 Walnut Mixon Marie (wid Maddie) r822 Walnut Mixon Oliver C (Unatie) gro 101 Hydrola h204 do Mixon Susie r2220 Broadway Mixon Walter r291 (56) Maynard Mixon Wm M (Mollie) fishermn h308 Water (E M) Mize Chas rl821 Broadway Mize Clarence S (Bessie) photog 20 Jaques bldg h 1728 3d Mize Clifford T (Lizzie) carp hlOlO Hazel Mize Herman L meat ctr L W Rogers Co r Hotel Arcadia Mize Walton E (Lois) ship elk Jackson Wynn Co rl55 Hendley (N H) Moat Jos D (Ethel) textile wkr hll2 Pierce (E M) Moat Mattie rll2 Pierce (E M) Moates Iris Mrs musician W T Grant Co 304 Church Mobley Ann (wid John) h56 Craigs la Mobley Bessie rll8 Green Mobley Emily (wid Jas F) r230 Duncan av Mobley Ewell L (Norwood & Mobley) r869 Cherry Mobley Jessie r230 Duncan av Mobley Ruth nurse Macon Hospital Mobley Walter E (Ida) h774 Mulberry Mobley Walter E (Frances) phys 515 Bibb bldg r774 Mulberry Modena Dominick (Rosa) furn rms 154 Broadway h do Modena Nicholas A (Lavonia) mech rl54 Broadway Modern Grocery Co E C Kent mgr 264 5th Moffett Delos L elk r815 Poplar Moffett Ernest r815 Poplar Moffett Paul student r815 Poplar "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" q Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory fhqn any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 664 (1925) R. L. POLK & CO.'S Mohan Danl J (Kathleen) prop Dinty Moore's Place h Washington av Mohorne Jennie lndrs rl42 North Mohorne Lizzie lndrs h311 Bdgewood av Moland Nevelin (Janie) porter hl55 Grants Moll John student r620 Walnut Moll Lula (wid Herman) r620 Walnut Molsby Geo R mldr r2334 2d Molton Cecil J ship elk C J Molton Lumber Co r290 Hillyer av Molton Chas J (Sarah) contr C J Molton Lumber Co h290 Hillyer av MOLTON C J LUMBER CO (Successors to Crisp County Lumber Co), J T Molton Jr Mgr, Yellow Pine Lumber, Sash Doors, Screens, Building Material and General Mill Work 348 Oak, Phone 2687 (See right bottom lines and page 75) Molton Hiram M elk Terminal Ticket Office h Ells (S M) Molton Howard mech rill Enterprise Molton Jas H (Eula) contr h213 Carling av (H H) Molton Jas H jr elk Terminal Ticket Office r213 Car- ling av (H H) Molton Jewell r290 Hillyer av MOLTON JOHN T Jr (Emma R), Mgr C J Molton Lumber Co, h202 Newberg, Phone 1991-W Molton Leonard D (Martha) slsmn h455 Virginia av Molton Lillie smstrs rill Enterprise Molton Riley J (Mattie) mech hill Enterprise Molton Ruby C bkpr C J Molton Lumber Co r290 Hillyer av Molton Sarah sten rl22 (119) Log Cabin dr Molton Thos F (Ida) draymn h656 Pebble Molton Wallace brickmason r213 Carling av (H H) Momand Daisy h748 Edgewood av Momand Henry G (Louise) slsmn S M Solomon jr h433 Johnson av Momand H Coleman flagmn r708 Oak Momand Jas (Willie) carp hl09 (193) Richard Momand Mary A (wid Elijah T) h519 Johnson av Momand 0 Faye (Gladys; R T Momand Fish Co) r 708 Oak R. L. POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) i^d~Ragland T (Naomi; R T Momand Fish Co) MomS Fish Co (R T and 0 F Momand) 655 Poplar Moncrief Adiel E (Margt) r726 College Moncreif Eva C student rll4 Rutherford av Moncrief Jas (Mattie) lab hl30 Cowan Moncreif Maggie M student rll4 Rutherford av Moncrief Marion W (Margt) carp hll4 Rutherford av Monday Abner (Melissa) wtchmn hl23 Yates av (E M) o Monday Carl A (Eva) meat ctr rl23 Yates av (E M) Monday Violet mach. opr rl23 Yates av (E M) Mondena Pete M (Ludie) h205 3d av (W H) Monfee Andrew J (Pearl) weaver hl2 Holt av (N H) Monfee David M (Annie Laurie) mill wkr h34 Brig- OQ ham Monica Court 353V2 3d Monk Arth (Carrie) r584 Whitehall Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 57-659 THIRD ST. PHONE 4846 Monning Rachel J r5 Davis al Monroe Ada cook r365 Hawthorne Monroe Anna cook Pies Jones r359 Hawthorne Monroe Calculating Machine Co T H Morgan mgr 705-6 Bibb bldg Monroe Emma hl08 Spring Monroe Essie maid r462 Chestnut Monroe John A (Nettie) wtchmn h534 Jackson Monroe Jos (Mariah) carp h462 Chestnut Monsees Chas elk Crumps Park Filling Station r North Highlands Monsees Dock F (Jessie) meat ctr North Highland Gro r Bradley Jones Monsees E F prop Crumps Park Filling Station h Park av and Forsyth rd (V) Monsees Jas A (Onie) lawyer 3 Washington bldg h 910 Clinton rd FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION jjDETROIT R. L. POLK & CO. CHICAGO <2 P * $ 21 BARRON & REAGAff TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attend B.BB REALTY BLDG. TCLEPHOnTm (1925) R. L. POLK & CO.'S Your City Directory Answers All Questions as to WHOM You Are Looking: For and WHERE Montague Andrew P (Florence) tchr Mercer Uni versity h503i/2 Adams Uni' Montague Rodney R (Rosalie) trav slsmn h597 Col- 16g6 Montgomery Bertha dom rlO Short (E M) Montgomery Dolly Indrs rlO Short (E M) Montgomery Jos cond r307 Forsyth Montgomery Jos L (Maude) slsmn h505 Pio Nono av Montgomery Leroy lab rlO Short (E M) Montgomery Marge Ann r505 Pio Nono av Montgomery Marsh (Alice) lab hlO Short (E M) Montgomery Wm (Rosa) lab h226 Chappell al Montoya Artemio asst tchr Mercer University Montpeha Garage Robt O Ford prop 945 Columbus rd Moody Benj W (Elvira) hl08 (2) Toombs (S M) Moody Benton sign pntr Crimmins Sign Co J Moody Emory A cond r801 Pine Moody John (Lizzie) lab h!4 Park Hotel al "A 75c Bottle Makes a Quart" PYORAL the best mouth wash DSsHleA'EgeIAhLytLYoTup. rHroFYdveooe.nrlcaTtaissathstaii*triolcseenA. ,niaNsoTtIDLafHyaoUEtdhuhYaSerneEvagDAlePtrhRrhuYlpyEgsOpgirgRp?iUnsiAntaNn'kLrls>-., They Can Be {Found The Moody John A (Flora) waiter 338i/2 Main (E M) Moody Walter T (Rosa) eng h613 Holt av Moody Wm W (Edith) blrmkr h569 Boulevard (N HI Moon Allice r225 Reid Moon Henrietta dipper Empire Candy Co Moon Jack (Julia) lab hl61 Phillips Moon Jackson lab Miller Bros r8 Phillips la Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet M0nr2^ 07t^ Wrasihi5nEgmtomnilaeve) slsmn Union Dry Goods Cc M0dersh(E ^Henrietta) basket mkr r359y2 FlanMooney Addie (wid Bill) r413 Chappell Mooney Jas (Lillian) lab h317 Madison Mooney Lillie r317 Madison Mooney W wamU^BC(/eA*(nAnuiedrMey) )h4si1S3nCPhnatprpeblll04 Magnolia Moor Sarah E (wid Jesse W) hl02 St John Moore Addie r668 Elm Moore Alice dom rlOl Bowman R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 667 Moore Alice lndrs rl27 Railroad av Moore Allen A (Mary) cond h Oliver av (Log Cabin Hts) Moore Alto F elk Am Ry Exp Co rl05 Kenmore pi (C P) Moore Alton student r458 Ocmulgee Moore Alva E (Mary) blr inspr h508 Hillyer av Moore Anna (wid Chas E) bl22 Spring Moore Annie lndrs hl26 Sherman Moore Annie V (wid J L) r317 Chappell Moore Arth B (Mattie; Central Loan & Investment Co) h685 Napier,,av Moore Arth R (Lula) h Bartlett la Moore Asa E exp msngr r805 Pine Moore Augustus L (Ida E) cond hl975 3d Moore A Raymond (Alice) loans h911 Napier av Moore A S h33 Arlington pi Moore Benj J (Bessie) h437 Carling av (H H) Moore Benj M (Emma) county health inspr h!41 Ly- MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS moore av Moore Benj M jr (Olga) slsmn rl41 Lymoore av Moore Berry A (Cath) hl56 Huguenin av Moore Calvin G (Dora) slsmn hl05 Kenmore pi (CP) Moore Chas (Kath) rl019 Edgewood av Moore Chas (Mary) porter h616 Spring Moore Chas A (Corinne) asst mgr Atlantic Life Ins Co h205 Powell (E M) Moore Chas B jr (Ruth; Moore & Boone) hl09 Clay- ton Moore Clara rl019 Edgewood av Moore Clara sten r806 Woolfolk Moore Clarence mill hd rl6 Bibb av Moore Cleveland (Louise) houseclnr hll5 New Moore Clyde K (Marie) carp h204 White Moore Columbus M (Mary) h534 Clinton (E M) Moore Cora C prin Antioch School Moore Cox B lab r455 Barracks al Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work o Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 668 (1925) R. L. POLK & CO.'S Moore C Marion jr student r534 Clinton A4 0M M *.<* !lw *s <*i ,-1 !I-*-<-<*. *:'*** Moore David E (Eupha) slsmn Matthews Jewelry Co r 701 Napier av (N H) Moore Dawson D cond h305 Linden av Moore Dinty (Tessie) r239 Washington av Moore Donald lab r480 (228) Bowman Moore Edith lndrs hllO Short la Moore Edw (Lorene) fishermn h502 Telfair The most comprehensive refer- Moore Edw shoe repr Remus Danforth r460 2d (E Ml Moore Effie T lndrs r480 (228) Bowman Moore Elfleta tchr rll5 Chestnut Moore Elie carp rll7 Williams ence work Moore Elijah F ship elk A S Hatcher Co r267 Hillyer on the av , banks of the world Moore Eliz r460 E 2d (E M) Moore Eliz lndrs h211 (111) Smith (E M) Moore Emma (wid Bostick) r330 Jackson Contains Moore Emma prsr Electric Dry Clng Co r228 Green Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of I State Banking Laws Moore Emory (Eupha) ins agt r701 Napier av Moore Enoch C (Marie) vulcanizer C B Holleman h 117 Williams Moore Ernest L (Irene) dist mgr Life & Casualty Ins Co h511 (507) E Napier av (H H) Moore Eulata student r305 Linden av Moore Evelyn student r685 Napier av Moore E H sis mgr rl41 Lymoore av Moore E Monroe mgr Ideal Laundry Co r77 Arlington and Much Other Data related to Banking Moore Fenton H lab rl53 Hilliard al Moore Florence smstrs h460 E 2d (E M) Moore Geo (Missouri) mill opr r2 Shell av Moore Geo (Rosa) plmbr hl48 Middle (V) Price $20 Moore Geo F (Willie) cond h333 Winship Published semi- annually Moore Georgia cook r45 Railroad av Moore Harry L (H L Moore & Co) r521 3d Moore Harvey (Rena) lab rl205 1st Moore Henry r224 Hill Crest av MARCH and SEPTEMBER Moore Henry C (Mary) slsmn Ga Furn Co h Brookdale av (Bellvue) by MOORE H L & CO (R W and H L Moore, E G Sherrill, J D Boone), Wholesale and Retail Grocers R. L POLK 521 3d, Phones 2837-2838 Moore Irvin (Exa) mill hd r24 Bibb av &C0. Polk DirectoryBldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 ELLIS MOTOR COMPANY LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Y% on Savmgs *r\ MACON CITY DIRECTORY (1925) 669 Mnore Jas C (Irene) gro 2357 2d hl71 Ells (S M) IMZooere J5aSs RJ l(aIbdar)50f9ire(m60n7)h8C0r6ispWooUolk Moore Jefferson M (Ruby) elk Wofford Oil Co hl743 Broadway Moore Jennie cook bl27 Railroad av Moore Joe L (Goldie) M415 Edgewood av Moore John (Effie) h480 (228) Bowman Moore John hl019 Edgewood av Moore John (Ella) lab hlOl Bowman Moore John H (Emily) h Forest av (Bellvue) Moore John T (Carrie W) h77 Arlinp,to^J)J Moore John T (Susie) elec eng rll4 Coleman av Moore Julia (wid Frank) r300 Ridge av Moore Julia lndrs rl60 College Moore J H pdlr h319 Vine Moore Leon r300 Ridge av Moore Levurg (Katie) lab h605 (205) Charles (S M) SOUTH'S lEABISe florists IDLE HOUR NURSERIES p m - Moore Lewis (Emma) lab h509 (607) Crisp Moore Lewis lab r201 Hazel Moore Lillie M dom h22 7th Moore Lloyd D (Mamie R) lawyer 714 Ga Casualty bldg hl92 English av Moore Lucille sten J P Allen & Co rl05 Kenmore pi (C P) MOORE LUKE W Dentist 20-21 Macon Savings Bank Bldg, Phone 1107, r Hines Ter cor Anola av, Phone 518 Moore L C mill wkr r29 Manchester qtrs ri Moore Maggie bkpr Dixie Cafe & Commissary rl56 Huguenin av (H H) Moore Marie r77 Arlington pi Moore Martha student r305 Linden av Moore Mary Mrs h219 Nottingham dr Moore Mary lndrs r496 Singletons la Moore Mattie mill hd r23 Lake City Moore Minnie (wid Robt) h227 Lawton av , Jfor lists of names 4NY TRADE ^ ANY BUSINESS r j-- ANY PROFESSION B DETROIT R. U. POLK & CO. CHICAGO Ed FOR. LISTS OF NAMES ANY TRADE - ANY BUSINESS - ANY PROFESSION DETROIT R. Is. POLK, Ss, CO. CHICAGO 670 (1925) R. L. POLK & CO.'S Moore Minnie elk r227 Lawton av Moore Oscar (Mary) lab h409 (311) Charles (S M) Moore Oscar (Ida) mill wkr h6 Manchester qtrs Moore Osie driver r213y2 Elliott (E M) Moore Owen O (Dora) carp r Log Cabin dr L I Moore O Laurence (Eva) r701 Forsyth Moore Pauline lndrs hl53 Hilliard al Moore Pennie tchr r460 E 2d (E M) Moore Philip lab r330 Barfield al Moore Ralph R asst tchr Mercer University Moore Robt (Jessie) lab hl45 Waterville rd Moore Robt jr rl45 Waterville rd Moore Robt A (Nell) chf elk County Sheriff h416 Forsyth Moore Robt L (Dollie) barber H L Jenkins r709 Main (E M) . Moore Rosa L cook rl45 Waterville rd Moore Roy janitor Bibb bldg hl60 College Moore Roy P (Lois) city firemn h570 1st MOORE ROY W (Nona S; HI Moore & Co), Attor- ney-at-Law, Solicitor City Court, 1011 Ga Casualty Bldg, Phone 3597, h327 Hill Crest av, Phone 3785 Moore Ruby C phone opr h778 Walnut Moore Sallie lndrs hlO Fulton al Moore Samantha (wid Owen) r Log Cabin Drive Moore Sami cook Union News Co 1 ! Moore Sanford A (Lizzie) cond h551 Arch Moore Sarah J (wid Freeling H) r210 Duncan av co Moore Simon (Lucile) dry gds 506 Poplar hll5 Inverness av Moore Sudie student r305 Linden av Moore Susie E Mrs office asst Board of Public Edu- cation rll4 Coleman av Moore S Eug (Lula B) cond hll7 Latta pi Moore Thos (Leila) carp h411 Short (E M) Moore Thos A (Hattie) mach Taylor Iron Works & Supply Co hl055 Ash UJ Moore Thos M (Ella) mill wkr h29 Manchester qtrs Moore Veva slsldy J P Allen & Co rl415 Edgewood av Moore Wm bus boy Union News Co Moore Wm (Josephine) lab h516 Fulton al Moore Wm (Ellen) lab h66 Harris al 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 6i Moore Wm (Emma) prsr rl58 (228) Green Moore Wm E (Mary) hll3 Culver Moore Wm J (Jane) flagmn rl414 2d Moore Willie (wid S C) student r608 Forsyth Moore & Boone (C B Moore jr, H C Boone) gros 646 Washington av , . 110_ Moorehead Victoria (wid Whittaker S) dairy rll2< Milledgeville (E M) Moorman A L (Essie) formn r330 Columbus Moorman Nannie (wid Everett) r622 Orange Moorman Ollie slsldy Burden Smith & Co r622 Orange Moran Agnes (wid Jas H) rl8, Nevaro flats Moran Daisy slsldy Union Dry Goods Co r218 Cole- man av Moran Emma lndrs h216 Short (E M) Moran Ida Mrs nurse r298 College Moran J B mech r Y M C A Moran Lena mgr Bibb News Co r720 Forsyth Moran Mattie Mrs r717 Cherry MACON OPTICAL Frank H. Johnson Opticians 468 CHERRY COMPANY Optometrists PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Moran Wm C (Kate) tuner Williams Guttenberger Music Co h224 Chestnut Moran Wyatt rll7 Bell av Morehorn Lavenia dom rl07 Pringle Morehorn Matilda lndrs rl04 Pringle Morel Lilia matron Julia Jones Benevolent Home h 512 Walnut Moreland Clarence lab Hub Fish & Oyster Co Moreland Edw (Mary) brkmn hl4 Bay Moreland Edw (Ethel) lab r214 Turpin Moreland Emma lndrs h524 Smith (E M) Moreland Marie rl30 Appleton av Moreland Mary nurse r28 Cheatham al Moreland Mattie cook L C Dodge r266 4th av V Moreland Melvin (Janie) gdnr h853 (855) 3d av (V) Moreland Paul R (Myrtle) r506 Walnut Morgan Beauty cook r24 Williams la Morgan Berry lab h437 Flanders (E M) Drink In Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TELEPHONES 786-1503 WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 (1925) R. L. POLK & CO.'S Morgan Cain (E Stella) switch tndr h211 Chestnut MORGAN CECIL (Nettie; Morgan & Morgan W ance Agency), Dep Clk U S District Court, hl88 Boulevard, Phone 3043 Morgan Chas C (Margt) dept mgr Kenmore Burns Inc hlO, 559 Orange Morgan Clara Indrs r321 McLean al Morgan Clarence (Ruth) slsmn h527 College Morgan Cottage 1311 (311) Edgewood av Morgan Danl C (Ina) slsmn hl98 Crescent av Morgan Della (wid Dock) r82 Wilder Morgan Dessie slsldy Barker Bakery r667 2d Morgan Edith rl98 Crescent av Morgan Edmund R teller Macon Natl Bank r669 1st Morgan Edw (Maude) porter h3 Harris al Morgan Ella dom r82 (80) Wilder (S M) Morgan Estelle rl21 Tatnall Morgan Flemon E D (Cora) agt Metropolitan Ins Co hll8 Clayton Morgan Georgia (wid John H) r717 Maine (E M) Morgan Grant (Mattie) lab h818 (418) Williams Morgan Guy P (Marion) mgr Askins res Ingleside av Morgan Hall 1444i/2 Broadway Morgan Hattie Indrs h310 Coles al Morgan Hazel sten rl06 Piedmont av Morgan Henry G (Bertha) hl016 Hazel Morgan Hobson H rl26 Lawton av 7i Morgan Hugh D (Susie) h425 (457) Edgewood av Morgan Hughie rl016 Hazel 3 Morgan Jas lab r215 Bright al MORGAN JAMES E (Maude E; Morgan & Morgan Insurance Agency), h ns Forsyth rd 4 w of Riverside dr, Phone 823-J Morgan Jas O (Lillian) stage mgr r428 Main (E M). Morgan Jas W (Rose) bkpr Willingham & Payne h 507 Napier av Morgan Jessie opr The Wm Carter Co res RFD 2 Morgan John (Osa B) lab h614 Chapman al Morgan John B (Mary E) city firemn hl06 Piedmont av Morgan Jos tailor Fit Right Tailors rll9 Tatnall Morgan J Porter (Helen) gro 2835 Houston av h do Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy K. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 673 Morgan Kenimer H student rll8 Clayton Morgan Leola lndrs h202 Edgewood ay Morgan Lucile rl05 Forest av (Y) Morgan Lucy opr r456 Womack Morgan Mamie (wid Moses M) rlOO Fulton Morgan Mary E (wid R Jake) h507 Napier av Morgan Naomi slsldy Reliable Outfitters r24 Nevaro apts Morgan Nellie lndrs r96 Shamrock Morgan Olin N (Florine) formn E B Smith Lbr Co h721 Pine Morgan Paul slsmn Adams Buchanan Motor Co r742 College i Morgan Porter J (Helen) gro 2107 2d h2831 Houston av Morgan Raymond rl235 2d Morgan Robt S (Margt) cond h225 Adams Morgan Ross E (Fannie) gro and meats 347 S Col- lege h 1st av Morgan Sidney shoe repr 1624 Broadway h do Morgan Thos (Ethel) pres Thos Morgan Inc hl23 Nottingham dr Morgan Thos Inc Thomas Morgan pres produce 661 Poplar Morgan Thos H (Laura B) mgr Monroe Calculating Mach Co rl73 Virginia av Morgan Wayland B (Minnie) insp hl06 Rogers av Morgan Wm (Hattie) lab r852 Broadway MORGAN WM T (Margaret), Pres Merchants & Mechanics Savings Bank, h669 1st MORGAN & MORGAN INSURANCE AGENCY (Cecil and James E Morgan), General Insurance 606 Georgia Casualty Bldg, Phone 4147 (See left bottom lines and page 71) Morland Velenor lndrs rll53 (1100) Woolfolk Morman David presiding elder r75 New Mormon John (Leonard) lab h92 Bay Morrell Edmond (Virginia) lab h235 Division Morrill Florence r234 American blvd Morrill Mamie r234 American blvd Morris Aaron B (Agnes) mach Taylor Iron Works & Supply Co r520 (552) Oglethorpe Morris Adam auto mech r227 Hendrix la for lists of names any tTrRaAdneF "-S,_-- ANY BUSINESS -- ANY PROFESSIO. DETROIT L- POLK & CO. chicagi Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DMlffl as a mm PLACE THE DIRECTORY IS THE GREATEST MARKET PEACE i THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year RLPoikaCo PUBLISHERS PoUtDirectoKjl DETROIT MICH' 674 (1925) R. L. POLK & CO.'S Morris Adele asst chief rec G U O W M of E rl36 Sycamore Morris Alberta nurse h202 Pear (E M) Morris Alex (Lucile) cook r231 4th av (V) Morris Angie cook Mrs Humphries rl040 Clinton rd Morris Arth T collr Dallas Investment Co rl31 Beech av Morris Beauty M maid r rear 1232 3d Morris Bessie (wid.Jos) h461 Oak Morris Callie (Julia) lab hl45 Chestney Morris Carl janitor Federal bldg r773 Moores la Morris Carl lab h252 Park Hotel al Morris Carolyn (wid Geo) slsldy r448 New Morris Carrie A sten r321 Orange Morris Cary M r453 Hazel Morris Cassie piano player Douglass Theatre r Doug- lass Hotel Morris Chas (Annie M) lab h223 (213) Mutual av Morris Chas trav slsmn r419 New Morris Chas A (Alice L; Morris Stone Co) hll4 Oak Haven av Morris Chas T r425 Telfair Morris Claude L mgr Union News Co r Terminal Hotel Morris Clinton mgr Morris-Flinn Co rl070 Walnut Morris C E collr r555 2d Morris C L Mrs slsldy LFM Store r448 New Morris Dock (Maude) lab h434 O'Hara la Morris Edw car oiler h501 E 1st (E M) Morris Ella (wid Pomppie) h445 Alabama Morris Ella (wid Carey S) r573 Orange Morris Essie M cook r360 Oak Morris Eug (Leila) lab h349 Hammond Morris Fannie L (wid John W) r464 Orange Morris-Flinn Co Clinton Morris mgr chemists 569 Cherry Morris Geo (Willie) lab h657 Elm al Morris Geo (Itie) lab h9 Plant al Morris Geo W (Esther) gro 2657 2d h2552 Broadway Morris Harold elk Morris-Flinn Co rl070 Walnut Morris Hattie r501 E 1st (E M) Morris Hattie slsldy Isaac Morris r812 Cherry Morris Helen Mrs rl21 Broadway Morris Hubert (Aggie) lab hl36 Sycamore A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 y2 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 675 Morris Hugh E sten Massee-Felton Lbr Co r718 Mulberry MORRIS HUGH L, Teacher Bookkeeping Dept Southern Business College, rlOl Cotton av Morris Ida cook rll5 Middle (E M) Morris Ida M Indrs h309 (1021) Wood al Morris Isaac dry goods 458 Mulberry h812 Cherry Morris Jas (Leila) brklyr hl30 Clark la Morris Jas (Mattie) lab h480 (226) Bowman Morris John (Hattie) lab hl06 Cowan Morris John lab rll5 Middle (E M) Morris John (Edna) lab h412 Monroe Morris John C Imbr r Southland Hotel Morris John W mach r464 Orange Morris Jos G (Max Morris Sch of Pharmacy) rl5 Nevaro flats Morris Julia Indrs r3 Davis al Morris J Fenton inspr Macon Ry & Light Co r804 Orange Royal Corona Typewriters SCOH-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Morris Lillian Mrs slsldy Dannenberg Co rll28 University pi Morris Mabel maid r32 Woodliff Morris Mable Indrs r278 Madison Morris Maggie Indrs hll4 New Morris Maria r321 Middle (V) Morris Marvin L (Marguerite) trav slsmn h464 Orange Morris Mary r416 Bay Morris Mary cook r817 3d Morris Mary E rll4 Oak Haven av Morris Mattie dom r608 Division Morris Mattie Indrs hl22 Plummers al Morris Max School of Pharmacy (Jos G Morris) 517^ 3d Morris Nancy Indrs r8 Short (EM) Morris Nathaniel (Melita) h755 Ash Morris Odestus (Mattie) sawmill h Lawton rd K" I HAYS I PYLE I LSJTTl J. kJ I rant CREDI1 406 THIRD ST. TEL. 3026 > Q .S< 2 |Z CaP ol| M bi8 CSfl i5r* S s *- 3p [s18 XI s28 oz zo sId H CO H ^ t/3 o tHuo *S , Myers Farmer H (Pearl) r766 Poplar Myers Geo hl98 Long Myers Gertrude maid rl45 Middle (V) Myers Homer H (Ocie; Bibb Printing Co) h205 Rogers av Myers Janie lndrs r98 Shamrock Myers John H h208 Delaware av Myers J Henry (Addie) lab h226 2d av (V) Your City Directory An.? ^rs Ail Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work R. L POLK & Company CABINET MANTELS, TILE, GRATES, ETC S i--i a.' -ft Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 NgW g bp X U Ctf a u (d CU (O a S* cd 684 (1925) R. L. POLK & CO.'S Myers Laura libr Christian Science Reading Room r 104 Hill Crest av Myers Leon student r205 Rogers av Myers Lila Mrs rll2 Boulevard (N H) Myers Lucile manicure Dempsey Barber Shop rl67 3d Myers Luke (Salina) h731 Edgewood Myers Mary Indrs hl45 Middle (V) Myers Mary student r205 Rogers av Myers Minnie (wid W Thos) hl29 Highland av Myers Paul student r216 Reid Myers Rosetta hll9 Franklin Myers Walter caller Sou Ry r216 Reid Myers Willard r216 Reid Myers Wm G (Linda) mach Willingham Sash & Door Co hll5 Cole Myles Carrie maid Mount de Sales Academy h435 For- est av (V) Myrick Henry O asst mgr Texas Filling Station r250 Hydrolia Myrick Julia maid r410 Virgins la Myrick Margt smstrs h523 E Academy (E M) Myrick Roscoe W elk Oscar Bradley rl728 3d Myrick Susie tchr r4 College Hill apts Myricks Wm lab r304 Ellis av Nail Edith millwkr rl63-164 Thomason Nail Lois H (Maggie) mech Coleman Motor Co hl63- 164 Thomason Nail Mildred millwkr rl63-164 Thomason Nalls Etheldra student rl37 Pine av (V) Nalls Frank R (Etheldra) solr N W Mut Life Ins Co hl37 Pierce av (V) Nalls Frank R jr slsmn rl37 Pierce av (V) Nalls Thos W elk Standard Oil Co rl37 Pierce av (V) Nancy Mills Hosp 31 S College Napier Apartments 1924 2d Napier Bessie R tchr hll9 Buckingham pi Napier Bldg 502% Poplar Napier Celine r271 College Napier E Tris real est 421 2d rl29 Jefferson Napier Elena Indrs h225 Lee Napier Eugenia r271 College Napier Fannie Mrs millwkr h38 Manchester qtrs Napier Geo (Mary) lab r461 Douglas av H FOR LISTS OF NAMES ? ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. `FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4 Vs}% on Savings MACON CITY DIRECTORY (1925) 685 Napier Hamilton student r271 College Napier Henry (Carrie) lab hl52 Duval (E M) Napier Jack lab h409 Bowman Napier Jos C (Celine) office 306 Grand bldg h271 College Napier Marion r328 Hill Crest av Napier Viola R (wid Hendley V) lawyer 314 Ga Cas- ualty bldg h328 Hill Crest av Napierian Apartments 301-309 Napier av Narred Lena Mrs rl235 2d Nash Clara M nurse rl005 Ocmulgee Nash Cliff (Daisy) lab r201 Kitchens Nash Cora dom r208 Turpin Nash Doc (Hattie) carp rl35 Adams Nash Dora (wid Monroe) lndrs h419 Elbert Nash John W (Lee) eng h371 Spring Nash Lee (Carrie) lab hll2 Moore av Nash Lee (Nettie) carp hll3 Collins la Nash Lucile r371 Spring Nash Meat Market (T M Nash) 84 Spring and 460 2d NASH MOTOR CARS, W R Finch Motor Co Distributors 658 3d, Phone 4354 Nash Mose (Lila) lab rll4 5th Nash Sausage Co (T M Nash) 222 Cotton av 1999 2d 601 (817) Vineville Nash Selia r428 Madison Nash Thos M (Elva; Nash Meat Mkt; Nash Sausage Co) h R F D 3 Nash Wm (Kath) lab h214 Elliott (E M) Nash Willie M r214 Elliott (E M) Nashville Chattanooga & St Louis Ry E H Forbes gen) agt 209 Bibb bldg Nasworthy Jas H (Bertha) pntr h409 Main (E M) National Accident & Health Insurance Co Mann Bros agents 813 Ga Casualty bldg National Benefit Life Insurance Co The A W Wright agt in charge Colored Pythian Temple National Biscuit Co R E Van Buren mgr 202 5th National Cash Register Co W L Fitts sales agent 365 Broadway National Drug Store D N MacLemore prop 411-13 2d National Highway Pharmacy H W Wood prop For- syth rd (V) Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. POLK'S dental WRbCetbag>naisdstaateters ^"TiWJHWIITtRCIODNNTYHEAR ,1SJ9JU2J A5CO. [RECIOUS Petals s POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 6SG (1925) R. L. POLK & CO.'S NATIONAL LIFE & ACCIDENT INSURANCE CO OF NASHVILLE, TENN, S L Farrar Manager, 414. 15 Citizens & Southern Bank Bldg, Phone 4060 National Milling Co Aleck Bloch pres Mrs W G Robarts sec 5th nw cor Ocmulgee Naylor Robt (Minnie) mech h240 4th av (V) Neal Anna slsldy r802 Cherry Neal Annie M cook h768 Ocmulgee Neal Eva smstrs r306 Ward (V) Neal Georgia Indrs h306 Hazel Neal Inez slsldy h802 Cherry Neal Julia Indrs h441 Forest av (V) Neal J Ruby Indrs r441 Forest av (V) Neal Mattie maid h295 2d av (V) Neal Manion lab r306 Hazel NEAL ROY I (Lula), Adv Mgr Macon Daily Tele- graph, h319 Vineville av, Phone 1132 Nease Jos R bkpr r Y M C A Nedd Wm F porter rl63 Coles al Neel Annie dept mgr Union Dry Goods Co r802 Cherry Neel Bert L (Eva) pntr rl48 Adams Neel Geo R (Emma) porter h427 North Neel Inez slsldy Union Dry Goods Co r802 Cherry NEEL JOSEPH N (Blanche), Pres Jos N Neel Co, V- Pres Fourth Natl Bank, li624 College, Phone 1206 NEEL JOS N CO, Joseph N Neel Pres, Walter F Houser V-Pres, Sidney S Griswold Sec and Treas, Stein-BIoch Clothing, Knox Hats, Manhattan Shirts and Clapp Shoes 520 Cherry, Phone 427! (See right top lines and page 59) Neel M Blanche r624 College Neel Odom S opr r622 Main (E M) NEEL ROLAND H (Evelyn), Director Jos N Neel Co, 525 Ridge av, Phone 4463-J Neel Senie J (wid Danl O) h622 Main (E M) Neel Wm R carp r622 Main (E M) Neely Bessie Indrs h223 Shamrock Neely Jesse (Pearl) ice ctr rll5 Kitchens Neely Jos (Emma) lab h501 Johnsons al NEIGHBORS JOE B (Jeanne), Claim Agt C of Ga, h 302 Hines ter, Phone 3005 Nelious Christine maid h9 (6) Spring la Nelm Alonzo shoemkr r460 Mulberry Nelms Carl W electn r206 Peachtree E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 ' M, AUTHORIZED Lincoln Fordsorvif ^ a,prd have iti PHONE 1591 JONES MOTOR COMPANY 557-559 plum st. MACON CITY DIRECTORY (1925) 687 Nelms Claud (Sally) plmbr h206 Peachtree Nelms Claude L ship elk Swift & Co h (E M) Nelms Hattie J (wid Wm S) h401 (308) Applewood Nelms Hope B electn r401 (308) Applewood Nelms Jas lab Central Ga Baking Co Nelms Lonnie G shoe repr Peter Andros r412 Mul- berry Nelms Troy (Lula) lab hl53 Madison Nelms Wm H (Vidah) lab r206 Peachtree Nelson Alex (Jane) shoemkr 15 Clayton h 13 do Nelson Andrew (Janie) shoe repr r210 Roosevelt (V) Nelson Annabell cook r rear 3 Waterville rd Nelson Annie r31 Orchard av Nelson Austin (Emmily) lamp lighter h rear 3 Water- ville rd Nelson Chas C r rear 3 Waterville rd Nelson Chas S (Dora) millwkr h26 Manchester qtrs Nelson Cleveland (Sadie) lab rl21 Middle (V) Nelson Cora lndrs b.208 W Boundary Nelson Daisy millwkr r31 Manchester qtrs Nelson Daisy M (wid Emory L) r321 Pio Nono av Nelson Douglas (Janie Lee) lab hl5 Ford al Nelson Edna R (wid Hyman) hl25 Rose Park Nelson Eldosia lab r rear 3 Waterville rd Nelson Eliza r406 Thompson Nelson Eliz cook h31 Orchard av Nelson Eug chauf r993 (16) Cowan Nelson Eug J (Margt) h3 Barnes apts Nelson Francis Anna emp W U Tel Co rl25 Rose Park Nelson Frank (Fannie) baker h455 Monroe Nelson Geo S (Gertrude) elk Fourth Natl Bank r477 Duncan av Nelson Gertrude S Mrs sten W S Dickey Clay Mfg Co r477 Duncan av Nelson Gussie r31 Orchard av Nelson G Eug porter R S Thorpe & Sons rl55 4th av (V) Nelson Henry L chauf rl55 4th av (V) Nelson Henry L lab r rear 3 Waterville rd Nelson Horace (Beulah) mill hd h242 Roff Home av Nelson Idela (nurse) r rear 3 Waterville rd Nelson Jas (Lizzie) carp h307 Peachtree Nelson Jas driver r237 Chestnut Nelson Jas (Anna) minister h76 Spring More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 688 (1925) R. L. POLK & CO.'S Nelson John (Stella) lab h259 White al Nelson John (Marie) truck driver rll Ross pi Nelson John H (Chainey) lab h270 Singletons la Nelson John H (Lizzie) lab h3 Sparks al Nelson John L porter rl55 4th av (V) Nelson Lee A lab r3 Sparks al Nelson Lizzie cook h513 Academy (E M) Nelson Lizzie millwkr r26 Manchester qtrs Nelson Lizzie nurse r rear 3 Waterville rd Nelson Lola cook r rear 3 Waterville rd Nelson Lonnie (Rowens) hl019 Oglethorpe Nelson Loubertha rl43 E 2d (E M) Nelson Mary dom h370 Maple Nelson Mary F lndrs r3 Sparks al Nelson Mary L lndrs rl55.4th av (V) Nelson Mila lndrs r511 Maynard Nelson Minnie cook rl43 E 2d (E M) Nelson Minnie nurse r406 Thompsons al Nelson Nora r31 Orchard av Nelson Peter J (Kath) lawyer 3 Washington bldg r 870 2d Nelson Reba opr The Wm Carter Co Nelson Rebeca cook r244 Thompsons al Nelson Robt H freight storer hl43 E 2d (E M) Nelson Roscoe lab r rear 3 Waterville rd Nelson Sarah dom h458 Hawthorne Nelson Stacy lab r rear 3 Waterville rd Nelson Thos (Dora) lab h215 Jefferson Nelson Thos lab r244 Thompsons al Nelson Walter B (Annie) porter Johnson Bros r7 Ful- ton al Nelson Wm (Bertha) carp h.993 (16) Cowan Nelson Wm lab r406 (106). Lexington av Nelson Wm (Eva) lab hlOO Phillips Nelson Wm lab h31 Orchard av Nelson Wm jr lab r31 Orchard av Nems Otis (Sweetie) lab h850 Singleton la Nesbit Robt porter Roughton Halliburton Co rl21 (115) Green Nesbit Sami R (Anna) porter Roughton Halliburton Co hl21 (115) Green Nesbit Sami R student rl21 (115) Green Nesbit Sarah cook Middle Ga Sanatorium hl45 (151) Lincoln av (Y) Automobile owners are select prospects tor mtearsnyfokrinadllskoifndmseorcfhAanudtoismeo. biSleenLdisttos.HeOaudrqunaewrCcoaptayl.og: coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfoHr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 689 Nesbit Wm (Nellie) lab h2 Fulton al NeSmith Myrtle slsldy McCommon Bros r231 Wash- ington av Nettles H Earl (Stella) mach h721 Plum Nettles Jas F jr (Mary V) mgr Travers Clothes Stores Corp h2929 Houston av Neuberger Pauline rl93 Eliabeth pi (V) Neundorfer John B (Clem) formn W S Dickey Clay Mfg Co h614 Main (E M) Nevaro Apartments Co L S Dure pres W H Becks v- pres 610 Mulberry Nevaro Flats 533-47 Orange Nevill Ashley (Alice) lab h322 Elizabeth New England Mutual Life Insurance Co 0 P Beall genl agt 801-3 Ga Casualty bldg New Hope Baptist Church 217 3d av (V) New York Cafe (Peter J Pappas, John Andros) 314 2d New York Hat Cleaning Co (Wm Lamis prop) 563 Cherry Newborn Paul (Willie May) flagmn r516 Elm NEW YORK LIFE INSURANCE CO, R A Heinsohn Agency Organizer 209 Ga Casualty Bldg, Phone 3167 New York Waist House Thelma Harrell mgr 420 3d New Zion Baptist Church 305 Edgewood av Newark Shoe Co T J Sessions mgr 356 2d Newberg Methodist Episcopal Church Rev Monroe Spivey pastor 170 Henry (S M) Newberg School Mamie Holt prin 3047 Houston av Newbern Lloyd (Ruth) bicycles 512 2d hl30 Ponce de Leon av Newberry Alma rl32 Oakland av Newberry Columbus M (Docie) city firemn hl32 Oakland av Newberry David B (Jennie) mill hd hll Dannenberg av Newberry Edw F (Sallie) collr Jones Motor Co hl921 2d Newberry Eliz mill hd h36 Taylor av Newberry John (Samantha) millwkr hl2 Dannen- berg av Newberry Mary rl32 Oakland av Newberry Monroe M (Annie) lumbrmn h619 Pine FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable 2 P fERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT ODR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656i/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 6.91 Newsom Emma (wid Harvey) cook hl91 Hawkins av Newsom Henry dom rll8 Rock Hill la Newsom John P electn r230 Jones av Newsom Lora dom r22 Wall Newsom Mattie L candymkr r359y2 Flanders (E M) Newsom Minnie Mrs h3591/2 Flanders (E M) Newsom Richd (Alice) lab h357 (10) 7th Newsom Roht G cahtmkr Macon Lumber & Mfg Co r458 Ocmulgee Newsom Rose dipper Empire Candy Co r359)/2 Flan- ders (E M) Newsom Wm F (Ellabert) custodian Cit & Sou Bank h230 Jones av Newsom Willie M sten r230 Jones av Newsome Annie (wid Elrod) h Columbus rd Newsome Edw pdlr r326 Maple Newsome Edw (Arrie) roofer h708 Hawthorne Newsome Jos S (Lillie) elk C H Little r207 Thomas Newsome Lucy (wid Jeffersom) h Melrose Newsome Sami T (Lillie) lab h207 Thomas Newsome Sirena dom hl205 1st Newton Alice O (wid Willoughby) r662 College Newton Alice W student r662 College Newton Arth F (Sarah; C E Newton & Bro) h754l 1st Newton Arth R (Victoria) h400 Forsyth Newton Beatrice (wid Isadore) cook h202 Green Newton Carrie M (Mell J) h26 Progress Newton Chas E (Lizzie; C E Newton & Bro) h51 Arlington pi Newton Chas E jr elk 4th Natl Bank r401 College Newton C E & Bro (C E & A F Newton) produce 353 Pine Newton Frank (Mattie) firemn hl604 1st Newton J J barber rl21 Middle (V) Newton Lucious (Penkie) pdlr h211 Hawkins av Newton Mary maid rl09 Empire av Newton Percy W (Bertha) car inspr h2606 2d Newton Ralph G (Irma) phys 805-7 Ga Casualty bldg r301 Hardeman av Newton Savannah dom h45 Massee la Neyland Oscar (Kathrine) aud r346 Hardeman av Nicholas Alex (Nicholas & Nicholas) r453 Oak Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 692 (1925) R. L. POLK & CO.'S Nicholas Jas sec-treas Melts Sanitary Baking Co r412 Montpelier av Nicholas Peter (Xrisontimus; Nicholas & Nicholas) h 453 Oak Nicholas & Nicholas (Peter and Alex Nicholas) fruits 325 Cherry Nichols Allen (Mattie) lab h307 Tindall av Nichols David millwkr r22 Manchester qtrs Nichols Gladys opr The Wm Carter Co rl411 Edge- wood av Nichols Harry A (Nell) sawyer r668 Walnut Nichols Jas driver r224 Tindall av Nichols John W (Mattie) millwright r90 Thomas Nicholson Croel J (Emmie E) elk Gulf Refining Co h745 College Nickerson Albert del rllO 4th av (V) Nighton Eug (Jimmie L) lab r223 E 2d (E M) Nighton Thos (Matilda) lab h231 E 2d (E M) Nims Hayes (Euzel) lab hl74 (307) Lincoln av (V) Nims Otis (Ruby) lab h213 (174) Lincoln av (V) Nipper Andrew C (Virginia) carp hl407 2d Nipper Bessie (wid Jas S) r314 Cutters Green Nipper Charlie A (Lucille) pharm Mitchell Williams & Mack hl505 2d Nipper Evelyn sten r314 Cutters Green Nipper Robt K mach r653 Elm Nipper Sami C (Parchee) mach r653 Elm Nipper Sami C jr (Ruth) gro 653 Elm h do Nipper W Uster (Bessie) mach h695 Anderson Nipper Wm P Rev (Clara) pastor Corinth Primitive Baptist Ch hll9 Ninadell av Nirenstein Bessie sten rl024 2d Nirenstein Geo L bkpr T & T Sausage Co rl024 2d Nirenstein Leon carrier P O rl024 2d Nirenstein Lillian bkpr Day's rl024 2d Nirenstein Mayer (Sarah) hl024 2d Nisbet J Wingfield (Sarah T) h221 Bond Nix Chas (Clara) millwkr h720 Campbell av Nix Edgar C (Emma) mach h2330 2d Nix Jenny K h70 Arlington pi Nix Mae (wid Lonnie) r Minnie Freeman Nixon Alto lab r48 Massee la Nixon Azalee (wid John A) r807 Cherry Nixon Bertha drsmkr r!66 Virginia av FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 693 Nixon Boisy (Henrietta) ice ctr h393 Madison Nixon Clifford (Pearlie) lab h247 Railroad ay Nixon Danl (Sarah) blksmith J W Gunn hll6 2d av (V) Nixon Donnell r923 Ocmulgee Nixon Gena Mrs toll supvr Sou Bell Tel Co h816 Cherry Nixon Horace C (Gena) barber Sanitary Barber Shop No 2 h805 Cherry Nixon John (Minnie) lab h48 Massee la Nixon John (Effie) supply cor h923 Ocmulgee Nixon J Walter (Mary) pntr h278 Ells (S M) Nixon Martha r393 Madison Nixon Mazie forldy r240 Orange Nixon Pinkie cook h541 E (E M) Noble Brownie tire changer r456 Clinton (E M) Noble Harriett (wid John J) r4 Maynard apts Noble Jas (Mary J) blksmith 318 Wall h261 Cowan Noble Luther lab r3 (2) Spring la p p H O OPZHI 02Q CO 55" 1r ~ o T] n YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Noble Robt lab r2 Spring la Nobles Cora (wid David P) hl024 Napier av Nobles Emma L knitter rll06 Oglethorpe Nobles Herbert mech rl024 Napier av Nobles Martha slsldy S H Kress & Co rl35 Park pi Nobles Mary elk McLellan Stores Co rl35 Park pi Nobles Mildred dipper Empire Candy Co rl024 Napier av Nobles Wm emp rl024 Napier av Nobles Wm (Leila) lab h405 Chestnut Nolan Alvin E (Calna) prop Reeves House h217 Broadway Nolan Jas firemn r47 Holt av Nolan Mark A (Leila; Nolan & Herrington) gro ss Forsyth rd 4 w Riley av h ss Forsyth rd (V) 3 w Riley av Nolan Quinces R (Ruth) plant eng h221 Buford pi (V) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit m*po0i r > r >3OPm3I H 1 3 H O at . m SaT ^o> n Z MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 694 (1925) R. L. POLK & CO.'S Nolan Roy elk M A Nolan r M A Nolan Nolan & Herrington (Mark Nolan, Herbert C Her- rington) filling station cor Forsyth rd and Riley av 1 Noles Jas W (Etta) eng hl09 9th av Nolley Janie smstrs r821 3d av (V) Noltee Mattie (wid Calvin K) smstrs h514 Jackson Noltee Miles H (Bessie) mech h300 Cherry av Nodes Mertie M mill hd h.29 Bibb av Noonan Minor B (Kattie) house supt Dempsey Hotel h501 Bailey av Norman Bertha r5 Ellis av Norman Clara r290 Winship Norman Jas E shipping h290 Winship Norman Jos (Thelma) carp r479 Chestnut Norman Maggie dom rill New Norman Mary (wid Robt) rll3 Nottingham dr Norman Rebecca lndrs h222 Woodliff Norman Ruby student r290 Winshop Norman S Webb (Annie L) mach r654 2d Norman Thos W (Nell) trav slsmn r239 College Normand Etta M r368 Bay Normand Whit (Mandy) lab r318 Hammond Norred Wallace P (Lalar) linemn r570 1st Norrell Addie sten Hall Grice & Bloch rl05 1st Norrell Alvin W (Cleo) trav slsmn r766 Cherry Norris Dora (wid J L) rl05 1st Norris Austin R (Betty) tol wire chief h.407 Hines ter (V) Norris Carl R parts mgr Yates Motor Co r Y M C A Norris Chas B (Sallie) pipeftr h Forest Hill av Norris Claude L elk r253 Broadway Norris Daisy nurse rll4 Virgin Norris David farmer r268 (660) Hall Norris Edith student r407 Hines ter (V) Norris Frank E (Vada) mach h.967 Walnut Norris Jos mach r3, 474 Orange Norris Lawrence V elk MD&SRR Co r865 Orange Norris Lewis (Amanda) lab hll4 Virgin Norris Lula (wid John F) h339 Ross Norris Mary (wid Franklin) r347 Hydrola Norris Mary L cook r303 Elbert Norris Nancy dom r900 Fort Hill (E M) Norris Nellie pkr Empire Candy Co r339 Ross More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 65 Norris Robt O (Martha) slsmn Union Dry Goods Co h 301 Woolfolk Norris Wm M (Nevada) agt Metropolitan Ins Co hll6 Corbin av North Carolina Mutual Life Insurance Co T R Epps manager 556 New North Carolina Pine Assn Inc R H Morris mgr 721 Citizens & Sou Bank bldg North Highland Grocery (Arth Stamm) 107 North av (N H) North Side Filling Station Guy C Cheatham prop 991 North av (N H) NORTHERN INSURANCE CO, John E Wilson Agt, 207 Citizens & Sou Bank Bldg, Phone 214 Northern Joanna h211 (435) Pio Nono av Northern Sami (Leila) lab h497 (101) Womack Northington Harry F (Allie B; Harry The Tailor) h908 Napier av Northington Henrietta (wid Jas F) rll7 Garden Northington Nettie (wid T M) r908 Napier av Northrop Adelle bkpr rll06 Walnut Northrop Odie rll06 Walnut Northrop Wm J rll06 Walnut NORTHWESTERN MUTUAL LIFE INSURANCE CO, J Clay Murphey Genl Agent 470 Cherry Norton Adrian student rill Nottingham dr (N H) Norton Cleveland (Florence) blrmkr h655 Clinton (E M) Norton Clover E (wid Frank) hill Nottingham dr (N H) Norton Fredk firemn r352 Clinton (EM) Norton Looney carp r655 Clinton (E M) Norton Wade (Emma) blrmkr r655 Clinton (E M) Norton Wm B city firemn rl242 College Norwood Annie cook P W Jones res Franklinton Ga Norwood Annie lndrs r800 Maynard Norwood Dilscy lndrs h50 (1) Cemetery la Norwood Emma lndrs r451 Mitchell la Norwood Ernest trucker h722 Hawthorne Norwood Fred (Annie) lab hlOO Thomas Norwood Geo M (Dora W) pres-treas M D & S R R Co hl24 Lawton av Norwood J Ernest (Ossie; Norwood & Mobley) rl921 The most comprehensive reference work on the hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of AH Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK n Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit 696 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Norwood Liza cook 500 Edgewood av r460 Alabama Norwood Loretto H rl24 Lawton av Norwood Mollie Indrs r722 Hawthorne Norwood Sami (Eula) lab hll7 Ritchey al Norwood Wm (Ceuphine) r252 Franklin Norwood & Mobley (Ernest Norwood, Ewell Mobley) restaurant 462 Cherry Nottage Danl A (Edna) blrmkr hl726 3d Nottingham Custis (Rosa) lawyer h Sunset dr (S H) Nottingham Dora S r446 Spring Nottingham Edw (Gladys) chauf hl21 Rock Hill la Nottingham Geo M (Zeca; Nottingham & Notting- ham) h384 Suwanee av Nottingham Harry E (Jennie ; Nottingham & Not- tingham) h211 Ridge av Nottingham Ida C (wid Robt V) h432 Carling ay (H H) Nottingham John J collr Collins r415 Vineville av Nottingham Martha sten r Sunset dr (S H) Nottingham Rose r C Nottingham Sunset dr (S H) Nottingham Warren D jr investments 1 Macon Sav Bank bldg h446 Spring NOTTINGHAM & NOTTINGHAM (George M and Harry E Nottingham), Attorneys-at-Law 312-13 Citizens & Sou Bank Bldg, Phone 1147 Nowell Avie mill hd r234 Roff Home av Nowell E T r220 1st Nowell Frank W r2 Glynn av Nowell John (Mary) dairymn h422 Log Cabin dr Nowell Jos J (Mary) dairymn r422 New Columbus rd Nowell Lillie Mrs millwkr r34 Manchester qtrs Nowell L Edgar (Nonie) elk h440 New Nowell Mattie E (wid Wm) h2 Glynn av Nowell Myrtie smstrs r422 New Columbus rd Nowell Richd hlpr Dixie Dental Laboratory r Lanier Pi Nowell Sidney G asst pressmn Macon Telegraph r2 Glynn av Nowell Sussie student r422 New Columbus rd Noyes Alice D rllO Rogers av Noyes Wm J (Evelyn) tchr hllO Rogers av Noyes Wilson W (Susie) acct Standard Brick & Tile Co h!33 Hines ter (V) Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES J 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 697 Nunn D Shelton (Addie) bkpr Dunlap Hdwe Co h.319 Beech av Nurses Home 569 Walnut NUSSBAUM ROBERT N (Bertha), V-Pres The Dan- nenberg Co, h3 Cherrydale apts Nu-Style Delicatessen (C N Kitchens) 668 Cherry \ Nutting Annie M elk Peeler Hardware Co r 401 Napier av Nutting Chas M (Leila) sergt police dept h401 Napier av NUTTING FLORAL CO, G G Nutting Prop, Flowers for All Occasions 414 2d, Phone 1776, Night Phone 3654-J Nutting Geo G (Crysal S; Nutting Floral Co) hll9 Crescent av Nutting Jennie tchr r401 Napier av Nutting John B (Ruth L) asst mgr Nutting Floral Co h222 Log Cabin dr E PjlfT Trucks and Auto Repairing if 1 fllSiii Authorized for White Motor Trucks 657-659 THIRD ST. PHONE 4846 Nutting Mattie N (Womans Exchange) rl05 Park pi Nutting Sarah K (wid L Wm) h468 Walnut Nutting Sidney (Harriette) slsmn r468 Walnut Nye Odorless Crematory Co A C Felton pres-genl mgr R A Johnson asst sec-treas 601 Ga Casualty bldg Oak Ridge Cemetery Northwestern part of city Oates Ella lndrs hlOl Mulberry Oates Mary (wid Jas) h415 Oak O'Cain Walter (Mattie) police r621 Duncan av Ocmulgee A M E Church 25 (525) Clayton Ocmulgee Park Corbin av end Ocmulgee car line O'Connell Danl (Princess) agt The Texas Co h3 Jor- dan apts O'Connell K Marie h858 Cherry O'Connell Margt T r858 Cherry O'Connor Chas M (Anne) acct h Forest Hill av O'Connor Sami B (Sallie) cond hl927 2d O'Daniel Chas W (Kath) linotype opr h414 Duncan QT7 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable Cn M H DETROIT R. L. POLK & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet R. L POLK & Company BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 69S (1925) R. L. POLK & CO.'S O'Daniel Chas W jr elk L W Rogers Gro Co r414 Duncan av O'Daniel Kathrine student r414 Duncan av O'Daniel Pearl M (wid Mark H) rl29 Jefferson Odd Fellows Building (col'd) 411% Cotton av Odd Fellows Halls 515 2d and 509 Mulberry Odell A B (Ruby) florist Idle Hour Nurseries res Rivoli Ga Odom Alonzo U (Laura) cook h519 Calhoun Odom Alonzo U jr porter Macon Barber Supply Co r 519 Calhoun Odom Athol lpr r623 Montpelier av Odom Barkin B (Minnie) trav slsmn hlOl Rembert av Odom Chas A (Pearl) h668 Napier av Odom Chas A jr student r668 Napier av Odom Clarence E (Eva) mach rl32 Piedmont av Odom Claudia Mrs bkpr J P Allen & Co r663 Oak Odom Clifford L cabtmkr h306 Cherry av "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmoe. lscaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseidgpUninaNokln-., SDeAeILyYou. r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Odom Crockette student r513 Napier av Odom Della lndrs h502 Harris row Odom Esther r306 Cherry av Odom Ethel H dept mgr J P Allen & Co rl32 Pied- mont av Odom Geo lab r342 Hammond Odom Jas R (Ethel) h419 Adams Odom Jos A (Daisy) mech hlOl Edna pi Odom Julian student r419 Adams Odom Laura (wid Wm F) hl32 Piedmont av Odom Louise sten r221 Knott Odom Lula (wid T C) r417 Winship Odom Lynwood porter Edw Butler r519 Calhoun Odom Margt lndrs h200 Yates al Odom Mary lndrs h617 Gilmer Odom Norman H (Annie) mech h221 Knott Odom Otis E carp h206 White r FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND T^p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 699 Odom Paul W (Martha L) slsmn A T Holt & Co r611 Forsyth Odom Pauline lndrs hS Smith (S M) ODOM REALTY CO (S E Odom), Ground Floor Ga Casualty Bldg, 516-522 Mulberry, Phone 1456 Odom Robt L (Maggie) cond h744 Walnut Odom Sherman E (Mamie C; Odom Realty Co) h513 Napier av Odom Sterling r419 Adams Odom Steve rlOl Edna pi Odom Stockton E student r513 Napier av Odom Tweedy D (Maude) agt Atlanta Life Ins Co res Unionville Ga Odom Walter (Julia) r221 Georgia av Odom Wm lab r362 Pine Odom Wm plstr r803 Ocmulgee Odom Wm W (Lahah) h623 Montpelier av Odum Isaac (Lorena) flgmn h758 2d MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIINSS Odum Wm (Idella) lab hl2 Alabama Oetter Electric Co Rudolph Oetter mgr 325 Wall Oetter Rudolph (Optye) mgr Oetter Electric Co h303 Clayton , O'Farrell Marion C (Rosalie) trav slsmn r320 College Ogburn Charlton appr r805 Pine Ogburn Jos F agt Fidelity Mut Life Ins Co r805 Pine Ogburn J Frank (Emma) hlpr h805 Pine Ogburn Leon B (Fannie) blksmith h560 Woolfolk Ogburn Robt E chauf r560 Woolfolk Ogden Fannie Mrs (wid Monroe G) tchr Wesleyan College h520 Orange Ogden Monroe G student r520 Orange Oglethorpe Infirmary Nurses Home 233 Tatnall Oglethorpe Private Infirmary Mary Campbell matron 1309 Oglethorpe Ogletree Geo W millwkr r21 Blosfield av Ogletree Horace lab r212 Coles al Oglertee Mamie millwkr r21 Blosfield av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work GJ o iann a. < in n <5. 5 o a> 2 > b pi po o n z PI n r O H X B "(Ot oEr E0)l GO O PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 700 (1925) R. L. POLK & CO.'S The most comprehensive reference work on the banks of the world' Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK Ogletree Robt C (Anna) millwright h21 Blosfield av Ogletree Robt E (Mildred) student h610 Holt av Ogletree Robt L r21 Blosfield av O'Hara Ellen music tchr 771 Oak r do O'Hara Jack rl37 Appleton av O'Hara Mary (wid J W) hl37 Appleton av O'Hara Michl (Pauline) real est h768 2d Okin Ira P (Ola) ins agt r Log Cabin dr Okins Jas (Rachel) porter hl03 Rose Crest av Oldham Amanda r326 Linden av Oldham Jos E (Alice) lens grinder American Optical Co h326 Linden av Oldham Mildred r519 Oak Oldsby Bose lab r454 Pine Oliphant Geo F (Belle) supt Ga Academy for the Blind Oliphant Homer N (Era) sergt police dept h44f) Ross OLIPHANT JAMES T, Mfr of Pyoral 658 Mulberry, Phone 2301, h Jackson Springs dr, Shirley Hills) Phone 1911-J (See left center lines and page 75) Oliphant Jeane Burden Smith & Co r Ga Academy for the Blind Oliphant Jennie r J T Oliphant Jackson Spring dr (S H) Oliphant Josephine tchr r J T Oliphant Jackson Spring dr (S H) Oliphant Lee (Catholine) lab hl46 (145) Sycamore Oliphant Twigs (Mammie) lab h307 Monroe Oliphant Wm F (Dunwody & Oliphant) res Forsyth rd Oliver Andrew (Mary) hl50 Roye Oliver Carl (Florence) lab h421 Thomas Oliver Carrie L r82 Schofield Oliver Dennis (Sarah) lab h303 Blount Oliver Floyd (Bertie) hlpr h300 (200) Charles (SM) Oliver Frances tchr r25 (1425) Lawton av Oliver Frances E Mrs hsekpr Dempsey Hotel r do Oliver Francis B lab rl07 Bonaire Oliver Frank (Rebecca) lab h558 Fulton al Oliver Geo r82 Schofield Oliver Geo W (Amanda) lab hl07 Bonaire Oliver Grace student r25 (1425) Lawton av Oliver Hattie cook r82 Schofield &C0. Polk Directory Bldg. r Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS RANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR'' Open All Day From 9 to 6--4^2% on Savings MACON CITY DIRECTORY (1925) 701 Oliver Havert lab r421 Thomas Oliver Hugh Rev pastor h721 Hammond Oliver Lowe lab r82 Schofield Oliver Lula cook h82 Schofield Oliver Mark lab rl07 Bonaire Oliver Martha rll2 Woolfolk (EM) Oliver Nan R (wid John L) r452 Spring Oliver Nathan H trainmn hl30 Winship Oliver Neasy (wid Wm) h444 Tindall av Oliver Nell sten r662 College Oliver Odessa dom rl07 Bonaire Oliver Richd (Isabelle) auditor h662 College Oliver Rosa dom r421 Thomas Oliver Thelma cook r82 Schofield Oliver Walter lab r82 Schofield Oliver Warren H (Annie H) spec rep h456 Orange Oliver Warren H jr student r456 Orange Vi SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Oliver Wm (Lessie) lab r464 Alabama Oliver W F ngt eng Dempsey Hotel r526 Montpelier Olmstead Arno C lab rl80 Palace av Olmstead E Clifton (Amy) printer 562 Mulberry rl80 Palace av Olmstead Esther H student rl80 Palace av Olmstead Kermit B prsfdr E C Olmstead rl80 Palace av Olmstead Thos C (Virginia) mech hl80 Palace av O'Neal Agnes cashr Douglass Theatre rl29 Jones St la O'Neal Benj rl29 Jones St la O'Neal Benj P (Anna) office 713 Ga Casualty bldg h 138 Bond O'Neal Beverly rl29 Jones St la O'Neal Bisma smstrs rl29 Jones St la O'Neal Clara A (wid Jack) r628 Main O'Neal Daisy maid rl29 Jones St la O'Neal Erman jr (Eufa A) mgr Georgia Grocery hlOO Daisy pk More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. bl iStSD 2 FOR. LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 702 (1925) R. L. POLK & CO.'S O'Neal Eva student rl57 Summit av (NH) O'Neal Florence maid h210 North O'Neal Jas student rl57 Summit av (NH) O'Neal Jas P (Maggie) supt h203 Montpelier av O'Neal John (Mary) lab h217 Fretwell al O'Neal John B elk J B Riley Drug Co rl57 Summit av (NH) O'Neal Lenette tchr r203 Montpelier av O'Neal Lula H (wid W R) hl321 Oglethorpe O'Neal Mabel H slswmn N Y Waist House rl321 Ogle- thorpe O'Neal Maggie rl29 Jones st la O'Neal Mamie maid Dr J W Lovelace r210 North O'Neal Mary lndrs rl23 Virginia la O'Neal Maudie cook rl29 Jones St la O'Neal Ruby rl29 Jones St la O'Neal Ruby student r203 Montpelier av O'Neal Seaborn pntr rl29 Jones St la O'Neal Wm nntr hl29 Jones St la O'Neal Wm jr pntr rl29 Jones St la O'Neal Wm B elk Standard Brick & Tile Co hl57 Summit av (NH) O'Neal Wm B jr student rl57 Summit av (NH) O'Neill Chas (Eliz) gro 308 Bay h400 Jackson Open Air School prin 950 Maynard O'Pry Bettie (wid Edw H) rll56 Milledgeville rd O'Pry Grove C (Stella M) pres-gen mgr O'Pry Plumb- ing & Heating Co h403 Boulevard (NH) O'Pry Plumbing & Heating Co G C O'Pry pres-gen mgr E R Hilliard v-pres H G Smith sec 163 Cotton av O'Quinn Frank R (Vivian) swtchmn h873 Mulberry ORANGE CRUSH BOTTLING CO, Clyde Daniel Mgr, 900 3d, Phone 2676 Orange David (Annie) lab hl3 Gas House al Orange Henry (Mary) cook r300 (220) Peacock Orange Nancy cook rl47 (150) 1st av (V) Orange Oscar lab r300 (220) Peacock Ord Rebecca sten r409 Virginia av Order Railway Conductors (Macon Division 123) G H Waller sec 408 Poplar Oriole Cafe (P J Pappas John Andros) 314% 2d Orlando Vincent (Mary) contr h274 Winship 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 703 ^Tltkdid P (Helen) solr R S Thorpe & Sons h254 Appleton av Orr Clifton B (Leila) v-pres S L Orr Co hl!3 Corbin Orr Emily student rl54 Summit av (NH) Orr Malcom W (Jennie L) supt Central Cotton Oil Co hl54 Summit av (NH) Orr Martha r405 Hillyer av Orr Sami L (Birdie) pres S L Orr Co h405 Hillyer av ORR S L CO, S L Orr Pres, C B Orr V-Pres, F W Wil- liams Sec-Treas, Jewelers Hotel Dempsey Bldg, 511 Cherry, Phone 4111 Orr T Julian (Ouida) pntr r825 Orange Orr Wm B (Mattie) mech hlOl Inverness av Osbon Annie (wid John C) h304 Plander (EM) Osbon Bertie M spinner r304 Flanders (EM) Osborn A Frank (Nona) wtchmn Willingham Sash & Door Co r464 Liberty Osborn B C agt Life Casualty Ins Co MACON OPTICAL Frank H. Johnson Opticians 468 CHERRY COMPANY Optometrists PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Osborn Fred (Lillian) mech h435 Liberty Osborne Jas F (Emma) steel wkr h628 Anderson Osborne Minnie r628 Anderson Osborne Otto O (Naomi) elk W A & J A Spiller h617 Plum Osborne O C r552 Oak Osborne Vannie R toll supvr Sou Bell Tel Co r573 Orange Osborne Wm E (Janie M) elk C of D R R Co hl27 Holt Osburn Annie S elk rl061 Ash Osgood Etta Mrs hsekpr Hotel Lanier r do Oswald Ida Mrs smstrs h429 Telfair OTIS ELEVATOR CO, Raleigh Blackwelder Local Agt, 301 Bihb Bldg, Phone 755 Ott Thos C (Ethel L) transfer 826 Orange h do Ottinger Alice r!08 Hartley av (CP) Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. u o WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 704 (1925) R. L. POLK & CO.'S Otto Fred R (Annie) starter Yellow Cab Co hl25 Winship Otto Isaacs Harness Co (Inc) J H Otto pres E A Isaac v-pres S D Winn sec-treas 355 Poplar Otto Julius call boy rl25 Winsbip Otto Julius H (Maggie) pres Otto Isaacs Harness Co h661 New Otto Margt M student r661 New Otto Thelma rl25 Winship Ousley Lula (wid S P) r C L McCrary Ousley Sami P (Bertha) elk r903 Cherry Outlaw Dessie lab r212 Henrietta Outlaw Mabel (wid A M) r201 Hendley Outlaw Susie (wid Dessie) lndrs r212 Henrietta Outler Thelma (wid Perry) r9 Hill Park av Outley Alene dom r602 (274) Crisp Outley Edw lab h602 (274) Crisp Outley Willie M lab r240 Division Ouzts Benj D oil formn r200 Beech av Ouzts Benj F (Alice) wood turner Builders Lbr Co h 200 Beech av Ouzts Chas E slsmn Jas N Neil Co r200 Beech av Ouzts Martin E (Cornelia; Ouzts Mitchell & Whaley) h362 College Ouzts M Emmett jr student r362 College Ouzts Mitchell & Whaley M E Ouzts H N Mitchell C L Whaley brokers 9 Terminal av 0YERLA1VD AUTOMOBILES, Yates Motor Co Distributors, 707 3d, Phone 1446 Overstreet Anna lndrs h728 Hazel Overstreet Clara cook r728 Hazel Overton Dolphin H field rep U S Vet Bureau r Y M C A Overtree Willie maid r233 Morgan av (WH) Owen Carrie H (wid John D) hll7 2d Owen Chas (Alice) formn shop h607 Montpelier av Owen Chas R student r607 Montpelier av Owen Danl firemn rll7 2d Owen Geo mill opr r36 Melrose av (B) Owen Kate r570 1st Owen Logan E (Margt) storekpr h258 Church (EM) Owen Mable cook r404 Lawton av (B) Owen Ruth Mrs cashr Am Natl Ins Co 258 Church Owen Thos R (Mary) mill opr h36 Melrose av (B) Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.i,blelDeELdTisaRttsaO..ITOA, uMsrkInCfeoHwr. The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St. MACON CITY DIRECTORY (1925) 705 Owen Wm R Rev (Nellie P) pastor First Baptist Cli h 121 High Owens Calvin W (Willie) slsmn rll7 Summit av (NH) Owens Chas (Stella) mech h406 (412) Montpelier av Owens Frances student rl27 Hines ter (V) Owens Guy L dist mgr Macon News r208 2d Owens Jas D (Eva) acct Terminal Ticket Office hl27 Hines ter (V) OWENS JAMES H, Real Estate and Loans 200 Pyth. ian Bldg, Phone 4397, h204 Lynwood av, Phone 1848 Owens Jefferson D mach r327 Calhoun Owens John (Essie) plstr r307 Campbell av Owens John W leather wkr r327 Calhoun Owens Lucille lndrs h308 Ash Owens Mack (Mammie) saw filer h552 Waterville rd Owens Nannie Mrs mill wkr rl65-166 Thomason Owens Wesley P (Josie) mldr Taylor Iron Works & Supply Co hll5 Post Myrtle (SM) Owens Wm (Mary) carp h404 Lawton av (B) Owens Wm (Ora) concrete paver h507 Flanders (EM) Owens Wm T (Lucile) plmbr r309 Georgia av Owings John L (Mary S; Dixie Roll & Cotton Co) r 457 Spring Owl Drug Store (A L McKissick) 872 Hazel Oxford Edw (Mollie) mill hd hl3 Bibb av Oxford John B (Gladys) slsmn McCommon Bros r256 (156) Center Oxford Sadie Mrs mgr Terminal Hotel Cafe r817 Mul- berry Oxley Benj T mgr Ga Battery & Vulcanizing Co r314 Beech av Oxley Carl checker Lohs Cafe r659 2d Oxley Chas H (Mattie) hl318 Broadway Oxley E D guard r714 3d Oxley Geo W jr elk F E Block Co 314 Beech av Oxley Jas I mill wkr r34 Manchester qtrs Oxley Lee E jr (Lawune) driver Plummers Creamery h320 Chappell Oxley Lillie mill wkr r34 Manchester qtrs Oxley Mary (wid Geo) h314 Beech av Oxley Paul R sta mgr Standard Oil Co r314 Beech av Oxley Robt E mill wkr r34 Manchester qtrs FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 K as a WET 706 (1925) R. L. POLK & CO.'S Oxley Texas (wid Ira) li34 Manchester qtrs Oxley W Harry shpg elk Jas N Neel Co r314 Beech Ozburn Jos L (Jewel) carp r340 Central av Pace Annie L bkpr Liberty Sav & Real Est Corp r 916 Ocmulgee PLACE THE Pace Florence (wid W L) smstrs h467 Elm Pace Glenn (Grace) mech rl21 Heard Pace Isabelle bkpr r258 1st Pace Jas A (Gwendolyn) elk hl27 Charles (SM) DIRECTORY PACE NOEL E (Eva L), Truck and Auto Repairing, Authorized Service Station and Parts tor White IS THE GREATEST MARKET PLAGE IN THE Motor Trucks, Brakes Lined by Machinery 657659 Bd, Phone 4846, res R F D 1, Phone 73-W (See right center lines and page 50) Pace Wm D (Paris D) hl21 Heard Padgett Janie (wid Thos) opr r319 Clinton Padgett Snow (Eudell) car repr h719 Anderson^ Page Edw (Susie) barber E Z Piercey r755 Broadway Page Dessie welder r623 Oglethorpe Page Francis student r901 Napier av WORLD Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Page Jas C (Bertha) asst train mstr h901 Napier av Page Julius (Mary) lab r437 Gilmer Page Leon W (Addle) pntr h623 Oglethorpe Page H Pearl dist elk Sou Bell Tel Co r654 1st Page Zelma slsldy S H Kress & Co rl221 2d PAIGE MOTOR CARS, Beeland-Conrad Motor to Distributors, 560 2d, Phone 2818 Paine see also Payne _ Paine Dave T (Augusta) r911 Walnut Paine Helen (wid Guy E) h329 (77) Hill Crest av Paine Maxie r911 Walnut The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Paine Rubin saw sharpener r348 Flanders (EM) Paine Rubin lab r rear 368 Flanders (EM) Pair Ash G (Bertha) bkpr rll5 Crescent av Pair Fred M (Emma) eng h523 Ash Pair Henry P dept mgr R S Thorpe & Sons rl37 Apple- ton av Pair Tohn E (Woodie) eng h215 1st Palace Barber Shop Robt Stephens prop 558 Mulberry Paldo Emmett lab h611 (301) Charles (SM) Palisades Ants Tre 571-77 Orange MJWto Palm Barber Shop (Pete Stocks & R D Rhodenhisei) PUBLISHERS 615 Cherry PolkDirecbmE DETROIT MICH- A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 56934 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 707 Palm Beauny r501 (212) Chappell Palm John r501 (212) Chappell Palm Purchasing Co H B Bloodworth mgr salary brks 8 Hardeman bldg Palm Silas lab h rear 554 Orange Palmer Amanda bkpr Jordan Realty Co r303 Glen Cove dr Palmer Florine H (wid Jos D) r309 Hillyer av Palmer Frank (Alice) r338 May av Palmer John B (Kate) sten bkpr hll4 Florence (SM) Palmer Louise (wid Wm A) rll4 Florence (SM) Palmer Luther D (Susie) cond h.765 Spring Palmer Major A (Samantha) h303 Glencove dr Palmer Millwood J (Beatrice; Southland Garage) h 1216 (1085) Ridge av Palmer Pasco (Alice) h600 Napier av PALMER SAMUEL B, M D, Specialist Eye, Ear, Nose and Throat, Office Hours 10 a m to 1 p m and 5 to 6:30 p m, Office 502-503 Grand Bldg, Phone 1254, hl41 High, Phone 2210-W Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Palmer Velma (Ophelia) lab r268 Division St la Palmer Wm (Matt) restr hlOl W Boundary Palmer Wm C (Neomia) agt Bankers Health & Life Ins Co hl667 3d PALMETTO PHARMACY, D N MacLemore Prop, 502 Mulberry, Phones 1271 and 1272 Palms Jesse lab b.358 Bay Palms Jessie (Naomi) r761 Ash ) Pan American Southern Petroleum Co Frank F Baker jr supt Poplar cor 8th Pannelle Paul S (Katie Mae) elec eng h304 Fairmont av (B) i Pappadis Geo (Southland Cafe) r360 Plum , Pappas Peter J (Mary; New York Cafe) h637 Vine- ville av Paragon Pharmacy J G Morris mgr 464 Poplar DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 o C cca o 33 Q.r^V'rt' < d > H More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 708 (1925) R. L. POLK & CO.'S PARCEL DELIVERY CO, S L Burns Mgr, rear 520 Cherry, Phone 416 (See page 63) Parden Mae r421 Liberty Pardner Robt (Mary) lab r3 Harris row Parham Jewell r22 Williams la Parham John H (Iva) slsmn Dunlap-Huckabee Auto Co h445 Duncan av Parham Mable H (wid John L) r2834 Houston av Parham M Julia elk W U Tel Co r208 Tatnall Parham Wm (Mattie) gro h22 Williams la Paris Cleo E mach rll3 Richmond Paris L B cashr Union Dry Goods Co rll3 Richmond Paris T Niles (Etna) hll3 Richmond Parish see also Parrish Parish Julia A Mrs h516 Orange Park see also Parks Park Annie E turn rms 714 3d h do Park Chas L (Mamie L) disp h212 Clisby pi Park Columbus M (Daisy) auto mech hill (5) Log Cabin dr Park Dock L solr Ideal Lndy Co r600 Main Park Eliz sten Sou States Fertlizer Co Park Elmyra T Mrs real est 565 Mulberry h556 Coll- ege Park Lula (wid Wm) r600 Main (EM) Park Lumy (Ocela) brick mason hl09 Spring Park Nellie lndrs rlOO Thomas Park Orville A (Elmyra T; Jones Park & Johnston) h556 College Park Orville A jr student r556 College Park Robt L disp r212 Clisby pi Park Russell O (Annie E) r714 3d Parker Abr eng r510 Mulberry Parker Abr (Osia) lab h354 Boardman's al Parker Allen lab h535 Smith (EM) Parker Anna lndrs h.433 Pio Nono av Parker Annie rl28 Holt Parker Aubrey blrmkr rlll2 Elm Parker Bee opr r970 Hazel Parker Benj lab h921 Fort Hill Parker Chas H (Mattie) slsmn h720 Napier av Parker Chas L (Maude; Central Georgia Baking Co) r Log Cabin dr Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 709 Parker Cherry maid h rear 753 Plum Parker Chester lab h.228 Jones Parker Cicero (Susie) clo prsr hlOO Ruby Parker Clarence F meter str rl40 Piedmont av Parker Claudia bkpr r663 Oak Parker Clyde slsldy Union Dry Goods Co r817 Mul- berry Parker Dan (Lula) lab hl221 Reynolds al Parker David A mach hd rl031 3d Parker Eddie lab r417 Steins al Parker Edw T (Verdie) gro 972 Hazel h418 Calhoun Parker Ernest (Lucile) lab h420 Hammond Parker Ethel Mrs spinner r855 Hazel Parker Eug (Fannie) farmer h519 Flanders (EM) Parker Evelyn r4 Maynard apts Parker Fannie lndrs r2 Woodliff Parker Freeman B student r246 Williams Parker Geo (Bertha) lab hl242 Broad Parker Geo F (Ella) sign pntr 314y2 3d h252 1st TATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES 317-319 Third St Parker Geo O slsmn T C Burke Inc r246 Williams Parker Helen sten Sou Underwriters Co Parker Henrietta lndrs h417 Steins al Parker Henry A (Ouida) collr Franklin Guaranty Co h251 Winship Parker Henry C (Laura) h547 Georgia av Parker Isaac (Gertrude) lab h305 (115) Roosevelt (V) Parker Jas lab h300 Cherokee av (SH) Parker Jas B (Addie) supt h4 Maynard apts Parker John elk Benj Glover rl53 Hetson Parker John (Allie) carp rl40 Elss (SM) Parker John (Emma) lab h619 Gilmer Parker John (Marie) lab h427 Spark al Parker John (Dollie) porter Taylor Iron Works & Supply Co hl02 Adams ^ PARKER JOHN B (Myra), Loans 515 2d, Phone 3096, hll7 Nottingham dr Automobile owners are select projects for many kinds of merchandise. Send to Headquar- ters for Catalog all kinds contains of Automobile Lists. much valuable data. OAura_*n*e"w a copy n. L. POLK & CO., DETROIT, MICH. MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 710 (1925) R. L. POLK & CO.'S Parker John M (Leila) lab h506 (250) Hall Parker Julia smstrs r216 Bright Parker Julia student r438 North Parker Julia B sten T C Burke Inc r246 Williams Packer J C lab r421 Liberty Parker Laurie L (Pearl) carp h360 Center Parker Leila (wid Parley) smstrs r416 Calhoun Parker Leonard F (Mattie E) mgr Franklin Guaran- ty Co h663 Oak Parker Leroy R Rev (Malissa) pastor Greater Cha- pel A M E Ch h438 North Parker Lewis (Maggie) lab hll07 (807) Woolfolk Parker McArth msngr boy rlll2 Elm Parker Maggie nurse rl28 Holt Parker Martha L lndrs r300 Cherokee av (SH) Parker Mary rl28 Holt Parker Mary r203 Montpelier Parker Mary student r246 William Parker Mary L lndrs r506 (250) Hall Parker Mattie E Mrs mgr Viavi Co h663 Oak Parker Mollie lndrs rl07 Mulberry Parker Nelson H (Lula) slsmn h246 Williams Parker Nelson H jr student r246 Williams Parker Odie lndrs r506 (250) Hall Parker Reney r207 Ocmulgee Parker Robt (Anna) butler h366 Craft la Parker Robt (Martha) janitor hll8 Braswell la Parker Robt E lab r300 Cherokee av (SH) Parker Rosa lndrs h475 (375) Bowman Parker Sami C (Marie H) slsmn r322 New Parker Tabitha (wid Eug) hl32 Stratton Parker Thurman r2 Gustin pi (V) Parker Thos W slsmn Corbin Supply Co res R F D Parker Uradella lndrs r206 Coles al Parker Valley W r421 Liberty Parker Virginia smstrs r416 Calhoun Parker Wm (Lillie) lab r420 Hammond Parker Wm (Zola L) meats 1302 Broadway h716 Hawthorne Parker Wm J (Laura) rl40 Piedmont av Parker Wm L (Ada) eng h206 Montpelier av Parker Wm M bkpr 4th Natl Bank r401 Katherine Cotirt apts < Parker Wm R (Lora) solr J B Parker h206 Winship More goods are bought and sold through the Classified Business Lists of the Directory thar any other medium on earth. IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor <1 Macon Transfer & Storage Company HEAVY HAULING REPAIRS -- SALES -- SERVICE 8 Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 711 2 w Parker Wm R (Lilia) supt Bibb Mfg No 2 h630 Ogle- thorpe Parker Zeb hlpr Taylor Iron Works and Supply Co I Parkerson Jas O (Parbia) meat ctr r210 1st Parkerson Mildred rl02 Ponce De Leon av $ vj Parks see also Park Parks Bernard PI (Sarah) pharmacist Bethune & Stevens r702 Holt av Parks Columbus firemn rl600 1st Parks Ella Indr hl40 Grants Parks Ella M tchr rl40 Grants Parks Fisher P (Lora) r2911 Houston av Parks H D mgr F E Block Co r Hotel Lanier Parks John A sec Macon Lumber & Mfg Co r Hotel Lanier MOVING Parks Justine student rl40 Grants Parks Kizie dom r354 Bay Parks Lizzie cook r474 Clinton 'JEM) Parks Mamie tchr rl40 Grants Parks Nelson (Lizzie) plstr r474 Clinton (EM) Parks Richard (Pinkie) lab h4 Prank al Parks W E mgr P E Block Co r Hotel Lanier Parnell see also Purnell Parnell Robt L (Lillie M) mkr Ideal Laundry Co r 202 Tatnall Parnell Wm T (Lorena) tel opr hill Dixie av Parr Marion J (Clyde O) trainmstr C of Ga h2 Jordan apts Parr Needham I gro h271 Ocmulgee Parr Oris H (Arizona) gro 100 7th h456 New Parrish see also Parish Parrish Edw (Anna) contractor r805 Columbus rd Parrish Geo H (Alfreda) auto repr 717 3d h420 Dun- can av STORAGE Parrish Henry H (Eliz) carp r559 2d Parrish Solomon A (Shelley) eng h858 New Parrott Ephraim H mech h607 Georgia av Parrott Nannie (wid Jas D) Parson Chas (Rosa) lab hll64 Ocmulgee Parsons Paul mach r604 1st Parsons Peter lab r554 Johnson's al Partain Harvey J (Ora) mill wkr h4 Manchester qtrs Partain Lydia nurse Macon Hospital Partin Theo Mrs slswmn Dannenberg Co r871 Oak Tsr) Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeactdsqufaorrters for all kinds of Automobile Lists. Our new cCoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, sMkICfoHr. to o 4^ W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 712 (19251 R. L. POLK & CO.'S POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers Pascall Mary A lndrs h354 Pine Paschal Mamie (wid W R) h322 Cherry av Passinger John H (Alice) supvr h764 Plum Passmore Annie sten Standard Brick & Tile Co h7, 811 Poplar Passmore Mamie sten Morris Harris r7, 811 Poplar Patat J Prince (Aldora) electn Wade & Co h.425 Win- ship Patat Leola Mrs mill wkr r65 Davis Pate Edw (Sarah) agt N C Mut Life Ins Co h215 Pond Pate Elisia (Florence) driver h219 (241) Fargason Pate Geo T (Maggie) mach h293 Cedar (SM) Pate Jesse H (Louise J) sec-treas Coleman Meadow Pate Drug Co Inc hl08 Rogers av Pate John M slsmn Macon Shoe Co r201 High Pate Jos truck driver Natl Highway Phar r219 (241) Fargason Pate Sami G (Frankie) supt motor car hl915 American blvd Paterson Adeline (wid Jack) hl69 Astor (EM) Patillo Nobice slswmn Burden Smith & Co rl09 Hill Crest av (CH) Patrick Anson (Mary) steward Progress Club h411 Madison Patrick Dave lab r217 Waterville rd Patrick Dock (Marie) lab hl06 (4) Toombs (SM) Patrick Floyd orderly Lundy Hosp Patrick Henrietta cook rl43 (133) Mutual av Patrick Robt (Charlie) carp h!43 (133) Mutual av Patrick Rozell (Katie) r rear 3 Waterville rd Patrick Sami (Rosalie) lab rll30 Broadway Patrick Viassar R (Caroline) hl405 Vineville av (V) Patten Ada r607Va Ash Patten Sami r607*4 Ash Patterson Andrew (Callie) lab hll4 5th Patterson Annie (wid John M) r233 Ayers rd Patterson Annie M lndrs r5 Harris row Patterson Augustus lab rl22 Orchard av Patterson Benj W (Ollie) city firemn Fire Dept h826 Main Patterson B Louie (Maude) waiter r711 (821) Columbus rd Patterson Carl B (Nezzie) slsmn h es Park 2 s Forsyth rd 536 S. Clark St. Chicago, 111. Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 713 Patterson Caroline hl32 High Patterson Chas I (Precilla) gro 218 American blvd h do Patterson Edna tchr Wesleyan College r520 College Patterson Edw (Alberta) hl49 Bartletts Patterson Edw W (Aurelia) butler h620 3d av (V) Patterson Emma r8 Reynolds al Patterson Fannie L student r281 Hillyer av Patterson Fred (Eliz) traffic officer Police Dept hl28 Virginia av Patterson Geo A (Rosa) brklyr hl22 Orchard av PATTERSON GEORGE E (Inez), V-Pres Fourth National Bank, h Sunset dr (SH) Patterson Helen student r620 3d av Patterson Ira B (Lula) dyer hl57 Clara Patterson Jas (Sallie) firemn hl21 Telfair Patterson John (Ida) lab h511 (411) Hall Patterson John T (Clara) knitter r Jas Snow Patterson Jones C (Ressie) h613 1st Patterson Jos A (Carrie) trainmn Macon Ry & Light Co h244 (51) Maynard Patterson Laura I (wid Wm N) r2632 Broadway Patterson Leila maid rl9 (17) Wise av (V) Patterson Lewis S (Susie) pastor Bellevue Baptist Church hl43 3d av (Bellevue) Patterson Lillie M smstrs r427 Calhoun Patterson Mattie nurse r233 Ayers rd Patterson Maude Mrs slswn N Y Waist House Patterson Nathan porter rl226 Broad Patterson N Felton (Irene) trainmn Macno Ry & Light Co h711 (821) Columbus rd Patterson Oscar (Laura) concrete wkr h Forest av (Bellevue) Patterson Robt A (Mary; Avery & Patterson) hl02 Whitehead Patterson Sami (Ollie) lab h475 (75) Ballard Patterson Sami (Emily R) public acct 514 Ga Casualty bldg res R F D 2 Columbus rd Patterson W Amos r427 Calhoun Patterson Wm (Emma) elk hl08 Elliott (EM) Patterson Wm J mach b.2632 Broadway Patterson Wm P (Mary) gro and meats 726 Haw- thorne h427 Calhoun Pattillo Chas R elk Exchange Pharmacy rl25 Virginia ar FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L.! POLI K & CO. CHIC. AGO' We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 714 (1925) R. L. POLK & CO.'S Pattillo Lucille bkpr Coml Credit Co r Mrs Lula Pat- tillo Pattillo Lula Mrs h ss Vista circle (I) Pattillo Marshall K (Jessie) state mgr hl25 Virginia av . . Pattillo Marshall K jr rl25 Virginia av Patton Ann lndrs r235 Watson al Patton Chas A printer The J W Burke Co r574 Boule- vard (NH) Patton Clara (wid Sami) r809 Elm Patton Fannie W (wid Robt) r765 Poplar Patton Georgia (wid Alex) h670V2 Ash Patton Jas student r290 Masonic Home rd Patton L Stanton tchr Ga-Ala Business College r Y M C A PATTON SAMUEL E (Mary T), Pres City Realty Co, Rep United States Mortgage & Trust Co, h290 Masonic Home rd, Phone 4560-J Patton T Emory (Ruth) dept mgr City Realty Co h574 Boulevard av (NH) M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lscaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbhRrlyeEseipdgUinnNaokln-,. SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRiAstLs 1 H PATTON'S SUN PROOF PAINTS, Sold by Jarrett L E Paint & Glass Co 312 3d, Phone 2606 Paul Beulah M cook Dinty Moore's r (NH) Paul Chas E (Leslie) eng r906 Walnut L A Paul Cleveland (Mary) car inspr h American blvct (Bellevue) I T Paul Eliz (wid John W) r Cleveland Paul Paul Enick (Eunice) carp h607 (1101) Colquill Paul Mary (wid John) rl39 Tenney R I Paul Matthew P mgr C E Newton & Bro r77 Arlington Pi 0 N Paul Mildred r906 Walnut Paul Oscar (Nita) slsmn Adams Buchanan Motor bo r3400 Houston av ,, T N G Paul Robt C mgr Macon Trading & Inv Co r90b Walnut Paul Sami (Pearl) lab rll Stripling al S Paul Thos (Pearl) lab r2 Harris al ________ 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L- POLK & CO. CHICAGO MACON CITY DIRECTORY (1925) Paul T Bertice (Winifred) chf elk hl09 Emory Paul Wm (Virginia) rl47 Bartlett Paul Wm H elk L W Rogers Gro Co r555 2d Pauldo Clifford (Beatrice) driver Thos Morgan Inc r345 Hammond Pauldo Marls T (Mattie) lab r300 Elizabeth Pauldo Willis rl053 Oglethorpe Paulk Nellie Mrs marker Independent Laundry Co r YWCA Paullin Margt (wid W B) h608 Forsyth Paullin Margt student r608 Forsyth Paullin Seawell P student r608 Forsyth Paxton Robt C flagmn r760 New Payne see also Paine Payne Alf mill wkr r605 Main (EM) Payne Community House Bellevue rd nr Green Payne Jas A police r560 Plum Payne John (Lula) brklyr h99 (73) Bay Payne John D (Mettie) slsmn The Texas Co h.311 Cutter's Green MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAIWLKLIISNS Payne Laura Mrs h2447 Broadway Payne Leslie' (Essie) car washer Gates Motor Co h 1330 1st Payne Maxie opr Sou Bell Tel Co r911 Walnut Payne Mill Auditorium Davis nr Payne av Payne Minnie lndrs h511 Gilmer Payne Thos J (Maggie) opr r605 Main (EM) Payne Wm S (Cecelia) cotton broker h263 High Payne Wm S jr (Mildred H; Willingham & Payne) h259 Boulevard (NH) Payton Alene rl02 Smith (EM) Payton Allen (Lucinda) mach hd hl02 Smith (EM) Payton Cora hl46 E Academy Payton Henry (Mary) firemn hll8 Bay Payton Maggie (wid Jos) h464 Liberty Payton Robt lab r464 Liberty Peabody Frances r544 Washington av Peabody Mary (wid E P) r544 Washington av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answers All Questions as to , WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company | LUMBER, SHINGLES, LATH a II o a; c c ^ a. CP ^ CM H CD CD Office, 457 Third St. Telephones 278 & 3976 716 (1925) R. L. POLK & CO.'S Peacock Allen porter r432 Monroe Peacock Annie Mrs hl310 Broadway Peacock Carrie cook r432 Monroe Peacock Chas (Edith) real est r681 College Peacock Clifford D (Lenora G) slsmn Jones Motor Co r618 Oak Peacock Eli J (Tippora) r Hotel Arcadia Peacock Ernest (Bertha) lab h203 Williams Peacock Eudell mach opr r212 Shamrock Peacock Evelyn winder r3 Bibb av Peacock Florence cook r369 Wright al Peacock Gladys mach opr r212 Shamrock Peacock Joel A (Rachel) mill wkr hl04 Green Peacock John (Lillie M) lab r213 Yates al Peacock John A (Leasie) 2d formn h3 Bibb av Peacock Lenora G Mrs bkpr Sou Loan & Real Est Corp r618 Oak Peacock Lewis O r552 1st Peacock Lillian cook East Macon Lunch Room Peacock Lucy lndrs r754 Center Peacock Mary cook r432 Monroe Peacock Norman M (Lucy) h212 Shamrock Peacock Wm slsmn r347 Hydrola Peacock Wm F h552 1st Peacock Willie (wid Chas F) r347 Hydrola Peak Llewellyn elk r810 Cherry Peak Marrietta L (wid Llewellyn) h810 Cherry Peak Mary L slsldy Barker Bakery r810 Cherry Peak Ovada mach opr r246 Willingham Pear Henry W (Margt) rl37 Appleton av Pearce see also Pierce Pearce Cecelia r637 Orange PEARCE ERNEST R, Auto Painter, Automobile Tops Built and Repaired 523 Pine, Phone 1279, h652 do (See left bottom lines and page 53) Pearce John T (Eliz) h652 Pine Pearce Laura A (wid Henry) hl03 Callaway Pearce Marshall H (Annie M) driver Police Dept h637 Orange PEARCE WALTER (Herbert Smart Clothing Co), r 103 Calloway, Phone 822-J Pearman Caledonia (wid Isaac H) rll9 Ayers rd Pearson see Pierson Pearson Agnes r512 Martha (EM) Pearson Callie r512 Walnut More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4x/2% on Savings MACON CITY DIRECTORY 11925) 717 Pearson Edw clothes clnr 971 Hazel h Middle Pearson Frank (Mary) firemn Builders Lmbr Co h512 Martha (EM) Pearson Frank jr bell hop r512 Martha (EM) Pearson Gerald W tchr hl31 Merritt av (MA) Pearson Ilah lndrs r224 Powell (EM) Pearson Imogene D Mrs slsldy Union Dry Goods Co rl31 Merritt av (MA) Pearson Jas (Laura) carp h217 North Pearson John lab hll36 Broadway Pearson Mary A (wid Sami H) r471 Walnut Pearson Mary E tchr h224 Powell (ElM) Pearson Ralph E r2308 Broadway Pearson Sami H (Patti R) slsmn r471 Walnut Pearson Sims P (Claudia) slsmn h2308 Broadway Pearson Walter J r2308 Broadway Pearsons-Taft Co M J Mikel mgr loans 604 Ga Casu- alty bldg Peavy Cath Mrs marker Independent Laundry Co r764 Plum Peavy Chas D jr (Ruth) pres Wood-Peavy Fum Co h ss Osborne pi 3 e Tyrone blvd Peavy Eliz student r Chas D Peavy jr Peavy Frank C (Lena) pntr hl537 Broadway Peavy G Clifton barber rlOO Enterprise Peavy Henry J (Laura) phys 306 Bibb bldg r300 Georgia av Peavy Jack (Emma) lab h625 Division Peavy Jas M (Mary) mach hd Macon Lumber & Mfg Co h289 Cedar (SM) Peavy John carp r460 Mulberry Peavy Laura phys r300 Georgia av Peavy Lazarus (Mary) lab r555 Chestnut la Peavy Lora r2098 3d Peavy Mary (wid Jos V) h2098 3d Peavy Sami (Nora) pntr rl537 Broadway Peavy W H firemn r760 (766) 2d Peavy Wm V (Claude) traffic officer Police Dept h 2173 2d Peck Equator porter h323 4th av Peck Nelson (Nellie) driver h358 Croft la Peck Wm driver r232 4th av Peddicord Geo W (Christine) dept formn h30 S College Peddy see also Pettey and Petty FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION URTROIT R. L. POLIv & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk &C0. Publishers 536 S. Clark St. Chicago, IU.` 71S (1925) R. L. POLK & CO.'S Peddy Sarah (wid Wm P) r205 Log Cabin dr Peddy Willie Mrs r2803 Houston av Peed Louise slswn Burden Smith & Co r678 Court- land ay Peek Frank S (Lucile) farmer hllO Highland av (NH) Peek Henry T slsmn Macon Grocery Co res Loraine Ga Peek John barber 511 Broadway Peek Lillian sten rllO Highland av (NH) Peek Lora sten rllO Highland av (NH) Peek L elk C of GRRCo r810 Cherry Peek Mary opr Sou Bell Tel Co r231 Washington av Peek Thos mech rllO Highland av (NH) Peele Evelyn student r J S Turner Peeler Aaron M (Jane B) pres Peeler Hardware Co h300 College Peeler Eliz (wid Chas G) hl27 Coleman av PEELER HARDWARE CO, A M Peeler Pres, C Johnson Sec, Hardware, Phones Store 634-625, Office 736, Cherry se cor Broadway Peeler Jane S (wid Wm E) r520 Washington av Peeler Mary opr h96 Short Peeler Warren C elk J B Riley Drug Co rl27 Coleman av Peeler Wm H (Della) mach h Bellevue rd Peeples see also Peoples Peeples Aaron (Lavinia) lab hll6 Glen Peeples Dell (Ardis) mach opr h845 Hazel Peeples Thos wtchmn r206 Hartley av (CP) Peeps Grover (Virginia) lab h218 Plant Pell Sami B (Louise) trav slsmn h768 Cherry Pellew Jas H (Marian) elk h301 Clayton Pellew Louis r639 Forsyth Pellew Louis E (Sarah) drugs h639 Forsyth Pellew Sarah sten r639 Forsyth Pelt Jas H (Hattie) contr h448 Vine Pelt Thos (Eva) ice cream mkr Dixie Ice Cream Co r327 Dannenburg av Pender Eug (Mattie) lab hl6 Spring Pender Frank cement fnshr R E Clark rl005 Napier av Pendergrass Mary (wid Henry C) prop hll5 Boule- vard (NH) Pendergrass Sanford student rll5 Boulevard (NH) Pendleton Sallie P (wid Chas R) h311 Hardman av E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS-TRUCKS -TRACTFOoRrSdsorvhIffoarvPietH'asOit*NaFEoFr1od5r,9d1woer JONES MOTOR COMPANY 557-559 PLUM ST. ^hs, MACON CITY DIRECTORY (1925) 719 PENDLETON WM E (Stella), District Agt Equitable Life Assurance Society of the U S, li3 Desseau, Phone 4093 Pendley Lillie (wid Wm) h Melrose nr C of Ga tracks Pendley Morris W (Ola) night wtchmn r Lillie Pendley Pendley Waymon D (Mavis) r Lillie Pendley Pendly Byron H elk r500 Edgewood Penfield Hall 1200 Elm Penion Queen lndrs h770 Park Hotel al Penn Annie lndrs h615 Gilmer Penn Augustus msngr M L Fleming r555 3d av (Un- ionville) Penn Chas R sten B B Ford & Co rl43 Laurel av (NH) Penn Charlie mill wkr r Carrie Jackson Penn Fannie' nurse r757 Pine PENN MUTUAL LIFE INSURANCE CO, Bagley, Wil- let & Paine General Agents 1005-1006 Georgia Casualty Bldg, Phone 887 Penn Paul R (Lucile; B B Ford & Co) hl43 Laurel av (NH) Penn Sami lab h Bartlett la Penn Tessie nurse Macon Hospital Penn Ulric M (Fannie) flagmn h700 Spring Pennamon E Hardy pharm Peoples Drug Co r659 Spring Penney J C Co J S Mansfield mgr dept store 608 Cherry Pennington Claude L phys 508 Ga Casualty bldg r218 Georgia av Pennington Idell (wid Respes) opr The Wm Carter Co r267 Willingham Pennington Jos auto mech C W Jones Pennington Lewis gdnr rl52 Coles al Pennington Lillie lndrs hl55 Coles al Pennington Sami (Annie) lab C of Ga R R h 1 Cedar (Unionville) Pennington Willis (Hattie) lab h215 (237) Farguson Penny Andrew (Annie lab h93 Woodliff Penny Jas F (Minnie) meat ctr h976 Walnut Pennyman Albert (Anna) blrmkr h415 Nussbaum Pennyman John (Pearl) porter h239 Kahn's al Pennyman Walter (Ella) lab hl2 Woodliff Pennymon Jesse (Lillie) lab h856 Cowan Pentacost Chas (Ophelia) carp h523 Elm The most comprehensive reference work on tne banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 720 (1925) R. L. POLK & CO.'S Pentacost Luther (Ethel) linemn r523 El m Pentacost Luther (Ethel) linemn r523 Elm Peoples see also Peeples Peoples Drug Co J H G Williams genl mgr 451 Cotton av Peoples Health & Life Insurance Co E 0 Powell pres-treas 0 M Hall sec-mgr 455 Cotton ay Peoples Sarah cook hll Ross St p'l Peppus Sallie' r243 Jones Percy Alex Z (Mamie) barber 621 Broadway hl41 (140) 1st av (V) Percy Lucy tchr rl41 (140) 1st av (V) Perdue Alonza (Sula) lab h553 Henrietta Perdue Augustus R (Williamina) student r611-15 2d Perdue Chas H (Lucile) dentist 13-14 Macon Savings Bank bldg hl06 Buford pi Perdue Helen student rl06 Buford pi Perdue Wm student rl06 Buford pi Perdue Wm R (Edna K) ship elk Roughton Hallibur- ton Co h611-15 2d Perkin Frances r633 4th av (U) Perkins Annie lndrs h220 Dempsey av Perkins A C lab r603 Peeble Perkins Chas (Penkie) lab h641 Hicks al Perkins Eliz (wid Wm H) r Wm Cook Perkins Eunice tchr rl47 Park pi Perkins Eva mill wkr r36 Brigham Perkins Frank (Lula) lmbr stacker r220 Dempsey Perkins Gladys mill wkr r56 Davis Perkins Henry J (Mattie) mill wkr h9 Paynes av Perkins Jas (Roberta) lab h567 Monroe Perkins Jas F (Malissa) h401 American blvd Perkins John lab h210 (175) Lincoln av (V) Perkins Josephine L r225 High Perkins Julius (Columbia) lab r566 Hammond Perkins J Wm (Annie) mill wkr hl06 Green (Payne Mill) Perkins Leona (wid Bdw) h36 Brigham Perkins Leroy mill wkr r36 Brigham Perkins Lou lndrs hl05 Neal av Perkins Mamie cook r640 Hick's al Perkins Mary mill wkr r36 Brigham Perkins Matilda maid r220 Dempsey Perkins Millard M baker Am Bakeries Co rl065 Wal- nut AmtCeauarsttnaoylfmookgoribnacidlloelsnktoiaofniwndmsnseeormrcfsuhAcaahnurdteovismaelso.uebalibeSlecleetnLddipsatrtotsoa.s.HpeeOAacudtssrkqunffeaoowrrrcopy. R. L. POLK. & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 721 Perkins Monroe (Melvina) driver h240 Rogers av Perkins Norris E baker Am Bakeries Co rl065 Walnut Perkins P Vance mill wkr r56 Davis Perkins Robt J (Sallie) mill wkr h56 Davis Perkins Robt N (Jimmie) dept mgr Union Dry Goods Co b761 Pine Perkins Ruby mill wkr r56 Davis Perkins Sarah (wid Napoleon) r337 Maple Perkins Sarah student r505 Coleman al Perkins Thos credit mgr r401 American blvd Perkins Wm (Ada) lab h505 Coleman al Perkins Wm lab h rear 652 New Perkins Wm (Martha) lab h9 Orchard av Perkins Wm I (Frances) mill wkr h.75 Short (Payne Mill) Perkins Wm R (Annie P) mill wkr r70-71 Davis Permenter Guy cond r619 2d Perry Ada M (wid M M) rl03 3d av (WH) Perry Bennett (Myrtice) shoe repr S G Sharp hl06 2d av (V) Perry Demous B (Lula) wtchmn Macon Lumber & Mfg Co hl23 Madden av Perry Ernest lab r809 (104) Cowan Perry Fannie cook rl26 Orchard av Perry Georgia T Mrs bkpr T W Stokes rl09 1st av (CP) Perry Harry C (Addie) air brake dept hl25 Madden av Perry Herman porter Union News Co r498 Singleton la Perry Jas carp rl85 Grant Perry Jas C (Minnie L) archt h273 3d av Perry John (Esther) porter I Kessler Commission Co r70 Spring Perry Joe lab r8 Tinsley la Perry Kate supvr Macon Hospital r do Perry Leola M sten DeFore & Estes r604 Montpelier av Perry Lula lndrs r675 Dunlap al Perry Mark J r413 Ayers rd Perry Nellie sten Juliette Milling Co r965 Cherry Perry Ollie M (Pearl) gro 205 Alabama hl03 3d av (WH) Perry Patsy lndrs h809 (104) Cowan Perry Precious cook r718 Campbell av * FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO en Von h>f30f>l L HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIMM 722 (1925) R. L. POLK & CO.'S as a Perry Robin T (M Ella) dairymn h413 Ayers rd Perry Speer (Ruth) h228 Massee la MMEI Perry Thos M (Nannie) lawyer h605 Hillyer av Perry Warren r413 Ayers rd Perry Wellington S (Lena) lmbrmn h604 Montpelier PUCE av Perry Wm H formn r413 Ayers rd THE Perryman Henry C (Gracie) cond h2524 2d Perryman Jas (Lizzie) porter M E Goode & Co h70 DIRECTORY Schofield Perryman Lizzie maid r70 Schofield IS THE Perryman Major C lab r70 Schofield Persley Thos K (Maxie) ins agt h215 Madison GREATEST Person Alva G slsmn Ga-Carolina Oil Co r341 Columbus MARKET Person Carrie Indrs r340 Gilmer Person Eug G (Harriett) dispatcher h ns Forsyth rd PLACE (V) 5 w Riley av Person Margt W sten Macon Lumber & Mfg Co r E G IN THE Person Person Mollie 0 rll34 College WORLD * Person Sami lab rl537 Johnson's al Person Wm R (Ola) lab h.340 Gilmer Person W R r341 Columbus Every Day in the Year the Directory Tells Where All Kinds Persons Ben S Inc John H Callender mgr 562-64 Cherry- Persons Lilia r617 Orange Persons Marie student r224 Cedar (SM) Persons R Gordon (Annie) drummer h224 Cedar (SM) of Goods and Service Can Be Had > * Pervis Margt mill hd hl5 Lake City Peterman Oscar (Susie) driver Carstarphen Whse Co r613 Bailey av PETERS CHARLES (Mary; Try-Me Bottling Co), h 304 Orange, Phone 3906-J The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Peters Frank porter Georgia Seed Store r Paradise al Peters Geo (Margt) mgr Ga Banana Co r Central Hotel Peters Lizzie Indrs h247 Ellis av Peters Rosa Indrs r219 Pond Petersen Holger (Christine) elk P O r202 Napier av Peterson Ananias (Fannie) lab hl90 (330) Neal av Peterson C Eug pharm Chapman's Pharmacy r Y M C A Peterson Jas L (Verna) eng h529 Clinton Peterson Lyda Mrs r560 Oak PolJtDiredonjE DETROIT More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. HAULING -- MOVING -- STORAGE Southern Business College E. L. RAY, President DAY AND NIGHT OUK MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 723 Peterson Oscar (Irene) lab h350 Turpin Peterson Rasmus farmer hl30 Log Cabin dr Peterson Wm (Susie) lab rl05 Massee la Pettey see also Peddy and Petty Pettey John R (Gussie; Read & Pettey) r338 Ross Pettey Seth D (Lillie) ship elk Otto-Isaacs Harness Co h338 Ross Pettey S Augustus elk r338 Ross Pettigrew John P (Mary) carp r224 (51) Maynard Pettigrew John M (Van) elk John F Herring res R F D 2 Pettigrew Leon W (Leona) trainmn Macon Ry & Light Co r826 Main Pettis Hattie mill wkr r200 Elliott (EM) Petty Arth M slsmn Johnson Bros h R F D 2 Rocky Creek rd Petty E H city firemn Fire Dept r do Petty Josephine Indrs h624 Gilmer Petty Liddie A (wid Jeff) h330 Hanson Petzinger Chas F (Mary) formn h742 Courtland av Pew Alonzo lab h Barracks al Peyser Tillie tchr r867 Cherry Peyton Acquin J- (Evelyn) printer rll50 Milledgeville rd Pfeiffer Louis O tchr h421 Duncan av PHAUL ADOLPH (Mamie; Schwartz & Phaul) 464 Napier av, Phone 3992 Phelps Chas S asst eng r715 American blvd Phelps Emma C (wid R L) hl070 Walnut Phelps Glasco (Lula) chauf h719 3d av (V) Phelps Jerry (Etta) driver Elmpire Candy Co h226 Northern Phelps Jos (Edna) lab h227 Turpin Phelps Wm (Lula) cotton sampler hl6 Gustin av (V) Phelps Wm (Emma) lab hllO Ruby (V) Phelps Wm porter M E Goode & Co Phelts John W (Mary F) agt Atlanta Life Insurance Co h209 (173) Lincoln av (V) Philadelphia Hat Cleaning Co (Chas Chirbas Wm George) 358 2d Philipps Benj (Inez) lab hl31 (134) lstav(V) Philipps Pauline Indrs rl26 Tatnall la Philipps Wm (Fannie) carp hill Tatnall la Philips Edwin A (Myrtle) rl22 Academy Philips Eug G (Mamie) carp h712 Elm Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 724 (1925) R. L. POLK & CO.'S Philips Ralph W elk Piggly Wiggly r621 Montpelier av Philips Robt H (Harriette) mech h621 Montpelier av Philips Rose r621 Montpelier av Philips Ross F (Hazel) mgr r908 Napier av Philips Sidney P (Elsie) local adv mgr Macon Telegraph h202 Beech av Philips Wm G (Clara) traffic officer Police Dept h352 Columbus Philips Willie (wid David) r621 Montpelier av Philips Woodie (Laura) card grinder h722 Oglethorpe Phillip Matthew T lab h95 Bay Phillip Miller (Mattie) lab h95 Bay Phillips Albert L (Lucy) h730 Oglethorpe Phillips Algee L (E Carrie) timekpr hl02 Charles (SM) Phillips Chaney hl2 Wings Hill Phillips Chas porter Sanitary Barber Shop No 2 r311 Jefferson Phillips Chas H (Lena) slsmn h Forsyth rd (V( cor Riverdale av Phillips Comer C (Maude) slsmn Wlson & Co h606 Hillyer av Phillips David G mgr Macon Academy of Music rll5 Academy Phillips Della dom h511 y2 Cotton av Phillips Dorothy L sten J W Shinsholser r346 Hard- man av Phillips Elijah hdwood floors r514 Pine Phillips Jas (Ruth) elk h222 Coleman av Phillips Jas A J (Daisy) carp rl24 Charles (SM) Phillips John cabtmkr 805 Broadway r do Phillips John shoe repr 1030 Broadway r412 Haw- thorne Phillips Jos f (Fay) formn h809 Cherry Phillips Joshua (Lillie) linemn h5 Spring Phillips J G collr r210 1st Phillips Leslie sten r411 Forest av Phillips Marbo (Emma) mattres mkr rl8 Clinton Phillips Mary cook h522 Singleton la Phillips Mary lndrs h504 Harris row Phillips Marzella attdt Ga Ind Home h Industrial Home rd Phillips Myron T (Eliz) formn hl2.. 811 Poplar Phillips Oscar (Alma) ins agt h778 Walnut FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO f Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 725 Phillips Oscar W (J Eva) elk Quality Market h466 Mulberry Phillips Perry L r8 Reynolds al Phillips Robt J (Eliz) trav slsmn r2 Nevaro flats Phillips Ruth sten Yates & Tabor Co r222 Coleman av Phillips Sallie maid h419 North Phillips Susie Mrs opr The Wm Carter Co Phillips Wm r552 Oak Phillips Wm (Bessie) elk r409 Campbell av Phillips Wm (Lizzie) janitor h96 Shamrock Phillips Wm truck driver Taylor Iron Works & Supply Co r552 Singleton la Phillips Wm M Rev (Hattie) pastor St Lukes Baptist Church h408 Ward (V) Phillips Wm W (Nell) civ eng h3043 Houston av Philmon Homer brklyr rl41 Colquitt Philmon Marvin P (Eliz) carp hl41 Colquitt Philmon Willie B sten Alex Blair rl41 Colquitt Phineze Henry (Ledonia) carp h201 Campbell av OVERLAND YATES MOTOR CO. FRANKLIN WILLYS-KNIGHT 707 THIRD ST. PHONE 1446 AUTOMOBILES Phoenix Cafe G L Temple mgr 504 Plum Phoenix Chas (Carrie) cook hl52 Lynwood av PHOENIX HOTEL, J D Brady Lessee, 3d sw cor Plum, Phone 285 (See page 70) Phoenix Matilda cook h rear 206 Cheatham al Pic and Pay Grocery (T H Timmons) 320 3d Picek M Mrs slsldy Burden Smith & Co r469 Spring Pickering Geo A mech Pan American Sou Petroleum Co h Mill av R D 3 Pickett Anne' student rl015 Clinton rd Pickett Carrie lndrs h203 Grant City rd Pickett Chas A (Agnes) mgr h307 Ross Pickett Eug M (Ida) clkMD&SRRCo hl015 Clin- ton rd Pickett Eug W (Louise) auto mech h307 Ross Pickett Ida M bkpr Electric Dry Cleaning Co rl015 Clinton rd Pickett Jas h59 Shell av Pickett Jerry (Annie) swtchmn h550 Hazel A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 726 (1925) R. L. POLK & CO.'S Pickett John carp hl42 North Pickett L Lee chemist rl015 Clinton rd Pickett Lula smstrs rl015 Clinton rd Pickett Sarah Indrs h222 7th Pickett Wm H jr mech Solomon Motor Co rl015 Clin- ton rd Picks Floyd C (Mary) rl39 Rembert av Pie Fenley ins agt r405 Madison Pierce see also Pearce Pierce Albert (Anna) linemn rl03 Washington av Pierce Clifford El (Birta) baggage agt Terminal Sta r245 Hardeman av Pierce Clifton trainmn r659 2d Pierce Cottage 1130 University pi Pierce Dessie slsldy Mrs Alice Easterday r307 Hillyer av Pierce Emma L (wid C F) hll20 Walnut Pierce Gordon I (Mamie M) mtrmn h2301 2d Pierce Henry (Emma) carp h204 Palace av Pierce Lewis barber rear M A Nolan ss Forsyth rd sw Riley avhRFDl Forsyth rd (V) Pierce Martha (wid A J) rl85 Virginia av Pierce Sallie pupil nurse Oglethorpe Private Infir- mary r do Pierce Sami hlpr Armour & Co Pierce Sarah F opr Sou Bell Tel Co rl85 Virginia Pierce Thos (Eddie) lab hl41 Middle (V) Pierce Wm L gro 767 Broadway r do Pierce W Lewis gro 19 Bellevue rd r do Piercy Jehu J lab r377 Monroe Piercy Sami E presser M G Bayne h377 Monroe Pierson see also Parson Pierson Annie student r3901 Houston av Pierson Benj H farmer rlOO Womack Pierson Benj M elk C of G R R Co rl21 Cleveland av Pierson Henry S (Mary) slsmn Macon Shoe Co rl03 Highland av Pierson John H (Anna) gro h3901 Houston av Pierson John H jr appr mach r3901 Houston av Pierson John S (Billie) slsmn hlOO Womack Pierson Ruth drsmkr rlOO Womack Pierson Stokes (Henrietta) lab hll04 (2) Elbert (SM) Piggly Wiggly, 414 Broadway, 201 Cotton, 462 and 474 2d Pilcher Geo W D tuner Cable Piano Co r Arcadia Hotel A natural by-product of the Directory business is the compilation of Mailing Lists, If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRD.UCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 727 Pilcher Howell R (Marie) asst mgr Life Insurance Co of Va r2810 Houston av Pilcher John E saw mill opr h237 Carling av (HH) Pilgrim Health &< Life Insurance Co R C Bailey agt in charge 556 New Pinckney David (Cora) lab h803 (141) Maynard Pines Edgar (Bertha) firemn h.408 Virginia la Pinholster Danl E (Maggie) elk Birdsey Flour Mills h2725 Houston av Pinholster Jas C stmftr r2725 Houston av Pinion Jeff farmer 1 Plumtree Pinkerton Frank student rll8 (8) Log Cabin dr Pinkerton Jas R student rll8 (8) Log Cabin dr Pinkerton Mattie (wid Peter H) hll8 (8) Log Cabin dr Pinkerton Robt A (Marion) elk P O h215 Log Cabin dr Pinkerton Roy H elk J B Riley Drug Co rll8 (8) Log Cabin dr Pinkett Charlott (Cora) carp r Louisa Jones Pinkston Ashberry (Belle) carp h236 (244) Fargason Pinkston Carrie dom rl23 Robinson rd Pinkston Cleveland (Rosa) lab h324 Curd's al Pinkston David S farmer h3 Mitchell Pinkston Gordon (Leila) lab h360 Hazel Pinkston Harris (Maud) furn pkr h217 (243) Farga- son Pinkston John D (Jewel) collr r403 Duncan av Pinkston Leo (Donelle) porter h236 (244) Fargason Pinkston Martha lndrs h218 Jefferson Pinkston Mary cook hllO Woodliff Pinkston Nathaniel chauf r454 Pine Pinkston Nora slswn Dannenberg Co r550 Woolfolk Pinkston Rebecca opr r560 Woolfolk Piper Eileen slsldy Burden Smith & Co r667 Mulberry Pippin Earl C (Irene L) mgr F W Woolworth Co h Log Cabin dr Pippin G T trav inspr r710 Pine' Pippin Raymond R (Laura) elk Am Ry Exp Co r260 Peachtree Pittman Agnes tchr rl31 Gordon (SM) Pittman Andrew O (Beatrice) slsmn Union Dry Goods Co h Habersham av (LP) Pittman Chas W (Patrica) trav aud h508 Ridge av Pittman Henry W (Mary L) h!17 Rogers av "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" *1 Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. Ii. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet 728 (1925) R. L. POLK & CO.'S Pittman Herman A (M Colita) meat ctr J F Pittman h757 Anderson Pittman John F (Lula) meats 1749 Broadway hl31 Gordon (SM) Pittman John H (Noami) meat ctr H B Sample hl05 Piedmont av Pittman Lenna (wid Walter D) r696 Courtland av Pittman Mary spinner r270 Main (EM) Pittman Mary J (wid Wm W) rll7 Rogers av Pittman Robt firemn r211 Broadway Pittman Wm A bkpr Swift & Co r Y M C A Pittman Wm B (Lois) optician C A Hilbun r702 Holt Pitts Abner C (Lillie) prop Pitts & Buxton Drug Co hll6 Pierce av (V) Pitts Alva lndrs r320 Williams Pitts Amy dom h244 Division St la Pitts Andrew (Louisa) lab h508 Maynard Pitts Berry (Pearl) hlpr hl32 Army Lot Pitts Chas car clnr h220 Pear Pitts Chas (Lizzie) lab h309 Straight Pitts Chas (Ida) lab h544 3d av (V) Pitts Chas N (Zephyr) tailor h415 3d av (V) Pitts Charlie (Louvenia) lab r501 E Academy (EM) Pitts Claudius porter Otto-Isaacs Harness Co rl27 Forest av (V) Pitts Dora dom h200 Kitchens Pitts Eliz (wid Jas) rl20 Grace pi (SM) Pitts Emma lndrs r902 Broad Pitts Enoch lab r307 Norris Pitts Eug (Kath) lab hl27 Forest av (V) Pitts Evelyn dom r320 Williams Pitts Fred porter L F M Store rl27 Forest av (V) PITTS FRED D (Ruth D), Mgr L H Burghard, hl37 Nottingham dr Pitts Geo lab h450 (464) 3d av (V) Pitts Harry (Alberta) lab h307 Short (EM) Pitts Hazel dom rl29 Grants Pitts Henry lab r735 Hall Pitts Homer carp h902 Broad Pitts Ida maid r544 3d av (V) Pitts Inez lndrs rl29 Grants Pitts Irene maid r309 Straight Pitts Jacob (Lizzie) lab h.610 Center Pitts Jas (Hattie) janitor Luther Williams Bank & Trust Co h!29 Grants R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 729 Pitts Jas lab r255 Plant Pitts Jas M (Mattie) lab h473 Alabama Pitts Janie r544 3d av (V) Pitts John farmer h320 Williams Pitts John lab h58 New Pitts John M (Mattie) farmer supvr rll6 Pierce av (V) Pitts John N (Henrietta) carp h358 Maynard Pitts Josiephene' cook h Lawton rd Pitts Lena rll6 Pierce av (V) Pitts Lillian slsldy L F M Store r209 Hardeman av Pitts Louise dom rl29 Grants Pitts Mattie r510 Maynard Pitts Myra L (wid C A) h209 Hardeman av Pitts Nancy lndrs h307 Norris Pitts Nathan carp r611 Maynard Pitts Ophelia nurse rl41 Frank al Pitts Raymond lab r611 Maynard Pitts Robt lab r611 Maynard Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Pitts Ross (Lillie) lab h366 Flanders (EM) Pitts Ruth student r209 Hardeman av Pitts Sally lndrs r358 Maynard Pitts Susie (wid Chas) pdlr h2 Bartlett Pitts Thos (Tessie) carp h602 Broad Pitts Ulysses H cold drinks res R F D Pitts Velma maid r309 Straight Pitts Vester dom r307 Norris $ P << Pitts Walter lab r204 (135) Neal av tfl Pitts Wm (Martha) carp h401 (121) Mitchell Pitts Wm lab rll5 Rose Crest av Pitts Wm J dept mgr L F M Store r209 Hardeman av Pitts Wm M (Mary) carp h204 (135) Neal av 2- Pitts Wm T (Elvina) slsmn Willingham Sash & Door Co h423 Forest av (V) cr Pitts Willie cook hl37 Forest av (V) (T Pitts Willis N (Roberta) elk h611 Maynard Pitts & Buxton Drug Co Abner C Pitts prop 364 Hardeman av FOR LISTS OF NAMES f ANY TRADE -- ANY BUSINESS -- ANY PROFESSION t- sa a " U j>etro!t 11. L. POLK & CO. Chicago 26 City Directory Answers AH Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 730 (1925) R. L. POLK & CO.'S Plant Geo H r629 Walnut Plant Graeme D (Eliz) sec-treas Macon Adv Service h207 Nottingham dr Plase Norman chauf r435 Douglas av Platt Harold A bkpr Wade & Co r207 Clisby pi Platt Jas bkpr G Bernd Co res R F D No 4 Platt Mary S (wid H A) h207 Clisby Player Sami T slsmn h533 Vineville av PLAZA HOTEL THE, Mrs Annie Powell Prop, Euro- pean Plan, Steam Heat, Elevator Service, Room Phones, Every Room a Batli, Reasonable Rates 510 Mulberry, Phone 4900 Pleasant Grove Baptist Church 400 Ballard Pleasant Hill School Zella Benton prin 323 Ward (V) Pleasapt Hill Seventh Day Advent Church 501 3d av (V) Pledger E A ship elk Am Bakeries Co r815 Cherry Plemmons Zade (Mattie) sawyer h310 (225) Pionono av "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsSDHifleriAEmgeyAIho,LytLuoYarTupn. rHrgdouYdFvmeeoo. nlcsraTtasiasthstiaritoicelsne.A,niNasoTtIDtfaHyaEUotdhhuYaSeenrEyagDAletPbrRhrYulyEegsOeigpdgRiUinsAntaNok'Llns-., Plez Ellla cook 520 (552) Oglethorpe Plezz Ida L cook rll2 (120) Roosevelt (V) Plumer's Creamery (R B Wadley) 2039 2d Plummer Luther (Cora) porter h306 Douglas Plummer Walter (Jessenna) lab h315 Patterson Plunkett John P (Ola) carp hll02 Napier av Plunkett Robt G (Portland) lawyer 26-27 Fourth Natl Bank bldg h ss Forsyth rd (V) 3 w Albernish Pi Plunkett Robt L electn Oetter Electric Co r406 Ross Plunkett Ruth r406 Ross Plunkett W Haze] sten R G Plunkett r406 Ross Plunkett Wm H (Ruth) meter rdr City Water Works h406 Ross Plymale R B tchr Mercer University r do Pocock Eliz r221 Forsyth Poe Eliz student r25 (1425) Lawton av Poe Geo lab r860 2d Poe Harry H collr r817 Poplar R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO MACON CITY DIRECTORY (1925) 731 Poe Hugh r25 (1425) Lawton av Poe John W (Annie) h25 (1425) Lawton av Poe Lila V (wid Wm A) h817 Poplar Poe Mary R r817 Poplar Poe Ouida tchr r25 (1425) Lawton av Poe' Paul cashr r25 (1425) Lawton av Poe Willie N r817 Poplar Poindexter Callie Mrs matron Mercer University r do Poland Dewitt (Ruth) drugs r319 Montpelier av Poland Fannie M (wid Dr Schiller B) h761 Mulberry Polenz Gustav (Johanna) umbrella repr 467 Cotton av h do Polhill Augustus J jr ins agt John E Wilson r284 College POLICE DEPARTMENT, M J Thompson Chief, City Hall Poline Jos (Rachel) driver hll2 Spring Polk Edgar tchr Mercer University r507 Adams Polk Evelyn opr Sou Bell Tel Co r2301 2d MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS POLK R L & CO, Publishers Macon City Directory, Woolworth Bldg 1826*4 3d av N, Birmingham, Ala, Library, Chamber of Commerce Pollard Wm (Carrie) firemn h816 Ash Pollock Ella r384 Monroe Pollock Hubert W train dispatcher rl06 2d Pollock Jas E (Sallie' J) firemn h430 Jackson Pollock London (Emma) gdnr h235 Ellis av Pollock Mattie tchr r235 Ellis av Pollock Wesleyan H dispatcher r208 2d Pond Wm lab r628 Washington av Ponder Allen T (Ella) barber hl27 Rembert av Ponder Allen T jr student rl27 Rembert av Ponder Amos (Alice) lab h342 Gilmer Ponder Amos jr lab r342 Gilmer Ponder Danl rll8 Green Ponder Edwin W elk Tatnall Square Pharmacy r467 Duncan av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &CG. Polk Directory ^ Bldg. Detroit, Mich. 732 (1925) R. L. POLK & CO.'S Ponder Ephraim D (Pearl) piano tuner h467 Duncan av Ponder Ephraim D jr appr r467 Duncan av Ponder John H (Mary) rllO Roff Home av (V) Ponder Mary dom r342 Gilmer Ponder Oliver lab r342 Gilmer Ponder Wade appr r467 Duncan av Pool Antoinette tchr r305 Fort Hill Pool Jack (Shirly) lab h50 Turpin Pool John T (Addie) gro 170 New hl57 do Pool Mollie' dom rl40 Division Pool Rosa C cashr r305 Fort Hill Pool Sarah F student r305 Fort Hill Pool Wesley S (Daisy) dep sheriff Municipal Court h305 Fort Hill Poole Albert (Lena) stone ctr rl310 2d Poole A Lionel stkmn Morris & Co r7 Glynn av Poole Bernese rll7 Jones Poole Collie sten rl37 Charles Poole Clifford (Jessie) driver r611 Montpelier av Poole Della (wid Wm A) matron Vineville Kings Daughters Home r207 Rogers av Poole Frances student rl37 Charles (SM) Poole Jas A (Lena R) stone ctr E H France rl310 2d Poole John elk Blue Front Lunch Room r Y M C A Poole John E carp rll7 Jones Poole Jos C (Beulah M) cond hl37 Charles (SM) Poole J B msngr Coml Credit Co rl37 Charles (SM) Poole Legn r611 Montpelier av Poole Walter C lab rll7 Jones Poole Wm J chf spl agt C of Ga Pope Bertie elk rlOl Emory Pope Bessie student rll (111) Wis av (V) Pope Bruce G (Nollie G) barber Flynt & Genone hlOl Elmory av Pope' Chas W asst tchr Mercer University r do Pope Elder (Willie) driver hl46 2d av (V) Pope Gertrude r230 Tatnall Pope G Raymond (Emma) barber Flynt & Genone h 116 Latta pi Pope Jas M (Ena) cond h618 Oak Pope Lizzie Indrs r411 (311) Hall Pope Olivia (wid W H) rl9 Arlington pi Pope Otis wood pdlr r204 Elliott (EM) Pope Susie (wid W Alex) r516 Oglethorpe KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vz% on Savings MACON CITY DIRECTORY (1925) 733 PPoopppeWLomuis(Amnencihe)GsHwtPcahrmrinshhrl5l5(2HOIa)kWise av (V) Poppell Henrietta (wid John E) gro 233 Cedar h do Poppell John (Beulah) slsmn hl304 2d popper Harry S (Blanche) r866 Mulberry Popper Jos W (Marjorie; Harris Harris & Popper) hll3 Buford pi Popper Stephen h866 Mulberry Porter Alberta (wid Henry) h349 Middle (V) Porter Annie E student r756 Pine' Porter Claude (Mosella) lab h318 Edgewood av Porter Dicie lndrs r217 Linden av Porter Edith student r349 Middle (V) Porter Ernest C elk Dixie Fireproofing Co r756 Pine Porter Esau (Serene) porter h74 Schofield Porter Fred (Beatrice) lab h9 Cherokee av (SH) Porter Fredk (Bessie) lab hl07 (9) Braswell la Porter Geo rlO Smith (SM) Porter Geo P (Mabel) elk Sou Ry System r756 Pine Cs3 Pfl CO a SOUTH'S LEADING FLORISTS P? *oTl IDLE HOUR NURSERIES W ' Porter Georgia lndrs r838 Fort Hill Porter Idabelle h805 Mulberry Porter Jas E (Secrena) gdnr J T Oliphant r74 Scho- field Porter John (Rosalie) lab h899 (775) Maynard Porter John A (Annie) mgr h Nottingham dr Porter John L lab r899 (975) Maynard Porter J Clifford (Tiny) slsmn Jones Motor Co rl29 Pierce 3/v n n Porter Kittie J cook r70 Schofield Porter Mabel sten Day's r314 New n Porter Mabel F student r756 Pine Porter Melissa student r349 Middle (V) Porter Riley (Farncis) firemn r476 Alabama Porter Robt porter Harry The Tailor r7 4 Schofield Porter Ruby B lndrs r899 (975) Maynard Porter Son (Fannie) lmbr stacker h464 May av Poses Jas (Sarah) carp 128 Yates av (EM) Posey Bessie spinner r667 Elm / . ,'fok lists of names ANY TRADE ANY BUSINESSr -- ANY PROFESSION j | g DETROIT^ R. L. POIxK & CO. CHICAGO. FOR JLISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L.. POLK & CO. CHICAGO 734 (1925) E. L. POLK & CO.'S Posey Bradley chauf rl032 Broadway Posey Cottage 1128 University pi Posey Laura (wid Jas) h667 Elm Posey 0 C yard agt rl04 Cole Posey Sarah boxmkr Tomlinson Paper Box Co rl29 Yates av Post Wm G phys 905 Ga Casualty bldg r374 Orange POST OFFICE, J H Bailey Postmaster, Mulberry ne cor 3d POSTAL TELEGRAPH-CABLE CO, F B Gabriel Mgr, 451 Cherry, Phone Call "Postal" Potter Chas (Berta) blrmkr h806 Edgewood av Potter Ernest lab r438 Hammond Potter Fannie B (wid Avanda) r430 Beech av Potter Jas W (Ina) mill wkr h24 Manchester qtrs Potter Lamar r806 Edgewood av Potter Ras G (Eva) pntr hll2 Gant Potter Winnie mill wkr r24 Manchester qtrs Potts Daisy elk r301 Main (EM) Potts David M electn Morris Uutzel Potts Florence sten J D Carlisle r6 Glynn av Potts Henrietta (wid Robt) r301 Main (EM) Potts Julian (Effie) mech h6 Glynn av Poulos Angelo (Adams & Poulos) r Edgerton Hotel Poulos Dennis mgr Siher Moon Cafe' r709 Walnut Poulos Geo (Kate) restr 314 3d h653 Oak Pound David (Cora) lab h804 Fort Hill Pound Felton B (Ida M) trav slsmn h307 Hillyer av Pound Ike delivery boy r24 Williams la Pound Jas (Bessie) hlpr h801 (2845) Colquitt Pound Julian R (Myrtice) barber hll7 Lamar Pound King (Henrietta) hlpr r24 Williams la Pound Mattie cook r24 Williams la Pound Moe elk Hatcher-Turpin Co r307 Hillyer av Pound Myrtice Mrs nurse City Health Dept hll7 Lamar Pounds Danl h rear 609 4th av (U) Pounds Georgia lndrs h219 Jordans al Pounds Wm (Willie M) porter Gulf Refg Co rl014 Ocmulgee Pounds Willie lab r219 Jordans al Powell Anna (wid J Frank) prop The Plaza Hotel h202 (855) Mulberry Powell Arrie (Annie) lab h536 Flanders (EM) Powell Beulah (wid Guy M) r2 Nevaro Flats 0. D. JAMES ' GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 735 Powell Chas M jr (Drusilla) pres Birch Insurance Agency r322 College Powell Della cook r238 Georgia av Powell Edw carp h702 3d av (V) Powell Edw O pres-treas Peoples Health & Life In- surance Co r659 Spring Powell Elisha C (Pauline) asst supt Carolina Life Insurance Co rl35 Academy Powell Ella (wid Jas) dom rl09 (110) Roberts Powell Frances r202 (855) Mulberry Powell Fred C (Conia) carrier P O hl35 Academy Powell Geo T (Dorothy) mech hll7 Beech av Powell Homer R (Mary) formn h659 2d Powell Howard H (Annie M) electn r568 Walnut Powell Jos (Rosalie) rll42 Broadway Powell Julia F (wid Frank) h509 Hawthorne Powell Juliet (wid Harney T) h!05 2d Powell Louise sten Ga Quincy Granite Co r2 Nevaro Flats MACON OPTICAL COMPANY rrank H. Johnson U- pti ci ans c*s ?v Optometrists 468 CHERRY PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Powell Lanty J (Lily M) pipeftr h2022 2d Powell Nina dom r20 Siam Powell Ozo K (Kath)' electn h776 Walnut Powell Roy lab hl24 Bright al Powell Ruby h355 Elm Powell Ruby cook r536 Flanders (EM) Powell Sami (Rosa) carp h533 (17) Plumtree Powell Sarah E (wid Geo W) r909 Cherry Power Luther R (Lula H) trav slsmn h213 Clisby Power Luther R jr student r213 Clisby Powers Edw lab h203 Forest av (V) Powers Emma hl08 Forest av (V) Powers Fredk F (Ellen) coml agt Ga R R hl23 Culver Powers Hannah rl68 Riley av (CP) Powers Herman (Annis) mech h40 (540) Clayton Powers John (Minnie) hl93 Hawkins av Powers John R elk Triangle Service Co r306 Wash- ington av Powers Jos B (Fannie) phys 168 Riley av (CP) h do The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Drink in Bottles TELEPHONE 287 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE 1ft ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 CJ 736 (1925) R. L. POLK & CO.'S Powers Julia H r4 Forsythe ter Powers Lucille rl68 Riley av (CP ) Powers Ollie lab r540 Flanders (EM) Powers Rena h553 Cotton av Powers Rena lndrs h553 Dunlap al Powers Sarah E (wid Jos C) h2637 2d s Powers Thos (Eva) draymn hl35 Adams Powers Virgil School Minnie C Robertson prin 1200 2d Powers Wallace (Jessie) h531 Cotton av Powers Wm (Marie) cabtmkr h355 Boardmans al Powers Wm pressing club 438 Alabama h415 Pine Powers Wm B ship elk r4 Forsythe ter Prater Chas H (Galbert's Candy Land) r464 Cherry Prater Julia lndrs h200 Astor (EM) Prater Warren (Cornelia) brklyr h204 Turpin Prater Wm (Bertie) h712 Hawthorne Prather Wm (Rena) h744 Oglethorpe Prator Daisy nurse r808 Orange Prator Pearl A (wid W Glenn) h207 Hines ter (V) Prator Wm M (Maude A) barber Palm Barber Shop h808 Orange Prator W Glen slsmn Reis &Armstrong r207 Hines ter Pratt Angie dom h817 Broadway Pratt Chas F (Susan) mech h448 New Pratt Chas 0 (Mary; High Point Mineral Wells) h High Point Pratt Jas elk Terminal Pharmacy r448 New Pratt Parks W (Emma) carp h209 Park av (CP) Pratt Sadie slsldy L F M Store r448 New Prentiss Louise r419 Johnson av Prentiss Marshall jr elk r419 Johnson av Prentiss Mildred student r419 Johnson av Prentiss Otis G (Mary J) agt G S & F Ry Co h419 Johnson av Prentiss Otis L traffic agt Sou Ry System r419 John- son av Prentiss Rhett sten H D Chapman & Co r419 Johnson av Prentiss Wm C elk r419 Johnson av Presbyterian Church cor Highland av and Log Cabin dr Prescott Lucile pupil nurse Oglethorpe Private In- firmary r204 Tatnall Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of AH Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 737 Presley Bessie sten Coml Credit Co r966 Eilm Presley Harry M (Belle) carp hl36 Charles (SM) Presley Ruby slsldy W T Grant Co h966 Elm Preston Chas porter L N Carmichael r489 Singleton la Preston Charlie J (Jannie) hlpr h257 Ocmulgee Preston Chas M (Odelle) h279 College Preston Cornelia (wid Thos) h224 Applewood Preston C McDowell jr student r279 College Preston Della lndrs r207 Tindall av Preston Dora maid Union News Co h498 Singleton la Preston Edw lab r202 Tindall av Preston Geo H (Martha) acct hl04 Madden av Preston Henry C (Nancy) mill wkr hl54 Comer ter Preston Jas E (Ruth M) asst supt Central Cotton Oil Co hl510 3d Preston Jos driver Enterprise Packing Co Preston Mary (wid Chas) lndrs r825 Columbus rd Preston Pearl rll05 Oglethorpe Preston Rogers (Annie) lab h608 Division Preston Robt (Annie) lab rl230 1st Preston Susie Mrs smstrs rl017 Hazel Preston Thos S (Effie) opr r224 Applewood Preston Vennie' r858 Elm Prewett Ossie L cook rl80 W Boundary Price Blanche Mrs h367 Walnut Price Blummie lab r502 Elbert Price David formn h538 E 2d Price Emma T tchr r538 E 2d Price Evangeline baker Am Bakeries Co rl924 2d Price Ezra (Mary) brick mason hl018 Ocmulgee Price Geo (Minnie) porter rl08 (120) Richard Price Geo G (Winnifred) slsmn Yates & Tabor Co h 118 Pierce av (V) Price Geo G jr mgr rll8 Pierce av (V) Price Getrude slsldy Singer Sewing Mach Co Price Henry lab h5 Mitchell Price Henry student r538 E 2d (EM) Price Jas formn W E Dickey Clay Mfg Co Price Jas I elk A & P Tea Co r720 Plum Price Jas P elk Am Bakeries Co h720 Plum Price Jessie L bell boy r502 Elbert Price John P mgr Proctor & Gamble Co r201 High Price J Corbett (Jewel) mach r431 Carling av (HH) Price J Hollis student r41 Marion pi (HH) Price Levata hlpr rl221 2d ANhY TRADE ^ LAINSYT BUSSINO ESSF -nAaNm Y PReOFsESSION j^TROlT R.JL. POLK & CO. cmrAnn Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5X01 73S (1925) R. L. POLK & CO.'S WORLD Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MlkaCo PUBLISHERS Price Lottie tchr r538 E 2d Price Lula (wid W H) r965 Walnut Price Mamie lndrs h502 Elbert Priee Marvin (Willie' M) eng r717 1st Price Mary lndrs rl38 (141) Sycamore Price Mary L (wid Sylvester B) h225 High Price Millie (wid Idus) h41 Marion pi Price Minnie L smstrs r306 Ward (V) Price Patk H collr A G Rhodes & Son r662 Hawthorne Price S B: Free Library Minnie F Rice Librarian Or- ange sw cor 1st Price Thos M (Virginia) dist mgr h856 Orange Price T B rll5 Rose Park Price Wm E tchr r538 E 2d (EM) Price Wm L elk rll8 Pierce av (V) Price Zula lndrs h621 Gilmer Prichard Simeon (Anna) agt hl26 Log Cabin dr Prichett Thos W (Bessie C) elk r696 College Priddy Belle (wid Edw) r469 Spring Pridgen Guardrow (Helen) dept mgr Kinnett-Odom Co h ns Forsyth rd (V) 4 w Riley av Pridgen John J (Ida) h425 Ridge av Pridgen John J jr slsmn r425 Ridge av Pridgen Serena r425 Ridge av Pridgett Sami pntr r421 Oak Priest Brilla (wid John) r321 Pionona av Priest Della Mrs h31 Manchester qtrs Priester Chas E (Mae) cond hl42 Charles (SM) Prim Jas E (Laura) solr H T Tabor h357 Church (EM) Primitive Baptist Church Rev Wm Warren pastor 100 Bay Primitive Baptist Church 2620 Broadway Primitive Baptist Church 401 S College Primitive Baptist Church Rev J A Monsees pastor 1000 Clinton rd Primus Abram deliverymn rl36 (150) Lincoln av (V) Primus Louis (Samantha) lab h Industrial Home rd Primus Lula cook hl36 (150 Lincoln av (V) Primus Mary lndrs r Louis Primus Prince H de S (Clara) credit mgr A G Rhodes & Son rl26 High Prince Jos (Annie) carp h292 Astor (EM) PRI1VCE LOYD B (Irene), Manager U-Drive-It Sys- tem, h Central City Hotel PolEDirectaryMi DETROIT i A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 739 Prince Mary (wid Cicero) h222 Shamrock Prince Sylvanus (Emma) whse mgr T C Burke Inc hll09 Oglethorpe Pringle Chas E (Virginia) flremn r613 1st Pringle Eliz student r405 Duncan av Pringle Harold msngr PO r405 Duncan av Pringle Ida (wid Robt) r405 Duncan av Pringle Paul J appr Taylor Iron Works & Supply Co r456 New Pringle Robt L (Pauline) trav slsmn h456 New Pritchard Annie M lndrs r523 Army Lot Pritchard Chas H mgr Volunteer Pharmacy r554 1st Pritchard Claudius (Gladys) auto mech r535 Georgia av Pritchard Davis G (Hazel) pres Central City Security Co h555 Elm Pritchard Hannie (wid L N) h250 Hardeman av Pritchard Harriett dept mgr Burden Smith & Co r250 Hardeman av Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Pritchard Simeon L (Anna) mgr Internatl Correspondence Schools h Log Cabin dr Pritchett Edw T (Annie) eng h333 Clinton Pritchett Eug B multigraph opr Ga-Carolina Lmbr rl39 Rembert av Pritchett Frank R (Mary E) hl426 2d Pritchett Henry T (Mary) mech hlOO McGee Pritchett John (May) lab hll9 (117) Fatnall la Pritchett Luther P (Louise) carp h2169 2d Pritchett Rachel (wid John L) hl39 Rembert av Pritchett Ruth sten Dunlap Huckabee Auto Co Pritchett Wm S ins agt h911 Orange Procter J pntr r460 Mulberry Procter & Gamble Co John F Price mgr soap mfrs 301 Hazel Proctor Anderson P shoe repr 363 Hazel hl03 (15) Mason (SM) Proctor Chas lab rl28 Sherman dress IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 Q c o wJ0-2j j0ju2j < d 13 e a w a B (/> fig u o5 J2-M HSU 5 sg aX > ^ -* Zf Q ^ 2 |S5 wHo >>c*o >HcwMo On Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE m ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 o U 768 (1925) R. L. POLK & CO.'S Roberson Martha (wid J Thos) rl04 Cedar (SM) Roberson Mary r!04 Cedar (SM) Roberson Mary r322 Hardeman av Roberson Nehemiah lab r205 Ward Roberson Noah (Mittilee) lab h421 E 2d Roberson Noner (Eva) chauf h222 Elliott (EM) Roberson Norwood tchr r322 Hardeman av Roberson Sami (Emma) lab h205 Ward Roberson Wm (Mamie) lab h7 Sparks al Roberson Wm J carp rl04 Cedar (SM) Roberts Abram lab r523 Army Lot Roberts Andrew (La'ura) lab h407 (307) Hall Roberts Ann r516 Ocmulgee Roberts Arth carp r500 Chappell Roberts Arth N slsmn J P Allen & Co r301 Cherry av Roberts Augusta L (Doris) auto mech h208 Sixth av (SM) Roberts Augustus (Choiney) lab h506 Elbert ROBERTS BAYARD (Fay), Asst Cashr Macon Na- tional Bank, k419 Beech av, Phone 344-W Roberts Calvin W (Eliz) mech h206 Forsyth Roberts Carrie (wid John J) hl60 Emory Roberts Cecil H (Nannie) autos 217 3d h414 College Roberts Chas B (Kath) slsmn Burden Smith & Co h 472 Beech av QC & Roberts Chas E (Lillian S) cotton mfr h610 College Roberts Chas H lab h511 E Academy Roberts Chas M (Mary E) restr 324 Main h327 Clin- ton Roberts Chas M jr elk r327 Clinton Roberts Charlie mech r500 Chappell Roberts Clarence C auto mech rll7 Nelson Roberts Clarence F (Viola) carp hll7 Nelson Roberts Cleo N (Velma) bkpr Cit & Sou Bank hl024 Clinton rd ROBERTS COAL & TRANSFER CO INC, L A Roberts Pres, L M Roberts Sec, 0 A Roberts Treas and Mgr, Retail Coal, Grading and Hauling 361 Oak, Phone 2686 Roberts Cornelia (wid John) lndrs h212 Henrietta Roberts Daisy maid h451 Barracks al Roberts Drew M (Percy) boarding 555 2d h do Roberts Edgar porter r!15 4th av (PH) 03 o' mtAeuarsntoyfmokoribnaidllels koiofnwdmsneeorrcfshAaanurdteoismeso. eblieSlecetnId.ipsttroos.sHpeeOacudtsrqnufeaowr-r o eCaPtya-log contains much valuable data. Ask for R. L. POCK & CO., DETROIT, MICH. The Buying of Office Supplies and Stationery Means a Lot of Future Satisfaction for You sr THE J. W. BURKE CO.'S STORE, 406 Cherry St. CRESCENT LAUNDRY CO. undry Work, Dry Cleaning and Dyeing Always Reliable MACON CITY DIRECTORY (1925) 769 Roberts Edgar H r555 2d Roberts Eleanor cashr Union Dry Goods Co r461 New Roberts Eliz E (wid Luke) hl34 Williams Roberts Eliz S (wid Jas) hl03 Nelson Roberts Ella (wid Jeff Davis) h451 Center Roberts Ella Indrs h523 Army Lot Roberts Emily Mrs slsldy Dannenberg Co r521 John- son av Roberts Eula elev opr r211 (177) Lincoln av (V) Roberts Felton lab r407 (307) Hall Roberts Felton (Alma) lab h228 Turpin Roberts Frank (Ella) h643 Forsyth Roberts Frank opr r451 Center Roberts Geo (Roxie) gro 700 Broad r202 Fort Hill Roberts Geo A elk P O r301 Cherry av Roberts Geo C (Pearl) slsmn Stewart Oil Co hlOl Crisp Roberts Geo M (Maybelle) chf opr Postal Tel-Cable Co hlOl Crisp Roberts Geo W (Lois) elk Holbman's Pharmacy h268 Center Roberts Geo W mech rll6 Colquitt Roberts Gussie h559 Cheatham al Roberts Hal (Anna) lab hl'07 Bennett al Roberts Hansel student r363 College Roberts Harriet P Mrs sec Empire Candy Co Roberts Hasta Indrs r522 Northern Roberts Henry auto mech rll7 Nelson Roberts Herman (Pauline) hl84 English av Roberts I Brazeal (Alma) gro 1650 Broadway rll6 Chappell Roberts Jas (Rebecca) lab rl57 Elizabeth Roberts Jas (Lovie) mill opr h4 Shell av Roberts Jas B police h402 Fort Hill Roberts Jas L (Lillie) stonectr h3 Violet av Roberts Jas R (Willa) elk Wright Auto Supply Co h 207 Fort Hill (EM) Roberts Jay C vulcanizer r668 Walnut Roberts Jesse (Lena) pdlr h345 Hydrola Roberts Jesse C mech r207 Fort Hill Roberts John blksmith S J Snead Roberts John (Rebecca) lab h703 Hammond Roberts John lab r211 (177) Lincoln av (V) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO cn m si "ip r Z Dunlap-Huckahee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DIMS 770 (1925) R. L. POLK & CO.'S as a Roberts John lab h.225 Shamrock Roberts John (Leona) lab h598 (506) Smith (EM) MMEI Roberts John H bkpr Bibb Grocery Co r419 Beech av Roberts John H (Annie) carp h500 Chappell PLACE Roberts John H (Mabel) mach h663 Walnut Roberts John L (Lottie) elk Arcade Billiard Parlor h ss Forsyth rd (V) 3 w Oak av THE DIRECTORY Roberts John O (Lemma) candy mkr h318 Chappell Roberts John W pres-treas Adams Bros Co r363 Col- lege IS THE GREATEST Roberts John Y lawyer 614-18 Ga Casualty bldg r254 Hardeman av Roberts J Chas del boy Ga Gro Stores r511 Academy (EM) MARKET PLACE IN THE Roberts Kate I (wid Benj T) h212 Pierce av Roberts Kate M student r212 Pierce av (V) Roberts Kath M (wid N C) r620 Montpelier av Roberts Laetus mill opr r26 Bellevue rd Roberts Lafayette elev opr r4 Gustin pi Roberts Lamar (Callie) caller rl724 2d WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had Roberts Lillie maid r706 (108) Crisp Roberts Lizzie hskpr 810 Mulberry Roberts Lizzie lndrs h9 Ford al Roberts Lizzie maid h211 (177) Lincoln av (V) Roberts Lois A pres Roberts Coal & Transfer Co Inc r Ridge av Roberts .Luther student r500 Chappell Roberts L Marvin sec Roberts Coal & Transfer Co Inc r212 Pierce av Roberts Margt elk Union Dry Goods Co r402 Fort Hill av Roberts Marguerite elk Union Dry Goods Co r461 The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year R'LPokaCo PUBLISHED New Roberts Martha r643 Forsyth Roberts Mary (wid John W) r701 Anderson Roberts Mary student r327 Clinton Roberts Mary E (wid Geo) hll6 Colquitt Roberts Mary J (wid Wm S) r456 Beech av Roberts Mary M rll'6 Chappell Roberts Mattie (wid Madison) h4 Gustin pi Roberts Mattie A (wid B F) h207 Oak Haven av Roberts Montine mill opr r26 Bellevue rd Roberts Moses (Macie) lab h427 Elliott (EM) PoIkDirecbwjSDfi DETROIT ; ^ -MICH* / I A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 56934 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 771 Roberts Nickolas L (Louise) mgr Standard Oil Filling Station hll9 Coleman av Roberts Orvis A (Lois A) treas-mgr Roberts Coal & Transfer Co Inc hl401 (1109) Ridge av Roberts Para Lee lndrs r703 Hammond Roberts Raburn cashr Fidelity Mut Life Ins Co r805 Mulberry Roberts Robt W h204 Virginia av Roberts Sadie B r511 E Academy Roberts Sami (Annie) lab h3 Bright al Roberts Sami (Mary) mill hd hi Manchester qtrs Roberts Sami B firemn r402 Fort Hill Roberts Susia lndrs r8 Reynolds al Roberts Thos M (Stella) elk h701 Clinton Roberts Vivian H (Bettie) elk Superior Court h314 Buford pi Roberts Vowlin C (Mittie) ins agt h26 Bellevue rd Roberts Wadis A (Ava) chf caller Sou Ry h2609 Broadway <2 p O 5C0L Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Servioe Roberts Waldron E (Elsie) carp hl04 Harold Roberts Warren (Camille) investments h632 College m Roberts Wm (Emily) farmer r521 Johnson av O Roberts Wm (Josephine) lab h300 (11) Henderson Roberts Wm mech rl!6 Colquitt pi Roberts Wm H r4 Gustin pi (V) Roberts Wm L (Lizzie) formn Southeastern Com- press Whse Co h26 Rose pi Roberts Wm M (Evelyn) hl23 Birch pi z in Roberts Wm T (Louisa) bkpr Dickey Auto Supply Co r501 Vineville av Roberts Wm T slsmn r555 2d Roberts W Alton elk Vineville Drug Co r212 Pierce av Roberts W Radford (Pauline) carp r207 Fort Hill Robertson A J (Annie) lab rl206 3d Robertson Bernard (Beatrice) flagmn h.761 Oak Robertson Bert (Mattie) farmer h315 Womack o 5 o oo 2 z H z H HaLL.>o C>HO oQ i z < *5g CQ |-5 Lj. QS a. < 05 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 772 (1925) R. L. POLK & CO.'S Robertson Blackley slsmn Wilson & Co r283 Hillyer Robertson Chas (Mollie) lab h845 Fort Hill Robertson Cooper (Sallie) lab r213 Elliott (EM) Robertson David lab r225 Elliott (EM) Robertson Edw B (Willie) hl66 Virginia av Robertson Geo B (Sarah) slsmn r267 Hillyer av Robertson Herman W (Nell) cond hll5 Rose Park Robertson Horner F (Dettie) mill hd h32 Bibb av Robertson lone slsldy Burden Smith & Co rllO Laurel av (NH) Robertson Jack C (Lois M) optician J H Spratling h451 Spring Robertson Jas L driver r354 (322) Mutual av Robertson Jas O (Gertrude) lmbrmn hl412 Edge- wood av Robertson Joel student r451 Duncan av Robertson John presser r8T9% Broadway Robertson John J elk Dempsey Haberdashery r24U Chappell (SM) Robertson J E mech r474 Orange Robertson Kate h354 (322) Mutual av Robertson Lafayette presser rl23 Sycamore Robertson La'ura wood pdlr h204 Elliott (EM) Robertson Lewis mill hd r32 Bibb av Robertson Lois Mrs sten Williams Mfg Co r451 Spring Robertson Lucia tchr r554 1st Robertson Mamie dom r444 Ballard Robertson Marius G (Odessa) pres-gen-mgr Sou Un- derwriters Co h819 Beech av W (HH) Robertson Mary maid h303 Burnett (EM) Robertson Minnie C prin Virgil Powers Sch rl29 Cul- ver Robertson Sarah M Mrs sten Harris, Harris & Popper r267 Hillyer av ROBERTSON THOMAS C (Clara), Pres Bankers Finance Corp, h451 Duncan av, Phone 3725-W Robertson Tommie dom 11819% Broadway Robertson T Hulon (Ethel) mgr T I Harris & Co hl06 Delaware av Robertson Wm (Sassie) lab h474 (174) Ballard Robertson Wm (Annie M) lab h3 Moore al Robertson Willie E student r613 Arch Robertson Willis L elk Eagle Hotel r853 Oak Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 . HUNNICUTT CLOTHING CO. A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 773 Robertson Windell A (Ethel) elk Peeler Hardware Co h613 Arch Robertson Windell A jr hlpr r613 Arch Robie John (Missie) lab r218 Wings Hill Robinson Ada dom r Emma Jackson Robinson Andrew H (Jessie) eng h871 2d Robinson Annie lndrs hl31 Middle (V) Robinson Augustus (Mattie) lab hl05 Empire av Robinson Augustus (Nanie) lab h610 3d av (V) Robinson Augustus P hlpr S M Solomon jr res R D 2 Robinson Benj L (Minnie) auto mech hl07 Enterprise Robinson Carlton (Anna) wtchmn h630 Forsyth Robinson Chas W (Roberta) cond h.851 Oak Robinson Clarence (Emma) lab hl50 Short la Robinson Edgar (Ruth) lab r322 Hammond CR Robinson Edw (Lucy) lab h!66 Plummer's al YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Robinson Effie Mrs gro h2032 3d Robinson Ella lndrs hl05 Mulberry Robinson Ella maid r303 1st av Robinson Ellen lndrs hll5 Cherry Robinson Elmer B auto repr r2032 3d Robinson Emma lndrs r207 Division Robinson Ethel student r630 Forsyth Robinson Etholia student rl28 Grants Robinson Eug auto mech r3, 474 Orange Robinson Fredk lab r405 (542) Stevens Robinson Geo F h556 Pine Robinson Georgia caterer h313 Telfair CO Robinson Harvey (Georgia) driver h315 Corbin av Robinson Hattie (wid Luther) h Industrial Home rd Robinson Henry (Belle) h485 Craft la Robinson Herbert W (Annie E) h611 Holt av Robinson Hester (wid Robt) h Robinson rd nr Bond Robinson Howard lab r641 Elm al Robinson Jack (Lizzie) restr 315 Telfair h do Automobile owners are select prospects for many kinds of merchandise. Send, to Headquar- ters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for CP a copy R. L. POLK & CO., DETROIT, MICH. NORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 774 (1925) R. L. POLK & CO.'S Robinson Jas lab r!08 May (U) Robinson Jas (Willie) lab h214 Nussbaum Robinson Jas sten r465 Woolfolk Robinson Jas M lab h809y2 Pine Robinson Jennie sten r424 American blvd Robinson Jewell lab r904 Hazel Robinson Johnnie maid r585 Craft la Robinson Jos tchr Mercer University h505y2 Adams Robinson Joshua (Ida) mech h Robinson rd Robinson Julia nurse 18 Clinton Robinson J M sten Cudahy Packing Co Robinson Katie Indrs r904 Hazel Robinson Lige (Collie) lab r916 Atlanta av (SM) Robinson Lina r641 Elm al Robinson Louis (Julia) lab hl07% (105) 2d av (V) Robinson Luke student r309 Georgia av Robinson Mabel cashr Union Dry Goods Co Robinson Mabel elk Burden Smith & Co r556 Pine Robinson Mack lab r485 Craft la Robinson Mamie dom hl03 Massee la Robinson Marlin student r630 Forsyth Robinson Mary r322 Hardeman av Robinson Mary h820 Ocmulgee Robinson Mary Indrs h318 (18) Bowman Robinson Mary maid r359 Hawthorne Robinson Mattie cook r310 Madison Robinson Maybell elk r240 Chestnut Robinson Minnie maid h641 Elm al Robinson Myrah cook rl28 Sycamore Robinson Norwood (Julia) r322 Hardeman av Robinson Odessa cook r718 Campbell av Robinson Odio (Sarah) lab r248 Broad (EM) Robinson Orielee r405 (542) Stevens Robinson Oscar (Lola M) pntr h497 Hall Robinson Rich (Minnie) h405 (542) Stevens Robinson Robt J (Ora) lab r332 Monroe Robinson Sadie Mrs nurse r240 Chestnut Robinson Sallie dom hl28 Kahn's al Robinson Sallie E (wid Jas) rl02 Heard Robinson Sarah E Mrs h230 Tatnall av Robinson Stanley L (Ottilie) tchr Mercer University h315 Coleman av Robinson Thos lab r320 Cheatham al Robinson Tiny Mrs millwkr r50-5.1' Davis More goods are bought and sold through the Classified Business Lists of the Directory that any other medium on earth. IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. MACON CITY DIRECTORY (1925) 775 Robinson Tommie L student r851 Oak Robinson Wallace lab r585 Craft la Robinson Walter R (Annie) brklyr h371 Madison Robinson Wilfrid formn Hammond Oil Co h611 Holt av Robinson Wm (Savannah) chauf h344 Patterson Robinson Wm (Carrie) janitor h326 Lexington av Robinson Wm (Julia) hl47 Bartletts Robinson Wm (Sarah) lab h421 (1313) Steins al Robinson Wm H (Emmie F) meats 1002 2d hl016 do Robinson Wm H (Georgia) truck formn h424 Ameri- can blvd Robinson Wm J (Etta) hll4 Park pi Robinson Willis L elk r853 Oak Robinson Willis L jr waiter r853 Oak Robinson W J carp W S Dickey Clay Mfg Co rl04 Cedar Robison Doctor r237 Jones Robison Howard (Nancy) driver h202 Railroad av Robison Isiah (Laura) chauf r554 (3) Chestnut la Robison Wallace (Alice) lab h2 Gunn's al ROBSON EYANS (Bessie), Treas Kinnett-Odoin Co, h Woodlawn av opp Osborne pi, Phone 9088 Rockens Laura cook h Lawton rd Rockmore Allen carp h260 Broad Rockmore Annie (wid Wm) hll6 Stratton Rockmore Annie M smstrs r.1'16 Stratton Rodgers Alfonzo T (Mary) spl agt h809 Clinton Rodgers Chas E mech r222 Bright Rodgers Claude' S (Roberta) mgr Atlanta Life Ins Co h515 Monroe Rodgers Claudie Mrs h757 New Rodgers Edwin R (Mary) slsmn r568 Walnut Rodgers Eva M cashr Dannenberg Co r757 New Rodgers Geo T (Fannie) carrier P 0 h602 Duncan av Rodgers Jos T (Laura) saw flier hl30 Plant Rodgers Katie elk r360 College Rodgers Louis W formn r460 Hazel Rodgers Martha L slswn Dannenberg Co r757 New Rodgers Minnie millwkr r222 Bright Rodgers Nellie r602 Duncan av Rodgers Robt (Mary) dep sheriff r26 Progress Rodgers Simpson B (Edna) car repr hl02 (104) Randolph pi Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoismeso. eblieSlecetnLdipstrtoso.sHpeeOacudtsrqunfaeowr-r cCoaptya;l:og coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, sMkICfoHr. W. R. Finch Motor Co. POLK'S dental I^URfwt-CtTeHagnIKsaiDtdsaatVteEeArs M19!:*2a5cc ?*ECIOUS pfSe^TtFaORlMs Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 776 (1925) R. L. POLK & CO.'S Rodgers T Furlow (Martha) filling sta 2915 Houston av rll4 Lamar Rodgers Wm (Sarah) cement fnshr hl56 New Rodgers Wm R formn City Stockade r859 Cherry &RCeAnTtIaOlN Rodman Ida (wid John S) rl26 Cleveland av Rodney Kate (wid Wm) h2 Violet av Rodney Wiley blrmkr r2 Violet av Rodriguez Cayetatiro 0 (Virginia) storekpr1 Citv Water Wks r484 Orange POLK'S Rogero Chas J (Mamie) elk T M Donnelly Co h711 Holt av Dental Rogers Alice lndrs h405 (307) Charles (SM) Rogers Alonzo L (Lula) opr h901 Clinton Rogers Annie nurse Middle Ga Sanatorium r do Register Rogers Arminta lndrs hl024 Main OP THE UNITED Rogers Arth (Fannie) lab r225 Elliott (EM) Rogers Benj S (Letha) cigarmkr Cowart Cigar Fac- tory r Milledgeville rd STATES AND CANADA Rogers Callie lndrs r4 (650) Tatnall la Rogers Carl D (Rosa) sec Soil Ry hl411 Edgewood av Rogers Chas lab h6 King Rogers Clifford A (Minnie) blksmith hl'25 Knott Rogers Clifford D (Luella) mech rl25 Knott 1925 Rogers David porter hl23 Phillips la Rogers D Frank (Eva) elec eng h473 Duncan av Rogers Earl r221 Ross Rogers Edw L elk Burney Bros Co rlOll Clinton rd The Splendid Features of Past Editions are retained, with much Rogers Elisha (Hattie) swtchmn h293 Belmont av Rogers Eliz slsldy L F M Store r239 Washington av Rogers Emmie cook r305 Madison Rogers Ethel sten r901 Clinton Rogers Ethel M tchr Wesleyan College Rogers Forine cook h300 Penn New, Useful Rogers Geo (Lula) lab r9 Frank al and Interesting Data added. Rogers Geo F r Y M C A Rogers Geo T (Fannie) carrier h602 Duncan av Rogers Geo W barber Palace Barber Shop r603 Plum Rogers Hardy (Leila) gro 707 Broadway h515 Ful- ton s la Rogers Hazel student rl20 Clisby R. L. Polk Rogers Howard W (Bertie) bkpr h318 WinsEip Rogers Hunter B student r877 Orange & Go. Publishers Rogers Jas R (Pearl) h221 Ross Rogers Jesse E (Edna) h219 Carling av (HH) 536 S. Clark St. Chicago, 111. | Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 777 Rogers Jos W(Gussie B) phys 201% Cotton av h877 Orange Rogers Julia C r375 College Rogers Julwin (Annie Mae) pdlr r236 Bell av Rogers Laura (wid D T) r514 Napier av Rogers Lester ship elk Macon Orange & Banana Co r Y M C A Rogers Lila slsldy Union Dry Goods Co r221 Ross Rogers Lizzie cook rll9 Moore la Rogers Lockett (Louise) plstr r254 Ellis av Rogers Lois tchr Wesleyan College r66 Arlington pi Rogers Lonnie (Mattie) hl02 Blount Rogers Losie truck driver r859 Broadway Rogers Louise sten Macon Sand Co r473 Duncan av Rogers L W Co gro 1231 Broadway 739 College, 222 Ross Robt M (Carrie) mech hl22 (119) Log Cabin av, 332 Main (EM), 117 Montpelier av, 452 Mulberry, 501 E Napier av (HH), 456, 1001 (1013) and 1999 2d, 84 Spring, 601 (817) Vineville av and 291 Washington av Rogers Martha H r375 College Rogers Mary (wid Robt) hlOll Clinton rd Rogers Mary B sten r26 Progress Rogers Mary O nurse r568 Walnut Rogers Michl L (Fannie) h763 Poplar Rogers Nellie Fay r602 Duncan av Rogers Obie mech r276 Willingham Rogers Oscar (Lena) mech hl33 Boulevard N H Rogers Printania cook hl38 2d av (V) Rogers Roosevelt lab r353 Edison (EM) Rogers Theo W elk P O r715 2d Rogers Thos mech r276 Willingham Rogers Thos E (Hazel) phys 1015-17 Ga Casualty bldg hl20 Clisby Rogers Thos E jr student rl20 Clisby Rogers Victoria lndrs r410 E 1st Rogers Walter R (Susie) pharm r595 Carling av (H H) Rogers Walter S (Miranda) janitor h207 Grants Rogers Wm r473 Duncan av Rogers Wm (Jessie) auto mech h54 New Rogers Wm barber Union News Co Rogers Wm elk r473 Duncan av Rogers Wm N gatekpr h276 Willingham FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION Detroit R. L, POLK. & CO. Chicago We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 778 (1925) R. L. POLK & CO.'S ROGERS WI E JR, V-Pres Fourth National Bank, li375 College Rohr Chas E soft drinks 26 Wall r do Rokens Nathan carp r Lawton rd Roland see also Rowland Roland Ada (wid A B) h213 Reid Roland Blanton r325 White Roland Geo r325 White Roland Jos A (May P) car inspr h2305 2d Roland Luther (Nettie) lab hl33 Gas House al Roland Robt O (Kattie) carp h325 White Roland Robt O jr r325 White ROLLER HOWARD F (Beulah; Roller & Millirons), h200 Napier ay, Phone 95 ROLLER & MILLIRONS (H F Roller, C V Mill; irons), Steam, Hot Water and Warm Air Heating Systems, Plumbing, Repair Work Given Special Attention 415 Bd, Phone 5110 (See left side lines and page 79) M 1 L L i R 0 N S "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH sIfligyhotuarpn LUMBER, SHINGLES, LATH Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 CMgCO III J s s, g-scn m 780 (1925) R. L. POLK & CO.'S Rose John millwkr r22 Manchester qtrs Rose Lizzie Indrs h40 DempseyRose Mary (wid Wingfield) r537 Cedar Rose Maud millwkr r22 Manchester qtrs Rose Mose- (Lettie) pdlr r200 Green Rose Robt (Adeline) lab hl2 Railroad av Rose Robt millwkr r22 Manchester qtrs Rose Sami (Hattie) formn h470 Straight Rose Sophronia Indrs hl38 Linden av Rose Wm millwkr r22 Manchester qtrs Rosen Bella gro 533 Forsyth r604 do Rosen Louis M(Rose; Central City Iron & Metal Co) h Georgian ter apts Rosen Marian student r604 Forsyth Rosey Walter (Mamie) lab r318 Edgewood av Rosier Quinnie h957 Ocmulgee la Rosky Annie r718 Plum Rosky Gus tailor r718 Plum Ross Alberta cook r214 Frank al Ross Alice r751 Ash Ross Allen (Alice) firemn h751 Ash Ross Allen T (Carrie M) col supvr Sou Bell Tel Co h215 Corbin av Ross Claude F (wid Floyd) h320 Orange Ross Clifford (Bertha) porter Collin's h695 Hall Ross Co The (Inc) T D Tinsley pres M G Ross sec- treas bldrs supls Poplar cor 8th Ross Dallas carrier r718 Main Ross Edgar A r328 Hill Crest av Ross Edgar A (Fannie P) office 314 Ga Casualty bldg h.302 (202) Charles (SM) Ross Elbert (Lizzie) lab h397 Plummer's al Ross Elijah E (Ada) store room dept hllO (197) Richard Ross Ernest E (Ida) sawyer r718 Main Ross Eug (Amanda) delivery boy rl'52 College Ross Eunice (wid Emmett) h Grand av (Bellevue) Ross Fannie P rl29 Rogers av Ross Felton (Georgia) porter hl41 Woodliff Ross Fletta cook r4 Tinsley la Ross Geo batterymn rl St Paul Ross Geo (Irene) lab r rear 528 E 2d (EM) Ross Georgia h515 Forsyth Ross Grace I pkr r718 Main (EM) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST GO. "FOUNDED AND BUILT ON HONOR'' Open All Day From 9 to 6--4Va% on Savings MACON CITY DIRECTORY (1925) 781 Ross Grover (Fannie) lab h224 Gilmer Ross Harrison (Margt) lab hll9 Elm Ross Hartwell (Annie) lab hl406 Broadway Ross Hilliard (Mary) lab h202 (137) Toombs (SM) Ross Jack (Martha) lab h857 Edgewood av Ross Jas (Sarah) brklyr h839 Main (EM) Ross Jas (Leila) lab hl9 Elbert la Ross Jas M Rev (Rosa) h240 Dempsey av Ross Jas T (Belle D) phys 503 Citizens & Sou Bank bldg h363 College Ross Jerome F (Laura) carp hll3 Willingham Ross Jerry h302 (608) Colquitt Ross John (Marie) lab h320 Gilmer Ross John B (Clara) porter h350 Harrison Ross Jos lab h723 Clinton Ross Kate h247 1st av (V) Ross Kate M (wid Geo) rl St Paul Ross Leanna maid r354 Pine Ross Lee (Dellq) lab li307 (603) Colquitt Ross Lettie lndrs hl44 Bay Ross Louis J (Colquitt) blksmith 856 Broadway h557 Woolfolk Ross Luverta cook r21'5 Jones Ross Maggie lndrs rl53 Hilliard al Ross Maggie R (wid Walter T) r629 Orange Ross Malcolm R (Martha) office 341 Ga Casualty bldg h212 B'uford pi Ross Maria lndrs r421 Bay Ross Mary cook r619 Monroe Ross Mary L h967 Ocmulgee Ross Max sten r215 Log Cabin dr Ross Minnie L lndrs h224 Hendrix la Ross Mollie h362 Hazel Ross Mosiah wood pdlr h.208 Lynwood av Ross Murrell G (Sarah T) sec-treas The Ross Co r555 College Ross Nora lndrs r215 Bright al Ross Obie (Edna) lab h305 Hanson Ross Paul (Pearl) lab r353 Flanders (EM) Ross Paul (Nellie) lab hllO Hazel Ross Pinkie (wid Chas) dom hl05 Bell av Ross Robt M (Carrie) mech hl22 (119) Log Cabin dr Ross Ruby lndrs h547 (447) Smith (EM) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION dktroit R. L. POLK & CO. Chicago Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. ,, Publishers 536 S. Clark St. Chicago, 111. V82 (1925) R. L. POLK & CO.'S Ross Ruth W (wid John P) hl27 Rogers av Ross Sallie h356 Madison Ross Sami (Rosa) lab h593 Cowan Ross Sarah (wid Meady) h345 Green (CH) Ross Sarah r304 Broad (EM) Ross Sol (Tommie) lab r320 Hammond Ross Thos Li (Helen R; Redding Lumber Co) h629 Orange Ross Walter M asst stereo Macon Telegraph r Log Cabin dr Ross Wansell lab h224 Gilmer Ross Wiley (Callie) carp hl25 Hall Ross Wm (Ruby) lab hl65 Hazel Ross Wm (PIeta) mecb rl2 Woodliff Ross Wm mech r557 Woolfolk Ross Wm G (Raymond) mech hlpr r334 Dempsey av Rosser Geo E Rev (Ruby) tchr Wesleyan College h507 Georgia av Rossignol Louis M (Florence) prop Hotel Macon li Rossman Evelyn sten Central City Brokerage Co r 1157 Napier av Rossman Wm H (Emma) slsmn Singer Sewing Mach Co hll57 Napier av Roughton Bradford E (Lavinia; Roughton Hallibur- ton Co) h232 Georgia av Roughton-Hallib'urton Co (B E Roughton, T H Halliburton, W R Allen) produce 315 Poplar Roundtree Geo W (Cora) h740 Oglethorpe Roundtree Jas R (Lillian) flagmn hl015 Walnut Rountree Hattie lndrs hl537 Johnson's al Rountree John A Rev (Irene) h342 American blvd Rountree Kath student r342 American blvd Rouse Arth A (Nora) msngr h656 Pine Rouse Bettie lndrs hlO Smith (SM) Rouse Ellis barber rl018 Oglethorpe Rouse Emmett (Wennie) mach hill Powell (EM) Rouse Henry (Jeroline) lab h328 Madison Rouse Oscar bellmn rl018 Oglethorpe Rouse Wm h315 Pear (EM) Roush Betty (wid Marcus) h486 May av Roush Brokerage Co F E Roush mgr 913 Ga Casualty bldg Roush Frank E (Alice C) mgr Roush Brokerage Co h.1'49 Summit av E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 If it's a Ford or for a Ford, we have it. JONESS'mOt5rTCOMPANY wP!HTO:N"E s 159t1 . MACON CITY DIRECTORY (1925) 783 Roush Wm A (Kate) pres Macon Cooperage Co ana Standard Handle Co h659 Napier av Roush W Allen (Lillian) sec-treas Standard Handle Co r659 Napier av Rousseau Edw H (Gertrude) acetylene welder h!30 Gordon (SM) Rousseau Jas C (Adelaide) spec agt hl23 Clisby Rowan Allene sten Wood-Peavy Furn Co r413 Spring Rowe David (Nancy) lab r4 Frank al Rowe Eug F (Annie) police hl85 Virginia av Rowell Adelle toll elk Sou Bell Tel Co rll06 Walnut Rowell Ernest rl25 Rose Park Rowell Geo W (Carrie L) bkpr Coleman Motor Co h353 Hines ter Rowell Geo W jr dept mgr S M Solomon jr r353 Hines ter Rowell John R (Effie) hll06 Walnut Rowland see also Roland Rowland Agnes r512 Telfair Rowland Geo T (Pearl) carp rl23 Peachtree Rowland Harry P mech Jones Motor Co res R D No 4 Rowland Isadore (Annie) lab h325 (125) Short (E M) Rowlenson Emma (wid Jas L) h218 Georgia av Roy Chas (Phillis) brklyr rl60 (115) Roye Roy Eug (Manda) lab r27 Wright al Roy Lewis (Nellie) waiter hT60 (115) Roye Roy Mary L rl60 (115) Roye Royal Arth L r206 (2) Smith Royal Bessie (wid B L) slsldy Burden Smith & Co h457 Duncan av Royal Billiard Hall J B Lee mgr 574 Cherry Royal Callie M maid r206 (2) Smith Royal Eliza lndrs rl33 (111) Mutual av Royal Jas lab r206 (2) Smith Royal Lucile lndrs r206 (2) Smith Royal Minnie 0 lndrs r206 (2) Smith Royal Morris (Annie) lab h206 (2) Smith ROYAL SHOE STORE (L J and C S Blum), Fashion- able Footwear for Women, $4, $5, $6 and $7, 414 3d, Plione 66 ROYAL TYPEWRITER, Scott-Parker Co Authorized Dealers 367 Broadway, Phone 1087 Royster F S Guano Co R E Ingham rep chemists 11 Jaques bldg More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 7S4 (1925) R. L. POLK & CO.'S Rozar Albert B (Lois R) taxi driver h217 Ross Rozar Allen R (Zoe) phys 207-8-15 Grand bldg h Rockey Creek rd (SH) Rozar Elliott slsmn Burden Smith & Co rl68 Spring Rozar Mattie weaver rll7 Telfair Rozar Otha L asst dectr Union Dry Gds Co r217 Ross Rozar Robt A r217 Ross Rozier Emmie cook r305 Madison Rozier Geo lab r857 Ocmulgee Rozier Geo W newsboy r Barn Rozier Lemmie (Queen) lab hlO Wise av (V) Rozier Mary lndrs hl67 Curd's al Rozier Mattie (wid A J) smstrs h Barn Rozier Ola smstrs r Barn Rozier Richd (Anna) lab h352 Bay Rozier Stanley (Ethel) r408 American blvd Rozier Willie lndrs r857 Ocmulgee Rozier W S driver W S Dickey Clay Mfg Co res R D No 2 R'uan Adele student rl43 Jefferson Ruan John G (Adele K) pres Ruan & Co hl43 Jef- ferson Ruan & Co J G Ruan pres R F Johnson sec-treas brokers 5 Terminal av Ruarks Mary (wid Wm A) rl23 Heard Rubin Morris (Sarah) tailor h654 2d Rubin Sami N (Marian) phys 719 Bibb bldg h627 Adams Rucker Henry auto mech r619 1st Rucker Wm (Ophelia) lab h9 Harris al Rudd Bertha rll2 Pierce (EM) Rudd Nettie rll2 Pierce (EM) Rudd Raymond elk Ridout & Marshall Drug Co r554 1st Rudd Thelma opr rll Lake City Rudisell Asb'ury (Lucy) driver r3.0T Edgewood av Rudley Gene (Roxey) lab r203 Yates al Rudling Lucy lndrs rl43 Forest av (V) Rudolph Mattie grocer 102 Elm rll2 do Rudolph Wm (Mattie) lab hll2 Elm Ruff Clarence H (Harriett) supt Happ Bros Co h423 Johnson av Ruff D Preston (Nettie) cond h672 Oak Ruff Louis (Clara) farmer r200 Elliott (EM) Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoimseso.,eb.lieSlecetnLdipstrtoso.sHpeeOacudtsrqunfaeowr-r cCoaptayl.og- coRnt,aLin.sPmOLucKh vft aCluOa.,blDeEdTaRtaO.ITA, MskICfHor. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 785 Ruff Nannette student r423 Johnson av Ruff Walter R (Georgia) wood pdlr hl66 Lynwood Ruffin D M elk C of Ga R R Co r240 Washing- ton av Ruffin H L mech r619 1st Ruffner Harry (Eleanor) carrier P O r659 1st R'ugular Mamie Indrs hl09 Thomas Rulefant Geo carp rl85 Gordon Rummell Benj P (Mollie) cond hl32 Steele Rummell Onnie rl32 Steele Rump Mary Indrs h341 Plummer's al Rumph Ephraim (Mary) lab hl8 Woodliff Rumph Georgia M maid r311 Blount Rush Albert (Clarabell) hl04 Hawkins av Rush Paul (Ella) lab r205 Powell (EM) Rusher Chas (Mamie) lab rl329 1st Rushin Chas A prop Kash & Karry Mkt h ws River- dale dr (I) 2 n Ridge av Rushin Herbert Dr (Hinkle' & Rushin) r362^ 2d Rushin Mattie sten rl05 Rogers av Rushin Mollie rl25 Academy Rushin Ona I dept mgr Burden Smith & Co r619 Pine Rushin Roxie maid r307 (113) Roosevelt (V) Rushin Sarah (wid Walter P) h315 Carling av (HH) Rushin W Clifford (Esther) elk Kash & Karry Mkt h Log Cabin Hts Rushing Edmund (Mattie) carp h301 Short (EM) Rushing Lulu Mrs slsldy Dannenberg Co r452 New Rushing Marie dom r301 Short (EM) Rushing Mary asst Supt Macon Hosp Rushing Mollie smstrs r203 New Rushing Walter (Lavinia) lab r301 Short (EM) Rushing Wm P (Lula) slsmn Strong Shoe Co r452 New Ruskin Jas lab r318 Wall Russ Amelia (wid Wm O) r706 Pine Russ Gertrude r874 1st Russell Andrew firemn r431 Alabama Russell Benj (Minnie) hl314 1st Russell B Scott (Emma) h215 Corbin av Russell Cleveland L (Malinda) contr h288 Cedar (SM) IS Pi6-i7S ' FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION I DETROIT R. I,. POLK & CO. CHICAGO HERBERT SMART WALTEWRAPL,TECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 Dlfflffl as a M1KET PUCE THE DIRECTORY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had i * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year 786 (1925) R. L. POLK & CO.'S Russell David E (Evelyn) millwkr h35 Mellrose Russell Eli rl60 Broad (EM) Russell Eliz h453 Winton av Russell Francis M wtchmn r Loretta Barker Russell Geo r622 Prince Russell Gerry H (Ethel) cabtmkr h954 Oglethorpe Russell Henry (Hester) lab r65 Plummer's al Russell Henry D (Carolyn; Brock Sparks & Russell) r254 College Russell Ida Mae (wid I N) hl03 Latta pi Russell Irene slsldy S H Kress & Co r288 Cedar (SM) Russell Jas E (Bessie) swtchmn h536 E 2d (EM) Russell John B (Ella) carp rl38 Ells (SM) Russell John V (Ella) carp hl40 Ells (SM) Russell Julia lndrs hl32 Phillips la Russell Lee (Rosa) janitor hl2 Booker's al Russell Lizzie hl8 Water (EM) Russell Louise lndrs r415 Glen R'ussell Lula maid h455 Army lot Russell Mattie lndrs h605 Henrietta Russell Ophelia lndrs h242 Jefferson Russell Raymond D (Corinne) elk. Birdsey Flour Mills h751 Ridge av Russell Sallie ~rl24 Holt Russell Thos (Queen) lab hl002 Main Russell Wm r536 E 2d (EM) Rust Jos D chiro 220 Bibb bldg r Lanier Hotel Rustin C Milo gatemn r203 American blvd Rutherford Butler (Rebecca) lab h5 New Rutherford Eug (Sarah) pntr r919 Hazel Rutherford Ezekiel (Maggie) lab h607 Gilmer Rutherford Herbert M (Willimena) ins agt h413 Mad- ison Rutland Benj rll5 Boulevard (NH) Rutland Floyd E (Lillian) brick mason r51'2 Ogle- thorpe Rutland Henry F (Lena) lawyer 565 Mulberry hll5 Boulevard av Rutland John (Ida) pntr h484 May av Rutland Lena sten M D & S R R Co rll5 Boulevard (N H) Rutland Wm W (Victoria) car inspr hl06 Capital av Rutledge David (Roberta) lab I16O6 Fort Hill More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Rutledge Edw lab r408 Applewood Rutledge Bug (Roxie) truck driver h203 Yates av (EM) Rutledge Geo (Lula) farmer hl86 May av Rutledge Grant (Rebecca) lab h Barrack al Rutledge Lillian lndrs r408 Applewood Rutledge Wm F (Ida) hl414 2d Rutledge Wm T (Era) mldr h912 2d Rutling Noble (Alma) driver h807 Anthony rd Ryals Abbie lndrs rl34 Malloy's al RYALS, ANDERSON & ANDERSON (T E Ryals, R L Anderson, R L Anderson Jr), Attorneys-at-Law 421-24 Macon Natl Bank Bldg, Phone 921 Ryals Andrew J (Mary H) r202 Maple Ryals Andrew J (Mattie L) cond h618 Montpelier av Ryals Clara trained nurse r412 Fort Hill Ryals Cottage rear 1307 (307) Edgewood av Ryals Ella millwkr r605 Main (EM) Ryals Elmer elk r814 Oak Ryals Emma L (wid Wm H) h814 Oak Ryals Ethel R sten Superior Court r202 Maple Ryals Frank lab r675 Dunlap al Ryals Frank (Ella) wtchmn r605 Main (EM) Ryals Henry T elk r202 Maple Ryals Jas (Lizzie) lab hl34 Grants Ryals John r814 Oak Ryals Mamie millwkr r605 Main (EM) Ryals Nora opr r412 Fort Hill Ryals Rembert (Hazel) elk r202 Maple Ryals Thos E (Lily; Ryals Anderson & Anderson) h201 Clisby Ryan Patk Rev asst pastor St Joseph's Catholic Ch r814 Poplar Rycroft John W (Fannie) slsmn Fashion Shoe Store rl27 Coleman av (HH) Rycroft W T Mrs nurse and supt of infirmary Mercer University r do Ryder Danl (DeLand) h442 Alabama Ryder Martha L gro Forsyth rd 3 w Park av h do Ryder Thos P swtchmn h2325 2d Ryle Agnes mlnr Newman's Millinery r242 Hydrola Ryle Agnes M sten rl07 St John Ryle Alonzo B sign pntr Crimson Sign Co r56i0 Plum Automobile owners are select prospects for many kinds of merchandise. Send, to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. 3 6) B ; > > 6) m TERMINAL TRANSFER COMPANY TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 7S8 (1925) R. L. POLK & CO.'S Ryle C Erskine (Lavinia) slsmn h317 Ross Ryle C T r319 Columbus Ryle Dorothy student r205 Log Cabin dr Ryle Frances student rl05 Courtland av Ryle Geo elk H A Kennington Gro Co r812 Woolfolk (EM) Ryle Henry J carp rll9 Jones av Ryle Jack J (Agnes) eng r302 Mercer (Bellevue) Ryle Jas G (Etta M) stereo Macon News hl07 St John Ryle Jas T (Mamie) opr h242 Hydrola Ryle John (Mamie) opr h222 Hydrola Ryle Jos K (Ethel) brkmn h.205 Log Cabin dr Ryle Josh J (Ruth) hll9 Jones av Ryle Marshal opr r222 Hydrola Ryle Mary F (wid Benj F) h415 New Ryle Pauline cashr r415 New Ryle Robt P elk r415 New Ryle Sami J (Lollie) formn Macon News hl311 Vine- ville av (V) Ryle Wm (Ella) eng h260 Center Ryle Winfred A (Roselle) agt Ind Life & Health Ins Co h809% Cherry Ryles Calder B Rose supt Life & Casualty Insurance Co hll9 School Ryles Jas T (Annie M) h459 Elm Ryles Martha (wid John T) r412 Fort Hill Ryles Rudisinn H mach r202 Maple Ryles Vernon R appr Macon News rl03 Lamar (V) Ryon Martin J r760 Cherry Ryon Mary M Mrs furn rms 760 Cherry h do Sadler Wm (Eliz) chauf hlOl Cabaniss av Saeger Wm E (Irene; Dixie Highway Garage) h2810 Houston av St Clair Grady blrmkr r342 Hydrola St Clair Lora opr r342 Hydrola St Clair Wm (Nomie) blrmkr h342 Hydrola St James Episcopal Church 101 Courtland av St James Sanctified Church 612 Hall St John Baptist Church 94 Bay St John's Baptist Church 1051 Clinton rd ST JOSEPH'S CATHOLIC CHURCH, Rev T D Mad- den Pastor, Revs D J Murphy, R P Ryan, S J) Assts, 814 Poplar, Phone 1428 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFES! SIO( N DETROIT R. L. POLK & CO. CHICAGO MACON CITY DIRECTORY (1925) 789 St Luke's Baptist Church 155 Broad (EM) St Mark's Protestant Episcopal Church 307 Madison St Paul's A M E Church 210 Powell (EM) St Paul's Episcopal Church ne cor College and For- sythe St Paul's Episcopal Parish House 643 College St Paul's Sanctified Church 122 Woodliff St Peter Claver Catholic School 430 Ward (V) St Peter Claver Convent 428 Ward (V) St Peter Claver Rectory 428 Ward (V) St Peter Claver R C Church 430 Ward (V) St Phillip's Missionary Baptist Church 75 Long la St Rest Cemetery (colored) ft of White (SM) Sales Leonard (Fannie) lab hll3 Edgewood av Sales Minnie elk r470 Alabama av Sales Sandy (Mary J) lab h237 Division Saleworth Wm (Lillie) truck driver h406 E 2d (EM) Sallas Doris phone opr r907 Cherry YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Sallas John S (Ina) truck driver r907 Cherry Salley Gilliard slsmn r802 Mulberry Salmon Montague (Zoie) mgr Rialto, Grand, Capitol and Criterion Theatres r912 Napier av (NH) Saloom Jos (Sally; S Saloom & Sons) rl301^ Broad- way Saloom Saied (Sarah; S Saloom & Sons) hlSOl^ Broadway Saloom Salem (Rosa; S Saloom & Sons) rl301i4 Broadway Saloom S & Sons (Saied, Salem and Jos) genl merchandise 1243-45 Broadway Salter Harry L (Oneida) musician rl331 2d Salter Jas W (Fredonia) cond h906 College Salter R Kirkland teller City & Sou Bank r906 Col- lege Salton Mary cook h453 Monroe Salvation Army Capt Demas Mataxas in charge 518 Broadway A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit NORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 790 (1925) R. L. POLK & CO.'S Salyer Edw r568 Walnut Sam Chung lndrs 454 Cotton av Sam Lee lndry 519 Mulberry Samburg Carl student r233 Wasbintgon av Samburg Ralph (Mary) pipe organ technician r233 Washington av Samford John R (Linda) r New Columbia rd Samford Thos P (Ida) carp r523 Linden av Sammons Adam J (Lula) rl23 Lawton av Sammons Eliz dept mgr Dannenberg Cc hl23 Lawton av Sammons Elmer hlpr r409 Elm Sammons E Walter h4 College Hill apts Sammons Jas P (Lucia) gro whol h201 Coleman av Sammons Jas P jr r201 Coleman av Sammons Lucia tchr r201 Coleman av Sammons Miller T cotton checker rll4y2 Rogers av Sample Daisy (wid Louis B) hill College pi Sample Harry B (Annie) meats 1500 Broadway h.2808 Houston av Sampler Lucile A tchr r209 Beech av Sampler Wm M (Eva) city firemn h209 Beech av Samples Evelyn cashr Macon Cafeteria rill College Pi Samples Frank R (Retha) h325 Ross Samples John M (Mamie N) elk hl20 Richmond Samples Jos J (Queenie B) collr Reliable Outfitters h324 Ross Samples Thos J (Eva) taxi driver r325 Ross Sampson Arth (Mabel) lab h613 (256) Crist Sampson Hattie lndrs h533 Smith (EM) Sampson Jesse student rl229 Tracy's al Sampson Lillie B lndrywkr r455 Barracks al Sampson Mary lndrs r256 (154) Park Hotel al Sampson Napoleon (Mattie) huckster hl42 4th av (V) Sampson Sami (Annie) barber hl229 Tracey's al Sams Hanson sta firemn hl331 1st SAMS RUFUS D (Laura G), Sec-Treas Macon Cigar & Tobacco Co, h Columbus rd Sams Wm S (Henrietta) plstr h372 2d av (V) Samuel Archie (Lucile) carp h229 Norris Samuel Dallie lab r229 Norris Samuel Dolphus (Sarah) lab hl5 Turpin la A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925). 791 Samuel Jodie (Eula) chauf rl60 College Samuel Luther (Rosa) draymn hl002 Cedar (U) Samuel Ola dom rl5 Turpin Samuel Wm (Addie) lab h447 (47) Ballard Samuel Wm (Leila) lab hl39 Turpin la Samuels Annie r715 Campbell av Samuels Gertrude Indrs r310 Forest av (V) Samuels Nathan (Ada) carp h715 Campbell av Sanctified Church 823 Ash Sanctified Church 303 Grant av (V) Sanctified Church 126 Rock Hill la Sanctified Church 1161 (325) Woolfolk Sandefur see also Sandifer Sandefur Ewell L (Bertha) elk Dunlap Hdw Co h402 Forsyth av V Sandefur-Harwell Clothing Co 355 3d Sandefur John E (Lester) ship elk h212 Plant Sandefur Louise bkpr Empire Furn Co r212 Plant Sandefur Mary sten I Kusler Commission Co r212 Plant Sandefur Thos 0 (Annie L) slsmn C H Hunnicutt Clo Co h222 Hines ter (V) Sanderlin Luther S mach opr r843 Hazel Sanderlin Rosa L (wid Luther) h843 Hazel Sanderlin Virginia M spinner r843 Hazel Sanders see also Saunders Sanders Abbie Indrs h617 Ross Sanders Abner millwkr r36 Manchester qtrs Sanders Albert porter r207 Coles al Sanders Albert H (Effie) bkpr hlOl Virginia av Sanders Amanda (wid Thos H) rl43 Piedmont av Sanders Ann (wid Mack) r219 Newberg Sanders Anna Indrs r311 Ash Sanders Annie (wid Thos J) r871 Cherry Sanders Annie Indrs 295 Craft la Sanders Annie L maid 337 Brookers av Sanders Arth (Lula) carp h339 Maple Sanders Arth N (Ruby) elk W A & J A Spillers h820 Main (EM) Sanders A Everett teller Macon Natl Bank r2719 Houston av Sanders Belle slsldy Burden Smith & Co r Magnolia Hall "More Goods are Boughi and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found Hie Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 792 (1925) R. L. POLK & CO.'S Sanders Blanche lndrs r318 Wall Sanders Chas (Emma) carp h310 Norris Sanders Claire r2719 Houston av Sanders Corine maid r617 Ross Sanders David collr J W Ford rll27 Broadway Sanders David lab r216 Middle (V) Sanders Edmond (Arlissy) carp r311 Ash Sanders Effie Mrs slsldy Dannenberg Co rlOl Vir- ginia av Sanders Eliza maid r256 Bright Sanders Eliz (wid J E) r477 Blackburn Sanders Ella (wid Robt G) slswmn W T Grant Co r555 1st Sanders Ella mill hd rl023 2d Sanders Ellis (Mattie) brkmn h705 Elbert Sanders Elmer C (Manona) elk Sou Bell Tel Co h226 Log Cabin dr Sanders Eug (Lula) formn h933 Columbus rd Sanders Evelyn C r355 Elm Sanders Fannie L nurse h337 Bookers al Sanders Frank (Viola) pntr h331 Ballard Sanders Fred (Addie) barber shop 115 Telfair Press- ing Club 724 Nussbaum h555 Henrietta Sanders Fred (Addie) lab r206 Coles al Sanders Geneva cook r223 5th Sanders Geo (Annie M) h403 (305) Charles (SM) Sanders Geo (Pinkie) lab h232 (233) Roosevelt (V) Sanders Geo P elk G S Bolton rl531 3d Sanders Geo T elk Max Cohen r300 Pio Nono av Sanders Geo T (Americus) wtchmn h.228 (53) May- nard Sanders Hattie K barber Moses Miles rl28 Green Sanders Henry rlll4 Napier av Sanders Homer L (Kitty M) feed mixer h415 Cal- houn Sanders Irene nurse r617 Ross Sanders Isoline sten L F M Store r477 Blackburn av Sanders Jack (Julia) mech W R Finch Motor Co r554 1st Sanders Jas wood ctr h313 Burnett (EM) Sanders Jas C (Cath) merchant h211 Washington av Sanders Jas D (Minnie) carp h615 Elm Sanders Jas W (Kate L) signalmn hll5 Colquitt R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 793 Sanders Janie B rl30 Magnolia Sanders John (Anna) lab h256 Bright Sanders John B (Bessie M) carp hl43 Colquitt Sanders John H (Donie) mill hd hl029 1st Sanders Jos lab rllO Bay Sanders Jos (Belle) lab h2 Cheatham al Sanders Jos H tel opr hl43 Piedmont av Sanders Lee (Abbie) lab r617 Ross Sanders Leo carp r615 Elm Sanders Lillie (wid R L) hlll4 Napier av Sanders Lizzie hlO Tracey's al Sanders Lucius (Annie) lab h rear 356 Spring la Sanders Lucy lndrs h207 Coles al Sanders Margt (wid Everett A) h2719 Houston av Sanders Mary cook r295 Craft la Sanders Ollie lndrs rl30 Ross Sanders Palmer V elk rl43 Colquitt Sanders Pearl nurse r617 Ross Sanders Peter (Cornelia) farmer r271 North Trucks and Auto Repairing Authorized for White Motor Truck* N. E. MCE 657-659 THIRD ST. PHONE 4846 Sanders Robt lab r256 Bright Sanders Robt (Cora) lab h353 Church al Sanders Robt porter Wright Auto Supply Co r218 Jackson Sanders Sami (Mattie) lab h518 Hammond Sanders Sarah 320 Elm Sanders Sidney (Henrietta) porter hl26 Fort Hill Sanders Terrell C (Margt) barber Haverfleld, Smith & Wood rl20 Colquitt av Sanders Thos lab r518 Hammond Sanders Viola h271 North Sanders Viola gro 820 Cowan r331 Ballard Sanders Walter r933 Columbus rd Sanders Wm lab r617 Ross Sanders Wm P (Mary) police h226 Applewood Sanders Wm S student rl531 3d Sanders Wm W (Georgia) roper h839 Hazel Sanders Wimberley C (Alice) car repr h!531 3d , FOR FISTS OF NAMES * ANY TRADE -- ANY BUSINESS -- ANY PROFESSION .DETROIT R. L. POLK. & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 794 (1925) R. L. POLK & CO.'S Sanders W Leonard (Leah) dept mgr City Realty Co r326 Ridge av Sanderson Docia (wid Jas) r319 Clinton Sandford Wm lab h500 Hammond Sandifer see also Sandefur Sandifer Beulah lndrs h204 Clark la Sandifer Frances sten Coleman-Meadows-Pate Drug Co r212 Plant (SM) Sandifer H Paul (Sallie M) car repr hl20 3d Sandifer John W (Alice) slsmn Singer Sewing Ma- chine Co h505 Beech av Sandifer John W jr elk G Bernd Co r505 Beech av Sands & Co F L Barnes mgr gro 1602 Broadway Sandwich Mose lab r523 Monroe Sanford Albert F (Mary) auto mech hl02 Cedar Sanford Alford lab h361 Blount Sanford Annie r307 Blount Sanford Chas D bkpr r662 College "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseigpdUinnNaokln-,, SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Sanford Clyde R (Willie) tailor 421 Cotton av h238 Jefferson Sanford Dock (Minnie) lab h307 Hanson Sanford Geo (Marie) lab h840 (340) Williams Sanford Horace lab h620 (110) Cowan Sanford Ida h620 Plummer's al Sanford Jack (Gertrude) lab r620 (110) Cowan Sanford Jos lab r316 Walnut Sanford Kate h359 Elm Sanford Laura maid r500 Chappell Sanford Lee mech Solomon Motor Co Sanford Lois F (wid Eug R) sten Ouzts, Mitchell & Whaley hlOl Clayton Sanford Major lab h936 Elbert Sanford Mammie lndrs r936 Elbert Sanford Marie h448 Craft la Sanford Mattie garment inspr hl39 (131) 1st av (V) Sanford Nellie L student r83 Arlington pi R. L POLK & Company FOR LISTS OF NAESES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) Sanford Oscar lab h628'Hammond Sanford Paul H (Ruth H) slsmn hll5 Corbin av Sanford Priscilla maid r251 5th Sanford Sadie sten r238 Jefferson Sanford Shelton P (Nell H) dept mgr R S Thorpe & Sons h.83 Arlington pi Sanford Sol clo clnr rear 246 Main r85 Yates al Sanford Susie hlOl 1st av (V) Sanford Thos (Julia) millwkr h Railroad Sanford Wm rl313 1st Sanford Wm carp r227 Norris Sanford Wm (Minnie K) lab h312 Hanson Sanford Wm (Pauline) lab hl09 Mitchell Sanford Wm lab h rear 515 Oak Sanford Wm J lab r432 Coles al Sanitary Barber Shop No 2 (JB Genone, H G Flynt) 568 Mulberry Sanitary Market (T W English) 420 Mulberry MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS O CD 1=3 Sanitary Milk Depot Charles T Eden prop 901 Oglethorpe Sanitary Pressing Club (J E Genone, H G Flynt) clo clnrs 568 Mulberry Sapp Bealey (Georgia) pntr hlOl Peachtree Sapp Bertha (wid Wm) h226 Hydrola Sapp Clayton H (Nellie E) rl327 2d Sapp Ellis R (Aline) gro 1338 Broadway h do Sapp H H (Lillian) real est 14 Washington bldg h Highland av Log Cabin Hts Sapp Jas M (Hildred) mah Solomon Motor Co hl08 Branch Sapp John W (Eliz) driver r822 Main Sapp Oscar (Clyde) gro h328 Hanson Sapp W Robt (Venie) chain gang guard h317 Maple Sappington Edw lab r640 Hammond Sappington John H (Notie M) lab r640 Hammond Sappington Olin (Inez) cotton buyer h es Oak av 1 s Ridge av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 796 (1925) R. Li. POLK & CO.'S Saranti Garafalia (wid Michl) rl03 Ross Sardis Sami (Josephine) fruits 667 Broadway h771do Sargent Jerry (Nancy) lab hl90 (186) Turpin la Sargent Wm H (Eliz) mech San Bell Tel Co h216 Log Cabin dr Sasser C Davis sign pntr rll7 School Sasser Emmett (Bettie) elk Corbin Supply Co h802 Amer blvd Sasser Everett (Florie B) cond h460 Spring The most comprehensive reference work on the Sasser Lawrence E (Eliz) eng hll7 School Sasser Lawrence E jr student rll7 School Sasser Mary Indrs h407 Chestnut Sasser Oscar lab r407 Chestnut Satterfield Eliz D (wid John E) h221 College Satterfield Marion H mattressmkr Central Bedding Co banks of r221 College the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of | State Banking Laws and Much Other Data related to Satterfield Mary F r221 College Satterwhite Prentice W (Mina) lab r408 American blvd Sauls Wm C (Eppie) slsmn Burden Smith & Co hl20 Beech av Saunders see also Sanders Saunders Aubrey (Jimmie) film opr Rialto Theatre h909 Cherry Saunders David M (Eliz) claim agt C of Ga h219 Hines ter Saunders David P student r219 Hines ter (V) Saunders Essie cook h Robinson rd nr Rockledge av Saunders Hilliard student r2503 Broadway Saunders Jimmie Mrs cashr Mitchell, Williams & Mack h909 Cherry Banking Saunders John L (Ethel) cond h525 Montpelier av Saunders Margt student r219 Hines ter Price $20 Saunders Mary Indrs h354 Ash Published semi- annually MARCH and SEPTEMBER Saunders Mattie nurse Macon Hosp Saunders Wm A (Bessie L) mech Independent Lndry Co h759 Cherry Savage Hopie lab hl028 Broad Savage Jack D (Georgia) switchmn rl05 Kemper av Savage John (Emma) lab hl024 Broad by Savage Josephine r225 2d av (V) Savage Melissa (wid Wm) r653 New R. L POLK Savage Nona maid r225 2d av (V) &C0. r Polk Directory i Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR'' N9 tn '6 Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 797 Savage Wm B (Emma) brklyr h229 4th av (V) Saville Warren V (Lula; College Hill Grocery) hll8 Lamar Savior Danl lab rll2 Plummer's al Sawyer Alvin B soda dispenser r505 American blvd Sawyer Anna r514 Fort Hill Sawyer Arth (Anna) lab h514 Fort Hill Sawyer Arth gro 516 Fort Hill r 514 do Sawyer Benj (Ruth) lab r511 Flanders (EM) Sawyer.Carlton (Christine) flagmn rl25 Rose Park Sawyer Cicero (Frances) porter r514 Fort Hill SAWYER COAL & ICE CO, E J Sawyer Prop, Ice Manufacturer and Dealer, 6th and Mulberry, Phone 1256 Sawyer Edw (Minnie) firemn hl56 Hill Sawyer Edwin J (Ada) prop Sawyer Coal & Ice Co rRFD 4 C/5 m SOUTH'S UEADINGr FT.ORISTS 88 IDLE HOUR NURSERIES Sawyer Jas elk Farmer's Exchange res Cross Keys Sawyer John B (Chalsie) elk R L Lassiter r Cross Keys : '! Sawyer J Henry (Hattie) gatemn h505 American blvd Sawyer Oscar student r809 Cherry Sawyer Sallie (wid Wm M) h647 Peeble Sawyer Viola millwkr r647 Peeble Sawyer Wm M (Estelle) clo clnr 205)4 5th r514 Fort Hill a Saxon Edw A millwkr r86 Green (PM) Saxon E Paul millwkr r86 Green (PM) Saxon Jas T (Lillie) printer 515 Cotton av h220 Mor- gs ris Saxon Perry millwkr r86 Green (PM) M ft Saxon Robt lab r220 Norris Saxon Robt A (Emma) millwkr h86 Greene (PM) Saxon Tyra (wid Robt B) rl27 Highland av Saye Martha Mrs rl23 Magnolia ^Jfor lists of names AN'YVTRA. DfE( ANY BUSINESS'j-- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO U3 o g (3 K a cn a FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 798 (1925) R. L. POLK & CO.'S Scandrett J Russell office mgr Harrold Bros Co r422 Spring Scarborough B V (Maude) trav hl41 Lymoore av Scarborough Emma maid r476 Jones la Scarborough Fanny B r222 Tatnall Scarborough Freeman F (Martha) slsmgr Ga-Caro- lina Oil Co h530 Washington av Scarborough Jas A (Dora) pressmn The J W Burke Co h222 Tatnall Scarborough Jas A jr pressmn The J W Burke Co r 222 Tatnall Scarborough Jas C flagmn rl28 Park pi Scarborough Jos W mech S M Solomon jr rl48 Tenny Scarborough Lillian sten John Malloch & Co rl48 Tenny av Scarborough Lillie (wid Chas W) hl48 Tenny Scarborough Martha nurse Macon Hosp Scarborough Paul T slsmn Hatcher Hdw Co r Y M C A Scarborough Prentice student r530 Washington av Scarborough Richd B r222 Tatnall Scarborough Robt lab hl28 1st av (WH) Scarborough Rosa B elk Sadie Abdoo r608 3d Scarborough Sarah ^ bkpr G F Yetter r758 Cherry Scarborough Sidney W mech rl24 Steele Scarborough Walter P (Essie) carp h301 Fort Hill Scarborough Wm elk Tatnall Square Pharmacy rl23 Lawton av Scarborough Wm lab r315 Division Scarborough Zoe elk Macon Telegraph r530 Washing- ton av Scarvey Robt (Lula) lab h208 Johnson av Schaefer see also Shaefer Schaefer Chas K mech r704 Main Schaefer Chas W (Minnie) blksmith h704 Main Schaefer Emanuel A (Annie) radiator repr hll9 Stonewall pi Schaefer Kath sten S R Jaques & Tinsley Co r704 Main (EM) Schaefer Raymond lab r256 (156) Center Schaefer Sally T (wid Emanuel) h256 (156) Center Schaefer Wm C cond h965 Cherry Schaefer Wm H mach r704 Main (EM) Schaffer Albert E (Ina) mach rl985 3d Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 799_ Schaffer Della (wid Chas) rl985 3d Schaffer Geo A (Ruth) lathe opr Bibb Basket Co h 1985 3d Schall see also Schell and Shell Schall Geo (Mary) hl47 Rose Park Schall Herman real est hl2, Nevaro flats Schall Sarah E opr r202 Cutter's la Schatzman Thos J C (Maybelle) formn Idle Hour Nurseries res Rivoli Ga Schaub Mary H (wid John L) sten L & N R R h670 Courtland av Schaupp Margt M dentist asst r359 New Schaupp Mary P (wid Chas E) r359 New Scheibe Lewis W (Lonie) mgr h330 Beech av Schell see also Schall and Shell Schell Chas E (Minnie) mech rl27 Winship Schell Elmer D mech r230 Chappell Schell Emma A (wid Louis W) h230 Chappell MACON OPTICAL COMPANY rrank H. Johnson Opticians Optometnsts 58 CHERRY - X > W PHONE 3213 Schell Ernest R (Claudia) mech Ellis Motor Co h530 Clinton - Schell Josephine rill Appleton av Schell Lewis C (Annie) mech hl28 Winship Schell Lula (wid Jas W) h616 1st Schell Sidney A (Bernice) mech h210 Jones av Schell Zachariah D student r230 Chappell Schelling Emil B elk J B Riley Drug Co r John M Schelling Schelling Geo R (Minnie) clo clnr and shoemkr 119 Cotton av h669 New Schelling John M (Ida T) scale inspr h ss Forsyth rd 6 w Tyrone blvd (V) Schelling Lillie S Mrs slsldy Union Dry Goods Co r669 New Schelling Ralph M (Lillie) shoe repr 228 Cotton a'V r669 New Schermerhorn Mary r920 Elm Schermerhorn Wm C h920 Elm in Bottles TELEPHONE 287 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. n. l. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 800 (1925) R. L. POLK & CO.'S Schlinzen Lena r758 Plum Schlueter Edw (Elsie) slsmn Macon Chero Cola Bot- tling Co r301 Montpelier av Schlueter Edw jr msngr boy r301 Montpelier av Schmidt see also Smith Schmidt Arth W (Irene) elk h319 Columbus Schmidt J Eug mgr Dixie Cafe & Commissary r30G Cutter's Green Schmidt Millie (wid J Eug) h306 Cutter's Green Schmidt Rosa M elk Dixie Cafe & Commissary r306 Cutter's Green Schneider see also Snyder Schneider Claude (Lucile) v-pres I Kessler Commis- sion Co hl04 Cleveland av (V) Schneider Josephine (wid Anthony) h655 Oak Schofield A D h250 Georgia av Schofield Bessie cook h812 (206) Pio Nono av Schofield-Burkett Construction Co I E Burkett pres Lola Hatfield sec-treas machinery 504 Bihh bldg Schofield Carl H (Louise) hl06 Hill Crest av Schofield Chas (Mattie) pntr h524 Rofes Schofield Eliz r250 Georgia av SCHOFIELD FLOYD 0, Sec-Treas Hatcher-Turpin Co, rlOO Yineville av, Phone 2443-W Schofield Gladys r250 Georgia av Schofield Jerry (Meha) lab r812 (206) Pio Nono av Schofield John A driver r656 Pebble SCHOFIELD JOHN S (Addie H), Pres J S Schofield's Sons Co Inc, hlOl Yineville av, Phone 110 Schofield John S jr (Hazel) mgr h809 Napier av Schofield Odessa cook r812 (206) Pio Nono av Schofield Tabitha R (wid Floyd O) hlOO Vineville av Schofield V Eliz (wid Joshua) rlOO Vineville av SCHOFIELD'S J S SONS CO INC, J S Schofield Pres, J B Hart Y-Pres, J N Barnes Sec-Treas, J A Asbell Asst Treas, Manufacturers of Engines, Boilers, Tanks and Towers, Edgewood av cor Hammond, Phone 4771 Schoonmaker Berton H (Elsie) electn h561 Boulevard (NH) Schoonmaker Ronda sten Ellis Motor Co r561 Boulevard <1 Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured the j. w. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 801 Schrimshire Hubert E (Gertrude) millwkr h Green (PM) Schuessler Eliz student rl04 Callaway Schuessler Nettie rl04 Callaway Schulte A A H Dubin mgr cigars 3d nw cor Cherry Schumake Leonard J lab r233 Gilmer Schuman Louisa (wid Fredk) rl53 Summit av (NH) Schuster M Richd (Maude) dentist 406 Macon Natl Bank bldg r Wesleyan dr SCHWARTZ LOUIS E (Esther; Schwartz & Phaul), r464 Napier av, Phone 3992 Schwartz Sol (Florence; Boston Shoe Shop) h806 Napier av SCHWARTZ & PHAUL (L E Schwartz, Adolph Phaul), Sheet Metal Works, Metal Cornices, Skylights, Ventilators, Tin, Tile and Slate Roofing, Metal Shingles, Warm Air Heating 452 Plum, Phone 340 (See page 79) Schwab Co The J R Zeigler mgr men's clothing 355 Cherry Scoggins see also Scroggins Scoggins Myrtle smstrs r2 Dannenberg av Scoggins Thos R (Minnie) car repr h2 Dannenberg av Scoggins Wm J (Clara) mech hll6 Concord Sconyers Edw A (Eleanor) eng h252 1st Sconyers Jas A Rev (Mary) h203 Jeff Davis Sconyers Leon Y student r203 Jeff Davis Sconyers Mae cashr N Y Waist House r203 Jeff Davis Sconyers Ruth student rll6 Yates av (EM) Sconyers Wm S (Belle) car inspr hll6 Yates av (EM) Scott Ada cook r323 Dempsey av Scott Agnes student r608 Holt av Scott Alice H r209 Cherokee av Scott Arth lab h4 Barfield al Scott Bertha cook h rear 126 Jones Scott Claude E (Lou B) h416 Calhoun Scott Cordie (Scott's Art School) rl26 Ponce de Leon Scott Daisy sten r259 Willingham Scott Della M (Scott's Art School) 126 Ponce' de Leon av Scott Dessie E (Maude; Scott's Drug Store) h916 Ocmulgee FOR LISTS OF NAMES ANY TRADE ^-- ANY BUSINESS f -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 mm as a PLACE THE DIRECTORY IS THE GREATEST MARKET PLAGE ffl THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Mik&Co PDBLBHEBS PoIkDirecbwjE DETROIT 802 (1925) R. L. POLK & CO.'S Scott Donie millwkr r Charles Drawhorne Scott Ebbin P (Eliz) barber Palm Barber Shop blOl North av (NH) Scott Eliz student r515 E Napier av Scott Emma (wid Jonah J) r955 Elm Scott Ernest (Nellie) porter r210 Tindall av Scott Eug (Belle) lab h36 Woodliff Scott Eula J rl05 Pio Nono av SCOTT E CLEVELAND, V-Pres Citizens & Southern Bank, h209 Cherokee av, Phone 2986 Scott Fannie cook rlO Tinsley la Scott Frank (Ada) h323 Dempsey av Scott Frank jr lab r323 Dempsey av Scott Frank H (Fannilu G) slsmn Roughton-Halli- burton Co hl05 Laurel av (NH) Scott Geo lab rl37 Forest av (V) Scott Georgia millwkr rl30 Comer ter Scott Henry (Mildred) lab h323 Curd's al Scott Henry lab r726 Nussebaum Scott Homer B student rl26 Ponce de Leon av Scott Horace deliverymn r439 Forest av (V) Scott Ira D (Alice) millwkr hl30 Comer ter Scott Jas (Fanny) lab h841 Center Scott Janie (Scott's Art School) rl26 Ponce de Leon av Scott Jesse firemn hl05 Pio Nono av Scott John (Dollie) lab rl229 Tracey's al Scott John (Laura) mill opr r259 Willingham Scott John D (Ola) barber C B Berry h439 Forest av Scott John F mech r259 Willingham Scott Jos P (Minnie) mech h608 Holt av Scott Leola r439 Forest av (V) Scott Leonard porter rl05 Pio Nono av Scott Lester lab r560 Smith row Scott Lillie Indrs h331 Barfield al Scott Lula dom rl05 Pio Nono av Scott Mabel sten r608 Holt av Scott Martha nurse r222 (221) Patterson Scott Mary Indrs rll7 Chappell al Scott Mary F Mrs r427 College Scott Mildred sten Ga Casualty Co res Lakeside Ga Scott Minnie Mrs slsldy Dannenberg Co r608 Holt av Scott Mose (Minnie) lab r560 Smith row A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569^ CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 803 Scott Moultrie lab r726 Nussbaum Scott Mount P pres-mgr Southern Negro Singers r240 Orange Scott Octavia r312 Corbin av SCOTT-PARKER CO, M G White Mgr, New Royal and Corona Typewriters, All Makes Rebuilt Machines, Rentals, Repairs and Supplies, Bibb Realty Bldg, 367 Broadway, Phone 1087 (See right center lines and page 86) Scott Philip (Elenora) hll2 (120) Roosevelt (V) Scott Robt A (Lula) mech Coleman Motor Co r955 Elm Scott Robt L (Ola B) trav h515 E Napier av Scott Robt L jr student r515 E Napier av Scott Rosa B cook rl50 Roye Scott Sarah G sten Bagley, Willett & Paine rl05 Laurel av (MH) Scott Solomon (Lottie) lab h726 Nussbaum Royal Corona Typewriters SCOIT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Scott Wm (Evelyn) lab h423 Madison Scott Wm (Eliza) lab h222 (221) Patterson Scott Wm C (Maggie) blksmith ss Forsyth nr McGhee h R F D 1 Forsyth rd (V) Scott Wm D (Della M) photog 411 Cherry hl26 Ponce de Leon av Scott Wm H (Muriel M) mgr Remington Typewriter Co h303 (309) Buford pi (V) Scott Wm M (Leila) cook h.304 Broad (EM) Scott's Art School (Janie Cordie, Della M Scott) 411- 13 Cherry SCOTT'S DRUG STORE, D E Scott Prop, Drugs, Soda Water, Stationery, Confectioners, Cigars Tobacco, Cigarettes, Etc 554 New, Phone 1996 Scoven Emory G (Mary) mech hl21 Colquitt Scoven Raymond R elk H A Fox rl821 Broadway Scoven Sami G (Mattie) formn hl821 Broadway Scoven Wm R (Lucille) gro 1823 Broadway rl821 do Scoville Doris student rll8 Laurel av (NH) dress IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 Cl os oi J3 ^ dd More goods are bought and sold through the Classified Business Lists of the Directory tbfln any other medium on earth. -2^ Q !< 2 !z O* c>>o HC>HO oO MQ w C6 Z < < s EhyH0 c >< folk Sessions Ruby r454 Elm Sessions Thos J (Mary) mgr Newark Shoe Co h22b Belmont Settle John H (Pearl; Christian Pharmacy) hl22 Holt Settle John H jr elk rl22 Holt Sevelle Cora nurse r312 Craft la Seventh Day Adventists Church Log Cabin Hts Seventh Street Baptist Mission 351 7th Sewell Ison pdlr h615 Mitchell la Sewell Mary lndrs h8 King Sewell Porter S trav r258 1st Sexton Henry C (Maggie; Dixie Bottling Works) h 1907 Broadway Seymour Estelle mill opr r34-36 Shell av Seymour Leonard F appr Beeland Conrad Motor Co res Lorain Ga Seymour Odessa mill opr r34-36 Shell av Shackleford Patk L bkpr 4th National Bank r220 High Shadburn John D (Flora) mgr J D Shadburn Top Co h Columbus rd Shadburn John D jr (Shadburn & Hudson) r R F D 2 Shadburn J D Top Co J D Shadburn mgr 514 Plum Shadburn Mary E (wid Thos) r611 Duncan av Shadburn Murtice opr Davis Beauty Shop r3211st SHADBURN WHELCHER H, Automobile Tops and Trimmings, Harness, Repair Work a Specialty, 708 3d, Phone 4580, h611 Duncan av, Phone 4448-J (See right side lines and page 68) Shadburn W Henry auto mech h611 Duncan av Shadburn & Hudson (J D Shadburn jr, C F Hudson) auto pntrs 514 Pine Shamis Oliver carp r225 Applewood Shamlin Love (Mary) edgemn h210 Forest av (V) Shanks Andrew (Lola) porter r280 Madison Shanks Danl (Geneva) h805 Edgewood av Shanks Flora lndrs h22 2d av (Y) MOVING STORAGE a FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO -- "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" W. R. Finch Motor Co* Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 S08 (1925) R. L. POLK & CO.'S Shannon Fredk membership sec Y M C A r Arcadia Hotel Shannon Lucille cook h573 Monroe Shannon Lucy maid 141 Hazel Shannon Tillman (Alice) lab h220 Hawkins av Shannon Walter M Rev (Florence) h206 Middle (V) Shannon Wm (Annie B) lab h3 Damour la Shannon Wm F (Bertha) bkpr Brad Wall Inc rl29 Pierce av (V) Sharp Albert (Sally) lab h440 Applewood Sharp Chas (Zula) lab h7 Bear's al Sharp Chas lab h 20 Tinsley la Sharp C J rl28 Park pi Sharp Fannie L r20 Tinsley la Sharp Harold elk Bethune & Stevens r721 Pine Sharp Harrison (Tempie auto mech hl07 Jones av Sharp Harvey (Mary L) mech h9 Buckner al Sharp Henry (Vivian P) h461 Spring Sharp Henry (Gertrude) lab r356 Maynard Sharp Jas (Viola) barber Geo Hatfield h534 E 2d (EM) Sharp Jas V (Eleanor V) eng maintainance of way Sou Ry System h530 (654) Vineville av Sharp Jas V jr student r530 (654) Vineville av Sharp John A r20 Tinsley la Sharp Laura r20 Tinsley la Sharp Mancy (Malinda) lab h344 Maynard Sharp Simon G (Goldie) shoe repr 607 Cherry h489 Orange Sharp Troy F shoe repr J Turner r615 2d Sharp Wm (Mattie) lab rl63 Bay Sharp Wm B attdt North Side Filling Sta rl44 High Sharp Willie Indrs r503 Plumtree Sharp Willie L (Anna) r721 Pine Sharp Zimie D (Mary) yd mstr h.3001 Houston av Sharpe Edw (Dora) lab h451 Mitchell la Sharpe Lila (wid Milburn C) h245 Hardeman av Sharpe Marcus (Addie) shoe repr h.429 Douglas av Sharpe Milburn r245 Hardeman av Sharpe Myra maid r429 Douglas av Sharpies Jos ptrnmkr Taylor Iron Works & Supply Co hl420 3d Sharpies Jos jr slsmn Dannenberg Co r!405 3d Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 809 Sharpies Louise rl420 3d Shatteen Arth (Viola) cook h324 1st av (V) Shatteen Wm (Mattie) barber E Z Piercey r314 (310) 1st av (V) Shattles Jack C (Dealva) yd cond r3901 Houston av Shaw Ellis (Maggie) firemn hlOl (75) Bay Shaw Enoch (Carrie) lab r226 Northern Shaw Lucy dom r22 Siam Shaw L D hlpr P B Yates Mach Co r869 Walnut Shaw Maude Indrs h22 Siam Shaw Oscar T (Maggie) millwkr h8 Manchester qtrs Shaw Wm T (Tommie) firemn hl331 3d Shea Bernard rl51 2d Shea Mittie A tchr rl51 2d Shealy Howard R sten r420 Johnson av Shealy Mary E (wid John W) h420 Johnson av Shealy Phil C (Lillie) elk r218 Coleman av Shealy Ruby sten r420 Johnson av Shealy Thos A (Eunice) elk rll9 Stonewall pi Shedd Ada (wid Preston) rl502 3d Sheehan Jas B elk M E Elliott Warehouse Co r Y M C A Sheehan John C (Ruth) asst supt rl09 Culver Sheehan Lucius C (Leila) purch agt h731 Courtland av Sheehan Lucius C jr sten r731 Courtland av Sheehan Robt E (Fannie) dept supt h553 Orange Sheffield Chas E (Dixie Dental Laboratory) r C H Brooks Sheffield Ellis M (Eunice) driver Plummers Creamery hl668 2d Sheffield Harvie (Cath) chauf r92 Bay Sheffield Lottie sten r758 2d Sheffield Mardell r C H Brooks Sheffield Mary r C H Brooks Sheffield Minnie r758 2d Sheffield M Carlton (Marie) auto repr 212 3d hl22 1st Sheffield Sarah (wid Monroe L) hl44 Deborde Sheffield Scymie hat mkr r470 May av Sheftall Chas H barber r418 (220) Pio Nono av Sheftall Julia S opr Sou Bell Tel Co rl65 Magnolia Sheftall Minnie barber 313 3d h(418) Pio Nono av Sheftall Willis B barber r418 (220) Pio Nono av A natural by-product of the Directory) Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do It BARRON & REAGAN TAX SPECIALISTS AND ADVISERS II Right Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 S10 (1925) R. L. POLK & CO.'S R P Shefton Annie cook h951 Ocmulgee la Shefton Cath tchr r951 Ocmulgee la Shefton Olivia tchr r236 1st av (V) Shehee Evelyn sten Odom Realty Co rl04 English ay Shehee Mary rl04 English av Shehee Unoka (wid J S) rl04 English av Shell see also Schall and Schell Shell Cliff P (Lillian) mech Ellis Motor Co h249 Win- ship Shell Jas W elk r249 Winship Shell Lula A Mrs r249 Winship Shell Mary L bkpr r249 Winship Shell Wm R (Margt) messngr r422 Duncan av Shelley Annie L (wid Alex F) gro 205 (105) Charles (S M) hllO Enterprise Shelley David starter Yellow Cab Co Chappell Shelley Geo S D (Josephine) taxi driver h417 Chap- pell r "A 75c Bottle Makes a Quart" PYORAL TM,y @MB8OggUSTggH55aaWABiS--H SIfsDHiflerAiEmegyIAho,LytLuYoarTup.nHrrgdouYdFvmeooe. nlcrsaTtasisathstiaritoiclesen.A,niaNsoTtIDtfaHyaEUotdhhuYaSeernEyagDAlePtrbRrhYulyEegOsegigRpdiUnisAntaNo'kLlns-., Shelley John R lab h302 Simmons Shelley Lewis H lab h203 Simmons Shelley Liza (wid Geo B) r417 Chappell Shelley Monroe (Minnie) farmer h Industrial Home rd Shelley Sallie hskpr 275 Orange Shelly Chas (Rosebud) mech h579 Siam Shelly Ernest farmer r Monroe Shelly Shelly Jas r230 Plant Shelly Lucinda (wid Jos) h230 Plant Shelly Oscar mill wkr r Solomon Shelly Shelly Sol (Annie) lab h Industrial Home rd Shelton Chas (Bertha) hl633 Broadway Shelton Homer (Bonnie) mill opr h225 (241) Flan- ders Shelton John (Minnie) lab hl006 Broad Shelton Laura gro 623 Division r do Shelton Needham (Lillie) opr h56 Clinton 41S Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO aENGLAND T"p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) Sll Shelton Oliver foremn W S Dickey Clay Mfg Co h ws Flanders IsRR tracks Shelton Oliver M (Ruby) mgr A G Rhodes & Son r 612 Forsyth Shelton Susie lndrs h415 Glen SHELYERTON CLAUDE W (Hovis), Architect 514 Grand Bldg, Phone 821, h Yista Circle Ingleside Phone 2909-J Shelverton Wm E (Fannie) druggist h852 1st Shelverton Wm J bkpr r852 1st Shepard Arth B (Gladys) filling sta 2635 Broadway h407 Jeff Davis Shepard Chas D (Mattie) cond hl29 Knott Shepard Chas D jr student rl29 Knott Shepard D T (Inez) mech Dunlap Huckabee Auto Co h311 White Shepard Jessie student rl713 2d Shepard John H(Mary) dray line h287 Morgan av MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Shepard Lula B rl713 2d Shepard Mary (wid Berry) r407 Jeff Davis Shepard Robt B (Willimena) mach h425 American Shepard R Olin mach r425 American blvd Shepard Volley C (Eunice) captain Fire Dept rl713 2d Shepard Wm A (Mamie V) trainmn Macon Ry & Light Co h538 Maynard Sheperd Jas E (Eliz) carp h305 Broad (E M) Shephard Benj F (Mollie) firemn hl04 Cole Shephard Dessie B mech rl04 Cole Shepherd Chas G (Clara) auto mech h200 Crescent av Shepherd Chas H teller Bibb Natl Bank r768 Mulberry Shepherd Chas M (Hilda) carp r412 Hanson Shepherd Jas D (Ola) ship elk hl05 Madden av Shepherd Le Verte student rllO Laurel av (N H) Shepherd Lewis A (Mary A) slsmn Jones Motor Co h711 Napier av Telephone 2687 J. T. MOLTON, Mgr., 348 Oak C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Anadirs All Questions as to WHOM You Are Looking For and WHER1 They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company Tharp's Pharmacy CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash H* Door Co. Office, 457 Third St. Telephones 278 & 3976 812 (1925) R. L. POLK & CO.'S Shepherd Lewis A jr student r711 Napier av Shepherd Ralph rl318 Broadway Shepherd Wilmer W (Madge) slsmn The J W Burke Co hllO Laurel av (N H) Shepherd Wm H (Mary) supt Bd of Water Commis- sioners h617 Carling av Sheppard Bessie opr Sou Bell Tel rll5 Lawton av Sheppard Bradley mill wkr r22 Blosfleld av Sheppard Grace opr r538 Maynard Sheppard Jas W (Mattie) millwkr h.22 Blosfield av Sheppard Jordan J (Evelyn) wks r2457 2d Sheppard Jos (Della) hl235 2d Sheppard Lois opr r538 Maynard Sher Harry A (Sallie B) gents furngs 565 Cherry h 852% do Sheridan Albert E slsmn T C Burke Inc rl23 Park p! Sheridan Christopher F (Lily) h318 Forsyth Sheridan Edw A (Alma) trav slsmn hl29 Park pi Sheridan John V (Theresa) mgr-X-V Clothes Shop h756 New Sheridan Julia H rl23 Park pi SHERIDAN LEO D (Kathleen), Sec-Asst Treas T C Burke Inc, h642 Ridge av (C P) Sheridan Patk J rl23 Park pi SHERIDAN ROBERT E, Pres T C Burke Inc, h!23 Park Place, Phone 2736 Sherling Emmitt L (Liza) h301 Hightower Sherling Jos G formn r301 Hightower SHERLING MADGE, Cashr Kenmore Burns Inc, r301 Hightower, Phone 1567-W Sherman Aaron (Robena) lab rl34 Williams Sherman Albert G treas 'Macon Lumber & Mfg Co r320 Orange Sherman Angeline lndrs r608 Norris Sherman Benj (Sally L) lab hl34 Williams Sherman Eliz lndrs r8 Reynolds al Sherman Fannie lndrs h406 (106) Lexington av Sherman Hugh D (Reva E) slsmn hll4 Beverly pi Sherman Louise lndrs rl34 Williams Sherman Mary car clnr h303 Patterson (N H) Sherman Minnie smstrs r322 Glen Sherman Sandy (Clara) hlpr hl24 Orchard av Sherman Willie M lndrs r450 Shoals al (E M) I FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4 Yz % on Savings MACON CITY DIRECTORY (1925) 813 Sherrer Wm (Jessie) cond h209 College pi Sherrill E Gordon (Alice; H L Moore & Co) r219 Lawton av Sherwood A Traywick (Avy) pur agt h ss Forsyth rd 8 w Tyrone blvd Sherwood Geo W cook r2 Spring Sherwood Google E (Annie M) foremn h448 Edge- wood av Sherwood Hall cor University pi and Adams Sherwood John H (Eula H) mfg jwlr 370 2d res Riv- oli Ga Sherwood Lester B (Madge) rl31 Clisby Sherwood Lou Mrs (wid Geo) rill 2d Sherwood Mollie spinner r355 Flanders (E M) Sherwood Reamer Y (Audrey) slsmn hllO Inverness Sherwood Thos B (Carolyn) yd eng h343 S College Sherwood Thos B jr truck driver r343 S College Sherwood Wm E (Ferris) r517 (513) Napier av (H H) Sherwood Wm W (Volucia) eng hl052 Walnut Shi see also Shy Shi Mary E (wid Thos F) r343 Carling av (H H) Shi S Robt (Lucille) county eng h343 Carling av (H H) Shield Ordella r383 Madison Shields Julia lndrs hl21 Clark la Shields Lizzie lndrs rl35 Mitchell Shields Mabel tchr rl024 Broad Shier Henry elk G Bernd Co r220 Chestnut Shier Leah sten Happ Bros Co r220 Chestnut Shier Sami (Seemah) shoe repr 456 Cherry h220 Chestnut Shitless Bessie h62 Davis la Shine Chas truck driver r613 Bailey av Shine Clarence (Tommie) h613 Bailey av Shine Jas W (Nora) stove repr 1993 3d h do Shines Lucile student rl29 Rutherford av Shinholser Alice mill hd r957 Broad Shinholser Daisy (wid Wm) h957 Broad Shinholser Ella L r957 Broad Shinholser Ella L r957 Broad Shinholser Geo (Ida) lab h209 Smith (E M) Shinholser Henry S (Agnes) city circ mgr Macon Telegraph h601 Hillyer av n Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. 814 (1925) R. L. POLK & CO.'S Shinholser Jas C (Lillie) porter h327 Jackson Shinholser Jas G (Josephine) planer h.301 Mikado Shinholser Jessie R (Edith) firemn rl20 Chappell Shinholser Jessie W (Della) cond h231 Reid Shinholser John farmer r Mrs C B Walker Shinholser John W officer 302 Grand bldg r Forsyth rd Shinholser Josiah W (Eliz) r2224 Broadway Shinholser Juineta student r301 Mikado av Shinholser Margaret sten Matthews Jewelry Co r20S High Shinholser Martha (wid Thos J) h206 High Shinholser Mary lndrs hl04 Bay Shinholser Matilda maid h8 Plant al Shinholser Walter N (Julia) gro s s Forsyth rd 5 w Riverdale dr h ns Forsyth rd (V) 2 w Belvedere dr Shinholser Wm (Lucinda) lab r218 Pear (E M) Shinholser Wm M (Mammie) foremn hl36 Winship Shipman Alex H (Annie J) slsmn Beeland-Conrad Motor Co hl05 Rogers av Shipman Lewis H (Mary) flagmn h956 Elm Shipman Mattie J r956 Elm Shipman Oliver (Annie) h649 Ash Shipp Benj R elk A S Hatcher Co rl41 Park pi Shipp Percy G (Dorothea) slsmn A S Hatcher Co r 147 Rose Park Shipp Perry flagmn r603 Plum Shipps Harrold S (Mary W) bkpr Macon Telegraph h Cl, 261 Georgia av Shirah Henry (Thelma) mech Acme Welding & Electric Co h Log Cabin blvd Shirley see also Shurley Shirley David A (Sara) dept mgr L F M Store h477 Spring SHIRLEY LOUIS A (Jane E), District Mgr Equitable Life Assurance Society of the U S, h414 Hines ter, Phone 2230-J Shirley Martha E r207 Rogers av Shiver Wm J asst tchr Mercer University Shivers Annie A cook rl34 Sycamore Shivers Edna maid r408 Monroe Shivers Emma lndrs h620 Gilmer E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 Shivers John L (Cassie) carp hl004 Napier av Shivers Julia cook rl34 Sycamore Shivers Lizzie lnrs hl34 Sycamore Shivers Louis porter S H Kress & Co h341 2d Shivers Lula cook r408 Monroe Shivers Oscar (Bulah) lab h424 Monroe Shivers Penny cook r424 Monroe Shivers Robt chauf r408 Monroe Shivers Rufus lab rl34 Sycamore Shoates Fred student r437 (441) Elbert Shoates Mattie h437 (441) Elbert Shoats Ella maid rl20 Lynwood av Shoats Gabriel lab r314 Ash Shoats John M contr h501 Fulton (E M) Shoats Lillie student rl20 Lynwood av Shoats Mattie presser Union Dry Goods Co 117 Crisp Shoemaker Wm (Emily) firemn hl52 Bay Shokespeor Annie cook r645 4th av (U) Shokespeor Garfield truck driver r645 4th av (U) Shokespeor Jessie (Sarah) firemn h645 4th a.v (U) Shores Edw L (Eunice) slsmn Try Me Bottling Co r 77 Wilder (S M) Shores Spicie A (wid Frank) h2338 2d Shores Walter (Hazel) auto repr h5 Barfield al Shores Willard M (Lula) mach Fuller's Garage r RFD 4 (E M) Short Clara r930 Walnut Short Emma lndrs h3 Parker av Short Henry W (Emma) blrmkr h Grand av (Bell- vue) Short Junior (Willie) lab h359A Bay Short Llewellyn H (Ava P) restr 451 Broadway meats 1025 do hl71 Magnolia Short Wesley P mgr The Wardrobe Pressing Club h 930 Walnut Short Wesley P jr prop The Wardrobe Pressing Club r930 Walnut Shorter Alma h450 Douglas Shorter Butler E (Ida) prod dir h674 (507) Douglas av Shorter Carrie cook r674 (507) Douglas av Shorter Eliz S (wid Jas H) hl30 Georgia av Shorter Frank pdlr hllO Moore la More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains ''Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 816 (1925) R. L. POLK & CO.'S Shorter John (Mattie) carp rl225 Napier av Shorter Mamie r674 (507) Douglas av Shorter Marian maid h407 Ward (V) Shortes Dock (Sallie) pdlr h608 (217) Crisp Shoupe T Alex (Mollie) farmer h411 Mikado av Shouse Alex F (Annie J) eng hl4 Balkcom av Shouse Benj B (Berta) firemn r760 1st Shouse Edgar S (Idelle) eng hl063 Elm Shouse Hugh A (Gertrude) eng h871 Orange Shouse Jas P (Lucile) cond h804 Spring Shouse Preston G (Anna) firemn rl Balkcom av Shrem Jack (Flora) gro -229 Turpin r do Shropshire Eliza (wid Sherman) rl321 Oglethorpe SHROPSHIRE JOHN T (Sarah E), Practical Plum- ing', Special Attention to Contract and Repair Work 525 Cotton av, Plione 1265, hl021 Hazel, Phone 3836-W (See page 79) Shropshire John T jr (Eula M) plmbr J T Shropshire rl021 Hazel Shuford Sami (Allie) pipe ftr h317 Morgan av Shupe Leroy (Hallie) student r43 S College Shurley see also Shirley Shurley Louise tchr r360 Hardeman av Shurley Mary R (wid Chas M) slsldy Union Dry Gds Co h360 Hardeman Shurling Ross B (Ophelia) mill wkr h355 Flanders (E M) Shy see also Shi Shy Irwin S elf Troy M Raines Gro Co r57 Pio Nono av Shy Jas C (Leila) custodian r330 Napier av Shy Mary Mrs opr The Wm Carter Co h617 Plum Shy Pound (Eula) carp r411 (311) Hall Shy Robt I (Mary) baker Am Bakeries Co h617 Plum Sibert Virginia H Mrs elk- J P Allen & Co rll5 Cres- cent av Sicurella Josephine boarding house 270 Main (E M) h do Sidwell Hattie L lndrs rl012 Main Sidwell Mary L lndrs rl012 Main Sidwell Thos (Mary) carp hl012 Main Sigman John M (Leila) phys 508 Ga Casualty bldg h 715 Napier av Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaorrters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for copy. R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 817 Signor Sallie S (wid Matt H) h209 Buford pi (V) Sikes see also Sykes Sikes A Monteith (Mamie) ckf dispr hl09 Park av (C P) Sikes Ellis (Carrie) porter Union Dry Goods C h357 Magnolia Sikes Hattie bkpr Macon Coca Cola Bottling Co r2 Forsyth ter Sikes Jas C (Lenora E) prsmn The J W Burkes Co h 425 Forest av Sikes Julian elk 4th Natl Bank rl09 Park av (C P) Silas Doris appr r202 Newberg Silas Francis D (Eliz) lab h326 Ridge av Silas Ina Mrs r202 Newberg Silas John P (Hennie) slsmn hlOl North av (N H) Silas Julia tchr rlOl North av (N H) Silas Margt (wid Lazarus) r617 Oglethorpe Silas Pattie H sten Ga Carolina Oil Co rlOl North av Silliman Alice student hill Courtland av Silliman Wm W Rev (Mary) rector St James Epis- copal Ch hill Courtland av Silliman Wm W student rill Courtland av Siloam Cemetery (col) Bellevue ws Pio Nono av Silver Moon Cafe Dennis Poulos mgr 311 Broadway Silvius Chas miller Birdsey Flour Mills r554 1st Simmone Almeta (wid John E) rlll6 Elm Simmone Jesse mach r311 Main (E M) Simmone Jos H (Emma) carp h311 Main (E M) Simmons Alberta cashr Chapman's Pharmacy r660 Elm Simmons A Franklin (Ethel) brick mason h621 Elm Simmons Bert h655 Elm Simmons Brantley K opr W U Tel Co rl08 Madden av Simmons Bubber r Dora Hobbs Simmons Camilla A (wid Jas T) r2534 2d Simmons Chapel (col) 9 White al Simmons Chas (Jane) lab rl22 Virgins la Simmons Cinderilla lndrs rll7 Elliott (E M) Simmons Davis lab r421 Gilmer Simmons Edith r83 (114) Roosevelt (V) Simmons Edna M cook r226 Madison Simmons Edw (Elvira) lab hl425 Broadway Simmons Edw lab r301 Plant Simmons Edw mach r660 Elm FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALPT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 as a MX PUCE THE DIRECTORY IS THE GREATEST MARKET PLAGE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had # The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MJkitb PUBLISHERS PolkDirecbraB DETROIT. 818 (1925) R. L. POLK & CO.'S Simmons Edw (Alice) mach h404 4th av Simmons Edw D (Dora) lab h226 Madison Simmons Elijah (Sarah) lab h206 Virgins la Simmons Eliza cook'rll9 (115) May av Simmons Eliz r303 Blount Simmons Elmore H (Wilma) slsmn Burden Smith & Co h460 Spring Simmons Emma lndrs hl20 Thomas Simmons Eva (I Simmons Mdse Co) r973 Hazel Simmons Flewelen h21 Wise av (V) Simmons Floyd (Eva) lab rllO Gantt City rd Simmons Foye nurse Macon Hospital Simmons Fred W auto mech rll4 Ponce de Leon av Simmons Fredk W (Josie) pharm r817 New Simmons Gilmer lab r226 Madison Simmons Glena cashr Life & Casualty Ins Co r53S Washington av Simmons Green (Linnie) lab h301 Plant Simmons Harry (I Simmons Mdse Co) r973 Hazel Simmons Henry (Janette) hll9 (115) May av (Un- ionville) Simmons Isaac jr slsmn Union Dry Goods Co r637 Vineville av Simmons I Mdse Co (Moses I, Eva, Martha, Harry) 973 Hazel Simmons Jas (Sallie) lab hl08 Gantt City al Simmons Jas (Jennie) pdlr hlOl Empire Simmons Jas A (Laura) r752 Edgewood av Simmons Jas J barber rllO Latta pi Simmons Jas M mgr Kash & Karry Market Central City Hotel Simmons Jas T (Mattie L) brickmason h311 Giles Simmons Joel J barber Sanitary Barber Shop No 2 rl04 Magnolia Simmons John (Sarah) h234 Simmons av Simmons John brick mason r660 Elm Simmons John (Alberta) lab r501 Johnsons al Simmons John R (Syble) slsmn Ga Carolina Oil Co r 415 American blvd Simmons John W mech N E Pace, h Houston rd Simmons Jos lab r301 Plant Simmons Jos (Cora) plstr h7221 (120) Cowan Simmons Jos C brick mason r660 Elm .FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. J-. POLK & CO. CHICAGO Southern Business College H E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 1. 656/2 CHERRY ST. PHONE 3041 MACON, GA. 1 MACON CITY DIRECTORY (1925) Simmons Julia r660 Elm 819 C/3 sr Simmons Lance B (Berta) slsmn hllO Clisby I' Simmons Lee (Sussie) hlpr r311 Blount Simmons Lewis lab r301 Plant Simmons Lillia lndrs h223 Mougbon Simmons Lillie K Mrs hl24 Concord Simmons Louis S barber A J Brown r Willingham Quarters Simmons Marcus V traffice agt r457 Spring Simmons Martha (I Simmons Mdse Co) r973 Hazel Simmons Martin V solicitor M D & S R R r Dempsey Hotel TERMINAL TRANSFER COMPANY Simmons May S cook r330 Napier av Simmons Milton (Essie) gen foremn h609 Anderson Simmons Moses I (I Simmons Mdse Co) h973 Hazel Simmons Norman (Greenie) lab hl229 3d Simmons Ophelia cook r226 Madison Simmons Pomie (wid Chas) hl50 Elizabeth Simmons Rebecca cook h533 Monroe Simmons Robt lab r303 Blount Simmons Robt (Millie) ship elk hl03 Pio Nono av Simmons Sidney J (Nellie) mgr Rogers Grocery r868 1st Simmons Stokes T (Jennie) phys 352 Cherry hlOl Empire av Simmons Sylvester (Lillie) lab h604 Broad Simmons S Henry blrmkr h2803 Houston av Simmons Thos S (Fannie) contr h660 Elm Simmons Ulysses (Ida) r201 Gantt City rd Simmons Victor L (Lucile) slsmn Ga-Carolina Oil Co h568 Boulevard av (N H) Simmons Walter (Ada) lab Jones Motor Co h.629 Georgia av Simmons Walter B bkpr Cit & Sou Bank r753 Mulberry Simmons Walter J slsmn Strong Shoe Co r457 Spring Simmons Wm r655 Elm Simmons Wm (Maria) barber C- Howell r721 Fort Hill (E M) Simmons Wm (Lula) lab h211 Bright al Simmons Wm H city emp rll9 (115) May av Simmons Wm S (Olive D) h457 Spring Simmons Wm S jr elk X V Clothes Shop r457 Spring POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk &Co. Publishers 536 S. Clark St. Chicago, 111. TRY-fflE BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 820 (1925) R. L. POLK & CO.'S Simmons Zippie smstrs LPM Store r409 Spring Simms Earl lab rl22 Sycamore Simms Edgar lab rl22 Sycamore Simms Frank E (Sallie) h22 Railroad av Simms Hattie rl015 Edgewood av Simms Henry draymn r970 (721) Columbus rd Simms Homer (Mattie) weaver b American blvd Simms Jas pdlr r970 (721) Columbus rd Simms John (Annie) lab r3 Frank al Simms Jos H lab r259 Ocmulgee Simms Mattie maid hl22 Sycamore Simms Oliver (Nora) draymn h970 (721) Columbus rd Simon Florrie r925 Ash Simon Hubert lab r40 Railroad av Simon Leila M student r604 Fort Hill Simon Starling (Ella) lab h40 Railroad av Simone Jacob S (Emma) millwkr hl02 Green (Payne Mill) Simpson Annie L matron hll7 Lawton av Simpson Bear eng r211 Broadway Simpson Chas hlpr Macon Coca Cola Bottling Co r 326 Maple Simpson Chas solr Crescent Laundry Co r851 Hazel Simpson Chas truck driver r39 Bibb av Simpson Clarence S (Mattie) eng b.744 Anderson Simpson C Robt (Eva) barber Rudolph Goepp r812 2d Simpson David A (Georgia) cond r440 New Simpson Donie (wid Jos) h39 Bibb av Simpson Edgar lab h33 Dixie row Simpson Edw (Rosetta) h220 Orange Simpson Eliz asst librarian r310 Washington av Simpson Ella (wid Lonnie M) hl37 Cole Simpson Henrietta cook h326 Maple Simpson Ida nurse Macon Hospital Simpson Jas (Mamie) carp hl068 Oglethorpe Simpson Jas M cotton wkr r324 Ross Simpson Jerry (Alma) news butcher hl08 Yates av (E M) Simpson John L (Edna) gro 165 5th rl06 Montpelier av Simpson J Thos (Lula) hardwood floor mn hl31 Ross Simpson Levora (wid Robt) r41 Marion pi (H H) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 821 Simpson Lola maid r857 (858) 3d av (V) Simpson Lucy tchr rll7 Lawton av Simpson Maggie r521 New Simpson Mary L opr Sou Bell Tel Co r358 Fairview Simpson Mattie opr Sou Bell Tel Co rl08 Emerald Simpson Paul (Vera) carpetmn Dempsey Hotel h351 Fairview _ _ , Simpson Rosalind caslir Natl Biscuit Co r200 Grand av Simpson Ruel hallmn Hotel Lanier r308 Spring la Simpson Sami (Mattie) h200 Grand av (Bellevue) Simpson Virginia elk Union Dry Goods Co r200 Grant av Simpson Wm A (Elsie) harnessmkr Otto Isaacs Har- ness Co h358 Fairview Simpson Wm A jr hlpr Jones & Coney r358 Fairview av (E M) Sims Andrew (Addie) pdlr hBartlett la Sims Clarence (Clara B) lab r454 Pine YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Sims Edgar driver Enterprise Packing Co rl22 Sycamore (PH) Sims Fannie (wid Clarence) r854 Gordon Sims Frank F (Ada) carp h220 Maynard Sims Jas (Mildred) carp r400 (i64) Roye Sims Jas (Maggie) driver Willingham Sash & Door Co hl65 Grants Sims John (Vera) lab hll6 Moore la Sims John A (Ada) blksmith 455 Hawthorne r220 Maynard (E Macon) Sims Jos S trainmn Macon Ry and Light Co r7 Hill Park av Sims Lorenza carp h233 Roye Sims. Lula cook hl55 Green Sims Mamie dom rl23 Rock Hill la Sims Margie rll6 Moore la Sims Mattie lndrs rl 3d s la Sims Minnie lndrs r95 Harris al go mzZz HO) *H-*tCi Z>1S?Ho oOgtco ^Zg A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit 210-212 MORRIS HARRIS Bibb Building INSURANCE SURETY BONDS Telephone 131 bi 822 (1925) R. L. POLK & CO.'S P Sims Ninell lndrs r228 McLean al MzM < Sims Robt bellmn r204 Lynwood av Sims Sylvia lndrs h204 Holmes av Sims Terrell r220 Maynard Q Sims Vera emp Hotel Lanier rll7 Moores la Sims Walter (Carrie) lab hl08 Concord Sinclair Ernest S (Leila N) driver Yellow Cab Co h 442 Lawton av Sinclair Jos (Emma) gro 803 Cowan h303 Short (E M) Sinclair Martha (wid Elias S) hl22 Daley (S M) Sinclair Walter (Alice) pntr rl028 2d Singer Sewing Machine Co W T Swint mgr 123 Cot- ton av Singletary Edna E r rear 920 1st Singletary Guy elk Midland Pharmacy r548 Ocmul- gee Singletary John I (Penny) barber h.548 Ocmulgee .SINGLETON CHARLES E (Minnie L), Mgr Hubbard Undertaking Co, h243 2d av Singleton Charlie C (Berta) carp h302 Rutherford Singleton Ella lndrs r641 Peeble Singleton Garfield (Eula) lab r217 1st av (V) Singleton Garland (Rachel) repr h235 Telfair Singleton Inez lndrs rllOl (801) Woolfolk Singleton John driver h220 3d av (V) Singleton John (Lena) janitor h201 Woodliff Singleton John (Frances) mach opr h823 Hazel Singleton John W (Katie) barber E Z Piercey r307 Womack (E M) Singleton Jordan (Sallie) pdlr h Bartlett la Singleton Lillian dom r456 Bay Singleton Louise tchr r520 Orange Singleton Lucretia maid rl21 Chestnut Singleton Lula lndrs h640 Hammond s D Singleton Marie lndrs hl23 Clark la Singleton Mary lndrs hllOl (801) Woolfolk Singleton May elk r520 Orange e Singleton Minnie sten Pilgrim Health & Life Ins Co r (2 243 2d av D Singleton Paul lab h263 Ellis av Z Singleton Paul waiter r228 (210) Green < Singleton Robt janitor h307 Womack More goods are bought and sold through the Classified Business Lists of the Directory thao any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 823 Singleton Tlios (Eddie M) driver Union Dry Goods Co rl54 Middle (V) Singleton Walter F (Sarah) pntr h233 Telfair Singleton Wm r823 Hazel Singleton Wm lab h806 Fort Hill Singleton Wm J h Robt Lee Sink Lewis F (Ida) agt Natl Life & Accident Ins Co h553 Oak Sinquefield Mary B (wid Wm A) r606 Carling av (H H) Sintell Harry (Nellie) loom repr b Villa av Bellevue Sipp Kira (Annie) blpr rll Henderson Sires Jas E eng hl35 Napier av Sires Melvin J (Annie; Smith & Watson) h317 Dun- can av Sires Melvin J jr r317 Duncan av Sirote' Nathan buyer Coplan Junk Co r870 Orange Sisk Alpha sten The Letter Shop r W E Sisk Sisk Delphin R emp r W E Sisk Sisk Vivian slsldy S H Kress & Co r W E Sisk Sisk Walter E (Edna) millwright h ss Log Cabin blvd Sissons Robt H (Mary) cotton broker hl09 Lamar Sissons Wm W pntr h420 Montpelier av Sisters of Mercy in charge Mount de Sales Academv 639-45 Orange Sitton Emmett L (Lois) eng hl335 3d Sitton Myrtle (wid Jerry) rl335 3d Skelley Edison (Clyde L) auto mech hll5 Callaway Skellie Harriett (wid Thos 0) 105 Culver Skelton Hugh elk Central City Hotel r do Skinner Ephram J (Emma) lab h801 (401) Williams Skinner Georgia M rl710 2d Skinner Jos D (Jessie) blrmkr Taylor Iron Works & Supply Co h553 Elm Skinner Jos D (Julia) lino opr hl710 2d Skinner Laverne r648 (1270) Elbert Skinner Lewis O (Ida) firemn r308 Cutters Green Skinner Nancy cook Tundy Hosp r602 3d av (V) Skinner Walter J (Mary) jeweler h412 Forest av (V) Skinner Wm B (Mary) slsmn Williams-Guttenberger Music Co r605 Carling av Skipper Chas J (Lucille) emp rl526 2d Skipper Claude hall boy rS14 Ocmulgee The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH ana SEPTEMBER by R. L. POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much -valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory1 Business is the compilation of Mailing Lists. If interested, ask for our Free "list of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" S24 . (1925) R. L. POLK & CO.'S Skipper Lois opr Sou Bell Tel Co r422 Log Cabin dr Skrine Franklin S printer Holte & Hanbery rl8l7 3d Slade Jos B (Gladys) slsmn Standard Oil Co h2107 Broadway Slade Truman J dentist 407 Bibb bldg r218 Georgia av Slappey Robt C firemn r871 Walnut Slappey Robt E br mgr Hammond Service Co r Arca- dia Hotel Slappey Thelma school tchr r T J Slappey Slappey Thos J (Mary) blacksmith h Log Cabin Hts Slappey Virginia nurse Macon Hospital Slappy Gilford (Lora) porter J L Johnson h No 12 Stripling la (E M) Slappy Joshua (Willie) firemn hl052 Hazel Slappy Ruby rl052 Hazel Slater Myrtice student rl28 Grants Slaton Ella rl43 Tatnall Slaton Sweet Rev (Eliz) h246 3d av (V) Slatter Fredie r381 Melrose (E M) Slaughter Chas H (Bessie) hlpr h252 Broadway Slaughter Ethel Mrs manicure Sanitary Barber Shop No 2 r Lanier Hotel Slaughter Frank (Pearl) lab h425 Ward (V) Slaughter Geo (Mary) lab h302 Turpin Slaughter Lewis lab r305 (10) Wood al Slaughter Lizzie cook r305 (10) Wood al Slaughter Marie weaver r252 Broadway Slaughter Thelma weaver r252 Broadway Slaughter Troy lab r305 (10) Wood al Slayton Thos J cook h224 1st av (V) Slayton Wm (Emma) restr 210 Division h216 do Sledge Augustus driver rll2 Green Sledge Lillie (wid Emory) maid hll2 Green Sligh Lois pupil nurse Oglethorpe Private Infirmary r204 Tatnall Sloan Crowell L (Hattie) sec treas I Kessler Commission Co h.709 Walnut Sloan C Guyton slsmn Murphy Taylor & Ellis r296 College Sloan Helen milliner rl55 1st Sloan Kyle D elk Ga Grocery Co rl55 1st Sloan Nora (wid Chas H) hl55 1st Sloan Thelma sten rl55 1st Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 825 Sloan Thos S (Ruby W) b217 Corbin av Sloan Wm H (Estelle) b296 College Slocum Abner (Ora) lab hl63 Hazel Slocum Amalia (wid J W) r406 Forsyth Slocum Burke L (Lillie; Macon Mach Shop) hl21 Cleveland av Slocum Frank (Lila) lab h22 Franks al Slocum Karl R (Louise) h406 Forsyth Slocum Lillie Mrs elk C of G R R Co hl21 Cleveland av Slocum Sami (Annie) lab r304 (606) Colquitt Slocumb Annie P lndrs r507 Coleman al Slocumb Arth G mech Ellis Motor Co r771 Spring Slocumb Benj F (Mattie) collr Union Furn Co h553 Oglethorpe Slocumb Calvin hlpr Taylor Iron Works & Supply Co r919 Montpelier av Slocumb Chas A (Mary) r858 Elm Slocumb Clarence (Lois) lab h918 (919) Columbus rd Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Slocumb Elija (Annie) lab r918 (919) Columbus rd Slocumb Emma smstrs Union Dry Goods Co r620 Walnut Slocumb Eudroa (wid David) h771 Spring Slocumb Evelyn sten rl23 Holt Slocumb Gertrude cook b.507 Coleman al Slocumb Girvis (Mildred) swtchmn hl37x/^ Park pi Slocumb Henry L (Nelle B) real est h204 Corbin av Slocumb Henry L (Effie) presser h858 Elm Slocumb Hugh T mach rl23 Holt Slocumb Margt slsldy W T Grant Co r553 Oglethorpe Slocumb S Albert (Hattie) bkpr Union Furn Co hl23 Holt Slocumb Walter (Claudie) h803 (129) Columbus rd Slocumb Wesley (Sophie) lab h974 Columbia rd Slocumb Wm hlpr Taylor Iron Works & Supply Co r 617 Ross Slocumb Wm (Tommie) lab r480 May av _ FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO en ^ tO _ ^--1 3o> t/> 5*5 r Z Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindt of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 826 (1925) R. L. POLK & CO.'S Slocumb Wm J (Mary E) solr Ideal Laundry Co h34l Hydrolia Slocumb W Cliff (Annie) slsmn Dunlap Hdwe Co h 139 Hines ter Small Artemus H trav slsmn h520 Washington av Small Augustus T (Minnie) pres h Jackson Spring Drive (S H) Small Augustus T jr slsmn W T Tharpe r452 College Small Corbin C bkpr r A J Small (S H) Small Geo C (Ruth) mach rl26% Washington av Small Jas K student rll5 Rogers av Small Mabel maid r406 Thompsons al Small Mamie maid r450 Alabama Small Mollie V (wid Geo) hl26% Washington av Small Ralph B (Annie) pecan grower hll5 Rogers av Small Robt H collr T C Burke Inc h2451 2d Small Tullie rl26% Washington av Smalley Jas lab hl304 Broadway Smalley Mamie hlOO Jtichard "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IAsSDHfleriAEmegyAIho,LytLuoYarTup.nHrrgdouYdFvmeoeo. nlcrsaTtasiasthstiaritoicelsen.A,niNasoTtIDtfaHyaEUotdhhuYaSeernEyagDAletPbrRhrYulyEegOseiggRdpiUnisAnaNtok'Llns-., Smalley Welcome T tcbr Mercer University h507y2 Adams Smalley Wm M (Racbl) gro 218 Elliott r221 do (E M) Smalling Chas R (Julia; R H Smalling Sons) h2451 2d Smalling John H (Johnnie; R H Smalling Sons) h 2455 2d Smalling Margt r2455 2d Smalling Minerva R (wid Geo H) h2515 2d Smalling Nelle B sten Coral Gables r2451 2d Samlling Noami r2451 2d Smalling Robt collr r2451 2d Smalling Ruth sten Bankers Health & Life Ins Co r 2455 2d Smalling R H Sons (C R and J H Smalling) contrs 461% 3d Smallwood Florence mill hd r8 Lake City Smallwood John J (Mattie) police h383 Clinton (EM) R. L POLK & Company FOR LISTS OF NAMES ANY TRADE ANY BUSINESS ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 45S7 MACON CITY DIRECTORY (1925) 827 Smallwood Mary L Mrs dom rl034y2 Broadway Smallwood Thos (Della) rodmn City Eng r356 Pair- view Smallwood Wm (Lydia) mill opr h50 Shell av Smallwood Wm H (Mae) slsmn h361 Fair-view Smallwood Wm J (Bessie) carp h374 Clinton (E M) Smallwood Wm S (Janie) mill hd h.8 Lake City Smallwood W Ray pntr rl034i/2 Broadway Smarr Julius L (Lily) trainmn Macon Ry & Light Co hll57 Elm Smarr Millard L appr Macon News rll57 Elm SMART HERBERT (Alberta H; Herbert Smart Clothing Co), hill Culvert, Phone 2979-W SMART HERBERT CLOTHING CO (Herbert Smart, Walter Pearce, Dean Bakewell), Macon's Smart- est Men's Wear Shop, "Correct Apparel of Dependable Quality" 559 Cherry, Phone 951 (See left top lines and page 59) Smelter Ison lab r690 Hall MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIINSS Smelter Thos (Eddie) lab h717 Fort Hill Smerling Moses (Elsie) men's furnishings 361 Broad- way r978 Walnut Smith see also Schmidt Smith Asa R (Tessie) agt Metropolitan Ins Co rl86 English av Smith Abr (Lizzie) lab h233 Jefferson Smith Ada C (wid Durham G) bkpr r273 Hillyer av Smith Adolphus (Daisy) car repr hl41 Evergreen la Smith Albert (Annie L) lab h216 Lynwood av Smith Albert C (Emmiela) slsmn Macon Paper Co h 121 Winship Smith Albert N student r305 North av (N H) Smith Aletha caterer h826 (830) 3d av (V) Smith Alex (Teady) lab h319 Plant Smith Alex P (Lucia) supt Bibb Basket Co h259 (159) Center Smith Alex P jr batterymn Wade & Co rl59 Center Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world* Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking ( Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg, r Detroit, Mich. 828 (1925) R. L. POLK & CO.'S Smith Alex W (Julia) pres Macon Grocery Co h411 College Smith Alice rl09 Forest av (V) Smith Alice lndrs h253 North Smith Alice spinner r350 Flanders (E M) Smith Allen eng r821 Mulberry Smith Alma cook r281 1st av (V) Smith Alonzo chauf r296 1st av (V) Smith Alvah R (Ruby M) carrier P 0 r554 1st Smith Anna E tchr r702 Forsyth Smith Anne D sten Macon Telegraph r721 Oak Smith Annelyn rill Lamar Smith Annie (wid Hiram A) r9 Balkcom av Smith Annie cook h72 (140) Forest av (V) Smith Annie cook r412 Monroe Smith Annie cook r267 Ocmulgee Smith Annie music tchr rl24 Rogers av Smith Annie L cook h315 Madison Smith Annie L maid r362 Pine Smith Annie L sexton hl2 (654) Tatnall la Smith Annie M opr r256 Hydrola Smith Arch J (Edna) mgr J S Schofield Sons Co Inc rl202 (1242) Edgewood av Smith Arth lab r438 Bright al Smith Arth H elk L K Liggett Co r340 Columbus Smith A Bernard firemn r721 Oak Smith A T brickmason r302 Hawkins av Smith Bailey P opr W U Tel Co rl24 Plant Smith Belle rll7 Ells (S M) Smith Benj C (Adele D) sec-treas Empire Inv Co h 570 College Smith Bertha lndrs r426 North (Y) Smith Bessie dom rll5 Hazel Smith Bessie sten Dunlap Hdw Co r C A Ruskin Smith Bettie Mrs r865 3d Smith Bluford E (Ettie) eng h2131 Broadway Smith Bluford E jr student r2131 Broadway Smith Brewston lab r432 Coles al Smith Bridges asst bkpr Macon Gro Co r337 Adams SMITH BRIDGES W (Margaret), Judge Juvenile Court, h855 2d Smith B Frank (Mattie) horses and mules 566 Popla'r rl30 Rogers Smith Carl (Veata) lab h rear 150 New KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR'' Open All Day From 9 to 6--4Va% on Savings s SN3 tn MACON CITY DIRECTORY (1925) ^hC^l B (Sallie B; Macon Barber Supply Co) h ss Forsyth rd 5 w Tyrone blvd Smith Carl L (Sula M) gro 653 Poplar hl96 (120) Crescent av CO Smith Carrie cook r68 Spring Smith Carrie' lndrs hl32 Moughon IS Smith Cath r20 Arlington pi Smith Cecil S (Alice) slsmn A S Hatcher Co r312 Napier av Smith Celestine student r207 (224) Mutual av Smith Chas (Lottie) carp hl09 Forest av (V) Smith Chas elk Union News Co rl24i/2 Cole Smith Chas collr dept Coml Credit Co r340 Columbus Smith Chas electn Macon Electric Co r560 Plum Smith Chas (Sallie) mach opr h835 Hazel Smith Chas (Rosa) plstr h222 Roosevelt (V) Smith Chas waiter J D Carr r77 Wilder Smith Chas B (Lula) slsmn Lyon Harris & Brooks r 215 Ninadell SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Smith Chas C (Minnie L) slsmn Swift & Co r219 New Smith Chas E r337 Adams Smith Chas E (Annie) trainmn Macon Ry & Light Co rl057 Walnut Smith Chas E (Mattie) trav slsmn h206 Crescent av Smith Chas H elk City Court r262 Georgia av Smith Chas H (Mattie) lab hl30 Green Smith Chas H student r207 Smith Smith Chas J rlOO Davis (SM) Smith Chas L (Walton H) hkpr Odom Realty Co h401 Winton av Smith Chas M (Eliz; Smith & Watson) h337 Adams Smith Chas M mach opr h847 Hazel Smith Chas M (Cleah) ptrnmkr hlOO Davis (SM) Smith Chas S (Anna) emp h ns Forsyth rd (V) Smith Chas W (Edith) bkpr United Credit Corp h215 Ninadell av Smith Chattie lab r309 Blount mEJO O^>n ^ O S* hd a. rCwi/3S* 58 Hgj oS 88 S1 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. E FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 830 (1925) R. L. POLK & CO.'S Smith Chauncey J (Jennie; Wade & Co) hll3 Cleveland av Smith Chester P waiter r2446 2d Smith Clara I r702 Forsyth Smith Clarence M (Ethel) mach Wade & Co h R p D 2 Smith Clark (Alice) flremn h357 Gilmer Smith Claude rll8 Latta pi Smith Claude W (Louise) insurance agt h2906 Hous- ton av Smith Claudie cook r218 (212) Fargason Smith Clelly F (Willie) cond hll2 Mudder av Smith Clifford (Mary E) eng Armour & Co r55 Spring Smith Clifford C (Annie) carp hl538 Broadway Smith Clifford S (Marion) pipeftr r2125 Broadway Smith Clifton C (Minnie) real estate r219 New Smith Comer D elk r2446 2d Smith Conley lab r313 Madison Smith Contee lab r235 Jefferson Smith Cora Mrs waitress Macon Cafeteria rlOl Capi- tol av Smith Cora lndrs r3_24 Bright al Smith Cosby W r68"6 College Smith Cossie (Minnie) rlOl Capital Smith Cottage 1131 College Smith Cyrus N lab r235 Jefferson Smith C A flremn r207 Smith Smith C M jr elk C of Ga R R Co r6 Rose pi Smith Danl (Lula) elk h238 (240) Fargason Smith Danl (Mary) lab b. Industrial Home rd Smith Danl C (Cora) elk rlOl Capital av Smith Della cook h266 4th av (V) Smith Dorothy W tchr Wesleyan College' r707 Vine- ville av Smith Dorhpus (Leila) hlpr h337 Bookers al Smith D H (Cassie) rl98 Magnolia Smith Edgar lab r726 Campbell av Smith Eldgar B (Ora) pres E B Smith Lmbr Co h206 Clayton Smith Edgar O (Pearl) elk M D S R R h.209 Hendley Smith Edw (Lina) lab h221 Lynwood av Smith Edw B (Mattie) flagmn h224 Knott Smith Edw G (Ella) huckster h82 (132) Forest av (V) 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 831 Smith Edw L lab r315 Madison Smith Edw P (Mattie) mgr Macon Co-operative Stores hl51 Charles (SM) Smith Edwin W hl88 English av Smith Elijah (Mary) pdlr h22 Woodliff Smith Eliza (wid E Cicero) r213 Reid Smith Eliza (wid Edw) h Robinson rd nr Rockledge av Smith Eliza Mrs r518 Clinton (EM) Smith Eliza cook h865 Ocmulgee Smith Eliza cook h264 Tatnall la Smith Eliza lndrs r3 Polk la (HH) Smith Eliz cook r Eliza Smith Smith Eliz phone opr r620 Pine Smith Eliz student r20 Arlington pi Smith Eliz student r256 Broad (EM) Smith Ella (wid Geo W) rl22 1st Smith Ella Mrs opr The Wm Carter Co r202 High- tower MACON OPTICAL F'rank H. Johnson Opticians X 468 CHERRY COMPANY ^ _ .. Optometrists PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Smith Ella cook hl03 Braswell la Smith Ella cook r320 Cheatham al Smith Ella E (wid Robt) h519 Pine Smith Ellis (Henrietta) slsmn hl26 Washington av Smith Ellis student r625 Linden av Smith Emanuel (Annie) eng h365 Church (EM) Smith Emanuel F asst chf elk r365 Church (EM) Smith Emma lndrs r459 Army Lot Smith Emma G (wid Fred J) soft drinks 316 Jackson h do Smith Emma H (wid Jas D) hl86 English av Smith Emma 0 prin Ft Hawkins Sch r400 Hill Crest av Smith Emmalou sten Ellis Glawson rl47 Charles (SM) Smith Emmet lab rll2 Short la Smith Emory C student rll2 Madden av Smith Emory W printer The J W Burke Co r706 1st Smith Enoch farmer h368 Flanders (EM) Drink in Bottles The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE to ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 o u u 06 a S32 (1925) R. L. POLK & CO.'S Smith Enoch (Lillie) lab h322 Hammond Smith Eric D call hoy r209 Smith Smith Erma cook r Danl Smith Smith Ernest porter r88 Murray al SMITH ERNEST E (Annie), Mgr Ideal Battery Co, r566 Walnut, Phone 254-W Smith Ernest W (Gertrude) bkpr h ss Forsyth rd 4 w Tyrone blvd Smith Estella cook h216 Fretwell al Smith Estella dom r240 Gilmer Smith Estella L (wid Theo) h340 Columbus Smith Estelle indrs r419 Bright al Smith Ethel maid r216 Fretwell al Smith Eug W (Martha M) elk R L Lassiter hll7 Sum- mit av (NH) Smith Eunice rll Ellis av Smith Eva r641 4th av (U) Smith Eva M elk Colored Knights of Pythias rl49 2d av Smith Evans dom r603 Norris Smith E B Lumber Co E B Smith pres H H Heath sec-treas ft of Division Smith Fannie (wid Jack) r319 Nussbaum Smith Fannie (wid John W) r901 Cherry Smith Fannie r759 Poplar Smith Fannie cook hlO Magnolia la Smith Fannie Indrs h484 Chestnut Smith Fannie L maid Hinkle & Rushin Smith Fannie M Indrs h453 Coles al Smith Felecia C tchr r207 (224) Mutual av Smith Felix (Susie) lab hl035 Clinton rd Smith Ferrill farmer r702 Forsyth Smith Fletcher C agt Pilgrin Health & Life' Ins Co h207 (224) Mutual av Smith Floride bkpr A S Hatcher Co r314 Columbus Smith Florine sten Strozier & Deaver res R F D 2 Smith Francis L hlpr r202 Hightower Smith Frank butcher r511 Hawthorne Smith Frank (Samantha) butcher h302 Hawkins av Smith Frank dishwasher Henry Gibbons Smith Frank (Fannie) hlpr Wm Thomas h27 Tinsley la Smith Frank (Emma) lab h407 Peachtree Smith Frank (Lola) pdlr h641 4th av (U) Smith Frank H (Nannie) yd cond r!44 Charles CQ o' Amuatnoymkoibnidles oofwmneerrcshaanrdeises. eleScetndptroosHpeeacdtsqufaor-r tCearstalfoogr aclolnktainindss omfuAchutovmaloubaibleleLdisattsa.. OAusrknfeowr o cpy- a. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Buying of Office Supplies and Stationery & Means a Lot of Future Satisfaction for You THE J. W. BURKE CO.'S STORE, 406 Cherry St. MACON CITY DIRECTORY (1925) 833 Smith Freeman (Nancy) carp h630 Peeble Smith Freeman (Bertha) lab hl02 Hawkins av Smith Fred lab r897 (979) Maynard Smith Garfield L tchr Beda Etta College rll5 Chest- nut Smith Gene lab r314 Elm Smith Geo lab r2 3d st la Smith Geo mgr Capitol Theatre r Hotel Lanier Smith Geo (Victoria) plstr r222 Roosevelt (V) SMITH GEORGE B (Gertrude; Macon Electric Co), hl21 Crescent av, Phone 4727-J Smith Geo C driver Yellow Cab Co rl22 1st Smith Geo D (Annie) firemn h340 Central av Smith Geo E (Anna M) policemn h215 Washington av Smih Geo H (Lizzie) trainmn Macon Ry & Light Co h64 Damour la Smith Geo W (Lula) collr h811 Walnut Smith Georgia lndrs h314 4th av (V) Smith Geraldine sten r235 Jefferson Smith Gertrude' rl02 Rogers av Smith Gertrude R mgr Richmond Hotel r653 New Smith Gladys dom r Mary Smith Smith Gladys lndrs h310 Ash Smith Grace H cashr J P Allen & Co r Forsyth rd Smith Grady (Maude) flagmn hl06 Appleton av Smith Gustave E (Ellia) millwright h2908 Houston av Smith Hally opr r256 Hydrola Smith Hannah r201 (333) Mason (SM) Smith Harry D (Mary) slsmn Macon Gro Co h305 North av (NH) Smith Harry H (Melba) formn hl44 Charles Smith Harry M (Nora) ptrnmkr hl98 Newberg Smith Hattie cook r720 (705%) Elbert Smith Hattie cook r7 Paul Smith Hattie lndrs h603 Norris Smith Hazel cook r203 Bartlett Smith Hazie B dom r357 Gilmer Smith Hennie cook r468 Railroad av Smith Henry (Lena) lab r25 Tinsley la Smith Henry (May) pntr h216 Flanders Smith Henry (Mattie) truck driver h256 Broad Smith Henry G (Bertha) lab h!23 Plant AA,,NYv TfRAo DEr--liANsYtBUsSINo ESSf --nAaNm Y PReOFsESSION Detroit R. L. POLK & CO. Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 mm 834 (1925) R. L. POLK & CO.'S as a Smith Henry P (Vera) formn Macon News h467 Carl- ing av MffiKET Smith Herman inspr rl09 Montpelier av Smith Hilda elk Union Dry Gds Co r763 2d Smith Hilder Indrs rl035 Clinton rd PLACE Smith Hilliard T (Lillian) coppersmith r604 Forsyth Smith Holmes student rl24% Cole THE DIRECTORY Smith Homer E (Lorine) elk h703 Columbus rd Smith Homer J (Angeline) hl24y2 Cole Smith Horace r753 Broadway Smith Horace (Ann) lab hl54 Sycamore IS THE Smith Howard soft drinks 1133 Broadway h 3d Smith Howard B (Minnie Lee) mach r520 Edgewood GREATEST av Smith Howard B (Kathleen) R F D carrier hl70 Riley MARKET av (CP) Smith Howard H steel wkr r715 Napier av PLACE Smith Howard M & Co A J Lyndon mgr loans 8 Macon Savings Bank bldg IN THE Smith H Grady (Kath) sec O'Pry Plumbing & Heat- WORLD * ing Co h914 Napier av Smith Ida M maid r457 E Academy (EM) Smith Ideal cook h246 Orange Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * Smith Inez A (wid R F) r303 White Smith Ira El (Annie) lab h600 Williams Smith Irene h248 Powell (EM) Smith Iris porter rll5 Elliott (EM) Smith Irwin lab r2 Plant al Smith Isaac (Dora) lab r66 Harris al Smith Ivey H (Bettie) carp r755 Clinton Smith Jas (Annie L) brkmn h431A Ward (V) Smith Jas (Carrie B) gro 557 Maynard h555 do Smith Jas (Lillie) lab rl25 Ash The Directory is the Natural Source of Information and is "On the Job* 365 Days Every Year Smith Jas (Lizzie) lab hl029 Broadway Smith Jas (Lula) lab hl66 Cedar (U) Smith Jas (Nancy) lab h5 Dempsey av Smith Jas (Hattie) lab hl24 O'Hara la Smith Jas (Sallie) lab h78 Smith (SM) Smith Jas A (Maggie) hl03 Clayton Smith Jas A student rl03 Clayton Smith Jas A (Nanette) farmer h ns Vista cir (I) Smith Jas A jr r J A Smith MJWifo Smith Jas B (Mary L) formn hl24 Plant Smith Jas C (Isabelle) carp r!09 Montpelier av PUBLKHEBS PoIkDirectaw/IS DETROIT A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 % CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 835 Smith Jas C (Dessie) trainmn Macon Ry & Light Co rl05 2d Smith Jas C trainmn Macon Ry & Light Co res Gris- wold Ga Smith Jas H (Ollie) car repr h2911 Houston av SMITH JAMES L (Mattie), Asst Mgr W S Dickey Clay Mfg Co, li603 8th, Cherokee Heights Smith Jas M (Mary B A) slsmn hl065 Hazel Smith Jas Q (Lelia) mach h863 Orange Smith Jas S (Ella) contr hl204 (1242) Edgewood av Smith Jas T (Inez) trainmn Macon Ry & Light Co r 820 Poplar Smith Jas X (Hazel) porter rl62 4th av (V) Smith Jane lndrs h230 Orange Smith Janie lndrs hl004 Main Smith Jay carp r716 3d Smith Jeff (Willie M) lab h6 3d st la Smith Jennie (wid Chas H) h355 Walnut Royal Corona Typewriters SC0TT-PARKERC0. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Smith Jennie r527 Calhoun Smith Jennie maid h330 Dempsey av Smith Jennie V (wid Robt H) h262 Georgia av Smith Jerry T (Lillie) batterymn Willingham Battery Co hl02 Davis (SM) Smith Jesse (Beatrice) lab hl96 Virgin Smith John hllO Duncan av Smith John (Mary) carp h320 Elizabeth Smith John driver C J Molton Lmbr Co Smith John (Mary) hlpr h236 Johnson's al Smith John (Mattie) janitor Ga-Ala Business College h360 Ash Smith John (Alma) lab h448 Douglas Smith John (Hattie) lab r213 Frank al Smith John lab r357 Gilmer Smith John (Leila) lab h60 6Mitchell Smith John lab rill Rose Crest av Smith John (Lelia) lab h606 Mitchell Smith John E mech M C Sheffield rll4 Cole dress IN STYLE DAY'S I 406 THIRD ST. TEL. 3026 G -C ^ jjdu; jjwa < d aoea> g 40 b ft Ly o * 2 .a H < U jl E > Q !< 2 fz < SB O 2 IS S3IU s s D 5 3Qu *18 24) *Hoz-- o z H u % ^UC5/3 U^ 5CO ^UH1co Hu o KSE2 S% o ed B U 43 CL, (A LUMBER, SHINGLES, LATH Willingham Sash 8t Door Co. Office, 457 Third St. Telephones 278 & 3976 844 (1925) R. L. POLK & CO.'S Smith Willie L opr r246 Hydrola Smith Willie M lndrs r320 3d av (V) Smith Willie M mill wkr Dixie Roll & Cot Co Smith Wilson (Sadie) hl48 Adams Smith W Carter student r J A Smith Smith W Stanford (Willie) sec-treas Gantt Mfg Co h 101 Latta pi SMITH & SMITH (John R L and Joseph Le Conte Smith), Attorn eys-at-Law 520-523 Bihb Bldg, Phone 375 Smith & Watson (C M Smith, M J Sires) 517 Poplar Smith's Pharmacy J Northrop Smith prop 694 College Smithey Annie Mrs h754 Edgewood av Smithey Leo P elk T M Donnelly Co r754 Edgewood av Smithey Sami lab r 754 Edgewood Smithey Willie T mill wkr r754 Edgewood av Smithsonia County Alms House W T Watson supt Smithsonia 6 miles e of city nr Swift St Station Smithsonia County Farms 6 miles e of city nr Swift St Station Smolloy Jas M (Ola) state inspr hl85 Boulevard Smothers Eldw lab r325 Madison Smothers Thos (Jessie) porter Burden Smith & Co li 227 Neal av Smuggens Jos firemn r221 Elliott (EM) Smyly Jas T (Sarah) electn h310 Cutter's Green Smyly Jas T jr electn r310 Cutter's Green Snares Add cook rl215 3d Snead Mary J hl42 Plummer's al Snead Sami J (Eunice) wagon mfr 312 Cherry r622 (614) Montpelier av Sneeds Mray (wid Jas) h88 O'Hara la Snell Elorious dom rlOl Thomas Snell Geo lab h7 Frank al Snell Hillie (Annie B) porter h625 3d av (V) Snell Jas lab rlOl Thomas Snell Judge (Mary) opr hlOl Thomas Snell Mary lndrs rlOl Thomas Snellgrove Geo E reporter Macon News r Y M C A Snelling J Palmer C S practitioner 308 Grand bldg r Mrs Cora L Fowler Snipes Amanda E (wid Z T) r752 Oglethorpe Snipes Chas E (Ada) pntr hl503 2d Snines Gladys opr Sou Bell Tel Co r!503 2d More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open AH Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY (1925) 845 Snipes Helen E sten r202 Church (EM) Snipes Herbert M mach r202 Church (EM) Snipes Oleda M elk r202 Church (EM) Snipes Roland (Bertha) chauf H Marshall Furn Co h 323 Nussbaum av Snipes Rosa rl5 Wings Hill Snipes R Westbrook (Eloise) slsmn Florida Real Est Co hl88 Laurel av Snipes Thelma sten rl503 2d Snipes Wm rl503 2d Snipes Wm R (Leanora) elk h202 Church (EM) Snips John mgr Douglass Sanitary Barber Shop r5 Butlers la Snips Wayne barber Douglass Sanitary Barber Shop r318 Walnut Snook John (Hazel) wtchmn hl306 Broadway Snow Alzada (wid Jas D) Grand av (Bellevue) Snow Burris B r752 Oglethorpe SNOW B CUBBEDGE, Sec Yellow Cab Co of Macon, Associate Strozier & Denver, r538 Washington av Snow Geo N (Sallie) mill hd hl535 1st Snow Geo N jr appr rl535 1st Snow Georgia C (wid Wm A) h.538 Washington av Snow Harmon student rl535 1st Snow Ida millwkr r Alzader Snow Snow Jas H (Hattie) weaver h Industrial Home' rd Snow John 0 (Leila L) formn h752-54 Oglethorpe Snow John W (Florence M) elk Otto Isaacs Harness Co hll9 Cleveland av Snow Lee millhd h31 Taylor av Snow Oliver E mach r752 Oglethorpe Snow Thelma r752 Oglethorpe Snow Wm A student r538 Washington av Snowden Andrew (Lucile) lab h307 Gilmer Snowden Chas T (Lucia M) lumber inspr h333 Hines ter Snowden Edw appr r554 1st Snyder see also Schneider Snyder Lee W (Mary) cond hl44 Ells (SM) SNYDER LOUIS (Julia; Snyder's Ready-to-Wear and Fashion Shoe Store), h515 Napier, Tel 2639-W Snyder Sadie J (wid Danl H) h322 Jenkins SNYDER'S READY-TO-WEAR, Louis Snyder Prop, Ladies' Ready-jto-Wear and Millinery 609 Cherrv. Tel 2511 (See page 72) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION nKTROTT R. U. POLK & CO. Chicago Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. 846 (1925) R. L. POLK & CO.'S Snyers Cora L Mrs dom h507% Broadway Sockwell Chas H (Annie) slsmn Taylor Iron Wks & Supply Co h517 Hillyer av Solomon Angeline' lndrs h530 Flanders (EM) Solomon Annie M lndrs rl22 Edison (EM) Solomon Bessie B Mrs slsldy Union Dry Gds Co r218 Forsyth Solomon Caeser lab r310 Norris Solomon Chas (Vella Mae) lab hl63 Bay Solomon Chas (Sarah) hl49 Sycamore Solomon Chas shoemkr h400 Hall Solomon Clara r231 Ellis av Solomon Edw lab rl49 Sycamore Solomon Emily r Linton Solomon Solomon Eug lab rl49 Sycamore Solomon Fred W mgr Carolina Life' Ins Co h669 Mul- berry Solomon Gussie (wid John Z) h867 Cherry Solomon Hattie lndrs r705 (75) Maynard Solomon Jack (Eva) lab hl26 4th av (V) Solomon Jefferson lab r506 Maynard Solomon John H (Georgia) lab h705 (75) Maynard Solomon Jos P (Laura) lab h414 E 1st (EM) Solomon Lee (Lugene) lab h206 Forest av Solomon Lewis lab r648 (1270) Elbert Solomon Linton M (Hazel) dairymn & engr Macon Wtr Wks res Bellevue rd Solomon Louise M Mrs mus tchr 318% 2d h311 For- syth Solomon Lucile maid r5 Davis al Solomon Maitland r300 College Solomon Mary r311 Forsyth Solomon Max dry gds 505% Broadway r554% Poplar SOLOMON MOTOR CO, W G Solomon Jr Pres, Chevrolet Dealers 213-15-19 2d, Tel 4047 Solomon Nathaniel (Beulah) janitor W U Tel Co hll5 Powell Solomon Robt lab h5 Bear's al Solomon Robt (Mammie) truck driver hll06 (3) El- bert Solomon Robt E (Eliz) dentist 411% 3d res Columbus rd Solomon Sanford (Mattie) cook Macon Cafeteria h 610 Fort Hill (EM) Solomon Steve (Amanda) lab r310 Norris E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS If it's a Ford or CARS-TRUCKS-TRACTORS lfioarve ait.Ford, we PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 847 SOLOMON STEYE M JR (Mary E), Distributor Dodge Brothers Motor Cars, 462 Broadway, Tels 4956-4957, hl24 Oakhayen ay, Tel 4595 (See left bottom lines and page 53) Solomon Theo lab r310 Norris Solomon Wm (Irene) lab h608 Norris Solomon Wm (Lillie) lab h402 Peachtree Solomon Wm C (Lois) collr A G Rhodes & Son r307 Duncan av Solomon Wm G (Lillian R) h218 Forsyth Solomon Wm G jr (Bessie B) pres Solomon Motor Co r218 Forsyth Solomon Wm L (Susie M) elk PO h620 Oak Solomon Wm W (Louise M) h311 Forsyth Solomon Willis (Estella) chauf h312 Madison Solomon Zollicoffer C Rev (Elxa) h721 3d av Sorrell Benj linemn r300 Rutherford Sorrell Geo linemn r300 Rutherford Sorrell Jack r300 Rutherford Sorrell Jas C truck driver r300 Rutherfod Sorrell Katharine r300 Rutherford Sorrell Lucile smstrs r300 Rutherford Sorrell Mittie (wid Jas) h300 Rutherford Sorrow John eng r211 Broadway Souder Redding C (Maude) office mgr hl21 Clisby Soule A Chas jr (L L Daugherty jr & Co) r218 Geor- gia av Sours Henry M (Kath B) dir Mo State Life Ins Co r 219 High South Georgia Conference Orphans Home Harrison Daugherty supt 121 Pierce av South Side Garage Dave Griffin prop 408 (11) Crisp Southard Nelson E (Helen; Proctor & Southard) h 606 Forsyth Southeastern Compress & Whse Co R G Duffey supt cor Poplar and 8th SOUTHEASTERN EXPRESS CO, G A Willis Agt Terminal Hotel Bldg 359 5th, Phone 396, Depot, Phone 1326 Southeastern Underwriters Assn Crowder Hale spl agt 302-3 Bibb bldg Souther Carroll ship elk Burden Smith Co rl41 Park pi Souther Eva A nurse hl41 Park pi Souther A Clarice sten R V Elledge rl41 Park pi The most comprehensive reference work on tne banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r & CO. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. S48 (1925) R. L. POLK & CO.'S Souther Frank W (Isa) collr T J Harris & Co h305 Bailey av Souther Geo L (Fannie) cond h342 Duncan av Souther Hazel r305 Bailey av Souther Henry L (Willie M) collr Central City Se- curity Co rl95 Belmont av Souther Mack G prsmn Macon News r39 Pio Nono ay Souther Morgan B (Louise) collr Franklin Guaranty li Co hl22 Academy Souther Nancy (wid J M) r219 Duncan av Souther Thos collr r219 Duncan av Souther Willie A sten Burden Smith & Co rl41 Park Pi SOUTHERN BELL TELEPHONE & TELEGRAPH COMPANY, W H Weaver Dlst Mgr, W L Albea Dist Cashier, 501-505 2d Southern Box & Basket Co C C Humphries pres J N Barnes v-pres R L Crandall sec fruit containers ft of Poplar SOUTHERN BUILDING SUPPLY CO, T E Artope Mgr, Lime, Sand, Cement, Brick, Tiling, Clay Pipe, Etc, Ground fl Room 3 Grand Bldg 617 Mulberry, Phone 748 SOUTHERN BUSINESS COLLEGE, E L Ray Pres, H L Morris Bookkeeping Dept, Mrs E C Riley and Mrs A P Ricketson Shorthand Dept, Day and Night Classes, Onr Motto Thoroughness, 656% Cherry, Phone 3041 (See right top lines and page 60) Southern Cotton Oil Co The H W Quin mgr Waterville rd 4 s of EdgeWood Southern Doll Hospital (W F Muecke) 703-5 Broadway Southern Dry Goods Co (Jos Haskin, David Racksin) 470 Poplar Southern Duco Enameling Co (Barney and L L Lifshey) 654 3d Southern Investment Co (J T Kennington) salaries bought 7 Jaques bldg Southern Land Co L S Dure pres 610 Mulberry Southern Loan & Real Estate Corp T I Harris pres 515 2d 512% 3d 613% Poplar and 517% 3d SOUTHERN MUTUAL INSURANCE CO, W D Griffith Agent, 208-209 Macon Natl Bank Bldg, Phone 456 mAuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r tcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,iblelIe>LEd'ilsa{tltstaO..ITOA, usMrkInCfeHowr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 849 Southern Negro Singers Chorus Rev M P Scott pres & mgr 320 Madison Southern Paint & Varnish Co P N Coley mgr 510 3d Southern Railway System H A DeButts div supt 102- 26 C B Rhodes div pass agt 127-131 Terminal Station 0 G Prentiss frt agt Plum cor 5th H G Stubbs mstr mech Waterville rd Southern Ry System Police Dept R P Kendall capt sw cor Plum and 5th Southern Ruby rl54 (113) Roye SOUTHERN SERENA DERS, Lee Davis Mgr, 0 Ham- ilton Middlebrooks Leader, Crump's Park (GA) Phone 4068 Southern Sport Supply Co (Henry Kaplan) 509 Cherry Southern States Life Ins Co LL Carrington agt 203 Citizens & Sou Bank bldg Southern Underwriters Co M G Robertson pres-genl mgr 28-29 4th Natl Bank bldg Southland Cafe (Vranes Brown, Geo Pappadis) 567 Broadway Southland Garage M J Palmer G S Baskerville 517-19 Broadway SOUTHLAND HOTEL, A E Weems Prop, H E Weems Mgr, 569-71 Broadway at Plum, Phone 3047 Southland Knitting Mills L S Dure pres W L Hanson v-pres M M Thurman sec-treas J W Hanson mgr 216 Holt av (V) Southside Grocery (A Rophie) 210 Gantt City rd Southwell Earl M U S N rl72 Magnolia Southwell Marvin L (Alma) car acct hl72 Magnolia Southwestern Railroad Co J F Minis (Savannah) pres W R Cox v-pres G I Hardeman sec-treas 808-9 Ga Casualty bldg Sovey Cecil R pres Florida Real Estate Co 311 Cherry Sowell Almond D (Lillie M) gro 95 Clayton h93 do Sowell Leon V (Katie M) elk PO rl20 Winship Sowell Oscar R (Eva) gro 701 Broad and 478 Clinton h Cross Keys Spain Frank chauf Jacob Hirsch r6 Virgins la Spain Mattie h777 Edgewood av Spangler Geo C (Gertrude) com slsmn hl30 Coleman av Spangler Geo R student rl30 Coleman av Spann Frank (Jonnie) driver r337 Bookers al Spann Mattie lndrs h396 Telfair * FOR lists of names ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. I,,. POLK & CO. CHICAGO HERBERT SMART WALTEWRALPT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 S50 (1925) R. L. POLK & CO.'S as a Spann Thos (Gertrude) hd firemn h328 Waterville rd Sparks Augustus 0 B (Mattie L; Brock Sparks & Rus- MET sell) Sunset rd 4 mi n Nottingham dr Sparks Charity (wid John) hl51 E Academy Sparks Chas elk Morris & Co r314 New PLACE Sparks Chas (Ada) pres Sparks Circus r Dempsey Hotel Sparks Circus Chas Sparks pres Clifton R Sparks THE treas winter qtrs Central City pk DIRECTORY Sparks Clifton R (Vera) treas Sparks Circus r Dempsey Hotel IS THE Sparks Corinne lndrs h509 E 1st Sparks Hattie h544 Washington av GREATEST Sparks Hazel A r450 Washington av Sparks Jas (Hattie) porter h504 Campbell av MARKET Sparks Jos R elk A Schulte r215 1st Sparks Julia cook h201 Lynwood av PLACE Sparks Julia tchr rl77 (195) Lincoln av (V) Sparks Leroy r336 Jackson IN THE SPARKS MOTOR CO (W B Sparks Jr), Essex Cars, Hudson Cars, Mack Trucks 550 Broadway, Phone WORLD * 4787 (See backbone and page 51) Sparks M Garten auto slsmn r468 College SPARKS ROBERT L (Jonnie H), Pres Kinnett Ice Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had & * & Coal Co, V-Pres Kinnett-Odom Co, h450 Washington av, Phone 60 Sparks Thos (Annie) lab h554 Johnson's al Sparks Virginia nurse rl77 (195) Lincoln av (V) Sparks Wm (Fannie) lab h425 Madison Sparks Wm S (Mamie) porter S M Wright hl77 (195) Lincoln av (V) Sparks Willis B (Mary L B) real est 422 Cherry h468 College SPARKS WILLIS B JR (Lucile M; Sparks Motor Co), The Directory is the Natural Source of Information and is "On the Job" h558 College, Phone 5109-J Spaulding Bessie lndrs rl98 (173%) Lincoln av (V) Spaulding Dora lndrs rl98 (173%) Lincoln av (V) Spaulding Ridley lndrs rl98 (173%) Lincoln av (V) Spear Earl (Mary) carp rl02 St John 365 Days Spear Michl M (Edel) millwkr h29 (9) Bellevue rd Every Year Spearman Clarence (Fannie) lab rl007 Ocmulgee Spearman John W jr (Lizzie) elk h253 2d av (V) Spearman Robt E (Fannie L) chemist Coleman Mea- RLPolkaGo dows Pate Drug Co hl67 Magnolia PUBLBHEBS Spector Nathan phys Macon Hosp r Y M C A PoIkBirectaruHD ^DEIK)IT t MICH- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 851 Speer Annie B r401 Duncan av Speer Blanch student r222 Chestnut Speer Chas 0 sta engr h Forsyth rd (V) Speer Eunice Mrs slsldy J P Allen & Co r615 Forsyth Speer Geo (Carrie) draymn h Industrial Home rd Speer Grace student r222 Chestnut Speer Inez r Charles O Speed Speer Jas R student r222 Chestnut Speer Jos R (Blanche) tchr h222 Chestnut Speer Lizzie h615 Forsyth Speer Lula M opr The Wm Carter Co r Mrs Cora L Fowler Speer Marion student r222 Chestnut Speer Otis V (Marvel) asst city treas rl427 2d Speer Sallie (wid Geo) h Log Cabin blvd Speer Wm J slsmn Jos N Neel Co r615 Forsyth Speer Wm R (Annie) h2125 Broadway Speights Mattie h301 Ells (SM) Speir Edwin (Louise B) firemn rl35 Rembert av Speir Jas H (Rosalie) slsmn rill (5) Log Cabin dr Speir Josie L (wid Herbert) mine wkr r26 Manchester qtrs Speir Otis I (Beatrice) mattress mkr Central Bedding Co rl674 2d Spell Arth T barber R G Stripling r664 Walnut Spells Bernice W r309 Georgia av Spence Ernest R (Dessie) mech h709 Adams Spencer Addie L hl46 Whitehall Spencer Augustus G (Lula) billiards 652 Poplar h384 Monroe Spencer Edw (Mary waiter A G Spencer h7 Orchard av Spencer Essie M hl46 Whitehall Spencer Ida L cook r210 McLean al Spencer Jennie cook h212 Coles al SPENCER JOHN D (Maidee), Columnist Macon Tele- graph, h Jackson Spring Drive (SH) Phone 2562W Spencer Mabel cook r230 Madison Spencer Mary student hl46 Whitehall Spies Augustus (Nellie) florist Idle Hour Nurseries res Rivoli Spikes Agnes lab rl6 Ford al Spikes Benj L wtchmn h216 Applewood Spikes Chas mach r506 Edgewood av Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. 1. Polk & GO. Publishers 536 S. Clark St. Chicago, 852 (1925) R. L. POLK & CO.'S Spikes Geo (Lucy) lab r307 Edgewood av Spikes Geo lab r75 Reid Spikes John (Vinia) night-wtchmn h411 Main (EM) Spikes Lillie rll22y2 Broadway Spikes Mary (wid Steph) h75 Reid Spikes Tbos lab r411 Main (EM) Spikes W Frank (Eliz) mach h506 Edgewood av Spikes W Isaac (Ellen) pipectr h506 Edgewood av Spillars Pauline Mrs r326 Sixth av (SM) Spillars Wm H (Eliza) hl50 Dixie av Spiller Jas A (W A & J A Spiller) rl53 Boulevard (NH) Spiller Wm A (Belle; W A & J A Spiller) hl53 Boule- vard (NH) Spiller W A & J A (Wm A and Jas A) restr 300-02 3d Spillers Claude (Lula) mech h532 Forsyth Spillers Eliza (wid Augustus) r319 Maple Spillers Eustace (Clara) mach hd hl20 3d Spillers Herbert elk Independent Lndry Co r319 Maple Spillers Jas B Rev (Mary) pastor Beach Ave Premetist Baptist Ch h Log Cabin Hts Spillers Lloyd M (Clyde) barber Sanitary Barber Shop No 2 h319 Maple Spillers Lorenzo H (Annie) slsmn Ga-Carolina Oil Co h302 Belmont av Spillers Louise bkpr r302 Belmont av Spillers Ruth r302 Belmont av Spillers Wilburn H (Ethel R) lawyer 618 Bibb bldg r 348 Pierce av Spinks Chas T (Lizzie) oiler h554 Roff Home av Spinks Lonnie R (Annie) eng Crescent Lndry Co h 810 Elm Spinks Louis T trav slsmn rl61 Magnolia Spitzer Robt C mgr Real Silk Hosiery Mills 214 Citi- zens & Son Bank bldg Spivey Allie cook r rear 1707 2d Spivey Claude (Mary) lab h215 Middle Spivey Felix M auto mech rl9 Nevaro Flats Spivey Harry (Fannie) tailor 519 Mulberry h207 3d av Spivey Irene Indrs rll9 Edgewood av Spivey Jas (Clara) lab h3 Coleman al Spivey Jas soft drinks hl5 Bibb av Spivey Loretta elev opr hl67 Telfair Spivey Louis student rl510 Broadway FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds .of Automobile Lists. Our new Catalog contains mueh valuable data. Ask for a copy It. L. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) Spivey Mary cook r460 Alabama Spivey Milton (Jonnie) gro 204 Middle h509 Monroe Spivey Monroe Rev (Ella) hl510 Broadway Spivey Nonie rl510 Broadway Spivey Oliver (Mattie) lab h313 Hazel Spivey Oscar S (Eugenia) phys 515 Bibb bldg 322 Bond Spivey Pearl student rl510 Broadway Spivey Saul (Polly) lab rlOO Whitlock Spivey Wm (Virginia) brklyr h260 1st av (V) Spradling Cecil (Eva) lab hl06 Pringle Spratling Jas H student rl21 Hines ter (V) SPRAT LINO J HOOK (Pauline W), Optometrist and Optician 652 Cherry, Phone 986, hl21 Hines Terrace, Phone 3493 Spratling Martha student rl21 Hines ter (V) Spratling Pauline student rl21 Hines ter (V) Spring St Apartments 163-165 Spring Springer Frank F (Francis) mach hl34 Tenny Spruce John W (Eunice E) mech h2 Gustin pi YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Spruce Robt (Susie) firemn h414 Bay Spruce Thurman soda dispr Central Pharm r2 Gus- tin pi Spruce Westley C r2 Gustin pi oprunt Alex & Son Inc L F Ham mgr cotton brokers se cor Pine and 3d Spry Emma cook r600 (1270) Elbert Spry Eug (Cora) lab h600 (1270) Elbert Spry John H lab r600 (1270) Elbert Spry Sami lab r600 (1270) Elbert Spry Wm truck driver r600 (1270) Elbert Spurley Ceola lab h242 Harris al Sprling Sherman D (Georgia C) emp Tomlinson Paper Box Co r345 Hydrola SPURLOCK BENJAMIN H (Daisy), Dentist (X-Ray Equipment), 509 Bibb Bldg, Phone 751, res Rivoli uft A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free"Listof Mailing Lists." R. L. POLK & CO., Detroit CO in C/3 MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 854 (1925) R. L. POLK & CO.'S H Spurlock Geo W (Evie) slsmn Ga Banana Co h Cross 2 Keys < Squakes Phyllis lndrs hl30 4th av (V) Staamer Agnes (wid D G) hl060 Walnut Q Stadium The Morgan and Oakland avs Staedtler Emil G (Frances) formn W S Dickey Clay Mfg Co hl44 Holt Stafford Ben (Addie) lab r307 Monroe Stafford Chas (Olivia) lab h374 Plummer's al Stafford Early elk r374 Plummer's al Stafford Edna F rl520 2d Stafford Edwin W rl520 2d Stafford Estelle cook r313 (327) 1st av (V) Stafford Esther cook r245 2d av (V) Stafford Gertrude lndrs r374 Plummer's al Stafford Jennie maid h245 2d av (V) Stafford Jennie V student r245 2d av (V) Stafford Josephine cook r579 Monroe Stafford Milton (Eula) printer r716 2d Stafford Ruby r245 2d av (V) Stafford Wiley B engr hl520 2d Stahle D Motter mech h620 Forsyth Stahle Ray H (Minnie) mech Clifford Walker h426 Liberty Stakeley Jas drftsmn Dennis & Dennis h337 Adams Staley Edw (Carrie) shoemaker h rear 413 Walnut Staley Jas H (Edna) ship elk Merritt & Co hl04 Ayers rd Staley Martha sten Bankers Health & Life Ins Co rl04 Ayers rd CO Staley Oliver D (Octavie) formn Massee Felton Lmbr Co rl30 Winship Uh O Stalker Annie asst matron Masonic Home r do Stalling H Porter (Sallie) paperhngr h908 Elm Stallings Jas B paperhngr r610 Elm Stallings Jerry T (Vera) millwkr hl03 Green (PM) Stallings Jesse A (Hattie) paperhngr h610 Elm Stallings John W lab r563 Monroe Stallings Louise smstrs r610 Elm Stallings Nellie bkpr r610 Elm Stallings Nellie cook r563 Monroe Stallworth Alice lndrs h607 Flanders (EM) Stallworth Amon J (Mary E) barber 316 Main (EM) r506 Church A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St, Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 855 Stallworth Annie smstrs r242 Mitchell Stallworth Asbury W (Ida) br mgr L W Rogers Gro Co hl21 Academy Stallworth Augustus H (Lilia) inspr Macon Ry & Light Co r417 Montpelier av Stallworth Benj (Lillie) chauf Idle Hour Nurseries h 406 2d Stallworth Julian carp h506 Church StallwoHh Mack (Lillie) lab h327 Ballard Stallworth Mary lndrs h.242 Mitchell Stallworth Nannie E elk Crescent Lndry Co r3 Gustin Pi (V) Stallworth Oscar C (Minnie) trainmn Macon Ry & Light Co h3 Gustin pi (V) Stallworth Paul (Nettie; Elite Cafe) h253 Oakland av Stallworth Robt rl21 Academy Stallworth Roscoe S (Jewell) elk Am Ry Exp Co h9 Marion pi (HH) Stallworth Roselle rl21 Academy Stallworth Thos lab r242 Mitchell Stallworth Wiley r506 Church Stamm Arth (Caroline; North Highland Grocery) h 126 North av (NH) Stamm Caroline Mrs slsldy Dannenberg Co hl26 North av Stamps Dolores L (wid Porter) hl38 Summit av (N H) Stamps Earl M (Sara E) inspr r3,. 415 New Stamps Walter chauf r8 Wise av (V) Stamps Wm (Bessie) cook h8 Wise av (V) Stamps Wm D porter r8 Wise av (V) Stancel Jas (Julia) carp h854 (852) 3d av (V) Stancile Doyle wrniter r Y M C A STANDARD BRICK & TILE CO, W E Dnnwody Pres, M H Massee Sr V-Pres, Face and Common Brick, Hollow Tile, Etc 460 Broadway, Phones 14471448 (See page 57) Standard Handle Co W A Roush pres H A Wright vpres W A Roush sec-treas 610 Division Standard Oil Co E C Rose mgr 119 Bay filling sta Broadway ne cor Mulberry 2638 Broadway 101 Montpelier av 601 2d 102 Vineville av and sw cor Forsyth rd and Hartley av Standford Lucinda lndrs r405 Norris Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 856 (1925) R. L. POLK & CO.'S Standifer Edw lab rl02 Thomas Standifer John (Dora) brklyr hl04 Pringle Standifer Lloyd (Clara) brklyr hl03 Pringle Standifer Wm (Stella) lab h721 Fort Hill Standifer Wm H (Malisa) lab hl02 Thomas Standley Henry (Eliz) lab h379 Plummer's al Standly Bennie lndrs r458 Hall Stanfield Paul elk City Recorders Court r301 Carling av (HH) Stanfill Fredk R (Barbara) millwkr hll7 Corner ter Stanfill Leroy millwkr r36 Brigham Stanford Augustus L (Essie) cond h391 Belmont av Stanford Chas (Ophelia) carp h324 Ballard Stanford Chas (Celia) tmstr h870 Cedar (U) Stanford Claude lab r rear 1218 3d Stanford Floyd (Rosa) lab r93 Harris al Stanford Hattie sten r404 (104) Lexington av Stanford Heard chauf r404 (104) Lexington ay Stanford Jas S (Maggie) janitor h404 (104) Lexington Stanford Jesse E (Bertie M) elk rl30 Charles (SM) Stanford Lewis (May) lab h322 Cedar (U) Stanford Ola M lndrs r rear 1218 3d Stanford Otis lab h7 White al Stanford Porter mech r27 Hill Park av Stanford Roe (Nellie) lah h rear 1218 3d Stanford Sol (Annie M) suit prsr Budrow Thompson h417 Clara Stanley Abbie C firemn rlOO Nelson Stanley Carrie E lndrs h347 4th av (V) Stanley David (Thelma) elec eng r John McClendon Stanley Edwin S r611-15 2d Stanley Ethel r716 3d Stanley Florine gro 319 Ash h321 do Stanley Hattie dish washer Elite Cafe Stanley Hayes (Daisy) lab r316 Hanson Stanley John firemn r375 Plummer's al Stanley Julia nurse rl22 Tindall av Stanley Lewis (Tabbie) lab hl61 Hazel Stanley Lizzie maid 1305 3d Stanley Lucile r716 3d Stanley Lucy lndrs h432 Davis al Stanley Maggie Mrs rl023 2d Stanley Marvin (Mommie) lab h910 Elbert Stanley Mattie Mrs furn rms 716 3d h do R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 857 Stanley Mittie cook r511 Hazel Stanley Nina rl22 Tindall av Stanley Nina cook rl8 Wise av (V) Stanley Sidney (Sallie) slsmn r820 1st Stanley Viva Mrs r J B Marshall Stanley Wm (Viola) lab hl22 Tindall av Stanley Wm K (Leonora) slsmn Adams-Buchanan Motor Co rl02 Holt av Stansford Jas (Mabel) lab hl52 Spring Stanton Clarence H (Florence) eng Swift & Co h720 Pine Stanton Geo G (Dellie) sis mgr H M Reid & Co h320 Hill Crest av Stapler Maury M (Irene) phys 518 Citizens & Sou Bank bldg h203 High Staples Ernest A eng r611-15 2d Staples H Grady (Sudie) trainmn Macon Ry & Light Co h426 Jackson Staples Jos lab r728 Reynolds al Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Stapleton Harvey P (Cora) trainmn Macon Ry & Light Co h417 Montpelier av Stapleton Jerry porter Stewart Oil Co rl50 Lynwood Stapleton John T (Stella) formn hl37 Colquitt Stapleton Thos cook L H Short Stapleton Viola smstrs h7 Hill Park Stapley Jennie (wid Wm) h337 Jeff Davis Star Billiard Parlor M H Howard mgr 323 Broadway STAR MOTOR CARS, Beeland-Conrad Motor Co Dis- tributors, 506 2d, Phone 2813 Stargele Jos W (Mary) asst supt P O h369 1st Stark Chas (Nora) lab h515 Ross Starke Dorothy sten rl02 Troup Starke John T (Dollie) train dispr hl02 Troup Starke Sally dom rl02 Troup Starke Sarah sten rl02 Troup Starke Hattie maid h210 Middle (V) Starling Fletcher (Mattie) lab hl68 Lynwood av - FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION ^DETROIT R. L. POLK & CO. CHICAGO Answers AH Questions as to WHOM You Are Looking For and WHERE They Can Be (Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 858 (1925) R. L. POLK & CO.'S Starling Julia maid h44 Bright al Starling Rosa maid r44 Bright al Starling Thos H (Irene) cond h346 6th av (SM) Starr Asia S (Lilia) baker Am Bakeries Co rl018 Oglethorpe Starr Betinna mgr Capitol Hotel h do Starr Herman (Frances; Weinstein & Starr) h3, 615 Walnut STARR JOHN H (Betinna; Macon Electric Co), r580 Plum, Phone 2751 STATE COLLEGE OF AGRICULTURE, See BIN County Farm Bureau Statemon Anna h.246 Church la Statham Eug soft drinks 608% Ross h do Statum Lewis (Ella) lab h779 Reynolds al Steadman Andrew J (Ida) carp h304 Center Steadman Chas T elk r304 Center Steadman Susie Mrs r808 3d Steadman Wm A student r304 Center "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH fsIiflrimgyh,otuarpnrgdouvmoelcsaasattiriocen. ,noTItfHaEthhYeeyaAltbRhlyEeedpUinNokn-, SDHeAEeIALyLYoTu.Hr YdFeo.nrTtishsatilseAiaNstDayUoduaSrnEgDePrrYugOsgiRginsAat'Lls. Stearman John (Annie) formn rll05 Oglethorpe Stearns H Ray (Georgia W) auto repr 514 1st h331 Carling av Stedham Sophronia (wid Martin) r B L Cox Steed Ella G (wid Clarence) h717 Oak Steed Emma millwkr r3800 Houston av Steed Frances E bkpr Postal Tel-Cable Co r717 Oak Steed Jos N (Eliz) cond h810 Oak Steed Jos N jr student r810 Oak Steed Louise E sten Ouzts Mitchell & Whalev r717 Oak Steed Philip S slsmn Dunlap Hdw Co hll5 Cleveland Steed Robt mgr Rogers Grocery r611 2d Steed Sarah M (wid Robt E) rll5 Cleveland av Steed Wm H (Cassie) blksmith h Clinton rd Steed Wm T (Lester) blksmith h3800 Houston av Steel Lee (Hattie) h638 4th av (U) Steel Mary lndrs h478 Chestnut R. L POLK FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND TMp the CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) Steele B A mech Dunlap Huckabee Auto Co r901 Cherry Steele Ernest L mech Solomon Motor Co 213 2d Steele Henry G (Gail) slsmn h203 Log Cabin dr Steenhise Willis elk rl26 High Steepe Rebecca nurse r410 Beech av Stefano Geo (Adelaide) mgr h318 Main Steger Frank B (Margt L) barber Palm Barber Shop hl405 Oglethorpe Steger Mary (wid Frank) rl405 Oglethorpe Steigers Mozell lndrs r628 Hammond Steinhilper Henry W elk Home Art Supply Co r H A Steinhilper Steinhilper Howard A (Mollie W) mgr Home Art Supply Co h ns Forsyth rd (V) 4 w Park av Stembridge Curtis hlpr Cliff Walker h Lizella Ga Stenson Amanda h27 Wright al Stenson Archie (Bessie) lab h rear 1022 Ocmulgee Stenson Jas (Mabelle) h953 Ocmulgee la -Lola MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAIWLKLIISNS Steppe Rebecca nurse Macon Hosp Stephan Prentiss D mach rll9 Yates av (EM) Stephan Wm G (Laura) pntr hll9 Yates av (EM) Stephan Wm L printer rll9 Yates av (EM) Stephen Boby nurse r rear 330 Dempsey av Stephen Clossie cook r rear 330 Dempsey av Stephen Irvin auto mech r rear 330 Dempsey av Stephen Nettie cook r rear 330 Dempsey av Stephen Sallie cook r rear 330 Dempsey av Stephens Albert (Viola) cook A G Spencer hl08 (857) Moore la Stephens Alex (Eliz) r978 Walnut Stephens Andrew J (Fannie) lawyer 226)4 Cotton av h do Stephens Annabelle Mrs r253 Broadway Stephens Arth lab r335 Madison Stephens Bessie M cook r700 (260) Charles Stephens Clarence r700 (260) Charles Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work O Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MAKCH and SEPTEMBER fcy R. L POLK S60 (1925) R. L. POLK & CO.'S Stephens Cleveland porter Sou Paint & Varnish Co rl6 Gustin av Stephens Edw D (Viola) blksmith hl60 (198) Lincoln av (V) Stephens Eliz (wid Jas) r307 Adams Stephens Eliz sten County Court of Ordinary r411 Blackburn Stephens Eliz W Mrs r255 New Stephens Emily student r453 Walnut Stephens Fox D (Nettie M) contr 304 Citizens & Sou Bank bldg hll2 Corbin av Stephens Frank lab r700 (260) Charles Stephens Frank (Hattie) lab hl06 Long la Stephens Georgia hl46 Magnolia Stephens Hattie lndrs hill (185) May av (U) Stephens Henry (Lena) Imbr stkr hi58 (175) Roye Stephens Henry S (Leila) elk Macon Co-operative Store r405 Cleveland Stephens Henry T Rev r237 Jones Stephens Horace (Pennie) lab h531 Flanders (EM) Stephens Horace jr lab r531 Flanders (EM) Stephens Hugh L (Annie M) eng h824 Orange Stephens H A hl24 Appleton av Stephens Irene maid r581 Flanders (EM) Stephens Isaac (Johnnie) mech h411 (104) Colquitt Stephens Jack lab h633 Division Stephens Jas (Ella M) lab h261 Walnut Stephens John (Bertha) r320 Ellis av Stephens John carp h307 Blount Stephens John Rev r411 (104) Colquitt Stephens John H Rev (Emma) h400 (304) Colquitt Stephens John W (Estelle) supvr bldg and bridges C of Ga h806 Oak Stephens Jos W (Margt) slsmn h411 Blackburn Stephens Lee M (Annie) carp h2520 Broadway Stephens Leon (Clemmie) lab rl2 Stripling al Stephens Lily cook r443 Forest av Stephens Lizzie cook h250 Johnson av Stephens Lottie hl025 Edgewood av Stephens Mae Mrs h462 Oak Stephens Maggie (wid Phil) r221 Georgia av Stephens Mamie' rl08 Delaware av Stephens Mark R (Nannie Lou) flagmn hll20 Ash Stephens Martha h909 Ash &C0. Polk Directory * Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open AH Day From 9 to 6--4x/2% on Savings MACON CITY DIRECTORY (1925) 861 Stephens Mary cook r552 Monroe Stephens Mary lndrs hi60 Plummer's al Stephens Mattie hll6 Adams Stephens Mavis cook rl06 Long la Stephens Mose (Lizzie M) lab h968 Ocmulgee Stephens Nancy tchr r307 Adams Stephens Nannie (wid Olie) rl30 Gordon (SM) Stephens Norwood (Margt) civ eng r503 Georgia av Stephens Odessa r700 (260) Charles (SM) Stephens Randolph r554 1st Stephens Robt lab rl06 Long la Stephens Robt A (Bessie) firemn h700 (260) Charles SM) v Stephens Robt A jr lab r700 (260) Charles Stephens Robt A (Emily; Palace Barber Shop) h453 Walnut Stephens Sallie (wid Walker) rll20 Ash Stephens Sami rl44 Adams Stephens Sami M (Irzonie) air brkmn h309 Cleveland SOUTH'S LEADING FLORISTS IDLE HOUR NURSERIES Stephens Walter (Sarah) janitor h738 Edgewood av Stephens Walter C atty and elk County Court of Or- dinary r411 Blackburn Stephens Walter F (Mercer) gro and meats 557 Telfair h do Stephens Wm (Alma) plstr r238 Roye Stephens Wm prsr r610 Fort Hill Stephens Wm D (Carrie) car washer r411 (104) Col- quitt Stephenson Mamie G tchr Wesleyan College r520 College Sterling Angelyn C tchr r301 Hightower Sterling Essie M dom r309 Edgewood av Sterling Jas E student r301 Hightower Sterling Randolph student r301 Hightower Stevens Adele student r860 Orange Stevens Cath lndrs h.207 Orange Stevens Chas (Minnie) lab hl03 Bay r-i* " CO p PI k FOR LISTS OF NAMES ANY TRADE , ANY BUSINESS rANY PROFESSION < DETROIT R. L. POLK & CO. CHICAGO 5 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 862 (1925) R. L. POLK & CO.'S Stevens Claud lab r28 Woodlift Stevens Cornelius lab rl09 Bay Stevens Dave lab rl09 Bay Stevens David V Rev h215 3d av Stevens Earl lab r318 Wall Stevens Edgar I (Clifford) carp rl045 College Stevens Edgar I jr electn rl045 College Stevens Edgar L student r508 Clinton (E M) Stevens Emanuel lab rll2 Edgewood av Stevens Emmie D (wid Walter C) r203 Higb Stevens Ethel A Mrs collr Macon Mutual Burial Assn r860 Orange Stevens Eula Indrs rlll3 Broad Stevens Evelyn cook h237 Clara (E M) Stevens Garfield (Mary E) stoker hl07 Spring Stevens Geo (Hattie) carp hll3 (103) Thomas Stevens Geo H (Imogene) switchmn h508 Clinton (E M) Stevens Horace (Sally) chauf h214 Northern Stevens Imogene student r508 Clinton (E M) Stevens lone G slsldy r759 1st Stevens Isabella Indrs rl6 Gustin av (V) Stevens Jas lab hl05 Smith (E M) Stevens Jessie P cook r756 Chappell al Stevens John B (Mamie) cond h201 Ridge av Stevens John T jr (Kitchener & Stevens) rl08 Capi- tal av Stevens John W carp rl20 Knott Stevens Josiah S (Georgia) carp h316 Shamrock Stevens J linemn r460 Mulberry Stevens Lee (Sarah) millwkr h.30 Manchester qtrs Stevens Leila pantry girl Hotel Lanier r227 Norris Stevens Lillian D (wid Louis 0) r367 College Stevens Lillian J sten Adams Buchanan Motor Co res White Oak Mineral Wells Stevens Lewis M (Missouri) car repr hl745 Broadway Stevens Lloyd lab r28 Woodliff Stevens Luther J (Eliz) dep sheriff hl045 College Stevens Madison J carp rl045 College Stevens Martha nurse rl50 Magnolia la Stevens Mary Indrs hlll3 Broad Stevens Mary Indrs rl05 Smith (E M) Stevens Mattie B sec r759 1st Stevens Miles G (Mabel) mach hllO Kemper av 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 863 Stevens Ora lndrs h208 Turpin Stevens Robt (Fleta) lab h450 Coles al Stevens Robt (Ollie) lab h808 Woolfolk Stevens Robt B (Addie S) brklyr b332 3d av Stevens Robt K (Eliz) eng h726 Walnut Stevens Robt L (Bertha B) auto mech hl08 Capital av Stevens Roberta lndrs hl51 Clara (E M) Stevens Ross H (Lucille) elk h669 2d Stevens Ruby dom r626 Gresham la Stevens Smith (Pearl) firemn hl91 Grants Stevens Susie (wid Jas) h759 1st Stevens Thos lab rll4 New Stevens Thos E (Mattie) concrete wkr hl20 Cedar (SM) Stevtns Verna lndrs rll2 Edgewood av Stevens Viola lndrs r98 Shamrock Stevens Wayman lab rl09 Bay Stevens Whittaker S (Mattie) plmbr hl02 (105) Ap- plewood MACON OPTICAL COMPANY Frank H;. Johnson ^ '-~-X C Optometrists Opticians 468 CHERRY PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Stevens Wm (Mintonous) brkmn hll3 Rose Crest av Stevens Wm (Hanna) brk mason h518 Cedar Stevens Wm (Eddielee) janitor rlOOO Cedar (U) Stevens Wm (Eva) lab h440 Flanders (E M) Stevens Wm O (Ethel; Bethune & Stevens) h860 Orange Stevens Wm P (Mildred) pres Dixie Fireproofing Co res Vista Circle (I) Stevens Wilson (Frances) h221 Telfair Stevenson Broaches (Rosa) box pkr hl47 Waterville rd Stevenson Frances (wid Isaac) h236 Thompson al Stevenson Isaac rl47 Waterville rd Stevenson Louise student r601 Clinton Stevenson Theo student r601 Clinton Stevenson Turen B (Mittie) carrier PO h601 Clinton Stevenson Zacaria lab r236 Thompson's al The Splendid Features of Past Editions sure retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE in ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 CJ S64 (1925) R. L. POLK & CO.'S Stewart see also Stuart t* Stewart Abb (Ethel) lab Central Ry h210 Lee Stewart Alice Indrs h803 Ballard Stewart Annie L (wid John) hl723 3d Stewart Annie L nurse rlOl Charles Stewart Arth (Addie) plstr hl05 (111) Brief Stewart A M E Church 565 Cotton av Stewart Benj C (Ethel; Stewart Oil Co) h210 Corbin av Stewart Bertha D (wid Fred) h322 Coleman av Stewart Carrie nurse rl49 (147) Lincoln av (V) Stewart Charity cook 101 Clayton Stewart Chas A (Ella F) electn H E Lowe Elec Co r 322 Coleman av Stewart Chas D (Ozzie) overseer h61 Davis Stewart Chas F (Pearl) elk Dempsey Hotel h208 Spring" Stewart Clarence E (Irma) flgmn rl406 2d Stewart Clifford student r914 Elm Stewart Colhoum (Charlie B) draymn h227 Morgan av (W H) Stewart D Miller furn rms 460 Mulberry h do Stewart Earl A (Cephlia) elk G P Fuller r213 North av Stewart Ebbie Mrs mgr Henderson's Gro Store r914 Elm 04 Stewart Eddie L r806 (909) Charles S M) Stewart Edw (Eughter) h806 (909) Charles (S M) Stewart Edw D (Augusta) lab h250 Powell (E M) Stewart Eliz (wid A J) r305 Hendley Stewart Eliz B elk R G Dun & Co 305 Clayton Stewart Elzie (wid Allen) r2109 Broadway Stewart Emma N (wid E Franklin) rl07 Cabaniss av Stewart Emmett E (Lucillie) woodwkr hl37 Stratton Stewart Ethel cook rl49 (147) Lincoln av (V) Stewart Ezekial (Disie) h545 New St la Stewart Frances r322 Coleman av Stewart Fredk D slsmn r322 Coleman av Stewart Fredk H (Julia; Stewart Plating Works) res Miami Fla Stewart Gertrude Indrs r7 Short (E M) Stewart Glenn J student r305 Clayton Stewart Glenn T (Louise) batteries 407% Cotton av h305 Clayton CQ Automobile owners are select prospects for many kinds of merchandise. Send to Headquar- ters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. ,. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 865 Stewart Harry C (Gladys; Stewart Oil Co) h401 Hillger av Stewart Harvey (Rosa) lab h7 Short (E M) Stewart Henry (Cora L) draymn h613 3d av (V) Stewart Henry (Pearl) lab h215 Short (E M) Stewart Henry Y millwkr r22 Railroad av Stewart Jas T (Maude) appr C of Ga h3 Randolph pi Stewart Jas T (Hattie) mech Ellis Motor Co r2627 Broadway Stewart John lab r728 Reynolds al Stewart John F r419 Beech av Stewart Jos (Hattie) lab r228 Madison Stewart Julian T (Ruth) sec-treas Ideal Supply Co rl723 3d Stewart J D slsmn Carstarphen Whse Co r Dry Branch Stewart Katie cook r708 Hazel Stewart Laura lndrs h224 Calhoun Stewart Leaven R elk Independent Lndry Co h460 Broad (E M) Stewart Leo appr r2109 Broadway Stewart Lewis (Mary) lab hl20 Chestney Stewart Mary E lndrs h303 Coles av Stewart Mathews (Delia) lab hl227 (514) Woolfolk Stewart Mattie r305 Jenkins Stewart Maude Mrs opr The Wm Carter Co h3 Ran- dolph pi Stewart Maud lndrs r460 Alabama Stewart May lndrs rl08 Cowan Stewart Millie (wid Benj) r210 Corbin av Stewart Moses chef Hotel Lanier 108 Spring STEWART MOTOR TRUCKS, A S Hatcher Co Dis- tributors, 598 3d, Phones 106-107 and 307 Stewart Nathan (Eula) lab h518 E 1st Stewart Nellie hll4 Adams STEWART OIL CO (B C and H C Stewart), Roy R Barrow Cashier, Filling Station and Vulcanizing 673 Cherry, Phone 206 Stewart Paul Mrs sec Mercer University rll50 University pi Stewart Plating Works (F H Stewart R E Tomlinson) electro nickle plating 687 3d Stewart Richd C hl49 (147-) Lincoln av (V) Stewart Robt A (Minnie) elk hll9 Latta pi FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS # -- ANY PROFESSION DETROIT R. Li. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DuTM as a MMEI Pffl 866 (1925) R. L. POLK & CO.'S Stewart Robt B millwkr r22 Railroad av Stewart Robt W (Eliz) slsmn hl55 Hendley (N H) Stewart Ruth sten r517 Georgia av Stewart Sami J lawyer 226% Cotton av h cor Hazel and Jackson Stewart Shaw (Mattie) textilemn h8 Holt av (N H) Stewart Theo driver Schwartz & Phaul r204 (6) Holt av (N H) THE Stewart Thos (Ebbie) formn r914 Elm STEWART THOMAS J (Octavia), Sec-Treas Burden, DIRECTORY Smith & Co Inc, h620 Yineville av, Phone 4589 IS THE Stewart Walter W (Willie L) mgr Jackson & Co hl24 Charles (S M) GREATEST Stewart Washington lab r554 Tinsley la Stewart Wm (Katie) baker h708 Hazel MARKET PLACE Stewart Wm lab h422 Peachtree Stewart Wm (Sallie) lab h268 Prince Stewart Wm E (Willie F) asst genl frt agt C of Ga h 143 Hines ter (V) H THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of . Information and is "On the Job" 365 Days Every Year Stewart Zeik (Dissie) hlpr hl45 New St la Stewart Zue rl625 Broadway Sties Morris (Maria) lab h511 (401) Crisp Stiles Jos E (Alma) mgr L W Rogers Co h822 1st Still Troy E (Ilah) firemn rl517 Broadway Stine John R (Mary H) eng h2418 2d Stinnett Wm S (Bettie) cond h460 Orange Stinson Annie millwkr r Rebecca Stinson Stinson Ellena r606 New Stinson Fannie Indrs hill Main Stinsonville Stinson Lula emp Jacob Hirsch 356 Pine Stinson Mattie cook r552 Magnolia la Stinson Pauline opr The Wm Carter Co r713 Main Stinson Rebecca (wid Matthew) h Brookdale av Bellevue Stinson Robt B millwkr r Rebecca Stinson Stinson Susie maid r212 Coles al Stinsonville A M E Church 115 Main Stinsonville (N H) Stinsonville School Jos A Brooks prin 103 Main Sstinsonville (N H) Stirk Fredk E (Mary E) constr formn rll4 Chappell Stirk Jas R (Susie H) cond hll4 Chappell Stirk Nina rll4 Chappell PUBLISHES A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 & CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 867 Stivarius Fredk W (Louise) bkpr Burden Smith & Co rl09 Lamar Stockbridge Geo G (Lola) asst mgr Home Art Supply Co h625 Montpelier av Stocks Pete (Annie; Palm Barber Shop) h475 Orange Stokes Augustus porter rl42 2d av (V) Stokes Bella lndrs hl42 2d av (V) Stokes Benj lab rl42 2d av (V) Stokes Carrie Mrs opr Tbe Wm Carter Co r538 Jack- son Stokes Chas W (Naomi) lbr inspr r241 American blvd Stokes Chester F (Lollie R) carp hl242 College Stokes Clarence (Arzato) hl021 Oglethorpe Stokes Cornelius (Bertha) brklyr h211 Wood al Stokes Edgar (May) slsmn Stokes Oil Co r R D 3 Stokes Edgar W farmer r2080 3d Stokes Edw (Mae) driver h2080 3d Stokes Eliz cook r350 Hanson Stokes Fannie smstrs r538 Jackson Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Stokes Gertrude lndrs r211 Wood al Stokes Grover W (Zora; Stokes Oil Co) h509 Mikado av Stokes Hattie cook r525 Craft la Stokes Ida M maid r336 Maple Stokes Jas (Maggie) lab h653 Dunlap al Stokes Jas lab rl42 2d av Stokes Jennie lndrs h336 Maple Stokes JohnH (Lucy) porter Nutting Floral Co hl54 Guernsey la Stokes Louise opr The Wm Carter Co r538 Jackson Stokes Marie dietician Macon Hospital Stokes Melita dom rl09 St John Stokes Odell bkpr Plummers Creamery res R D 3 Stokes Oil Co (Grover W Stokes) 225 Edgewood av Stokes Otis R (Ida) driver Macon Hosp h423 (453) Edgewood av Stokes Susie opr The Wm Carter Co r538 Jackson I DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. S68 (1925) R. L. POLK & CO.'S Stokes Thos (Clara) wood pdlr h538 Jackson Stokes Thos W (Mary) ins 153 Cotton av h207 Ridge av Stokes Wm (Susie) h204 (135) Toombs (S M) Stokes Wm A driver T & T Sausage Co res Skipperton Ga Stone Chas 0 (Addie) sec-treas Corbin Supply Co h 513 (623) Vineville av Stone Chas O jr elk Corbin Supply Co r513 (623) Vineville av Stone Dicy cook h260 Singleton's la Stone Ernest P (Mary) sec-treas Richardson Lmbr Co and Davis-Richardson Lmbr Co hl6 Nevarro apts Stone Frances L slsldy Williams-Guttenberger Music Co r209 West End av Stone Jas (Anna) carp h356 Maynard Stone John (Gertrude) lab h457 Martha (E M) Stone John (Mabelle) lab r322 Monroe Stone John C (Lucy) pntr h303 Cleveland Stone Jos L truck driver r209 West End av (H H) Stone Louise dom r356 Maynard Stone Raphael E r970% Oglethorpe Stone Raymond auto meeb r303 Cleveland Stone Ricbd H (Mary) carp b970^2 Oglethorpe Stone Robt (Leola) auto meeb h4 New St la Stone Robt driver Yellow Cab Co Stone Robt L (Fannie) macb h209 West End av H H Stone Rufus (Eliz) porter Roughton Halliburton Co h5 Gunns al (V) Stone Sami (Florine) lab h236 Telfair Stony Rogers porter Gulf Refining Co rl02 Patterson Storey Florence cook 665 (1033) Vineville av Storey Geo lab rl Fulton al Storey Wm (Bertha) lab hl203 1st Stork Amelia (wid Fredk W) h817 Walnut Storrs Edith R tebr r307 Adams Storrs Emma M (wid Frances L) h307 Adams Stork Alf K (Lizzie) agt Metropolitan Ins Co hill Piedmont av Story Chas (Mary) lab hll4 Whitlock Story Clinton M (Effie) millwkr h20 Brigham Story Georgia A (wid J W) rl05 Edna pi Story Mamie cook 1537 3d Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) Stotesbury W I solr Ideal Lndry Co r Mikado pi Stough Herbert (Geneva) lab h211 Elm Strange Precious Mrs h565 Henrietta Strayer Annie r2327 2d Strayer Horace G (Ethel C) slsmn A T Holt & Co h 2327 2d Strayer Mildred sten Otis Elev Co r2327 2d Street Carrie cook hl068 Ocmulgee Street Edw (Annie) truck driver hlOll Oglethorpe Street Fannie cook hll55 Edgewood av Street Henrietta rlOll Oglethorpe Street Hester A student r613 Woolfolk Streeter Chas lab rl3 Ford al Streeter Jos (Mary) lab hl3 Ford al Streeter Jos jr lab rl3 Ford al Streeter Wm A eng r Arcadia Hotel Streetes Sami (Marie) janitor r Annie Boden Streyer Mattie (wid W N) r269 Hillger av Strickland Arth G (Grace) bkpr 4th Natl Bank hl39 Oakland av & *1 a ^ m m YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Strickland Bradson B (Dollie) millwkr h Railroad Strickland Dinkier flgmn Sou Ry r815 2d STRICKLAND EARL H (May M), General Mgr Georgia Casualty Co, h Albemarle pi (I) nr Forsyth rd Strickland Eva M rl07 Madden av Strickland Henry P dept mgr h2 Spring St apts Strickland Ida cook rll5 New Strickland Jas M drftsmn F R Happ rl20 Highland av Strickland Julian W (Orelia) eng hl07 Madden av Strickland Mary Mrs bkpr Watts & Co rl20 Highland av Strickland Red (Lela) lab h419 Steins al Strickland Ralph (Katie) opr r622 Hawthorne Strickland Sol P (Mary E) mgr Fulton Inv Co hl20 Highland av Strickland S M Mrs office elk Dannenberg Co n CO I--* FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION in DETROIT R. L. POLK & CO. CHICAGO MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 870 (1925) R. L. POLK & CO.'S Strickler Luther W Rev Pastor Lutheran Church of the Redeemer h200 Beech av Strickling Felton meat ctr r413 Lawton av Stringer Thos A (Mayorie) firemn r560 Arch Stringfellow G G machmn Builders Lhr Co r Colum- bus rd Stringfellow Henry R (Susie) car repr r27 Progress Stringfield Cleo (wid Jack A) h222 Bright Stringfied Gladys Mrs millwkr h319 Dannenberg av Stringfield Jas W porter 201 Linden av Striplin Jos L asst jailer Bibb Co jail r350 Mulberry Stripling David R brklyr r477 Spring Stripling Eliz student rll50 Milledgeville rd Stripling Emly Mrs r701 Anderson Stripling Emory R prsmn The J W Burke Co r303 Flanders Stripling Jas C (Irene) h725 Walnut Stripling Jas P (Cleo) mech h233 Washington av Stripling Jos T (Minnie) car inspr hl28 Williams Stripling Lawrence T (Marie) lieut M F D Sta No 5 h205 Center Stripling Marion tchr rll50 Milledgeville rd Stripling Mary r725 Walnut Stripling Milton rll50 Milledgeville rd Stripling Minnie H Mrs smstrs Union Dry Gds Co h 613 Plum Stripling Nellie N Mrs slsldy Union Dry Gds Co h477 Spring Stripling Pauline rl22 Academy Stripling Pete T mech Dixie Dental Laboratory rl28 Williams Stripling Pink W (Sallie) h664 Napier av Stripling Robt G (Laura A) barber 47iy2 3d hll50 Milledgeville rd Stripling Robt G jr mech rll50 Milledgeville rd Stripling Sarah opr r315 Cutter's Green Stripling Sytra (wid S C) r204 Cole Stripling Wiley W (Nellie N) slsmn McManus Fur Exchange h.477 Spring Stripling Wm J (Enterprise Pkg Co) h212 Hardeman av Stripling Wm J (Emma) city police h861 2d A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company IDEAL BATTERY COMPANY <1 ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE 0M1 Phone 4951 256 Second St. 0 HEAVY HAULING MOVING MACON CITY DIRECTORY (1925) 871 w STROBERG CHARLES W (Ruth H), Auto Painter and Top Builder, Commercial Truck Bodies 451- 1 453 1st, Phone 1244, hl45 Summit av N H, Phone p 4072-W (See right top lines and page 53) Stroberg Earl M bkpr C W Stroberg r759 Walnut Stroberg Fredk R L (Estie) h752 Spring Stroberg Kate M (wid Chas F) r759 Walnut Strohecker Frances D sten rl02 Cleveland av Strohecker Henry F (Francis D) lawyer 15 Wash- ington bldg hl02 Cleveland av Strohecker Henry F jr bkpr Wilson & Co rl02 Cleve- land Strohecker Margt T sten rl02 Cleveland av Strohecker Sarah A student rl02 Cleveland av Strom Egan J formn r516 Orange Strom John S (Fay) constr eng r516 Orange Strong Alf U (Minnie) r C B Strong Strong Chanie Indry r863 Pine Strong Chas B (Lucile) solr Ideal Lndry Co h Forest av Bellevue N Strong Eula M opr Sou Bell Tel Co rl026 2d Strong E Bernice elk rl02G 2d Strong E Walter (Mae) wtchmn rl026 2d Strong Harriet sten r403 Bailey av Strong Henry stockmn Union Dry Gds Co r R D 4 Strong Jack C appr Hamlin & Subers rl026 2d Strong Jas B (Mary) dairymn h403 Bailey av Strong Jas T hlpr r403 Bailey av Strong Mae r403 Bailey av Strong Minnie L (wid Louis D) elk Postal Tel-Cable Co h301 Montpelier av Strong Pauline maid r468 Railroad av Strong Ruth r301 Montpelier av Strong Shoe Co G H Tharpe prop 360 2d Strong Wm F (Alberta) pntr hl056 Oglethorpe Stroud Elnora cook 227 Roosevelt (V) Stroud Helen r rear 330 Dempsey av Stroud Jas D (Curmpy) mill hd hh32 (24) Randolph pi Stroud Jesse lab h320 Hazel Stroud Lewis r rear 330 Dempsey av Stroud Mark (Olie) lab h314 Hazel Stroud Mary (wid Boss) r rear 330 Dempsey av Stroud Teazer lab h227 Roosevelt av (V) TsrJ 1 FOR FISTS OF NAMES w o ANY TRADE -- ANY BUSINESS -- ANY PROFESSION STORAGE {ni'TROiT R. L. POLK & CO. chicaho j W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 "More 872 (1925) R. L. POLK & CO.'S Stroup Edw C (Ethel) mech Georgia Auto Co h R D 4 Strozier Alex (Annie) blksmith hl57 Grants Strozier Annie dom rl57 Grants Strozier Carrie dom rl57 Grants Strozier Chas F collr Snyder's Ready-to-Wear res R Goods are Bought and Strozier Dudley blksmith J W Gunn r23 Spring Strozier Estelle sten Ga Casualty Co r22 Nevaro apts Strozier Harry S (Margie; Strozier & Deaver) tchr Mercer Univ h406 Vineville av Strozier Hattie lndrs rl57 Grants Strozier Hattie D (wid Robt L) h616 Carling av (H Sold Through Strozier John H appr T L Wood r336 6th av (S M) Strozier John S (Viola) slsmn h403 Napier av (N H) Strozier J Frank (Ethel) slsmn Jarrett Paint & Glass the Co r749 Anderson Strozier Margie Mrs slswmn Florida Real Est Co h406 Classified Vineville av Strozier Mary dom rl57 Grants Business Lists Strozier Mary lndrs r404 (104) Lexington av Strozier Mary mlnr Newman's Mlnry r802 Mulberry Strozier Paul stock kpr Miller Bros r366 6th av (S M) of the Directory Strozier Rebecca (wid JohnW) h21 Nevaro apts Strozier Robt C (Eunice) elk r616 Carling av (H H) Strozier Seabron (Helen) blksmith h23 Spring Strozier W Henry (Alice) wtchmn h336 6th av (S M) Than STROZIER & DEAVER (H S Strozier, B S Deaver; Any B C Snow Associate), Attorneys-at-Law 715-717 Ga Casualty Bldg, Phone 3667 Other Struby Chester A (Julia; Struby's Sch of Pharmacy) sec J B Riley Drug Co hl08 Clisby Medium Struby's School of Pharmacy (C A Struby J T Olip- phant) 416% 2d On Stubbs Albert J (Lennie) slsmn R S Thorpe & Sons r Earth" 760 1st Stubbs Alice E tchr r530 (654) Vineville av Stubbs Augustus (Sophia) plstr hll3 Forest av (V) Stubbs Brady porter Kash & Karry Mkt r514 Flanders (E M) Stubbs Bud lab hlOl Moore la Stubbs C K slsmn Dannenberg Co r452 New Stubbs Dorothy tchr r7 Ellis av Stubbs Eddie pdlr rl71 Long la Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 873 Stubbs Eddie T slswn Collins r562 Oglethorpe Stubbs Emma hl022 Ocmulgee Stubbs Emma lndrs h454 Womack Stubbs Essie hlpr r511 Hazel Stubbs Frances elk Day's r Lake Shore dr Massyville Stubbs Frances student r509 (505) E Napier av Stubbs Frank chauf rl22 Garden Stubbs Grady lab r514 Flanders (E M) Stubbs Green (Mary) farmer h509 Lexington av Stubbs Hazel r562 Oglethorpe Stubbs Henry (Florence) lab rill Tindale av Stubbs Henry G (Birdelle) mstr mech Sou Ry shops hi, 853 Cherry Stubbs Jack elk rl22 Garden Stubbs Jas r562 Oglethorpe Stubbs Jesse (Lula) lab h507 (209) Charles (S M) Stubbs Jesse C (Ora) eng hl22 Garden Stubbs Jos (Carrie) flagmn h204 Maple Stubbs Jos F sausage mkr T & T Sausage Co res Skipperton Ga Stubbs J Dudley r275 Orange Stubbs Lena smstrs h5 (4) Spring la Stubbs Lillian cashr Dunlap Hdw Co rll4 Cole Stubbs Louise r318 Spring Stubbs Marie lndrs rl024 College Stubbs Martha G nurse r530 (654) Vineville av Stubbs Mary R (wid Ferney B) r208 Buford pi (V) Stubbs Mattie h.514 Flanders (E M) Stubbs Mattie maid h510 Flanders (E M) Stubbs Mildred student rl22 Garden Stubbs Minnie lndrs h204 (201) Plumtree Stubbs Ollie C (wid Peter) h509 (505) E Napier av (H H) Stubbs Peter elk C of G R R Co r509 (505) E Napier av (H H) Stubbs Peter W (Lora W) h275 Orange Stubbs Powell (Lula) lab h247 5th Stubbs Prince lab rllOO Broad Stubbs Ralph C elk C of G R R Co r509 (505) E Na- pier av (H H) Stubbs Robt (Mary) carp hl032 Clinton rd Stubbs Robt (Rose) lab h309 Elbert Stubbs Robt (Bessie) lab h651 Elm al A natural by-product of the Directory Business is the compilation of Mailing Lasts. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN" TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 874 (1925) R. L. POLK & CO.'S Stubbs Robt B (Fannie) slsmn h530 (654) Vineville av Stubbs Robt E jr student r530 (654) Vineville av Stubbs Ruben lab r514 Flanders (E M) Stubbs S Louise (wid Cbas) tcbr h318 Spring Stubbs Tbos P (Eddie) blksmitb h562 Oglethorpe Stubbs Virginia K student r318 Spring Stubbs Wm (Lola) lab hll27 Broad Stubbs Wm lab r507 (209) Charles (S M) Stubbs Wm P (Annie) plstr h7 Ellis av Stubbs Winstead (wid Milard F) r708 Napier av Stubbs W Eug (Effie K) bkpr Burden Smith & Co r530 (654) Vineville av Stuckey Alma (wid Emmet W) cashr Industrial Loan & Inv Co rl09 Cedar Stuckey Benj F r78-79 Short Stuckey Blanton auto mech r524 Calhoun Stuckey Ethelyn nurse Macon Hospital Stuckey Herman A r78-79 Short EVB 1 L L I R 0 N S "A 75c Bottle Makes a Quart" PYORAL the best mouth wash IsSfDHifleriAEmegyAIho,LytLuYoarTpu.nHrrgdouYdFvmeoeo.nlcrsaTtasisathstiaritoilcesen.A,niNasoTtIDtafHyaEoUtdhuhYaSerenEyagDAlePtbrRrhYulyEegOsegigRdpiUnsiAntaNo'kLlns-., H Stuckey Homer W (Willie) cond h201 College pi E Stuckey Jessie nurse Macon Hospital Stuckey John E (Erie) millwkr r78-79 Short Stuckey Pinney r524 Calhoun A Stuckey Wm (May B) auto mech h524 Calhoun STUDEBAKER CARS, Coleman Motor Co Distribu- T tors, 218-220 3d, Phone 2545 Studebaker Elwyn (Fannie) lab h520 Telfair Studstille Jonathan elk r Y M C A I Stull David H r303 Hillyer av Stull Frances N r303 Hillyer av N Stull Ray T (Lena) eng h303 Hillyer av Sturgis Lena maid r209 Middle (V) Sturkie Sami D (Anna B) toolroom kpr hi 162 Edge- G wood av Sturkie Sami D jr elk rll62 Edgewood av Style Eula maid hl29 (15) Park Hotel al Suber Annie L slsldy r222 Magnolia 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSIO(N DETROIT R. L. POLK & CO. CHICAGO aENGLAND THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 45S7 MACON CITY DIRECTORY (1925) Suber Laura A (wid N B) rl09 Cleveland av SUBERS ALEXANDER B (Nettie; Hamlin & Su* bers), h ns Vista Circle 5 e Ridge av, Phone 3015 Sudden Julia cook r611 Hazel Sudduth Ernest (Hilda) carp r209 Hydrola Sudduth Stella M (wid Sidney) ins agt r553 Orange Suffridge Harry (Mary) elect h Highland av (L C Hts) Suggs 0 Lee (Susie) formn h2608 2d Sullivan Annie M cook h5 Harris al Sullivan Benj (Plorine) porter Burden Smith & Co h 338 Woodliff Sullivan Chas B appr rl20 Appleton av Sullivan Frances slsldy Union Dry Gds Co rl20 Ap- pleton av Sullivan Grace (wid Gross R B) smstrs hl25 Daley (S M) Sullivan Harold A (Myrtle) ball player r!103 Walnut MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Sullivan Harvey E (Lila) yd cond rl62 Jeff Davis Sullivan Hattie (wid Chas B) rl20 Appleton av Sullivan Ida L rl06 2d Sullivan Ira B lah rl25 Daley (S M) Sullivan John L slsmn Roughton-Halliburton Co rl06 2d Sullivan Katie r253 Chestnut Sullivan Lena rl977 3d Sullivan Martha Indrs hl60 (144) Green Sullivan Mattie K slsldy Union Dry Gds Co rl20 Ap- pleton av Sullivan Merrill L (Marie) elk hl977 3d Sullivan Susie nurse r567 Walnut Sullivan Walker fnshr Sou Duco Enameling Co r725 Walnut Sullivan Wm G mech W R Finch Motor Co r556 Ash Sultzer Wm mech r247 Boulevard N H Sumlin E Frank (Effie) mach opr h833 Hazel Your City Directory An#.t irs All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak" C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens - and General Mill Work R. L POLK & Company CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 go; * |*g -e 5 a J'st'l T3 . m o> o&c rza Taylor Raymond lab r228 (38) Hendrix la Taylor Robt (Ardell) lab hl58 Virgin Taylor Robt J (Taylor Furn Co) h711 College Taylor Robt J (Kathleen S; R J Taylor Co) h205 Vineville av Taylor Rosa cook hlOO Randall al Taylor Rosa prin Whittle School Taylor Ruby r425 Vineville av Taylor Ruby M winder r9 Bibb av Taylor Rufus L Rev (Lillie) h325 3d av (5) Taylor Ruth tchr r318 Napier av Taylor Ruth tchr r400 Ward (V) Taylor Ruthilee r9 Bibb av Taylor R J Co Robt J Taylor pres stocks and bonds 605-06 Bibb bldg 1 S Taylor Sallie tchr r711 College A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our free "List of Mailing Lists." r L. POLK & CO., Detroit f 210-212 MORRIS HARRIS! Bibb Building INSURANCE SURETY BONDS Telephone 131 886 (1925) R. L. POLK & CO.'S Taylor Sam driver Carstarphen Whse Co r Montpelier * av Taylor Sami (Mary) farmer h810 Fort Hill Taylor Sami (Mattie) rope stock h9 Bibb av Taylor Sami W elk r968 Columbus rd Taylor Sarah S tchr r425 Vineville av Taylor Sidney L (Agnes) eng h767 Pine Taylor Susan Indrs rl48 Cedar Taylor S Lawson (Mattie) carp h968 Columbus rd Taylor S T (Mattie) hi08 Roye Taylor Thelma Indrs r517 E 2d (E M) Taylor Thos (Emma) lab h365 Hawthorne Taylor Thos jr lab r365 Hawthorne Taylor T W baker Am Bakeries Co rl51 2d Taylor Vera maid rl3 Frank's al Taylor Vera mill hd r37 Taylor Taylor Walter (Irene) lab h609 Ross Taylor Walter L (Gussie) pntr h218 Chestnut Taylor Wash (Mittie) lab h431 Chestnut Taylor Watt (Irene) inspr h609 Ross Taylor Wm (Rosa) car repr h517 E 2d (E M) Taylor Wm chauf rl Spark's al Taylor Wm lab r431 Chestnut Taylor Wm lab r310 2d av (V)' Taylor Wm A (Lillie) boilermkr hl03 Capital av Taylor Wm C (Elmeta) pntr h Grand av Bellvue Taylor Wm H driver Natl Biscuit Co r818 Walnut Taylor Wm T oiler rl9 Blosfield av Taylor Willie (wid Wm) hll4 Duncan av Taylor Willis A (Ethel) sta eng rl802 2d TAYLOR W ANDREW (Jennie R), V-Pres Merchants & Mechanics Savings Bank, also Pres Taylor Iron Works & Supply Co, r825 Adams Teague Robt H r246 Winship Teague S Wesley city circ mgr Macon News r402 Beech av Teal Clinton (Carrie) clo prsr 410 Poplar h rear 220 High Teal Robt B slsmn W S Dickey Clay Mfg Co 865 Mul- berry Teal R Clarence (Annie) eng h2323 2d Teasley Oscar A (Allie M) elk r525 College Teasley Sami W (Hattie) wtchmn Taylor Iron Works & Supply Co h414 Oglethorpe More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 887 Tebeau John A (Claude) asst aud h257 New Tedder M Odell (Minnie L) shoe repr Macon Shoe Shop and Army Store r367 Walnut Teele B Frank (Frances) swtchmn hll7 Ells Teichman Margt slsldy Sami Barnett rl017 2d TELEGRAPH THE, See Macon Daily Telegraph Telfair Adel lndrs hl6 Bay Telfair Nathan lah rl6 Bay Telfair Peter (Edna) draymn hl04 May av Unionville Tell Robt (Lula) lab h426 (1323) Steins al Tellis Wyatt lab J H Dubose h77 Longs la The most comprehen- Temple Geo L mgr Phoenix Cafe rl50 Dixie av sive refer- Temple Hushel rl012 Elbert Temple Jas (Maude) lab hll7 Wyche Temple Jessie lab rl012 Elbert Temple Mazzie cook rl012 Elbert Temple Walter P (Anna) cond h658 Pine ence work on the banks of the world TENNESSEE DISTRICT TELEGRAPH CO, L R Dublin Mgr, 455 Cherry, Phone Call: Western Union Tennille Anna P (wid Albert A) h576 College Tennille Estelle tchr r576 College Tennille Paullin r576 College Tennis Thos (Ollie) lab h600 4th av (U) Tennyson Jefferson (Corine) lab G Bernd Co h23G Plant al Tenson Wm (Lula) clo prsr h356 Pine TERMINAL HOTEL OF MACON, E G Jacobs Prop, 301 Cherry, Phone 1228 Terminal Hotel Cafe Sudie Oxford mgr 301 Cherry Terminal Information Bureau C E Reese elk in charge Terminal station Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Terminal Pharmacy W E Dixon prop se cor Broadway and Mulberry Terminal Station W F Wippler station mstr 5th at Cherry Terminal Station Barber Shop L E Williams mgr Terminal Station terminal Tailors & Haberdashers (A C Crow W L Daniel) 313 Cherry Price $20 Published semi- annually MARCH and SEPTEMBER by Terminal Ticket Office E P Bonner ticket agt Terminal Station L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog; contains much valuable data. Ask for a copy B. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. L. POLK & CO., Detroit 888 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" TERMINAL TRANSFER CO, Win T Green Mgr, Hauling, Moving and Storage, Baggage Transfer A Specialty, Terminal Station, Phone 38 (See right side lines and page 86) Terrell Jack H (Kath) mgr The Rent-A-Pord Co r 257 New Terrell Wm (Lula) brklyr h325 4th av (V) Terrence W R trainmn Macon Ry & Light Co Terry Arth (Lillie) lab hl70 Lynwood av Terry Bland (Helen) trav slsmn r558 College Terry Cameron elk Dunwody & Oliphant Houston rd Terry Mack I (Carrie) firemn hl919 2d Terry Marian P (Jessie) supt Life & Casualty Ins Co hl05 Cabaniss av Terry Mary maid Union Dry Gds Co r rear 1252 2d Terry Paul (Liza) lab h801 (150) Charles (S M) Terry Roberta hlpr h704 Ocmulgee Terry Thos (Mary) draymn hl252 2d Texas Co Filling Station No 3 The 770 Division 2846 Houston av 280 Main (E M) Thackston Jas A (Myrtle) mech Dunlap Huckaber Auto Co rll9 Lamar Thaggard Lillie Wm D in U S Service Texas r Wm Yaughn THAGGARD WALTER L (Mae), Certified Public Ac- h410 Fors7y0t8h,GPehoorSniea 2C2a6s2ua(SlteyeBpladgge, P5h0o) ne 2914, Thames Carrie Indrs r328 (240) Rayl Thames Evelyn student rl30 Rembert av Thames Grocery Co J C Thames cor Forsyth rd and McGhee Thames Gwendolyn tchr r612 Holt av Thames Jay C elk Thames Grocery Co rl03 McGhee (C P) Thames Joel student rl03 McGhee (C P) Thames John A (Francis) police h556 Pine Thames Jos C (Fronie) genl merchandise hl03 Mc- Ghee (CP) Thames Jos L bkpr C D Kenny Co rl03 McGhee (C P) Thames Lehman bkpr rl03 McGhee (C P) Thames Leila Mrs elk Coleman Meadows Pate Drug Co r556 Pine Thames Mathew A (Mable) contr h612 Holt av Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 889 Thames Ruth sten C H Hunnicutt Clo Co and Geo Washington Life Ins Co r556 Pine Thames Thos J (Mary) contr r562 Edgewood av Thames J jr (Myrtle) appr Taylor Iron Works & Sup- ply Co rl04 Harrold Thames Walter jr mgr Piggly Wiggly rl30 Remhert av [ THAMES WALTER F (Elizabeth), Contractor and Builder 88-39 Fourth Natl Bank Bldg, Phone 1501, hl30 Rembert av, Phone 4225-W (See page 63) Thames Wilber M slsmn Jos N Neil Co r612 Holt av Tharp Alf C (Pearlie) wood hauler h Bellevue Tharp Archie (Jennie) lab h400 (300) Bowman Tharp Chas (Lela) lab h423 3d av (V) Tharp Stella Indrs r311 Edgewood av Tharp Wm (Mary) porter h235 Middle THARP WM A (Mary; Tharp's Pharmacy), I1I68 High Trucks and Auto Repairing N. E. PACE Authorized for White Motor Trucks 657-659 THIRD ST. PHONE 4846 Tharpe see also Tharp Tharpe Anthony (Bessie) lab h416 Glen Tharpe Benj C (Mattie) overseer h350 Clinton (E M) Tharpe Benj C jr (Louise) elk PO h244 Edna pi Tharpe Carrie student r319 2d av (V) Tharpe Cicero (Odessa) emp h Forest Hill av Tharpe Clara dom 1 (117) Hydrola Tharpe Edgar J jr chauf r7 Balkcom av Tharpe Edw (Mary) carp h319 2d av (V) Tharpe Emma (wid Geo) rl515 Dempsey av Tharpe E Jefferson (Ferris) elk PO h7 Balkcom av Tharpe Frank (Ella) lab hl056 Fort Hill Tharpe General (Bessie) lab hl44 Turpin la Tharpe Geo H (Lula M) prop Strong Shoe Co h ns Vista Circle 6 e Ridge av Tharpe Gus pntr rll9 Tatnall Tharpe G Gordon student r G H Tharpe Tharpe Jos (Katie) lab h805 (115) Cowan FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R, L. POLK & CO. CHICAGO 31 City Directory Answers All Questions as to WHOM You Are Looking For and BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 seo (1925) R. L. POLK & CO.'S THARPE LOUIS A (Martha M), City, Suburban and Parm Property, Loans and Insurance, Exclusive Agent Ingleside, 308 2d, Phones 2376 and 2377, h Yista Circle, Ingleside, Phone 3364 (See front coyer and page 82) Tharpe Malissa Indrs rl24 Bright al Tharpe Martha (wid Fredk) rll3 Plant Tharpe Mary (wid Robt A) r3601 Houston av Tharpe Mary Indrs h422 Hammond Tharpe Monroe C (Louise) ret farmer hll3 American blvd Tharpe Oscar R (Tommie) gro 701 Main h703 do E M Tharpe Oscar R jr (Louise) v-pres Industrial Loan & Inv Co hll2 Laurel av (N H) Tharpe Ozie cook hl64 Virgin Tharpe Perry lab r416 Glen Tharpe Robt A (Emma) slsmn L A Tharpe h701 Ridge av Ingleside Tharpe Thos S jr slsmn Taylor Iron Wks & Supply Co r560 Boulevard (N H) WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kindc of Merchandise and Service Meet "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmoe. lcsaTasathtirioicesn.,nisoTItafHaEtdhhYaeenyagAlet.RbhrlyEeseigpdUinnNaokln-., SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls Tharpe Wm (Janie) h201 Patterson Tharpe Wm porter Dannenberg Co r235 Middle Tharpe Wm H (Daisy) firemn hllO West End av (H H) Tharpe Wm H (Mary; Tharpe's Pharmacy) rl68 High Tharpe Wm T (Verna; W T Tharpe & Co) hl02 Corbin av Tharpe W Dudley (Jeanette) r215 Jeff Davis Tharpe W Tullie (Verna) auto supplies 613-15 Mul- berry hl02 Corbin av Tharpe W T & Co (W T and G H Tharpe) live stock 617 3d THARPE'S PHARMACY, W H Tharpe Prop, Drugs Soft Drinks, Candies, Cigars and Tobacco 672 Spring, Phone 217 (See left side lines and page 65 R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND T^p THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 891 Theiss Conrad A (Edith) supt J H Bailey Coffee Co h 105 Ponce de Leon av Theiss Marion G sten rl05 Ponce de Leon av Theus Hubert (Eloise) h810 Broadway Thiele Lillie M cook r320 Maple Thigpen Emmet B (Mary) carp h222 Maynard Thigpen Guy A (Willie V) elk hl780 3d Thigpen Myrtle nurse Middle Georgia Sanatorium r do Thigpen Troy R (Agnes) bkpr hllO Park pi Thistlewood Geo S (Rosa L) mech h720 Plum Thistlewood Geo S (Rosa Lue) slsmn Flounce Auto Co r512 Main (E M) Thomas Adam (Mollie) chauf h410 Peachtree Thomas Allen (Bertha) lab h614 Crisp Thomas Allie cook h6 Cheatham al Thomas Allie F lndrs r456 Steins al Thomas Alsetta r257 North Thomas Amanda maid r819 Cedar (U) MACON Chero-Cola Bottling Co. WJ.. AJ. . HWAWILKLIINS S Thomas Andrew (Mabel) lab rl23 Edgewood av Thomas Anna lndrs hl30 Curds al Thomas Anna C (wid Henry J) h515 Linden av Thomas Annie cook r222 Jordan al Thomas Annie lndrs h225 Hall Thomas Annie lndrs r93 Woodliff Thomas Arth hllO Emerald (E M) Thomas Arth lab r551 Hall Thomas Augustus hlpr Hoppy's Place r Nesbitt av Thomas Aurvon R waiter J D Carr rlOl Myrtle (E M) Thomas A Mansel elk r Clinton C Thomas Thomas Barney M (Millie) pntr h308 Church (E M) Thomas Benj (Belle) emp hll7 Bell av Thomas Benj T farmer hll6 Chappell Thomas Bernice slsldy S H Kress & Co rll6 Chappell Thomas Berry L (Josephine) mech h330 Winship Thomas Bertha rlOl Myrtle Thomas Buster B lab r648 Rock Hill la Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to ' Banking r Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. r | Detroit, Mich. 892 (1925) R. L. POLK & CO.'S Thomas Carrie B dom r549 Massee la Thomas Carson C (Fannie L) carp h Forsyth rd (V) over Shinholser store Thomas Cecil lab r201 Uydrola Thomas Chas (Ada) emp h400 (164) Roye Thomas Chas (Bessie) porter h610 4th av (V) Thomas Chris A meat ctr rllO Emerald (E M) Thomas Clarence rllO Emerald (E M) Thomas Clarence (Lizzie) lab h338 Maple Thomas Claudie nurse r James Thomas Thomas Cletia r257 Jeff Davis Thomas Clinton C (Athalia) car inspr h Ayers rd Thomas Clyde A (Lucy) millwrt hlOO Grace pi (S M) Thomas Cooper (Julia) lab h603 Charles (S M) Thomas Cornelia lino opr rl98 Magnolia Thomas Cozy L r Jas Thomas Thomas Dave (Dora) h820 Edgewood av Thomas David lab rllO Bay Thomas Donald student r205 (162) Lincoln av (V) Thomas Duffy E baker rllO Emerald (E M) Thomas Edgar (Eldora) agt Pilgrim Health & Life Ins Co h205 (162) Lincoln av (V) Thomas Edgar (Frances) baker rl54 Broadway Thomas Edw appr Bibb Ptg Co r308 Church E M Thomas Edw (Evelyn) cotton sampler hl36 Woodliff Thomas Eliz rll6 Chappell Thomas Ella Mrs maid hll4 May av (U) Thomas Ella lndrs h76 Cherokee al (S H) Thomas Ellen (wid John R) h Church Thomas Elmira (wid Sanford) h915 Ocmulgee Thomas Elnora h Bartlett la Thomas Elsie rll6 Chappell Thomas Emma (wid Jerry) h311 Elbert Thomas Emma (wid Wm) h611 Prince Thomas Essie M lndrs r468 Steins al Thomas Ethel M r476 Jones st la Thomas Eulise r707 (446) Charles Thomas Evie dom r549 Massee la Thomas Fannie lndrs h7 Tracey's al Thomas Fannie lndrs r964 Ocmulgee Thomas Fannie lndrs r537 Plant al Thomas Fannie H (wid Jas A) hll7 Culver Thomas Felix (Clifford) shoe repr 340!/2 Middle (V) h276 2d av (V) KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. -FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 893 Thomas Felton (Marsha) lab h Industrial Home rd V) Thomas Flossie cook rl23 Telfair Thomas Frank (Cordelia) hl98 Magnolia in Thomas Geo student rll4 Forest av (V) Thomas Geo (Annie) truck driver h301 Magnolia Thomas Geo (Ethel) driver h441 Alabama Thomas Geo (Laura) mech hlpr h.201 Bartletts I Thomas Geo (Rilla) lab r46 Massee la Thomas Geo N (Irene; T & T Sausage Co) h785 Holt av (C H) Thomas Georgia lndrs r202 Elliott (E M) Thomas Geraldine (wid Glenn) h244 Thompson's al Thomas Gladys nurse r Jas Thomas Thomas Hattie lndrs h8 Cheatham al Thomas Hattie A cook hl23 Bartlett Thomas Hattie Mae cook r330 Napier av Thomas Henry (Cath) h Robinson rd nr Bond Thomas Henry (Mamie) h505 (303) Charles (S M) Thomas Henry (Julia) trucker M E Elliott Ware- house Co h332 Monroe ra SOUTH'S o LEADING 90 3 FLORISTS IDLE HOUR NURSERIES Thomas Henry lab h416 Steins al Thomas Henry H (Sarah) carp r C C Thomas over Shinholser's store Thomas Herbert carp r201 Hydrola Thomas Hester cook h404 Craft la Thomas Horrace lab r29 Tinsley la Thomas Irvine lab r317 Hammond Thomas Isabelle r478 Alabama Thomas Jack r330 Winship Thomas Jas (Lucy) carp h Simmons av Thomas Jas (Ada) lab hl311 1st Thomas Jas pntr J H Spratling Murphydale av Thomas Jas student rll6 Chappell Thomas Jas student r205 (162) Lincoln av (V) Thomas Jas waiter Dixie Cafe & Commissary r Pleas- ant Hill Thomas Jas T truck driver r511 Flanders (E M) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. m g1 J *-5 1 u i li^ ZCQ ao s E=? O ^CQ 5 K CO CO 2 FOR FISTS OF NAMES ANY TRADE ^-- ANY BUSINESS - ANY PROFESSION DETROIT R. L. POLK & CO. cmn^p-n 894 (1925) R. L. POLK & CO.'S Thomas Janie lndrs h710 Hawthorne Thomas Jennett dom r648 Rock Hill la Thomas Jesse lab r311 Ellert Thomas Jethro P inspr rl817 3d Thomas Joe (Hattie) lab rlOl Bay Thomas John r330 Winship Thomas John (Lizzie) carp h Lawtin rd Thomas John carp r445 Tindall ay Thomas John (Emma) cement wkr h402 4th av Thomas John lab rl37 Bay Thomas John (Mammie) lab h248 Thompson's al Thomas John (Georgia) lab rll2 Whitlock Thomas John (Martha) pdlr r289 1st av (V) Thomas John (Minnie) plstr hl26 Cedar (U) Thomas John D lab r214 Fretwell al Thomas John R (Effie) city flremn Fire Dept rl514 2d Thomas John W (Addie) driver Wilson & Co r357 Madison Thomas John W (Janette) firemn h214 Fretwell al Thomas John W (Josephine) gro 442 Telfair h do Thomas Jones L ice wagon r707 (446) Charles (S M) Thomas Jos r410 Peachtree Thomas Jos (Georgia) h755 Edgewood av Thomas Jos (Ethel) carp h2 Frank al Thomas Jos (Beatrice) emp h Bartlett la Thomas Jos (Nellie) lab r408 (210) Henderson Thomas Jos wks Dixie Ice Cream Co Thomas Jos E (Mary) gro 336 Monroe h658 New Thomas Jos H (Minnie) v-pres Merritt & Co hll2 Pierce av Thomas Josiephene cook H C Stewart r rear 401 Hill- ger av Thomas Julia maid r459 Army Lot Thomas Julious lab rl51 Jones st la Thomas J Adrian br mgr Dickey Auto Supply Co rll7 Culver Thomas J B hlpr W S Dickey Clay Mfg Co r Giles Thomas J C kitchen hlpr Hotel Lanier Thomas Katie nurse r253 Chestnut Thomas Lalia lndrs r915 Ocmulgee Thomas Latha rlOl Myrtle Thomas Laura lndrs r549 Massee la Thomas Lee T (Mittie) firemn h707 (446) Charles 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 895 Thomas Leila M cook r311 Elbert Thomas Leola lab r551 Hall Thomas Leon inspr Macon News rlOO Grace Thomas Leon porter Dannenberg Co rll4 Forest av (V) Thomas Leroy lab h227 Daisy Thomas Lester A (Clifford; L A Thomas Drug Co) and v-pres Coleman Meadows-Pate Drug Inc Co hl318 Vineville av Thomas Lester A jr (Eliz) elk Coleman Meadows- Pate Drug Co r340 Vineville av Thomas Lewis G tchr Wesleyan College r218 Georgia av s Thomas Lizzie lndrs h6 Virgin la Thomas Lizzie lndrs h551 Hall Thomas Lonnie lab r301 (609) Colquitt Thomas Lonnie mill opr r4 Shell av Thomas Lois r257 Jeff Davis Thomas Louise r311 Elbert MACON OPTICAL `rank H. Johnson .OApti,.ci.ans Sft CHF.RRY %' COMPANY U_ ptometriysts PHONE 3213 POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Thomas Louise tchr r502 American blvd Thomas Lucille h857 Ash Thomas Lucille maid r803 Ocmulgee Thomas Lula (wid Robt O) r502 American blvd Thomas Lula cook r239 Thompsons al Thomas Lula H nurse r311 Elbert Thomas Luther (Mollie) swtchmn h805 Ocmulgee THOMAS L A DRUG CO (L A Thomas), 1001 Broadway, Phones 201 and 202 Thomas L H (Sue) eng r620 Pine Thomas L M elk r Central City Hotel Thomas L Minter cable splicer rlOO Grace pi (SM) Thomas Mabell r302 Hanson Thomas Maggie maid r334 Elizabeth Thomas Mary h819 Cedar (U) Thomas Mary h302 Hanson Thomas Mary (wid Charlie) h Industrial Home rd Thomas Mary r2 New st la Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TELEPHONES 786-1503 BLUE GEM-RED ASH-JELLICO AND HEATER COAL DIXI C0AL COMPANY WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 S96 (1925) R. L. POLK & CO.'S Thomas Mary Indrs h770 Nusbaum Thomas Mary B (wid Napoleon) hl514 2d Thomas Matthew firemn r522 Hawthorne Thomas Mattie nurse City Health Dept r72 (140) For- est av (V) Thomas Mattie L nurse r205 (162) Lincoln av (V) Thomas Mattiesue sten Willingham L & T Co r502 American blvd Thomas Maud nurse rl39 Roosevelt Thomas Melvina r410 Peachtree Thomas Mensell elk r Clinton C Thomas Thomas Mildred C student rll2 Pierce av (V) Thomas Milton (Coreen) lab r424 Flanders (E M) Thomas Minnie Indrs r4 Alabama Thomas Mittie h707 (446) Charles (SM) Thomas Morley E (Mae) h93 Arlington pi Thomas Morris (Mattie) pntr hl02 Ruby Thomas Morrison (Dorothy) trav slsmn r307 Orange Thomas Nellie Indrs r216 Gilmer Thomas Nelson (Mary) lab h216 Gilmer Thomas Nettie M store kpr r707 (446) Charles Thomas Nora dom r231 Turpin Thomas Odessa h812 Edgewood av Thomas Ora cook h rear 250 Johnson (SM) Thomas Oscar (Ida) employer h584 Whitehall Thomas Otha (Sussie) hlpr r302 Thompson Thomas Othea lab r311 Elbert Thomas Paul (Maggie) firemn h511 Flanders (EM) Thomas Pearl Indrs r657 Elm al Thomas Philip lab r4 Stewarts la Thomas Porter D (Nina) credit mgr Jones Motor Co hl08 Log Cabin dr Thomas Quinton ab r302 Hanson Thomas Raymond student rll6 Chappell Thomas Rebecca nurse rl51 Jones st la Thomas Robt auto mech r Jas Thomas Thomas Robt (Bertha) firemn h234 2d av (V) Thomas Robt lab rl30 Curds al Thomas Robt (Viola) lab hl07 Mitchell Thomas Robt (Artie) opr h201 Hydrola Thomas Robt porter E A Waxelbaum & Bro r Pio Nona av Thomas Robt H (Lillian) spl agt rl608 Forsyth rd (V) HAWTHORNE and FIFTH STREETS C C BENNETT Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r tcCeoarpstya.lfoogr aclolRnkt.ainLind.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, uMsrkInCfeHowr. GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON CITY DIRECTORY (1925) 8S7 Thomas Robt L (Mattie) hlpr Armour & Co hll4 Forest av (V) Thomas Robt L police rl057 Elm Thomas Robt L jr lab rll4 Forest av (V) THOMAS ROBERT 0 JR, (Calhoun & Thomas), h502 American Blvd, Phone 5304-J Thomas Robt T carrier P 0 r234 2d av Thomas Roberta lndrs h463 Alabama Thomas Rosalie r524 Calhoun Thomas Rose r859 3d Thomas Ruby h Bartlett la Thomas Rufus (Lucinda) porter h604 May av Thomas Sami (Annie) lab r442 New st la Thomas Sami lab r318 Wall Thomas Sami (Carrie) lab h412 Thompson al Thomas Sami M (Frances) mach hd h555 Oak Thomas Sanford jr brickmason r915 Ocmulgee Thomas Sarah r201 Patterson Thomas Sarah E cook r302 Hanson Thomas Scott (Louise) pdlr h244 (228) Brewery al Thomas Sevola lab r416 Steins al Thomas Silas (Annie) lab h.459 Army Lot Thomas Sussie (wid Owen) h Lanier pi Thomas Thelma C boxmkr Tomlinson Paper Box Co rlOl Myrtle Thomas Tom (Mary) r540 (248) Smith (E M) Thomas Ullyses lab r416 Steins al Thomas Versole lab r302 Hanson Thomas Victoria h701 3d av (V) Thomas Viola (wid Lewis) h72 Oliver av Thomas Viola lndrs hll9 Powell (E M) Thomas Virginia (wid Ben) r203 Peachtree Thomas Walter (Maggie) meat ctr hlOl Myrtle Thomas Waltina student rl52 (210) Lincoln av (V) Thomas Wesley pdlr h328 E 2d (E M) Thomas Walter P (Mary) carrier P O and gro 229 Patterson h do Thomas Wm (Pearl) carp h603 Gilmer Thomas Wm cook hl34 O'Hara la Thomas Wm garage 659 Georgia av rl90 Lincoln av Thomas Wm (Julia) lab h531 Calhoun Thomas Wm lab rl35 Hazel Thomas Wm (Daisey) lab h43 Massee la Thomas Wm (Susie) lab hllO Smith (E M) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DMlffl 898 (1925) R. L. POLK & CO.'S as a Thomas Wm mech r250 (190) Lincoln av (V) Thomas Wm (Fannie) pdlr hl51 Jones st la MMEI Thomas Wm B lab r225 Hall Thomas Wm D (Margt) eng h257 Jeff Davis Thomas Wm H carp h314 Forest av (V) PLACE Thomas Willie M cook r24 Williams la Thomason Annie (wid Virgil C) h507 Clinton THE Thomason DeWitt hlpr H E Lowe Electric Co rl03 Balkcom av DIRECTORY Thomason Jas U (Hattie) supt hl60 Thompson Thomason Lillian O student r507 Clinton IS THE Thomason Mary L student r507 Clinton Thomason Sarah M Mrs smstrs Acme Mattress Co GREATEST Thomaston Augustus B (Mayble) car inspr C of Ga R R r337 Jeff Davis MARKET Thomaston Walter housemn Wilson & Co r534 Flanders PLACE IN THE Thombley Bob L (Martha) bkpr h517 Georgia av Thompkins Chas P (Georgia) prop Georgia Grocery No 13 r309 Georgia av Thompkins Daisy lndrs h635 Division WORLD * Every Day in the Year the Directory Tells Where All Kindis of Goods and Service Can Be Had Thompkins Essie h853 Ash Thompson Albert r214 Madison Thompson Alice bkpr rl335 2d Thompson Anna (wid John S) rl27 Fort Hill Thompson Anna cook h218 Duval (E M) Thompson Annie L mill hd r20 Bibb av Thompson Annie R bkpr r208 Tatnall Thompson Budroe (Bessie M) prop Thompsons Bar- ber Shop h719 Pair Thompson Carl (Eula) hl924 2d Thompson Carrie (wid Joshua) h20 Bibb av Thompson Chas (Annie) farmer h Burton av The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Thompson Clara M matron Methodist Orphans Home r do Thompson Clark (Ella) farmer h Lawton rd Thompson Clarke A bkpr Macon Cooperage Co rl4 Marion pi Thompson C E slsmn Dunlap Huckabee Auto Co Thompson Darnie (Lera) lab hl39 (191) Mutual av Thompson Dollie F supt of nurses Middle Ga Sanatorium r do Thompson Dorothy dom rl28 Moughon Thompson Edw L rl42 Stratton A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569*6 CHERRY ST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 899 Thompson Eldora nurse r5 Forsyth ter Thompson Eliza lndrs hl75 Park Hotel al Thompson Elija (Tensy) millwkr r9 Bellevue rd Thompson Ella R Mrs r44 S College Thompson Estell student r211 American blvd Thompson Ethel M sten r556 Woolfolk Thompson E Raymond (Cecilia) mach b.759 Walnut Thompson Fred W (Vivian) hl22 Latta pi Thompson Geo soda dispr Bethune & Stevens Thompson Geo A buyer G Bernd Co Thompson Geo W truck pdlr h Villa av (Bellevue) Thompson Grace millwkr rl65-166 Thomason Thomas Lillie M nurse Macon Hosp h513 E 2d (E M) Thompson Harry rl65-166 Thompson Thompson Ivey M (Grace) mach hll61 Milledgeville rd Thompson Jas M (Athlea) pressmn The J W Burke Co r620 Plum Thompson Jesse E (Fleta) elk h556 Woolfolk Royal Corona Typewriters SCOTT-PARKERCO. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Serviee Thompson John r853 Ash Thompson John lab r632 Prince Thompson Jos A (Mallory) flagmn hl44 Holt Thompson Julia cottonwkr r318 Calhoun Thompson J Dalton (Eliz) blksmith h604 Main (E M) Thompson Kath maid 412 Vineville av Thompson Katie B rl39 (191) Mutual av Thompson Leroy B (Eda Belle) genl mgr h401, 855 Mulberry Thompson Letha (wid Jas) hl335 2d Thompson Lizzie lndrs h449 Gilmer Thompson Lizzie slswmn Day's r604 Main Thompson Lovie cook r Clark Thompson Thompson Lucius (Timpie) farmer r330 Campbell av Thompson Martha (wid Jas I) r301 Main (E M) Thompson Martin J (Minnie) chf of police h616 Arch Thompson Mary r Charles Thompson Thompson Mary E (wid Wm A) r211 American blvd I DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 c o JS ^ u-~0J2i JJw02 2 I < d 13 I I " t/> fig O u o* 2 5 H gw 3 I 33 a 2 < o 2 Ics Qt go S3 3 r1 iy S - D J & A 3cIs O z H HsCuO "OU02yQZ02i < < Huh M0-U*. Q X a, More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 900 (1925) R. L. POLK & CO.'S Thompson Mattie lndrs h3 Traceys al Thompson Meta companion r224 Georgia av Thompson Napoleon B (Mattie) hl65-166 Thompson Thompson Nina sten Bankers Health & Life Ins Co r 763 2d Thompson Odessa r Jessie Leath Thompson Oscar butler rl21 Middle Thompson Otis R (Hazel) phys 610 Bibb bldg hl47 High Thompson Owen P teller Macon Natl Bank r401, 865 Mulberry Thompson Paul supt Adams-Richardson Lumber Co rl07 Latta pi Thompson P Herbert (Mary) slsmn hl25 Laurel av (N H) Thompson Ralph (Ethel) emp r C G Franklin Thompson Richd G tel opr h6, 811 Poplar Thompson Robt L (Lottie) electn hll53 Ash Thompson Robt L (Ruth) agt Life Ins Co of Va h720 Anderson Thompson Roy H (Sarah) meeh Dunlap Huckabee Auto Co hi Rose pi Thompson Ruth r214 Madison Thompson Ruth bkpr W U Tel Co r208 Tatnall Thompson R Frank (Hattie) millwkr rl65-166 Thompson Thompson Sami slsmn rl335 2d Thompson Sarah Mrs slswmn Dannenberg Co 1 Rose Pi Thompson Theo (Emma) linemn r835 Main (E M) Thompson Thos A Rev pastor Washington Av Pres- byterian Ch h214 Madison Thompson Timothy A pastor Washington Av Presbyterian Ch r214 Madison Thompson Vivian Mrs slswmn Dannenberg Co rl22 Latta pi Thompson V Lynwood (Emma) electn r653 Forsyth Thompson Walfred A (Maud) elk P O h211 American blvd Thompson Walter (Laconia) lab h534 Flanders (E M) Thompson Wilber L (Grace) eng h615 Johnson av Thompson Wilburn S elk r211 American blvd Thompson Wilhelmina r214 Madison Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 901 Thompson Wm A (Anne) slsmn Central Ga Baking Co h208 Tatnall Thompson Wm P (Maud) flagmn h260 Church (E M) Thompson Wm H (Nettie) slsmn H Kessler & Co h605 Carling av Thompson Wm L farmer r Charles Thompson Thompson W S elk C of G R R Co r211 American blvd THOMSON LEWIS E, Mgr Macon Coca-Cola Bottling Co 418 Oak, Phone 287, h Rivoli Weslyan Driye Thorner Gertrude sten Hall Grice & Bloch r204 Buford pi (V) Thorner Stella tchr r204 Buford pi (V) Thornton Albert (Luline) cook h433 Chestnut Thornton Clara lndrs h214 Frank al Thornton Edwin A (Lilly) garage 858 Broadway h 1164 Elm Thornton Emma (wid Thos) cook h 2d av (Bellevue) Thornton Ethel lndrs r720 Short (E M) YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES Thornton Jessie (Mary) blksmith hl030 Broad Thornton John P (Mary J) blksmith 830 Main rl018 Broad Thornton Jos G (Mamie) firemn h724 Ash Thornton Lillian Mrs gro 528 2d hll64 Elm Thornton Lillie cashr Terminal Pharmacy r860 Elm Thornton Lizzie lndrs h613 Maynard Thornton Mamie dom hi 2 Massee la Thornton Mamie lndrs h328 Short (E M) Thornton Mildred smstrs r320 Giles Thornton Pauline rl331 1st Thornton Robt L (Essie) h320 Giles Thornton Tommie C car inspr r320 Giles Thornton Wm (Mary) lab h216 (565) Turpin Thornton Willie M lndrs Mount de Sales Academy r 613 Maynard (E M) Thorpe see also Tharpe Thorpe Lilly rl52 College Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy n. Ii. POLK & CO., DETROIT, MICH. O to in MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb BuildingTelephone 131 902 (1925) R. L. POLK & CO.'S Thorpe Cecil A v-pres R S Thorpe & Sons r300 Geogia av Thorpe Fannie lndrs rl63 Coles al Thorpe Jas porter Dempsey Barber Shop rl2 Park Hotel al Thorpe Katie lndrs h303 Womack Thorpe Mabell lndrs r967 Ocmulgee Thorpe Melissa lndrs h234 Calhoun Thorpe Norman (Katie L) porter hl63 Coles al Thorpe Richd S (Marion) pres R S Thorpe & Sons h 300 Georgia av Thorpe Roberta lndrs r303 Womack THORPE R S & SONS, R S Thorpe Pres, C A Thorpe Y-Pres, V S Thorpe Sec-Treas, Clothing, Men's Furnishings and Shoes, Ladies Sanitary Hair Cutting Parlor 2d fl 515-517 Cherry, Phones 159, 314 and 761 (See page 59) Thorpe Ulysses lab hl02 Texas Thorpe Virgil S (Daisy) sec-treas R S Thorpe & Sons h98 Delaware av Thrailkill Mary nurse Macon Hosp Thrash John janitor Mount de Sales Academy h803 Daisy Thrash Lillie M maid h25 Buckner al Thrash Louis janitor r234 Calhoun Thrash Margie (wid Baker) hl07 Tindall av Thrash Wm (Lillian) swtchmn h801 Daisy Thrasher Paul E colln mgr Washington Dessau r247 Vineville av Threadgill Andrew G (Imogene) elk h916 2d Threaks Eug (Lula) lab h704 (189) Crisp Threaks Lucile r317 Vine Threat Alex (Alice) carp h481 Douglas av Threat Edw K (Lula) draymn h410 E 1st (E M) Threat Wm (Louise) lab h446 Virgins la Threats Jas (Fayette) carrier r531 Campbell av Threatt see Thweatt Threatt Adele E chf elk Pilgrim Health & Life Ins Co r610 3d av Threat Annie lndrs hlOO Green Threatt Arth (Mary) lab hlOO Mutual av Threatt Beatrice student r307 (113) Roosevelt (V) Threatt Clark (Eliza) farmer hl29 Mutual av Threatt Florence lndrs r303 (116) Roosevelt (V) More goods are bought and sold through the Classified Business Lists of the Directory that any other medium on earth. Macon Transfer & Storage Company IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. HEAVY HAULING MACON CITY DIRECTORY (1925) 903 MOVING Threatt Green gdnr h226 4th av (V) Threatt Henry (Leila) lab Willingham Sash & Door Co h303 (116) Roosevelt (V) Threatt J W carrier P O rl31 Grant av Threatt Mozel r303 (116) Roosevelt (V) Threatt Ned (Amelia) carp h307 (113) Roosevelt (V) Threatt Wm L (Mattilda) lab rl8 Woodliff Threatte Emmie maid rl62 Sycamore Threatts Mose lab r455 Barracks al Threets Lena lndrs h30 Dixie row Threlkeld Wm E (Luella) farmer h866 Elm Thurman Brag (Mary) lab h381 Middle (V) Thurman Chas lab h726 Campbell av Thurman Chas S (Emma) prop Central Ga Automo- tive Co h614 Holt av Thurman Ella M (wid Jas P) r209 Rogers av Thurman Fozie Lee lab r805 (115) Cowan Thurman John (Mollie) lab h349 Hawthorne Thurman M Merritt (Mattie) h209 Rogers av Thurmand Alberta (wid Wm) h822 Edgewood av Thurmon Warren (Mattie) lab rllO Bay Thurmond Bethena (wid A T) h401 Franklin (S M) Thurmond Chas mech r401 Franklin (S M) Thurmond Jefferson C (Ola) collr Empire Furn Co h 210 Rutherford av Thurmond J B (Marie) elk h310 Duncan av Thurmond Lee truck driver Taylor Iron Works & Sup- ply Co rll5 Jackson Thwaite Anna B student r325 Ridge av Thwaite Chas E (AnnaB) elk h325 Ridge av Thweatt see also Threatt Thweatt Henry (Lelia) lab hl7 (917) Clayton Ticknor Eug T (Katie) dept mgr Dannenberg Co h 743 Courtland av Ticknor Holmes B pntr rlll4 Milledgeville rd Ticknor John H pntr hll32 Milledgeville rd Ticknor Mary (wid Wm O) rlll4 Milledgeville rd Tidwell Annie (wid Geo E) hlll4 Milledgeville rd Tidwell Annie I sten rlll4 Milledgeville rd Tidwell Annie L gro 201 Linden av hill Randolph pi Tidwell Baxter B flagmn r758 2d Tidwell Chas (Fannie) baggagemstr r504 Oak n Tidwell Cliff (Sallie) hl4 Holt av (N H) Tidwell Edna student rl33 Gordon (S M) rp Automobile owners are select prospects for W O many kinds of merchandise. Send to Headquar- tcCeoarpstya.floosr aclolRnkt.ianiLnd.ssFomOfLuAcKhut&ovmaClouOba.i,blelDeELdTisaRttsaO..ITOA, usMrkInCfeoHwr. STORAGE W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 904 (19251 R. L. POLK & CO.'S POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. Tidwell Elmer T (Annie) carp h946 (595) Columbus rd Tidwell Ernest H driver W S Dickey Clay Mfg Co h505 Mikado av Tidwell Etheridge (Minnie) h315 Shamrock Tidwell Frances L sten rlll4 Milledgeville rd Tidwell Henry E (Ethel) city firemn hll8 Yates av (E M) Tidwell H baker Am Bakeries Co Lizella Ga Route 2 Tidwell H T city firemn Fire Dept r do Tidwell Jas M (Jessie) trainmn Macon Ry & Light Co h!07 Freeman Tidwell John rl4 Holt av (N H) Tidwell Johnson elk Ideal Creamery r319 Shamrock Tidwell J Lester (Lillie) carp W S Dickey Clay Mfg Co h505 Mikado av Tidwell Lessie rl4 Holt av (N H) Tidwell Lester E (Willie) gro 454 Clinton h614 Mont- pelier av Tidwell Marie r315 Shamrock Tidwell Mary rill Randolph pi Tidwell Oscar F (Annie) eng hl33 Gordon (S M) Tidwell R Vernon (Ethel) rl28 Academy Tidwell Robt D (Lizzie) formn h319 Shamrock Tidwell Romer (Lillie) h477 Virginia av Tidwell Roy J hlpr r319 Shamrock Tidwell Ruth Mrs opr The Wm Carter Co r3708 Hous- ton av Tidwell Thos E (Mattie) gro 936 (510) Columbus rd h do Tidwell Thos J elk r201 Linden av Tidwell Thos J (Annie) hill Randolph pi Tidwell Wiley C mech Cliff Walker r319 Shamrock Tigner Edw (Eva) lab h458 Steins al Tigner Oscar (Ada) lab hl52 Cedar (U) Till Frank K (Lula) slsmn Johnson Bros hl07 Calla- way Till Marguerite rl07 Callaway Tillery Homer W (Nona) carmn h460 New Tillman Chas appr Taylor Iron Works & Supply Co r 103 Troupe Tillman Jackson janitor r75 Reid Tillman Jake brakemn r355 Elm Tillman Joshua (Annie) lab rl05 Edgewood av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 905 Tillman Mona (Bell) millwkr r93-94 Green (Payne Mill) Tillman Spencer firemn r355 Elm Tillman Wm H (Malissa) asst mgr Atlantic I & C Co r415 New Tilman Georgia Indrs h8 Reynolds al Tilson Georgia nurse h254 Orange st la Timberlake Jos H (Mary) sec-treas Carter Hdwe & Supply Co h710 Forsyth Timberlake Ulysses (Lillie M) carp h415 4th av (V) Timme Clarence H firemn r203 Virginia (W H) Timmerman J Warren (Marie) v-pres Adams Bros Co r657 College Timmons Leon H (Beatrice) chauf rl016 Oglethorpe Timmons L M driver Yellow Cab Co Timmons Mollie Mrs r374 Clinton (E M) Timmons Nell Mrs slswmn N Y Waist House r572 Boulevard (N H) Timmons Thos A (Nellie; Pic & Pay Grocery) h572 Boulevard (N H) Timothy John driver J W Collins r382 Madison Tindall Chas C (Minnie) elk h856 Orange Tindall Constance E student r856 Orange Tindall Luther E (Sarah) ship elk Builders Lumber Co hlOl Highland av Log Cabin Hgts Tindall Ollie (Nina) wtchmn hl741 Broadway Tindall Ollie sten rl5 Balkcom av Tindall Richd H carrier P O r856 Orange Tinker Eliz (wid Wm H) rl35 Culver Tinker Francis E (Hattie) slsmn Fuller Brush Co h 124 Log Cabin dr Tinker Herbert G supt Higgison Constr Co hl35 Cul- ver Tinker Margt opr Sou Bell Tel Co rl35 Culver Tinley Clarice Mrs slswmn Dannenberg Co rl63 2d Tinley Foy L (Clarice) slsmn Dannenberg Co rl63 2d Tinley Jennie (wid J J) r273 Hillyer Tinley Joshua E (Jessie) embalmer J B Hart & Bro r Hotel Arcadia Tinsley Cadmus L (Bertha) cashr Procter & Gamble Co h201 Forsyth ter Tinsley Caroline r201 Forsyth ter Tinsley Chas L hi Forsyth ter Tinsley Ethel nurse genl r734 Hazel FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. I.,. POLK. & CO. CHICAGO We Do It Right R P 0 L L U L M E B R I N & G BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 906 (1925) R. L. POLK & CO.'S Tinsley Fred (Mary) farmer h418 Applewood Tinsley John (Alice) brkmn h809 (129) Charles (SM) Tinsley John D (Lucy) lab h554 Henrietta Tinsley John W (Lora) mech hl58 Oakland av Tinsley Marcella S tchr r210 College Tinsley Martin elk Mrs M H Grunnels r666 Arch Tinsley Nathaniel (Anna) lab h9 Alabama Tinsley Robt (Annie) carp h319 Norris Tinsley Robt (Eliz) porter H L Barfield r75 Schofield Tinsley Theo D v-pres S R Jaques & Tinsley Co h555 College Tinsley Theo D jr r555 College Tinsley T Nisbet (Ada) ins agt h210 College Tinsley Walter (Lula) lab h222 Division St la Tinsley Walter (Annie) lab h222 Turpin Tinsley Wm (Fannie) mill opr hl05 (217) Flanders Tipton Edw W (Lillian) lawyer 13 Hardeman bldg h 111 Madden av M "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH IfsHiflriEmgyAho, tLuarTpnHrgdouYvmeo. lcsaTasathtirioicesn. ,nisoTItfaHaEtdhhYaeenyagAletbRhrlyEeseidpgUinnNaokln-., SDeAeILyoYu.r dFeonrtissatleANatDyUouSrEDPrYugOgRisAt'Ls 1 H Tiseman Maggie Mrs hl017 2d L E Tison Lucy lndrs hl25 McKay's al Tissereau Daisy r312 Giles Tissereau Louis (Ellen) wtchmn h312 Giles L A Titcomb Louise tchr Wesleyan College r do Tittle Mattie (wid J W) h594 Duncan av I T Toaster Elbert lab h332 Boardsman al Todd Cellie chauf r528 Coleman al Todd Georgia lndrs hl214 Broad R I Todd Mary lndrs h207 Smith (E M) Toland Collier mill hd r321 Pio Nono av 0 N Toland Eug (Lizzie) r321 Pio Nono av Tolbert Chas gro 550 Hammond h616 Hammond Tolbert Chas (Mary) lab b.901 (913) Ocmulgee N G Tolbird Albert M specialist rl27 Virginia av Tolbird Frank elk rl27 Virginia av S Tolefree Cottage Mercer Univ 1121 College Toles Hoyt electn rlOl Franklin 415 Third Phone 5113 FOR LISTS OF WAIVES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND xjf THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 907 Toles Milo plmbr rlOl Franklin Toliver see also Taliferro Toliver Adell cook rl02 Empire av Toliver Jas (Coldonia) pdlr hlOl Blount Toliver Jas jr rlOl Blount Tolliver Danl (Golden) lab h312 Gilmer Tolliver Ernest (Ida) lab hl06 Hazel Tolliver Jas blpr Taylor Iron Works & Supply Co r 1238 Broadway Tolliver King r8 Woodliff Tolliver Mollie maid rllO Tindall av Tolliver Nancy h724 Edgewood Tolliver Ola tchr r724 Edgewood av Tolliver Ralph (Susie) lab h327 Gilmer Tolliver Viola cook r40 Railroad av Tomlin Chas F (Gertrude) millwkr h34 Mellrose Tomlinson Frances student r519 Walnut Tomilnson John T (Ella) soft drinks h Grand av (Bellevue) * MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAIWLKLIISNS Tomlinson Nelle bkpr Stewart Plating Works r324 Napier av Tomlinson Paper Box Co (W T Tomlinson) 5th nw cor Ocmulgee Tomlinson Roht E (Julia; Stewart Plating Works) h 324 Napier av Tomlinson Thos (Willie) lunches Forsyth rd h do Tomlinson Wade H (Vera) collr h23 (15) Bellevue rd Tomlinson Wm T (Blanche) mgr Tomlinson Paper Box Co h519 Walnut Tompkins Carter (Georgia Lee) r309 Georgia av Tompkins Frank (Mattie) h818 Edgewood av Tompkins Henry O (Annie) formn h Forest av (Bellevue) Tompkins Hugh L (Lorene) h767 Poplar Tompkins Loraine nurse Middle Ga Sanatorium r do Tompkins Margt agt rl04 Yates av (E M) Tompkins Mattie r623 Oglethorpe Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L. POLK & Company j (A a u mC LUMBER, SHINGLES, LATH Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 908 (1925) R. L. POLK & CO.'S Toole Catheren (wid Dr O A) h Oliver av (Log Cabin Hts) Toole Chas J (Paul) furn dir h440 Beech av Toole Chas J jr (Louise) collr Empire Furn C h32 Progress Toole Chas L (Eva J) dentist 722 Bibb bldg h202 Elizabeth pi (V) Toole Chas L jr dentist 722 Bibb bldg r202 Elizabeth pi (V) Toole Dorothy tchr r505 Vineville av Toole Eula (wid Fred C) h505 Vineville av Toole Frank L (Mary) mech Coleman Motor Co r Log Cabin blvd Toole Fred student r505 Vineville av Toole Geo C (Mary) collr A G Rhodes Son h258 Jeff Davis Toole Gertrude tchr r5, 478 College Toole Glen (Mary) real est h5, 478 College Toole Glen jr elk Vineville Drug Co r5, 478 College Toole Helen student r202 Elizabeth pi (V) Toole Jas J (Florence) cond h2520 2d Toole J Wiley (Dollie) slsmn H Marshall Furn Co r 206 Pierce av (V) Toole Lewis E (Annie) farmer h Burton av Toole Lila r Mrs Cath Toole Toole Lula (wid Chas J sr) r210 Glen Cove dr Toole Robt J elk r2520 2d Toole Ruby student r505 Vineville av Toole Thos E (Julia F) farmer h422 Vineville av Toole Virgil J (Reba) mgr Globe Furn Co r386 Clin- ton (E M) Toombs Alice lndrs h863 Pine Toomer Beatrice lndrs r337 Woodliff Toomer Chas (Lizzie) furn repr h242 2d av (V) Toomer Clifford (Beatrice) presser Edw Pearson h337 Woodliff Toomer David hlOl (214) Toombs (S M) Toomer Doris dom rl24 Stripling al Tomer Frances E lndrs rl24 Stripling al Toomer Frank (Lizzie) lab h320 North Toomer Frank (Eugenia) lab hl24 Stripling al Toomer Gladys lndrs rl24 Stripling al Toomer Harry (Maude) lab h228 McLean al Toomer Hector (Eliz) porter h208 Middle (V) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V2% on Savings MACON CITY DIRECTORY (1925) 909 Toomer Jas driver r320 North Toomer K Patk lab rl24 Stripling al Toomer Mary r603 Peeble Toomer Naomi cook r208 Middle (P H) Torbett Virginia (wid J K) rl09 1st av (C P) Torchinsky Aaron mgr Workingmans Store r654 2d Torchinsky Isadore elk Workingmans Store r654 2d Torrance J Alva flagmn r761 Mulberry Torrence Arth D (Johnnie) elk h6 Spring St apts Torrence Wm R (Ibbie) mtrmn h7 Spring St apts Tory Love (Annie) h708 (713) Elbert Touchstone Wm L acct r407 Forest av (V) Towery Albert student r819 New Towery Clara r819 New Towery Wm M (Ada E) boilermkr h819 New Towler Silas C (Blanche) slsmn hll8 Corbin av Towler Wm F student rll8 Corbin av Towns Fields pdlr h319 Davis av Townsend Belle cook Mrs N C Burr r do Townsend Ezekiel flremn r358 Ash Townsend Geo (Rosa) mech h321 Randolph Townsend Zeak (Mitilda) lab h318 Hammond Towsely W E wtchmn W S Dickey Clay Mfg Co r Jettler House Tracy Berta smstrs r454 Bay Tracy Mattie Mrs smstrs Burden Smith & Co r Triple Hill Tracy Uriah D carp h206 Main (E M) Trail Richmond (Cofield) lab h8 Buckner al Travelers Aid Society Mrs Mattie Griffin Mrs W Gil- lon Mrs Mae Bowles Lula E Glass matrons Terminal Station TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg, Phone 214 Travey Clara (wid Mose) h218 Main (E M) Travick Byron J (Lottie) slsmgr r825 Orange Travis Adolphus (Cora) lab h604 (328) Charles (S M) Travis John W (Ida) lab hl21 Middle (V) Travis Patk T (Sarah) police city hl22 Cole Trawick Benton J (Lottie) slsmn Remington Type- writer Co r825 Orange Trawick Bessie (wid C Rogers) r3502 Houston av <1 O00 H XN-N 73 o H 73 X H W X > a co c po z o FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. I.. PORK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. 910 (1925) R. L. POLK & CO.'S Trawick Chas H (Sallie) elk J C Trawick h3502 Houston av Trawick Claud M (Lulu) bkpr Kinnett-Odom Co r20 Marion pi Trawick Edw F (Johnnie) butcher h39 Mellrose Trawick Frankie Indrs r207 Grants Trawick Geo V (Ruth) bkpr hl31 McKee Trawick John C (Hannah B) gro 115 Middle (V) r 3502 Houston av Trawick Maybell r3502 Houston av Trawick Robt (Mary) lab hll08 (4) Elbert Trawick Ruby (wid Wm R) rl23 Habersham av (L P) Trawick Wm A (Jessie) genl mgr Dixie Ice Cream Co h206 Fort Hill Trawick Wm L r3502 Houston av Trawick Wm L (Dollie) agt Bankers Health & Life Ins Co h39 Mellrose Trawick Wm M barber Forsyth rd (C P) r Reeves House Treadwell Homer E garage prop hlOO Fulton Treadwell J Edw towermn rlOO Fulton Treadwell Mittie (wid W T) r976 Walnut Treadwell Victor A (Clelie) slsmn Singer Sewing Ma- chine Co rl65 Magnolia Treat Agnes executive head Appleton Church Home r do Tree Sarah E sten J P Burnett r763 2d Treglown Nolan T (Pauline) yd cond h3024 Houston av Tremble Alice rl33 Ellis av Tremble Calvin (Willie B) baker hl33 Ellis av Tremble Cleosia baker rl33 Ellis av Tremble Edw chauf rl33 Ellis av Tremble Elmore mech rl33 Ellis av Tremont Temple Baptist Church 534 Cotton av Triangle Service Co C A Cheatham mgr auto sup- plies 501-507 Cotton av Tribble Frances r309 Georgia av Tribble Geo (Lula) undertaker h309 Georgia av Tribble Hattie student r309 Georgia av Tribble Roy mech r411 Winship Trice John J hlpr Plummers Creamery r315 Jenkins Trice Leola lab h4 Parker av Trimble Calvin T porter Barker Bakery rl33 5th ac E. ft. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS-TRACTORS hIffoarviet'asit.aFoFrodr,d woer PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 911 Trimble Clemmie lab Barker Bakery r333 Monroe Trimble Cleosie lab Barker Bakery rl33 5th av Trimble Justice T (Bertie I) inspr rl22 Rogers av Trinity C M E Church Rev J J Williams pastor 446 Tindall av Tripp Effie Mrs slswmn Jacob Areson rl922 Broad- way Tripp Joshua (Annie) lab h318 Patterson Tripp O C (Effie) barber rl922 Broadway Tripp Ruel E (Laura) wtchmn h33 Manchester qtrs Tripp Susie tchr r318 Patterson Trips Augustus (Mattie) lab h708 Clinton (E M) v TRIVERS CLOTHES STORE CORP, James J Nettles Jr Manager, Custom Made Clothes at a Reasonable Price 566 Cherry, Phone 5326 Tronce Fred photo (Metro Studio) r302, 855 Mulberry Troutman Annie maid r218 Bartlett Troutman Benj (Sarah) carp h218 Bartlett Truotman Bennie emp r218 Bartlett Troutman Connie (Annie) pntr h224 4th av (V) Troutman Eural lab r218 Bartlett Troutman Nellie cook r298 Craft la Troutman Thos J (Bessie) mach r221 Broadway Troutman Wm (Zeffie) lab r806 Fort Hill Troy Thos V (Edw) dist mgr Haven Villa Corp r257 High Truesdel B Rhett (Sallie C) elk Municipal Court h660 Napier av Truesdell Ella (wid Jacob) hl332 3d Truesdell Pearl rl332 3d Truman Annie slswmn Dannenberg Co r434 Ross Truman Dorothy H (wid Arth L) r434 Ross Truman Ida Mrs teller Luther Williams Bank & Tr' Co rl416 Oglethorpe Truman John A (Ida) bkpr rl416 Oglethorpe Truman Martha A (wid John) h434 Ross TRUST COMPANY OF GEORGIA (Bond Department), Marion H Liles Mgr, 404-5 Macon Natl Bank Bldg, Phone 568 TRY-ME BOTTLING CO (Peter Frank, Charles Peters), Soft Drink Mfrs 359 Cotton av, Phone 5061 (See left top lines and page 56) Tschudy Virginia (wid Mathias) r910 Walnut Tsistas Tony restr 218 Cotton av rll2 Academy The most comprehensive reference work on tne banks of the world Contains Condensed Statements of AH Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK i < More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. f &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 912 (1925) R. L. POLK & CO.'S Tuberville Mildred Mrs sorter Crescent Laundry Co r858 2d Tuck Jas lab h203 Colquitt Tucker Alberta rll57 Napier av Tucker Allen P (Louise) slsmn Dunlap Hwde Co hill Buckingham pi Tucker A E emp Cudahy Packing Co Tucker Benj M (Georgia) car repr hl38 Tenny Tucker Chas asst eng rl03 Montpelier av Tucker Chas shoe shiner r Boatmans la Tucker Chas B barber Edw Butler rl59 5th Tucker Chas O (Emma) police h505 Jackson Tucker Chas W (Sallie) foremn hll3 Stonewall pi (V) Tucker Danl lab Central Ry r326 Hammond Tucker DeWitt barber A J Brown rl08 Spring Tucker Edw (Vinie) carp h Industrial Home rd Tucker Edw (Susie) cook Terminal Hotel Cafe h931 (963) Ocmulgee Tucker Geo (Lois) carp h54 Craigs la Tucker Gordon truck driver r213V2 Elliott (E M) Tucker Grace waitress Union News Co Tucker Harry C bolt cutter r939 Columbus rd Tucker Helen nurse r24 Williams la Tucker Henry (Dellie) lab hl07 Long la Tucker Ida maid r714 3d av (V) Tucker Jack (Lizzie) hl28 Orchard av Tucker Jesse E lab r5 Randolph pi Tucker Jessie (wid John) rl05 Heard Tucker Joe M (Martha) hl03 Montpelier av Tucker John elk Terminal Hotel of Macon rl03 Mont- pelier av Tucker John H (Alma) cook rll48 Broad Tucker Jos T (Cordelia) slsmn Union Dry Goods Co r505 Jackson Tucker Lillie M rl03 Montpelier av Tucker Lizzie (wid Jas) hl019 Hazel Tucker Lula cook h914 Atlantic av (S M) Tucker Lula r314 Elm Tucker Mary r362 Ridge av Tucker Mary Lee dom r4 Harris row Tucker Pearson W r505 Jackson Tucker Ralph elk C H Hutchings & Sons r269 Madison Tucker Richd W carp rl019 Hazel Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartcCeoarpstya.lfoogr aclolRnkt.ianLind.ssPomOfLuAcKhut&ovmaClouOba.i,blelDeELdTisaytttsaO..ITOA, nMsrkInCfeHowr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 913 Tucker Robt P rll57 Napier av Tucker Rubye nurse Macon Hosp Tucker Willene nurse Middle Ga Sanatorium r same Tucker Wm I (Carrie; T & T Sausage Co) h R P D 3 Tucker Wm W slsmn Villa Haven Corp rl38 Tenny Tucker Willie Indrs h262 Division St la Tuff Benj (Mollie) h486 Chestnut Tuff Ike (Emma) lab h rear 368 Flanders (E M) Tuff Jackson (Amanda) firemn h706 Clinton (E M) Tuff John lab r486 Chestnut Tuff Rebecca cook r rear 118 Summit av (N H) Tuff Wm (Bertha) lab hl52 Broad (E M) Tuff Thos lab h242 Church la Tuggle Wm E r304 Broad (E M) Tuker Willie K dom r54 Craigs la Tukes Annie Indrs r200 Astor (E M) Tumor Amanda Indrs h537 Henrietta Tunison Geo A (Mary) eng h2923 Houston av Tupman Eva S instr Macon Hosp Turk Augustus G evangelist h911 Orange Turk Dexter (Ethel) cook YWCA hl236 Broadway Turk Gussie opr The Wm Carter Co rl022 Hazel Turk Maria Indrs r625 Gresham la Turk John (Mattie) kiln firemn h707 (205) Colquitt Turk Maria indrs r625 Gresham la Turk Wm C (Polly) mach hl022 Hazel s uilington Carrie Mrs slsldy Lees Dept Store rl49 Magnolia Turlington Edw slsmn rl49 Magnolia Turlington Edwin M elk J B Riley Drug Co rl49 Mag- nolia Turlington Mildred sten rl49 Magnolia Turlington Walter C (Carrie) sheriff Municipal Court hl49 Magnolia Turlington Wm T (Mary) pres-genl mgr Ideal Sup- ply Co hl29 Rembert av Turner Alice L (wid Allen W) r864 Mulberry Turner Annie maid rl09 Empire av Turner Augustus R r3002 Houston av Turner Chas C (Rosalee) printer h900 Main Turner Chas E (Louise) hl34 Academy Turner Chas H proofrdr r900 Main Turner Chas H Mrs slswmn J P Allen & Co rll31 Col- lege FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO I HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIM 914 (1925) R. L. POLK & CO.'S as a Turner Clarence (Flossie) mech h27 Hill Park av Turner Collie r8 Woodliff MMEI Turner Crafford (Kate) lab h203 Yates al (B M) Turner Della lndrs h3 (2) Spring la PUCE THE DIRECTORY Turner Dottie (Lucille) lab hl09 Empire av Turner Edith janitress Federal bldg h225 Grant Turner Edw carp r320 Ward (V) Turner Eoline (wid J L) h222 Belmont av Turner Geo H (Mary) dept mgr Dannenberg Co r281 Orange Turner Hanna h508 Campbell av IS THE Turner Harris (Lucile) lab h527 Grant Chapel al Turner Harry E (Ida M) drugs 115 Napier av h224 GREATEST MARKET PLACE Belmont av Turner Hattie Mrs opr r569 Hawthorne x Turner Henry (Josie) carp h403 Ward (V) Turner Henry (Mary) farmer h200 Palace av Turner H Lee miller r554 1st Turner Ida cook rl09 Empire av IN THE Turner Jacob shoe repr 508 Cherry r Phoenix Hotel Turner Jas carp r320 Ward (V) WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had i- * Turner Jas B oil inspr h207 Corbin av Turner Jas W (Willie) wtchmn ice plant hl314 Broadway Turner Jeffie carp r331 Clinton Turner Jessie cook hl40 Linden av Turner John (Katie) plstr h324 2d av (V) Turner John presser rl012 Ocmulgee Turner John H N (Neomi) presiding elder h219 Elli- ott (E M) Turner John L (Lucile) express messenger hl28 Log Cabin dr Turner John W (Ella) landscape gdnr h264 Main The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year (E M) Turner Jos (Bettie) driver h213 Elizabeth Turner Jos (Mary) ship elk h225 Calhoun Turner Joshua lab h520 Northern Turner Julian (Maud) presser h295 Gunn's al (V) Turner Julian H (Reba L) bkpr Kingman & Everett hl09 9th av Turner Julious (Maude) Pressing Club hl012 Ocmulgee Turner Julius pdlr r610 Clinton (E M) PUBLISHERS Turner J D (Alice H) r519 Pine PolkltaectaryEffl iDETKOIl f MICH- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656'/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 915 sr Turner Laura maid Cherry Turner Lawrence (Anna) lab hl37 Bay Turner Lola opr Sou Bell Tel Co r758 Cherry Turner Lula (wid Hiram M) hl309 Broadway Turner L Harris slsmn Dannenberg Co r281 Orange Turner Mamie (wid Augustus R) h3002 Houston av Turner Mamie maid r8 Woodliff Turner Mary cook r433 Forest av (V) Turner Mattie h423 Elbert Turner Mattie tchr r219 Elliott (E M) Turner Milton A (Clara) carp h320 Ward (V) Turner Mittie Q (wid J W) h619 Forsyth Turner Mose (Elnora) carp h Log Cabin Hgts Turner Napoleon (Ruby) plstr r324 2d av (V) Turner Ollie Mae pupil nurse Oglethorpe Private Infirmary r204 Tatnall Turner Ophelia lndrs r643 Elm al Turner Oscar C (Ida A) bkpr Merritt Coal & Wood Co h858 2d Turner Perry lab r508 Campbell av Turner Phillip (Lula) blksmith h4 Short St la (EM) Turner Ralph elk Fourth Natl Bank r Columbus rd Turner Raymond elk r659 2d Turner Reba L Mrs elk Luther Williams Bank & Tr Co rl09 9th av Turner Rebecca cashr J Turner r963 Cherry Turner Rebecca maid h221 Jordans al Turner Robt (Mary) carp r331 Clinton Turner Robt lab r304 (159) Peacock Turner Ruby r441 Craft la Turner Russel elk Georgia Grocery Store r215 Log Cabin dr Turner Russell L mach r3002 Houston av Turner Sally lndrs h6 Ford al Turner Sami (Ruby) lab h.4 Harris row Turner Shadrick elk Day's rl, 163 Spring Turner Sheppard (Eva) lab h801 (139) Maynard Turner Solomon lab r304 (159) Peacock Turner Susie h8 Woodliff Turner Tabernacle A M E Church cor 3d and Haw- thorne Rev Calvin Johnson pastor Turner Thealf J clo prsr rl40 Linden av Turner Thelma student r900 Main Turner Therman A (Ester) flagmn r405 Cleveland Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 916 (1925) R. L. POLK & CO.'S POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers Turner Thos E jr elk Fourth Natl Bank r Columbus rd Turner Troy C eng r560 Plum Turner Tullie C (Orca) truck driver h.104 Enterprise Turner T E miller Birdsey Flour Mills r770 Poplar Turner T Edwin (Irma) ship elk Roughton-Hallibur- ton Co h3811 Houston av TURNER T RADFORD (Helen), Pres Bibb National Bank of Macon hBOO Hardeman av, Phone 245 Turner Vernon H (Turner & Lyles) h Vidalia Ga Turner Walace (Mattie) lab rl006 Main Turner Warren S (Ora) pntr hi Spring St apts Turner Wm ball player r246 Main Turner Wm (Martha) carp h203 Lynwood av Turner Wm hlpr P B Yates Mach Co Turner Wm (Geneiva) mach h409y2 E 1st Turner Wm F (Cora B) horticulturist h430 Washing- ton av Turner Wm N (Brotherhood Press) r219 Elliott (E M) Turner Wm N (Ella) porter h907 Clinton rd Turner Willie rl015 Oglethorpe Turner & Lyles (V H Turner B F Lyles) restr 554 Mulberry Turpin Annie P tchr r376 Orange Turpin Virginia r376 Orange TURPIN WALTER H, V-Pres Hatcher-Turpin Co, r Hotel Dempsey Turpin Wm C (Eliz) v-pres Georgia Baking Co h37b Orange Turpin Wm C jr (Edith; Turpin & Lane) hl31 Hines ter Turpin & Lane (Wm C Turpin jr, V McKibben Lane) lawyers 5-6-7-8 Monica ct Turrentine Danl C (Sarah E) carp h607 2d Turrentine Jas (Reba) lab h66 Plummer's al Turrentine Jas H mgr r607 2d Tuten Jas G (Mae) r245 Bond Tuten John J (Ollie K) ship elk Willingham Sash & Door Co hl53 New Tutt Jeff W (Freda) slsmgr h316 Cherokee av Tyler Bettie mgr Hephzibah Orphanage h296 Bel- mont av . ... Tyler Cullen slsmn Maxwell Bros & Bridgers r7 Hui Park av .... 536 S. Clark St. Chicago, FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MACON CITY DIRECTORY (1925) 917 Tyler Curtis flagmn r7 Hill Park av Tyler Faith elk McLellans Store Co rll3 Log Cabin di Tyler Jeff lab r22 Williams la Tyler Martin P (Leila M) h321 Ross Tyler Mollie r296 Belmont av Tyler Paul E mach rll3 Log Cabin dr Tyler Sallie h815 Edgewood av Tyler Wm H (Chattie) carp rll3 (6) Log Cabin dr Tyner Benj H (Beulah) police hl27 Fort Hill Tyner Chester D (Vada) mech C P Bethea hl41 Academy Tyner Clark M (Frances) hl308 3d Tyner Estelle sten rlOO Highland av (N H) Tyner Eug appr rl308 3d Tyner Fleming L (Annie) carp h520 (552) Ogle- thorpe TYNER HERMAN 0 (Eloise(, Special Agt Equitable Life Assurance Society of the U S( rl020 Clinton rd, Phone 4407 OVERLAND FRANKLIN YATES MOTOR CO. WILLYS-KNIGHT 707 THIRD ST. PHONE 1446 AUTOMOBILES Tyner Jas (Phillie) lab h628 Division Tyner J Felton ship elk J P Allen & Co rlOO Highland av N H Tyner Lester student rl308 3d Tyner Martha elk rll3 Ponce de Leon av Tyner Mary bkpr T W Holt r761 Mulberry Tyner Myrtle r761 Mulberry Tyner Oneita sten rlOO Highland av (N H) Tyner Paul E teller Cit & Sou Bank rlOO Highland av (N H) Tyner Richd (Mary) lab hl61 Wings Hill Tyner Richd J mech C W Stroberg rlOO Highland av Tyner Wm E (Addie) mech C W Stroberg hlOO Highland av (N H) Tyrone Hall 1354 (354) Edgewood av Tyrus Andrew H pastor C M E Church r500 Maynard Tyson Frank (Ruby) lab h780 Reynolds al Tyson Jas (Lilly) lab rl409 Broadway A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 M8 (1925) R. L. POLK & CO.'S Tyson Joe (Hattie) lab h263 Bookers al Tyson Leroy (Effie) cabtmkr h618 Main (E M) Tyson R L cabtmkr Macon Lumber & Mfg Co Tyson Sallie E (wid Wm) h319 Walnut Tyson T Harris law student Martin & Martin r Sher- wood Hall Tyson Walter (Eliz) r319 Walnut Tyson Wm (Sarah) driver Burney Bros Co rl51 E Academy Tysson Edw (Candis) lab hl216 3d Tzimka Eftimios G restr 305 Broadway rl57 3d U-DRIVE-IT-S1STEM, L B Prince Mgr, Rent a Car lor Business or Pleasure and Drive It Yourself 409 Mulberry, Phone 281 (See page 50) U-EAT-A LUNCH CORP, Nicholas Christophulos Pres, Louis S Belos (Miami) V-Pres, Charles Andru Sec-Treas, "A Good Place to East" 555 Cherry, Phone 2387 Ullman Emanuel (Floretta) hl306 Vineville av (V) Ulsery Geo (Mollie) carp h341 Clinton Underwood Collins rl71 Long la Underwood Corinne maid Hotel Lanier rll7 Davis Underwood Drucilla mach opr r20 (14) Randolph pi Underwood Eliz (wid H Frank) h505 Duncan av Underwood Emma cook rl68 Astor (E M) Underwood Fannie h20 (14) Randolph pi Underwood Leila Indrs r rear 368 Flanders (E M) Underwood Lizzie (wid Frank) h505 Duncan av Underwood Mary Indrs h6 Plant al Underwood Robt W (Pearl) lardmkr h310 Telfair Underwood Sallie cook r2 Polk la (H H) Underwood Typewriter Co C D Burdette mgr 107 Ga Casualty bldg Underwood Wilbur H (Eliz) trav slsmn h217 Buford pi (V) Underwood Wm H (Lila) slsmgr h3 Forsyth ter Underwood Wm H jr student r3 Forsyth ter Underwood W O elk r Y M C A Union Baptist Church Rev Wm Goolsby pastor 330 E 2d (E M) Union Bargain Store (Sami Gordon) 514-16 Poplar UNION CENTRAL LIFE INSURANCE CO, T S Lowry Jr Manager, 901-2 Georgia Casualty Bldg, Phone < 258 s natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 919 UNION DEI GOODS CO, J T Killen Pres, D S Wagnon Sec-Treas, Dry Goods, Ladies' Ready-toWear Garments, Curtains, Rugs, Etc 417-421 Cherry, Phone Private Branch Exchange 4761 Union Furniture Co S L Becker mgr 510 Poplar Union News Co C L Norris mgr 361 5th restr Ter- minal Station Union Tony (Mary) fruits 771 Broadway h771^ do Union Trading Co C P Worley mgr 422i/2 Mulberry Unionville Baptist Church Rev Ashley Neville pastor Pio Nono av se cor Cherry Unionville Cemetery (col'd) Pio Nono sw cor Cherry (U) Unionville School Bliz J Disroon prin Straight sw cor May av UNITED AMERICAN LIFE INSURANCE CO, M E Elliott Pres, J N White Sec-Treas, 201-205 Georgia Casualty Bldg, Phone 1626 (See page 71) United Auto Co N R Howard mgr 860 Broadway United Barber Supply Co (Isadore Horovitz) 551 Broadway "More Goods are Bought and Sold Through the Classified Business United Credit Corp Wm Herman pres Jerome Herman sec-treas loans 404 Bibb bldg United States Army Recruiting Station Sergt W M Cain in charge 6 Jaques bldg United States Collector of Income Tax A A Cook div chf 246 Federal bldg United States Commission W E Martin 234 Federal bldg United States District Attorney F G Boatwright 324325 and 335 Federal bldg United States District Court Hon W H Barrett judge 236 Federal bldg Lists of the Directory Than Any Other Medium United States District Court Clerk L M Erwin 228 and 244 Federal bldg . On United States Government Building Mulberry cor 3d United States Insecticide Bureau F B McAuliffe inspr r608 Grand bldg Earth" United States Internal Revenue (Auditing Dept) W M Brown agt 4th fl Federal bldg United States Internal Revenue Service A A Cook div chf 246 Federal bldg UNITED STATES MARSHAL, G B McLeod 381-333 Federal Bldg, Phone 1024 Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO.. DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 920 (1925) R. L. POLK & CO.'S UNITED STATES MERCHANTS AND SHIPPERS^ Morris Harris Agt, 210-212 Bibb Bldg, Phone 181 UNITED STATES MORTGAGE & TRUST CO, S E Patton Rep, 565 Mulberry, Phone 1561-1562 United States Petit and Grand Jury Rooms 231-34 Federal bldg UNITED STATES POST OFFICE, J H Bailey Postmaster, Mulberry ne cor 3d United States Post Office Inspector H H Hudson 334 Federal bldg United States Referee in Bankruptcy J N Talley referee 303 Grand bldg United States Veterans Bureau J W Butler subregional mgr 506-7 Grand bldg United States Weather Bureau Harry Raynes observer 328 Federal bldg Upchurch Jas O rllO Enterprise Upchurch Lee A. (Rosa) carp Cent Mfg Co hl39 Daly Upton Barney H mach r667 Mulberry Urquhart Julius F (Sanela) lawyer 14-15 Hardeman bldg hll4 Log Cabin dr Urquhart J Louis slsmn Burden Smith & Co r756 Mul- berry Urquhart Leonard r617 Plum Used Car Clearing House Lon B Moore mgr 448 Ogle- thorpe Usher Benj lab h432 (732) Bowman Ussery Alphonso (Belle) newshitch h864 Elm Ussery Clarence (Menthia) brick mason r864 Elm Ussery Emelia (wid John) h458 Ocmulgee Ussery Ewell N (Lillie) mgr Bibb Brokerage Co h506 Ridge av Ussery Grover C (Mattie L) collr Burtons Inc hllO Calhoun Ussery John lab rl20 Curds al Ussery Jordan (Kate) lab hl20 Curds al Ussery Jos baker Am Bakeries Co rl20 Curds la Ussery Julius driver Macon Flour & Feed Co Ussery Mattie (wid Geo) rl028 2d Usury Lena cook Hotel Lanier r442 New Usury Mason lab r421 Oak Usury Mattie smstrs r421 Oak Utley Leroy J (Edna) photogr D A Warlick & Son h 230 Tatnall L POIK Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 921 Vail Vernon A (Laura) purch agt h Osborne pi (I) Vail Vernon A J student r V A Vail Osborne pi (I) Vailes Holsie (Carrie B) lab hi55% Broad (EM) Vaison Hilda lndrs h648 (1270) Elbert Valentine E Henry (Belle R) dentist 401 Bibb bldg h Overlook av (I) nr cor Albermarle pi Valentine Magie h24 Holt av (NH) Valentine Wm lab hl47 New st la Vallette Wm H (Nettie) chf detectives Police Dept h 401 Ft Hill VanBuren Bayard M (Evelyn) lumber h214 Hines ter (V) VanBuren Jas R slsmn Jones Motor Co r560 Plum VanBuren Ronald E (Hulda) mgr National Biscuit Co r692 Ridge av Vance Oscar F (Eliz) traveling slsmn h218 North av (NH) Vandegriff Edwin H rll8 Forsyth Vanderchys C J slsmn Macon Telegraph r220 1st Trucks and Auto Repairing Authorized for White Motor Trucks N. E. PACE 657-659 THIRD ST. PHONE 4846 Vandigriff C R linemn W U Tel Co r623 Walnut VanDine Danl D (Nellie) mach h708 Oak Vandiver Eliza A (wid Danl M) hl22 Napier av Vandiver Escar tchr rl22 Napier av Vandiver Owens P (Effie) mach h Ayers blvd (Belle- vue) Vandiver Roy (Ida) rl51 2d Vandiver S Homer elk rl22 Napier av Vandiver Wm J (Bertha B) train dispr rl06 English av Vandoran Chas (Susie) wtchmn h2 Polk la (HH) VanEvera Arch K (Annie) eng h260 Winship VanHoose School of Music Mrs E V H Glover prin 525 College VanHouten E Wells student r531 Boulevard (NH) VanLandingham Clyde H (VanLandingham & Hada- way) r345 S College VanLandingham Frances r207 Rogers av FOR. LISTS OF NAMES * ANY TRADE -- ANY BUSINESS . . -- ANY PROFESSION JOETROIT R. L. POLK & CO. CHICAGO 2 P 05 r & v> ^2 in = . r 2 BARRON & REAGAN A& TAX SPECIALISTS AND ADVISERS BB REALTY BLDG. ^ RetUrnS G!vCn SPT-EiLaEl PAHtOteNntEion213 O925) R- L. POLK & CO.'S VanLandingham Herman baker r345 S College Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet VanmarfirSliam Wm R (Bertha) elk h257 HardeVA1V LANDINGHAM & HADAWAY (C H YanLand- sSwi'h L ^adin';ay Jr)' Soda> Cigars, Candies, Phone 92^1* Superior oda 304 Cherry, JaTMAi;ch M (Ella) pntr hl'322 Broadway VAJVjV CYAN P (Mary; Pres Consolidated Natl De- tective Agency), h800 Cherry ann Harrison porter Chapman's Pharmacy r417 E JLSl Vann Jas O (Corinne N) asst ticket agt Terminal Ticket Office h465 Orange Vann Lawrence pntr rl322 Broadway Vann Lillie Indrs r478 Chestnut Vann Mary opr The Wm Carter Co rl703 2d Vann Minerva (wid Jeff) h417 E 1st (EM) Vann Pauline r478 Chestnut "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH If your rims are not a healthy pink, cStluigShLtaprKrovoecaa'ts)i;Kon'-, TIfHEthYeyAbRlEeedUNonSuHeaEeiAlyLyoTu. Hr YdFeo.nrTtishsatilseAiaNstDayoUduaSrnEgDePrruYgsOiggRinsAta'lLs. Vann R E r555 2d Vannover Viola r779 Nussbaum Vano President (Pearl) lab h316 Plummer's al VanSant C R (Sarah T) mgr Cable Piano Co VanZandt Helen pupil nurse Oglethorpe Private In- firmary r204 Tatnall Varn Andrew D (Luly) eng h807 Pine Varn Rose student r807 Pine Varn Sarah student r807 Pine Varnadoe Jos O (Belle) firemn h965 Oglethorpe Varnell Edw D (Ada) carp r716 Main Varner Harvey h Industrial Home rd Varner Lillie dom h Lawton rd Varner Lillie pdlr h411 May av Vaugh Lucius student rll8 (8) Log Cabin dr Vaughan Geo (Edith) mech r328 Hydrola Vaughn Bessie student rll8 (8) Log Cabin dr Vaughn Chas (Ruth) brklyr h268 Willingham R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Vincent 613-618 a ENGLAND Tj* THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 923 CtoO o iaftn Vaughn Darwin T (Lillian) slsmn Lettice & Goodwin a* Co r608 Forsyth Vaughn Effie Indrs h301 (201) Smith (EM) tenr ft Vaughn Esolene slsldy S H Kress & Co r303 Church (5. Vaughn Fred (Ella) lab rl'64 Cedar (U) Vaughn Geo (Emma L) section formn h5 Bibb av Vaughn Guy L (Lillian) trav slsmn r615 Spring Vaughn Hershey J (Bessie) elk h452 Cherry av Vaughn Jas M (Pearl) linemn h Log Cabin dr Vaughn Jas R (Mamie) chauf h303 Church (EM) Vaughn John (Pearl) lab h213 Patterson Vaughn Lucille sten O P Beall r303 Church Vaughn Mattie h713 Ash Vaughn Mattie cook r232 Fargason Vaughn Minter (Pearl) lab h310 Womack Vaughn Rhoda Indrs r598 Norris > Vaughn Robt (Mattie) lab h228 (232) Fargason Vaughn Wm (Emma) lab r431 (129) Cowan m 73 Vaughn Wm J (Lizzie) mill hd h31 Bibb av MACON On Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS z tn O r Vaughner Israel carp r222 Lynwood av Vaughner Lucious carp rl236 Napier av 0 H Vaughner Mary hl236 Napier av Vaughner Millie cook h222 Lynwood av 1in Veal Billy elk rl4, 476 College Veal Carrie Indrs r608 Division Veal Forest W (Mary) pipeftr hl24 1st Veal Gaynor C (Mattie L) mach rl24 1st Veal Jas (Mazie) swtchmn r619 Hazel Veal Marcus (Belle) lab h408 E 2d (E M) Veal Mattie wid J D Alley rl63 Bay Veal Otis (Theresa) trucker h45.1' E Academy (EM) Veal Thos (Maggie) porter h360 Elm Veal Wm slsmn Union Dry Goods Co rl3, 476 Col- lege Veale Carrie cook r349 Hawthorne Veale Lena H (wid Jas E) h317 American blvd Veale Lula r404 (206) Henderson Hft. oSIT" O Telephone 2687 J. T. MOLTON, Mgr., 348 Oak 7ft Canipelli G. J. MOLTON LUMBER COMPANY CO O Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK 924 (1925) R. L. POLK & CO.'S Veale Patsie r404 (206) Henderson Veazy Myra bkpr J W Collins r200 Ridge av Venable John J (Susie) hl701 Broadway Venson Patsie cook rll7 Jones st la Vernon Geo (Cordelia) lab r315 Division Vernon Richd B r757 Poplar Viavi Co Mrs Mattie E Parker mgr medicine mfrs 711 Bibb bldg Vickers Bonnie B r414 Oglethorpe Vickers Carlton H timekpr Sou Ry h Clisby Vickers Carrie lndrs h707 Maynard Vickers Edwin lab T & T Sausage Co R F D No 3 Vickers Herbert C r202 Clisby Vickers Robt R (Berta) prop Bert's Place Grocer Columbus rd h do Vickers Wm H (Jodie) formn h Grand av (Bellevue) Vickery Clifford E (Lemma) presser The Wardrobe Pressing Club r612 Hawthorne Vincent Frank T (Lula F) pres F T Vincent Realty Co hll4 Pierce av Vincent F T Realty Co F T Vincent pres 154 Cot- ton av Vincent Mamie sten Pearsons-Taft Co r461 Vineville av Vincent Margt r.1'14 Pierce av (V) Vincent Mattie Mrs h720 Plum Vincent Ned (Lucille) ins 154 Cotton av r207 Clisby Vincent Walter (Annie) lab rl803 2d Vineville Av Baptist Church Rev M A Wood pastor 415 Vineville av ne cor Pierce av Vineville Baptist Church Rev Wm M Phillips pastor 461 Chestnut Vineville Drug Co H E Burson mgr 599 (815) Vineville av Vineville Fish Co (Sami R Yeomans) 117 Hardeman av Vineville Improvement Co W E Harrold sec-treas real est 321-24 Macon Natl Bank bldg 1 Vineville King's Daughters Home Mrs Della Poole matron 207 Rogers av Vineville M E Church Rev Osgood F Cook pastor 221 Vineville av Vineville Packing Co J E Brady mgr 123 Harde- man av & CO. Polk Directory \ Bldg. Detroit, Mich. KENMORE BURNS In* Read Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vsj% on Savings 3 m CO . MACON CITY DIRECTORY (1925) 925 Vineville Presbyterian Church Rev McK R Long pastor 439 Vineville av (V) Viney Fred S (Mary) collr r758 Cherry Vineyard Carl B (Iva) mgr h258 Orange Vineyard Elsie millwkr rl39 Comer ter Vineyard J Jas millwkr rl39 Comer ter Vineyard Walter W (Fannie) millwkr hl39 Comer ter Vinie Jennie Indrs h223 North Vinson Oscar (Rosa) porter Roughton Halliburton Co rl02 Woolfolk (EM) Vinsen Richd (Kate) truck driver hl55 Broad (EM) Vinsin John H (Nettie) slsmn Coleman Meadows Pate Drug Co hl403 Vineville av (V) Vinson Anna (wid W D) r46T Vineville av Vinson Anna Indrs r506 Maynard Vinson Annie cook h.45 Railroad av Vinson A D Mrs matron Methodist Orphans Home r do SOUTH'S LEADING FLORISTS mS OTl IDLE HOUR NURSERIES IOM -oM Vinson Belle mach opr r390 (102) Lexington av Vinson Cornelia r305 (115) Roosevelt (V) Vinson Elijah L hlpr r2212 2d Vinson Eva nurse r435 North Vinson Frank (Mamie) lab hill Short la Vinson Geo W porter A L Glasco rl (101) Wise av (V) Vinson Hattie mach opr r390 (102) Lexington av Vinson Henry (Sarah) lab h390 (102) Lexington av Vinson H Pierson (Jessie) mach r228 Knott Vinson Jas (Lillie) lab h309 Campbell av r Vinson Jas D (Lila) cond h672 Oak Vinson Jas F wks Happ Bros r2212 2d Vinson John lab h229 Nussbaum Aft Vinson John W (Mattie) collr Union Trading Co h w (fl 2212 2d Vinson Jos farmer rl052 Fort Hill Vinson Leonard (Fannie) waiter h227 Green ,, ,FOR LISTS OF NAMES A< NiYt TRA. Dy-E*-- '* ANY, BUSINESSr <-- ANY PROFESSION DETROIT, R. L. POLK & CO. CHICAGO 5 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 926 (1925) R. L. POLK & CO.'S Vinson Lewis porter rl39 Jones Vinson Lewis appr Lyon Harris & Brooks r2217 2d Vinson Lucendy lndrs rl39 Jones Vinson Mamie lndrs h41 Massee la Vinson Mamie sten r3, 533-47 Orange Vinson Mary E lndrs r26 Malloy's al Vinson Mitchell (Dora) lab h208 Yates av Vinson Mitchel (Mary) lab h307 Norris Vinson M L Mrs slsldy Union Dry Goods Co h720 Plum Vinson Naomi r930 College Vinson Robt rl60 5th Vinson Wm delivery boy North Highland Gro rl55 Broad Vinson Willie M nurse r802 Spring Virgil Powers School Minnie C Robertson prin 1200 2d Virgil Wm (Rosa M) lab h313 Norris Virgil Wm (Emma) lab h421 (121) Ballard Virginia-Carolina Chemical Co R F Sams (Atlanta Ga) dist mgr fertilizers 71 mse cor Harris Virgle Sylvia h300 Elizabeth Vissage Jas E truck driver rl25 Curry pi Vissher Jannie rill Jones Voellinger Maria student r3602 Houston av VOIGHT A1VDREW W (Lula M), Sec-Treas Indepen. dent Laundry Co, r858 Cherry, Phone 4553 Volk Theo J (Mary) dept mgr Murphy Taylor & Ellis hl04 Rogers av Volkens Fred student r634 Montpelier av Volkens Henry W (Ida) gro h634 (626) Montpelier av Vollinger Willis E (Alberta) bakery prop h3602 Hous- ton av Volunteer Pharmacy C H Pritchard mgr 472 1st VonTobel Raymond G (Flora) prin Ballard Normal School h50 Forest av (V) Vowers Edw (Alma) blrmkr h210 Clara (EM) Vullo Michl elk Florida Fish & Oyster Co r318 Main Vullo Sami jr elk Florida Fish & Oyster Co r318 Main Vullo Sami (Katie) r318 Main Wachtel David (Adeline) clo 518 Cherry h420 For- syth 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON CITY DIRECTORY (1925) 927 Wachtel David jr elk David Wachtel r420 Forsyth Wacter Wm N (Mary) carp hl25 Curry pi Waddell Daisy (wid Wm W) tel opr Dempsey Hotel r727 Holt av Wade Albert M (Ruth) collr Jackson & Co rl23 2d Wade Arth (Minnie) mill opr h26 Shell av Wade Byrdie rl70 Laurel av (NH) Wade Carrie mill hd h28 Taylor av Wade Chas R (Virginia) slsmn Empire Products Co r322 Johnson av Wade Emmett millwkr r93-94 Green Wade Fredk H (Ethel) acct hll5 Gordon (SM) Wade Geo C (Minnie) overseer h26 Holt av (NH) Wade Gladys rl25 Cole Wade Harriett Mrs hllO Ayers rd Wade Harry W (Ella) bkpr h ws American blvd 3 n Grand Wade Harry W jr r H W Wade MACON OPTICAL COMPANY Frank H. Johnson . . Opticians A Optometrists 468 CHERRY '4 > PHONE 3213 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 Wade Harry W inspr rllO Ayers rd Wade Henry E (Mattie) carp hl34 Shell av Wade Irene (wid Moses T) hl'01 Hightower Wade Jack A student r207 Buford pi Wade Jesse hlpr r3 Shoals la Wade John (Lizzie) mill hd h29 Taylor av Wade Lillie M Indrs rlOl Plummer's al Wade Linwood W timekpr Sou Ry r H W Wade Wade Louise student r H W Wade Wade Marion P (Eliz) welder Wade & Co h ws Belve- dere dr cor Overbrook av Wade Mary Indrs h526 Moughon Wade Ola Indrs r819 Cedar (U) Wade Phelps (Sallie E; Wade & Co) h207 Buford Pi Wade Robt D elk Piggly-Wiggly r H W Wade Wade Robt M student rll5 Gordon (SM) Wade Ulysses P mach rllO Ayers rd Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE 10 ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 o Hog iw ^ a fcSosg: tag 928 (1925) R. L. POLK & CO.'S WADE & CO (C J Smith, Phelps Wade), Machine Shop and Welders, Exide Batteries 566 2d, Phone 1547-4236 Wadley Mary nurse Middle Ga Sanatorium Wadley Richd B (Rosalie; Plummer's Creamery) h 1641 Lamont Wadley Ulysses rl58 (228) Green Wadley Wm (Willa) chauf hl58` (228) Green Wadlow Lillie cook r518 Cedar Wadsworth Arth P (Emma) carp hl814 3d Wadsworth John A (Ella) h Vista cir Wadsworth John W starter Yellow IC'ab Co r906 Cherry Wadsworth Kate Mrs slsldy Dannenberg Co rl'008 Napier av Wadsworth Mary (wid Earl S) slsldy Union Dry Gds Co r630 Anderson Wadsworth Mary L smstrs rl814 3d Wadsworth Oscar (Mary) lab r457 Barrack al Wadsworth Sallie M smstrs rl814 3d Wages Eddie Mrs r462 Oak Wages John T (Blanche) slsmn J B Riley Drug Co h4, 307 Napier av Wages John T jr elk J B Riley Drug Co r4, 307 Napier av Wages Lee county coroner rl49 Laurel av (NH) Waggenstein Minnie r655 Oak Wagner Beverly P (Ida) sawmill opr r237 Carling av (HH) Wagner Eleanor student r237 Carling av (HH) Wagner Jos H (Marie) trav slsmn h321 1st Wagner Marguerite sten L R Newby rl29 Richmond Wagner R R asst eng r Y M C A Wagner Wm A (Sallie) sawyer hl29 Richmond Wagnon D Sidney (Esther), sec-treas Union Dry Gds Co hll39 Vineville av Wagnon Esther M rll39 Vineville av (V) Wagnon Lucien T (Ada) r202 Clayton Wagnon Wm C (Allie) cond h247 Williams Wainwright Benj F (Marie) genl mgr Fowler-Wain- wright Handle Co h Osborn pi (I) Wainwright Ethel mach opr rl02 (104) Randolph pi Wainwright Raymond (Ethel) mill hd h24 (20) Ran- dolph pi Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 929 Wainwright Roxie rl02 (104) Randolph pi Waite Colie adv mgr Burden Smith & Co rl96 Laurel av Waits Arth C (Ruth) formn Beeland-Conrad Motor Co r868 Elm Waits Bertha Mrs slsldy Union Dry Goods Co r860 New Waits Girley elk Jas Cassidy r555 2d Waits Grady (Bertha) auto mech h860 New Waits Jas E (Helen) trainmn Macon Ry & Light Co h219 Ell Waits John W (Annie) bge mstr r219 Ell Wald John (Nettie) baker h234 American blvd Walden Chas G (Sallie L) cond hl24 Highland av Walden John B (Rubye) mech r750 Pine Walden Mary dom r231 Turpin Walden Mary student rl24 Highland av Walden Narcissus (wid Wm) r821 Oak Walden Nettie rl22 Yates av (EM) Walden Roger L (Mary) firemn hl22 Yates av (E M) Waldorf J Sturgis (Bessie; J S Waldorf & Son) hll6 Ayers blvd Waldorf J S & Son (J S and W R Waldorf) grocers 659 Poplar Waldorf Mattie (wid Wm) r W A Waldorf Waldorf Sturgis W baker Barker Bakery r Wm A Waldorf Waldorf S Leila nurse r628 Orange Waldorf Wm A (Burdie E) mgr Standard Oil Co h Log Cabin Hts Waldorf Wm R (Annie T; J S Waldorf & Son) hl26 Highland av Waldron Cletia tchr rll5 Florence (SM) Waldron Julia (wid John H) hll5 Florence (SM) Waldron Millard F (Myrtice) carp hl46 Ells (SM) Waldrop Della Mrs ftr Burden Smith & Co r722 1st Walker Albert (Laurinda) lab h609 4th av (V) Walker Amanda r760 Ash Walker Anderson (Lula) lab hll2 4th av (V) Walker Anderson (Kefie) lab h3 Stewarts la Walker Arth J (Annie) shoe repr 123 Hardeman av h225 Middle (V) Walker Belle lndrs h714 3d av (V) FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L, POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Gan Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year R-LPoik&Go publishers PolkPirecbryE DETROIT 930 (1925) R. L. POLK & CO.'S Walker Benj (Anna) lab h441 Gilmer Walker Bessie cashr r909 Orange Walker Blake (Ida B) chauf h425 3d av (V) Walker Burton (Henrietta) lab h742 (730) 3d av (V) Walker B P (Cora) h70 Arlington pi Walker Calvin N agt Guaranty Life Ins Co rl22 Spring Walker Chas sawyer h221 Calhoun Walker Chas H phys 210-11-12 Grand bldg h374 Orange Walker Chas K lab rll5 Jones Walker Clara Mrs r Mrs C B Walker Walker Clara B (wid Sami) h ss Forsyth rd (V) 1 w Albemarle pi Walker Clifford (Gladys) bicycles 125 Cotton av h9 Glynn av Walker Clinton (Martha) lab h810 Edgewood av Walker Colton W (Julia) pdlr hlOl Long Walker Colton W jr del boy rlOl Long Walker Cora (Woman's Exchange) r70 Arlington Walker Cornelius h216 Middle (V) Walker Daisy nurse r8 Frank al Walker Danl (Josephine) chauf h320 Middle (V) Walker Danl W (Carrie) lab h255 4th av (V) Walker David A (Fannie) bkpr Empire Candy Co h 305 Hillyer av Walker Dock (Sallie) cotton sampler Williamson In- man & Co h503 Hazel Walker Duncan D (Helen) phys 622 Bibb bldg r547 Georgia av Walker Ed (Ida) lab h436 Hammond Walker Edd carp r9 Glynn av Walker Edw (Maggie) porter rl58 4th av (V) Walker Elijah (Maggie) lab rl206 Broadway Walker Eliz nurse h460 Ward (V) Walker Ellis lab r500 Shappell Walker Elmira smstrs r204 Mitchell Walker Emma Indrs r424 (24) Short (EM) Walker Emory (Lounie) lab r354 Ellis av Walker Estelle cook 318 Forsyth Walker Eudora (wid Jinks) h801 (400) Columbus rd Walker E L elk r Central City Hotel Walker Ford bell boy r354 Pine Walker Forest (Mae) rl22 Cole A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 ^CHERRYST. TELEPHONE 2391 MACON CITY DIRECTORY (1925) 931 Walker Prances r8 Frank al Walker Frances Indrs h468 Bay Walker Frank (Fannie) chauf hl61 Grant's Walker Frank lab h66 Schofield Walker Fred hlpr r410 Mitchell al Walker Fred porter rl46 Elizabeth (TF) Walker Geo (Mary) sten r667 Oak Walker Gus (Annie) lab h418 Gilmer Walker Gussie r801 (400) Columbus rd Walker Henrietta r66 Schofield Walker Henry A student rlll7 Ash Walker Homer J (Estelle) h330 Columbus Walker Horace D (Leila A) route agt Am Ry Exp Co r708 Napier av Walker Jas (Mary) car ph627 Division Walker Jas (Florence) lab hl620 Johnson's al Walker Jas (Annie) lab hl062 Ocmulgee Walker Jas lab r Pearl Burse Walker Jas (Mary) lab h!24 Waterville rd Royal Corona Typewriters SC0TT-PARKERC0. Bibb Realty Building 367 Broadway Tel. 1087 Dictaphones Mimeographs Supplies Service Walker Jas E (Emma) brick mason hll5 Jones Walker Jas E (Ruth) dentist 905 Ga Casualty bldg hl07 Buckingham pi Walker Jas T carp rl21 Garden Walker Janie dom hl234 Broadway Walker Jesse (Mollie) lab h204 Mitchell Walker Jessie presser rl68 2d av (V) Walker John house clnr hlOO Green Walker John C pres I Kessler Commission Co h667 Oak Walker John H chauf rl'21 Garden Walker John H (Ruth L) mgr Macon Cycle Co hl21 Garden Walker John L lab rll5 Jones Walker John T field rep U S Vet Bureau 506-7 Grand bldg Walker Jones (Annie) lab rllO Hazel Walker Jos (Annie) lab r205 Toombs (SM) s* I DAYS I PYLE I JLATTL A I CREDI1 406 THIRD ST. TEL. 3026 R SCREENS DOORS SASH, Central Sash & Door Co. 9% ? s rf fZS (2P rs&o More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. yj o oz OS P * ^ H o C/5 Hcwo < S 5 CO B 32 <0 JOOOh co W0ZQ5 co < < 00 >-j [K QS< Oh < a 932 (1925) R. L. POLK & CO.'S Walker Jos (Clifford) lab hl420 Broadway Walker Jos (Susie A) carp h23 (523) Clayton Walker Julia lndrs h4 Stewarts la Walker Julia student rl61 Grants Walker J Clay (Annie L) tchr Mercer University h 704 Napier av Walker Kath student r750 2d Walker Katie sten rl College Hill apts Walker Laura (wid Lafayette) rl59 Jeff Davis Walker Lee (Florence) lab r95 Woodliff Walker Lenjanna maid r354 Pine Walker Lewis (Mabel) lab rlOl Pio Nono av WALKER LEWIS A (Mae D), Pres Macon Cigar & Tobacco Co, Ii336 Napier av Walker Lillie r240 Roye Walker Lillie lndrs r219 Hazel Walker Lola maid r578 Monroe Walker Luellen rlll7 Ash Walker Lula r760 Ash Walker L L slsmn r Y M C A Walker Mabel cook hll2 Moore la Walker Mae opr Sou Bell Tel Co rl22 Cole Walker Maggie cook hl2 Orchard av Walker Marie r510 Orange Walker Mary lndrs r424 Long Walker Mattie cook rlOl Long Walker Mattie dom r Wm Walker Walker Mattie lndrs r204 Mitchell Walker Moses (Mary) driver h515 Coleman al Walker Obie lab r418 Gilmer Walker Quince lab hll8 4th av (V) Walker Pomp (Mary) pipeftr h456 (133) Mutual av Walker Pritchett rl'15 Jones Walker Renfroe L elk Peeler Hardware Co r 106 Lamar Walker Robt (Alberta) lab h241 Jackson Walker Robt (Fannie) plstr hl61 Grants Walker Robt (Sarah) plmbr hl21 New Walker Robt A asst mgr Bibb Brokerage Co r803 Pine Walker Robt L (Alice) gro 1119 Ash hlll7 do Walker Robt L music tchr 506 Orange h do Walker Ruth W Mrs woman's editor Macon Telegraph rl07 Buckingham pi Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 933 Walker Sallie Indrs r505 Port Hill Walker Sami A gro 460 Clinton (EM) r do Walker Selestene rll5 Jones Walker Sol (Annie) lab hl02 Elliott (EM) Walker Stella rlOl Long Walker Steven student rl22 Cole Walker Tiros r862 3d Walker Thos (Mattie) house mover r610 Mitchell (500) Walker Thos lab r801 (400) Columbus rd Walker Thos (Caroline) lab hll Stripling al Walker Thos D (Margt T) phys 411-13 Ga Casualty bldg h253 Boulevard av (NH) Walker Walter (Carrie) lab h454 Coles al Walker Watson (Annie) civ eng h215 Carling av (HH) Walker Wm (Rosabell) h702 (789) Crisp Walker Wm bkpr Carstarphen Whse Co r518 Pine YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES 317-319 Third St Walker Wm (Mary) lab h219 Hazel Wailker Wm lab h Industrial Home rd Walker Wm lab rll5 Jones Walker Wm (Cullie M) pdlr r856 Hazel Walker Wm soft drinks 123 Nussbaum h do Walker Wm B slsmn S R Jaques & Tinsley Co Walker Wm F (Minnie L) slsmn Dannenberg Co h 1525 3d Walker Willie cook r329 Frank al Walker Wilson (Susie) lab hl54 Hill Walker Winston (Avery) cement fnshr hl37 Roose- velt (V) Wall Alonzo rl04 Latta pi WALL BRAD INC, J B Wall Pres, Auto Supplies 369 Cotton av, Phone 757 Wall Don C eng r560 Plum Wall Geo (Frances) lab h8 Gunns al (V) Wall Harris C plmbr Durward Davis h454 Broad (EM) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO NORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 9S4 (1925) R. L. POLK & CO.'S Wall Jos A (Sarah) cond hl04 Latta pi Wall J Brad (Zeta) pres Brad Wall Inc hl42 Pierce av Wall Mattie r236 Elliott (EM) Wall Maude matron Methodist Orphans Home r do Wall Penelope (wid John) hl29 Pierce av (V) Wall Wm agt Metropolitan Insurance Co r742 Wal- nut Wallace see also Wallis Wallace Alda r3710 Houston av Wallace Anne C tchr Wesleyan College r520 Col- lege Wallace Bailey (Edna) mill opr 22-24 Shell av Wallace Benj E elk W U Tel Co r227 Chappell Wallace Celia maid h263 Booker's al Wallace David C (Loreana) slsmn Bateman-Freemau Co h227 Chappell Wallace Elise r37 Arlington pi Wallace Eug elk r227 Chappell Wallace Gussie cook h218 Jones Wallace Harriett h921 Ocmulgee la Wallace Helen rl24 Buford pi Wallace Henry (Lena) hlpr hl23 4th av (V) Wallace Inez r3710 Houston av Wallace John B agt Fidelity Mut Life Insurance Co r Mercer University Wallace John L (Effie) grading contr h3710 Hous- ton av Wallace Leila h865 Edgewood av Wallace Mary lndrs r310 Coles al Wallace Milton K (Wallace & Wallace) rl24 Buford Pi Wallace Morris (Lula) lab h425 Elliott (EM) Wallace Otis B (Bennie M) cranemn hlOO Park av Wallace Robt E (Bessie) eng h817 Mulberry Wallace Ruben (Barbra lab h209 Madison Wallace Thos A (Eliz; Wallace & Wallace) hl24 Bu- ford pi Wallace Wm W cond rl55 Broadway WALLACE & WALLACE (Thomas A and Milton K Wallace), Attorneys-at-Law 511-512 Grand Bldg, Phone 2431 Wallenstein Stanley (Debia) trav slsmn h324 Hill Crest av A# natural by-product of the Directory business is die compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit Macon Transfer & Storage Company HEAVY HAULING MOVING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second S MACON CITY DIRECTORY (1925) Waller Aldine lab hlOO Hazel Waller Alonzo (Fannie) cha'uf r436 Monroe Waller Anthony (Hattie) lab hl60 (15) Glen Waller Benj I (Carrie) eng hl518 Broadway Waller Benj I jr acct rl518 Broadway Waller Brendie W (Ella) mill hd h4 Bibb av Waller Callie Mrs h808 3d Waller Danl (Viola) porter rl53 Green Waller Ella F (wid Jas T) r717 1st Waller G H sec Order Railway Conductors r408 Pop- lar Waller Jennie janitress Roughton-Halliburton Co Waller Jos D elk Atlantic & Pacific Tea Co r809 Cherry Waller J Kelly (Belle) mill wkr Dixie Rol & Cot Co r623 Main (EM) Waller Minnie L rl518 Broadway Waller Nettie lndrs rl55 Chestney Waller Oscar (Lizzie) lab h436 Lawton av Waller Oscar L acct rl518 Broadway Waller Owen cook h539 E (EM) Waller Sarah nurse h313 (327) 1st av (V) Wallis John ebauf r257 4th av (V) WALLIS ROY R (Lila), Business Mgr Macon News and V-Pres Macon News Printing Co, hll2 Boulevard av, Phone 1409-J Walls Homer H (Ora) pntr hl005 Walnut \ Walls Jas H mech r559 Siam Walls Julia r229 Jones Walls Maude student rl005 Walnut Walls Sami (Phillis) brklyr h810 Ocmulgee Walls Violet sten Macon Woolen Mills rl005 Walnut Walls Wm C (Cynthia) car repr h2344 2d Walls Wm L (Grace) baker r2344 2d Walters Ella J supvr Macon Hospital Walters Frank F (Eliz) car repr h630 Anderson Walters Freddah (wid Henry) h453 Hazel Walters Henry W appr Taylor Iron Works & Supply Co r630 Anderson Walters L B agt Natl Life & Accident Insurance Co r759 Cherry Walters Marie r403 Franklin (SM) Walters Pinkie dom h803 (126) Charles (SM) Walters Rolin O lab r403 Franklin (SM) STORAGE FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO 1 "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 936 (1925) R. L. POLK & CO.'S Walters Sarah rll8 Inverness av Walters Thos L (Kate) formn hl'18 Inverness av Walters Winnie Indrs h219 Dannenberg av Walthall Anne student r841 Courtland av Walthall Edw L (Laura) hlr inspr h301 Johnson av Walthall Everett auto mech r505 Hillyer av Walthall Frank W (Eula) dept mgr Dunlap Huckabee Auto Co h841 Courtland av Walthall Fred auto mech r505 Hillyer av Walthall Lula M sten r505 Hillyer av Walthall Margt student r301 Johnson av Walthall Walter student r505 Hillyer av Walthall Wilbur student r505 Hillyer av Walthall Wm mech r505 Hillyer av Walthall Wm W (Lula) contr h505 Hillyer av Walton Blanche cook r649 Elm al Walton Caroline r614 Ross Walton Carolyn (wid Berk) r614 Ross Walton Clinton B (Maggie) ins agt r420 Winship Walton Danl (Annie L) auto mech hlOl Crump's Pk av (CP) Walton Enoch S (Hattie N) slsmn Philip Barnett h 534 Lindon av Walton Ernest C (Aline) meat ctr Kash & Karry Mkt h250 Jeff Davis Walton Ethel Indrs r701 Hammond Walton Frances r265 Hill Crest av Walton Geo lab r9 Orchard av Walton Harry (Odessa) hi Ross st pi Walton Henry C (Josephine) contr h559 Broad Walton Herbert student r265 Hill Crest av Walton Jas r604 4th av (U) Walton Jas S slsmn The J W Burke Co r265 Hill Crest av Walton Jas T (Libbie) sheet metalwkr hl58 Crisp Walton Jesse mech r869 Walnut Walton John lab r356 (355) Spring la Walton Jos (Lizzie) pntr hllO Mitchell Walton Lizzie cook r5 Mitchell Fort Hill (EM) Walton Lucile cook r649 Elm al Walton Lucy cook r9 Orchard av Walton Marion T (Caroline) bkpr Jones Motor Co r869 Walnut Walton Victoria r26 Progress Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 937 WALTON WALTER F (Lyde C), Sec-Treas J W Burke Co, h265 Hill Crest av, Phone 3056-J Walton Wm driver r649 Elm al Wanamaker Mary (wid Wm) h213 North av (NH) Wansley Wm E r653 Plum Ward Addie lndrs h318 Gilmer Ward Albert lab r318 Gilmer Ward Alma r304 Reid Ward Andrew J (Willie M) carp r ne cor Cherry and 8th Ward Arch lab r304 Reid Ward Bartow W elk W A and J A Spiller r820 Walnut Ward Calvin lab r318 Gilmer Ward Chas lab hl6 Alabama Ward Claud P (Nettie M) carp h317 White Ward Danl millwkr r99 Green (PM) Ward David (Hattie) lab r519 E Academy (EM) Ward Edw (Reesie) blrmkr h222 Hillyer av Ward Edw (Luvenia) lab rl07 Brief Ward Edw L (Condace) musician Rialto Theatre h 138 Concord Ward Ella (wid Wm) r202 Center Ward Ella (wid Wm O) r346 S College Ward Emma cook r202 Railroad av Ward Eug elk Sou Paint & Varnish Co rl46 Debrode Ward Fannie slsldy S H Kress & Co r420 Calhoun Ward Frank W (Pattie) supt h300 Fairmont av Ward Geo (Flora) h408 Nussbaum Ward Geo (Nora) formn h264 Winship Ward Graham sten Ruan & Co r736 College Ward Harry E (Theo F) eng r320 Coleman av Ward Helen G nurse r736 College Ward Irvin chauf r202 Center Ward Jas carp h.315 White Ward Jas mech r302 Plant Ward Jas W Rev (Hattie) lil40 Washington (EM) Ward Janie sten rl357 Oglethorpe Ward John (Lillian) lndywkr r420 Ash Ward John W (Lilia) meat ctr East Macon Pack Co h216 Clinton Ward Jos (Mamie) carp h302 Plant Ward Jos (Henrietta) lab hl28 (228) Cowan Ward Jubal B (Sarah I) phys 614 Grand bldg hll5 Nottingham dr A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 938 (1925) R. L. POLK & CO.'S Ward Julian (Rena) flremn h307 Duncan av ~ Ward J C chauf Yellow Cab Co hl024 Ash Ward Laura cook r5Tl Hazel Ward Leo C (Theodosia) window decorator J P Allen & Co h es Park 1 s Forsythe rd Ward Martha r222 Hillyer av Ward Mary K (wid Patk H) h736 College Ward Maude (wid Julian) rl07 Broadway Ward Mildred student r304 Reid Ward Myrtle student r304 Reid Ward Narcissus h530 Grant Chapel al Ward Reuben H prsmn Smith & Watson rl07 Broad- way Ward Richd (Annie) lab h798 (138) Williams Ward Robt D (Mamie) eng Macon Ice & Cold Storage Co hllO Pierce (EM) Ward Rosalie dom rl Harris row Ward Sie (Alice) lab r307 Crisp "A 75c Bottle Makes a Quart" PYORAL THE BEST MOUTH WASH L your gums are not a healthy pink, Arm, and elastic. If they bleed on HEALTpHroYv.ocTathiiosn,isTaHEdYangAeRr EsigUnaNl-. nDeAAeIMLyvY.Ur FdeonrtissatleAaNtDyoUuSrEDPrYugOgRisAt'Ls Ward Theo F Mrs sten Dunlap Huckabee Auto Co r320 Coleman av Ward Walter lab r318 Gilmer Ward Wm lab r315 Division Ward Wm C carp r304 Reid Ward Wm E (Nellie) carp h304 Reid Ward Wm J (Clara) overseer hl4 Manchester qtrs Ward Wm 0 (Lillie W) slsmn h346 S College Ward W Addie news butcher r554 Plum Wardlaw Eliza E dept sec rl81 Magnolia Wardlaw Jack B (Louise) slsmn h871 Walnut Wardrobe Pressing Club The W P Short jr prop 409 Cherry Ware see also Weir Ware Clarence (Jane) lab h306 Broad (EM) Ware Delores bkpr Dr J C Anderson r602 Carling av Ware Emma Indrs h526 Gilmer Ware Gerald H trav slsmn h211 Buford pi Ware Henry (Mabel) lab h452 E Academy (EM) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND tJ* THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON CITY DIRECTORY (1925) 939 Ware Jessie T special agt hll4 Holt Ware John P (Madie) mach h252 Broad (EM) Ware Kate rll4 Holt Ware Mary D asst matron Masonic Home Ware Ruby r452 E Academy (EM) Ware Ulices lab r452 E Academy (EM) Warfield Jas B live stock 464 Plum r do Warfield Lula cook h256 Madison Warlick David A (Leila; D A Warlick & Son) hl07 Appleton av Warlick D A & Son (D A and H C Warlick) photogs 117 Cotton av Warlick Freeman H rl07 Appleton av Warlick Hillyer C (Lura; D A Warlick & Son) h215 Boulevard av Warlick Inez student r215 Boulevard (NH) Warlick Wm P (Josie V) trav slsmn h720 1st Warlie Louise cook rl43 Sycamore Warren Aaron (Levada) lab h213 Elliott (EM) MACON Chero-Cola Bottling Co. WJ.. AJ.. HWAWILKLIISNS Warren Delmar A elk L K Liggett Co Warren Ebb B (Rachael) news butcher h350 Wool- folk Warren Erman H elk C of Ga R R Co r506 Hillyer av Warren Frankie bkpr Dr H G Weaver r620 Oak Warren Fred (Jennie) butler h316 Madison Warren Hubert (Lillie M) hl747 Broadway Warren Jos (Nellie) lab rl214 Broad Warren Jos H (Fannie) lab h:1012 Elbert Warren Lizzie cook h405 Madison Warren Mamie Mrs student rl27 Washington av Warren Rosa Indrs rlO Gas House al Warren Rupert D (Beatrice) mech Jones Motor Co h 250 Peachtree Warren Sarah F hl248 2d Warren Thos N (Mary) elk P O h Log Cabin Hts Warren Wilbur (Lillie) lab h557 Henrietta j Telephone 2687 J. T. MOLTON, Mgr., 348 Oafc C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Ans*.t srs All Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company Tharp's Pharmacy CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 940 (1925) R. L. POLK & CO.'S Warren Wm (Georgia) lab h509 Fort Hill Warren Wm A (Thenie) mach h2 Lake Warren Wm L (Mollie) hlpr h252 Broadway Warren Wm R (Lula) brick mason h291 Morgan av (NH) Warren Willie D maid r216 Elliott (EM) Warren Willie M lndrs r405 Madison Warren's Methodist Chapel 150 (171) 1st av (V) Warsham Chas (Ester) carp h420 Liberty Warsham Clauda bkpr J W Ford r623 Main (EM) Warthen Edw (Jennie M) lab h214 Middle (V) Warthen Fannie M r214 Middle (V) Warwick Elma r396 Forest av (V) Warwick Henry E (Melle) lumbrmn h396 Forest av (V) Wasdin Julia C tchr rl35 Pierce av (V) Wasdin Wm F (Jessie C) trav slsmn hl35 Pierce av (V) Wash Jas mech r349 Middle (V) Washburn Abr C (Tillie) lmbrmn hl22 Fort Hill Washburn Clatus B (Pauline) lmbr h801 Main (EM) Washington Alberta rl'O Woodliff Washington Apartments 475-79 Orange Washington Armor farmer h519 Fort Hill Washington Arth (Louise) lab hl60 Bay Washington Av Presbyterian Church Rev T A Thomp- son pastor 219 Washington av Washington Building 566 Mulberry Washington Carl (Detres) lab h609 (309) Charles (SM) Washington Carrie r202 Fort Hill Washington Chas h9 Bright al Washington Chas (Fannie) lab h362 Bay Washington Chester lah r217 Linden av Washington Columbus J (Mary) barber hill Linden av Washington Cora L h203 Elliott (EM) Washington Elmira maid Dixie Dental Laboratory Washington Emma L dom rlOO Elm Washington Geo h627 Gilmore la Washington Geo (Georgie) brick mason r249 Morgan av (WH) Washington Geo lab r7 Stripling al Washington Geo porter r305 Martha FOR LISTS OF NAMES 1 J ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO J LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4 Va% on Savings MACON CITY DIRECTORY (1925) 941 Washington Henrietta lndrs hll33 (321) Broad Washington Ida h401 (190) Texas Washington Jas (Marguerite) cotton sampler h211 Linden av Washington Jennie lndrs hl'59 Bright al Washington John D (Gussie) lab hll2 Whitlock | Washington John M (Roxie) cllrh202 Fort Hill Washington Jessie dom rl60 Bay Washington Kate cook h902 Elbert Washington Lilia lndrs r354 Ellis av Washington Louise rll2 Whitlock Washington Lula J dom hll22i/2 Broadway Washington Mary h212 Church al Washington Mary rl26 4th av (V) Washington Mary lndrs h655 Hazel Washington Mary E dom rl60 Bay Washington Melton (Addie) lab rl33 Bay Washington Memorial Library Sallie M Akin librar- ian 320 Washington av Washington Mozell lndrs rl60 Bay Washington Park College bet Magnolia and Wash- nigton av Washington Rachel lndrs h400 Smith (EM) Washington Roy trav slsmn h869 Mulberry Washington R E Mrs slsldy J P Allen & Co r459 New Washington Salina lndrs rl4 Bright al Washington Wm (Martha) carp h304 (625) Crisp Washington Wm (Annie) lab h505 (192) Lexing- ton av Waskins Shine (Jessie) lab r315 E 2d (EM) Wasner Ella (wid Geo D) h259 Church (EM) Wasner Geo L (Armita) mach h628 Main Wasner Sarah E bkpr A S Hatcher Co r209 Apple- wood Wasner Sidney W (Mattie) eng h209 Applewood Wasner Wm L (Lettie) eng h248 Church (EM) Waterhouse R Holt (Mamie I) slsmn Johnson Dur- ham & Burke h410 Ridge av Waterhouse Thos W hl427 2d Waterman Henry (Theresa) hl922 3d _ Waterman Leah (wid Leopold) rl500 Forsyth rd (V) Waters Alice waitress r552 Ocmulgee Waters Benj J br mgr A & P Tea Co rl05 Rogers av Waters Carrie (wid Robt L) hlOO Applewood Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. ,1L'O9LK2*5r [JECIOUS MetFaOlRsM IS POLK'S Dental Register OP THE UNITED STATES AND 942 (1925) R. L. POLK & CO.'S Waters Chas elk r971 Oglethorpe Waters Chas lab r803 (126) Charles Waters Claudius C (Camilla) cond h2528 2d Waters Danl (Lucinda) lab hllO Mason (SM) Waters Eliza lndrs rll7 Jones st la Waters Eug (Thelma) lab r4 Bright al Waters Freddah (wid Henry) h425 Telfair Waters Harrison (Mary) lab h916 Atlantic av (SM) Waters Humphries cashr P A Callianos r552 Ocmul- gee Waters John (Eliza) lab h403 (502) Colquitt Waters Jos R (Lurainy) farmer hl211 (110) Wool- folk Waters Lee (Lou) lab h370 Flanders (EM) Waters Lula (wid Edw H) h971 Oglethorpe Waters Murry (Pearl) porter h354 Maynard Waters M B lab r803 (126) Charles Waters Oscar (Ella) lab h6 Spark's al Waters Pinkie h803 (126) Charles Waters Russell E student r2528 2d CANADA WATERS-SPARKS CO, See Sparks Motor Co Waters Susie cook rl26 Charles 1925 Waters Wm L (Emily) slsmn h254 Masonic Home rd Waters Willie carp r803 (126) Charles Watkins Benj T (Ethel) inspr Security Loan & Ab- stract Co h201 Hendley The Splendid Features of Past Editions Watkins Bennie lab r21 Tinsley la Watkins Blake (Rinda) waiter h262 4th av (V) Watkins Elaine maid r615 Prince Watkins Ella lndrs h615 Prince are retained, Watkins Emma lndrs h552 Mitchell with much New, Useful and Interesting Data added Watkins Emory student r262 4th av (V) Watkins Enos (Clara) sexton Lynwood Cemetery h 228 Lynwood av Watkins Eug lab r615 Prince Watkins Geo R auto mech r398 Belmont av Watkins Georgia (wid Aug B F) hl05 Park pi Watkins Georgie (wid T Frank) r398 Belmont av Watkins Goode (Claude) trav slsmn h570 1st Watkins G C slsmn Singer Sewing Machine Co R. L. Polk Watkins Hattie cook h21 Tinsley la & Co. Publishers Watkins Jas hlpr r204 Coles al Watkins John (Hattie) firemn h727 Campbell av Watkins John (Mamie) lab h230 Lynwood av 536 S. Clark St. Chicago, III. E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS-TRUCKS-TRACTORS hIffoarviet'asit.aFoFrodr,d woer PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 94S Watkins John lab r21 Tinsley la Watkins John H (Mavis) porter h204 Roberts Watkins Julian lab r6T5 Prince Watkins Louise rl05 Park pi Watkins Mattie smstrs r425 Arch Watkins Robt mech C P Bethea r398 Belmont av Watkins Rosa maid rl58 Middle (V) Watkins Sallie smstrs r425 Arch Watkins Vienna bkpr Roller & Millirons r814i^ 2d Watson Agnes (wid David T) sten L L Daugherty jr & Co rlOlO Walnut Watson Albert P (Myrtle) pntr h332 Hanson Watson Alberta (wid Edd) h360 Whitehall Watson Alf (Lois) firemn r429 Douglas av Watson Alva D asst supt r317 Cherry Watson Anna M drsmkr 606 Ross r do Watson Annie rl015 Oglethorpe Watson Annie cook r9 Ellis av Watson Annie cook r243 Jones Watson Annie L (wid Geo) h319 Duncan av Watson Annie R tchr r319 Duncan av Watson Arth L (Mamie) carp hll3 Shell av Watson Beulah rl06 (7) Richard Watson Boyce S (Florence) cond hll4 Ponce de Leon av Watson Claud B (Ruth) servicemn Ellis Motor Co h 124 Colquitt Watson Clinton mach hd r!031 3d Watson Daisy cook rlOO Collins la Watson David orderly Middle Ga Sanatorium Watson Dixon elk Massee Felton Lbr Co r Y M C A Watson Dollie mach hd Bibb Bag Co Watson Dollie M cook rl21 Gordon Watson Dorothy (wid John) h763 Anderson Watson Earle T (Emma M) mfrs agt 318 Broadway h 409 Hill Crest av Watson Eliz tchr rl20 Coleman av Watson Erma smstrs r604 Ross Watson Ethel bkpr Amer Investment Co r306 Wash- ington av Watson Fannie rl08 Amos Watson Fannie rl520 2d Watson Frances butterwkr Plummer's Creamery h 113 Nelson More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 944 (1925) R. L. POLK & CO.'S Watson Francis mill opr rll3 Shell av Watson Frank (Mattie) carp h627 Main (EM) Watson Geo (Margt W) pharm S M Wright r867 Mulberry Watson Harriette tchr r319 Duncan av Watson Henry barber J A Braswell Watson Henry E (Carrie) agt Interstate Life & Acc Insurance Co Watson Horace E (Ethel; American Investment Co) h306 Washington av Watson Hubert mach r554 1st Watson H A elk Morris & Co Watson Ida M sten r319 Beech av Watson Jas (Annabelle) formn h234 Powell (EM) Watson Jas lab rlOO Richard Watson Jas Rev (Lucy) pastor Lee St Baptist Church h614 (339) May av Watson John B student r319 Duncan av Watson J Lee (Minnie) v-pres Dunlap Hardware Co h617 Orange Watson Kath r763 Anderson Watson Laura W mach opr rl031 3d Watson Leah student r2632 Broadway Watson Leola Indrs h3 Cherokee av (SH) Watson Leola maid rll7 (3) Braswell la Watson Lillian r763 Anderson Watson Lillie cook rll3 Nelson Watson Lillie sten The Bradstreet Co r2636 Broad- way Watson L Gardner elk W H Tharpes r!28 Park pi Watson Martha Mrs sten Security Loan & Abstract Co r411 Hill Crest av Watson Marvin formn r319 White Watson Mary student rl20 Coleman av Watson Mattie rl28 Park pi Watson Mattie J (wid Theo E) hl28 Park pi Watson Mildred student rill Newberg Watson Nancy (wid Wm H) r2111 2d Watson Nettie rl520 2d Watson Otis O (Bessie) repr R L Wayman rl635 Broadway Watson Paul H (Eliz) buyer hl20 Coleman av Watson Paul H jr slsmn Peeler Hardware Co r319 Duncan av Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoismeso. eblieSlecetnLdipstrtoso.sHpeeOacudtsrqunfaeorw-r Ccoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfHor. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE SMTEIN-BLOECDHWISNMCALRATPCPLSOHTOHEESS,, MANHATTAN KNOX HATS SHIRTS MACON CITY DIRECTORY (1925) 945 Watson Paul L (Annie M) solr Independent Lndry Co 200 College pi Watson Ralph hl015 Oglethorpe Watson Roger A (Martha) ship elk Peeler Hard- ware Co h411 Hillcrest av Watson Rose maid r349 Hawthorne Watson Roy r2169 2d Watson Roy A (Eva) mech h324 Hunson Watson Sarah hl46 Forsyth la Watson Thos h360 Whitehall Watson Thos (Flora) lumber inspr h204 Hartley av (CP) Watson Thos H (Bertha) carp hill Newberg Watson T Emory hostler rill Newberg Watson Walter lab r240 Harris al Watson Wm (Ida) lab h534 Kahn's al Watson Wm A driver rl031 3d Watson Wm D (Emily) mach hd hl031 3d Watson Wm H (Hanna T) sec-treas Middle Ga Agn Credit Corp h728 College Watson Wm J (Kate) mill hd h233 Roff Home av Watson Wm T supt Roff Home and Smithsonia Coun- ty Alms House hl65 Roff Home av (V) Watson W Augustin jr (Vera) slsmn h210 Ridge av Watson W C r Y M C A Watts Addie opr r317 Randolph Watts Arch (Sallie) formn hl25 Myrtle (SM) Watts A C carp r620 2d Watts Bonner H millwkr r32 Manchester qtrs Watts B H trav rl23 Nottingham dr (NH) Watts Cecil lino opr Macon News Watts Electra Mrs h302 Ells (SM) Watts Geo T (Lula) barber Flynt & Genone hl25 Piedmont av Watts Hugh R (Eliz) eng h821 Cherry Watts Jas H lab r306 Water (EM) Watts Jesse (Maria) lab h347 Hammond Watts John (Rachael) lab h306 Water (EM) Watts John L (Rebecca) opr h317 Randolph Watts John W (Minnie) millwkr h32 Manchester qtrs Watts Jos (Lizzie) lab hl25 College Watts Julia r273 3d av (V) Watts J Edw millwkr r32 Manchester qtrs FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable cn S3w UaN- HERBERT SMART WALTEWRAELT, ECRLAPREKA, RSChEoe Dept. DEAN BAakKlEwWeFLTLI <\pt HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DM! 946 (1925) R. L. POLK & CO.'S as a Watts J Mote mgr Central City Hotel r do Watts Kate r226 Jones MMLT Watts Noland E electn Oetter Electric Co res R D No 2 Watts Paul W bkpr Cit & Sou Bank res R D No 6 PUCE Clinton rd Watts Sylvester B (Annie) mill hd h6 Ford la THE WATTS WALLACE C (Alma), Sec City Realty Co, h809 Beech av DIREGTUHY Watts Wayland M (Bernice) mgr Fuller Brush Co r 1'512 Forsyth rd (V) IS THE Watts Wm (Georgia) lab hl62 Hazel Watts Wm T rill Newberg GREATEST Watts Wm T (Radie) collar mkr Otto-Isaacs Harness Co hl30 Main (EM) MARKET WATTS & CO (G N McCook, R L Hales), Salary Buyers 064 Poplar, Phone 680 PLACE Waxelbaum Caroline student r815 Orange Waxelbaum Edgar A student r554 College IN THE Waxelbaum E A & Bro (Inc) L I Waxelbaum pres whol shoes 351 Cherry WORLD Waxelbaum Gates J (Aimee) pres Empire Products Co h815 Orange Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year BLRiffiifb PUBLGHEBS Waxelbaum Jos (Maude) whol dry gds h926 Cherry Waxelbaum Josie r4, 811 Poplar Waxelbaum Louis I (Marian) pres E A Waxelbaum & Co Inc h.554 College Waxelbaum Marion r926 Cherry Wayman Robt L (Alice D) auto repr 555 3d r261 Bond Wayne Betty Q rl04 Lamar WEATHERLY ERNEST B (Bessie A), Attorney-fit- Law 406 Gfa Casualty Bldg, Phone 5009, hllO Rogers av (V), Phone 364 Weatherly Ernest B jr student rll6 Rogers av Weatherly Evelyn student rl'16 Rogers av Weathers Danl (Bertha) lab 623 Middle (EM) Weathers Harry L (Sarah) flagmn rll9 Ells (SM) Weathers Lillie mill hd hl413 1st Weathers Mary huckster hll5 Forest av (V) Weathers Norman A (Johnnie M) gro 1011 Elbert Weaver Alex H S (Weaver & Cravan) rl07 Cleve- land Weaver Anna C student rl07 Cleveland av EUilVecEoraE DETROIT .FOR LISTS OF NAMES ANY TRADE/k--z ANY BUSINESS -- ANY PROFESSION Detroit R. TL. POLK & CO. Chicago TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656l/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) Weaver Arch (Annie) lab rlOl (102) Roberts Weaver Bass carp h226 Turpin Weaver Carrie r267 Maple Weaver Chas (Mary) carp hlOT (102) Roberts Weaver Clyde W (Hattie) mech h865 Cherry Weaver Comer (Rebecca) r475 Spring Weaver David L appr Taylor Iron Works & Supply Co rl34 Charles Weaver Eugenia r415 Boulevard (NH) Weaver Florence J nurse r615 Spring Weaver Geo B (Cecilia) mach h666 Oak Weaver Henry (Carrie) lab h614 Gilmer Weaver Howard A (Reba) asst formn Macon Tele- graph r267 Maple Weaver Howard D (Inez) h415 Boulevard (NH) Weaver Hudnall G phys 1014-17 Ga Casualty bldg rl07 Cleveland av Weaver Inez Mrs slsldy Dannenberg Co r415 Boule- vard Weaver Jack N bkpr Cit & Sou Bank rl07 Cleve- land av Weaver Jane cook 471 Walnut Weaver Jos (Mamie) farmer h717 Broad Weaver J Nollie (Nettie) slsmn Lee's Dept Store h615 Spring Weaver J T sten Willingham Sash & Door Co r865 Orange Weaver Mary (wid Thos) rl'34 Colquitt Weaver N Terrell (Lucille) asst treas Bankers Health & Life Ins Co h2 Barnes apts Weaver Olin FI (Georgia) surgeon Middle Ga Sana- torium hl28 Buford pi Weaver Richd (Josephine) millwkr h231 Flanders WEAVER RUFUS W DR (Charlotte M), Pres Mercer University, h501 Adams Weaver Wm student r717 Broad Weaver Wm H M (Anna) dist mgr Sou Bell Tel & Tel Co hl07 Cleveland av Weaver Wm W (Laura) carp h267 Maple Weaver & Craven (A H S Weaver, G H Craven) law- yers 918-19 Ga Casualty bldg Webb Ada maid r354 Ellis av Webb Adolphus D (Leanor) farmer h931 Columbus rd Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog' contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. -- TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 948 (1925) R. L. POLK & CO.'S Webb Andrew H printer Macon News rl980 3d Webb Blanton assorter Ideal Laundry Co r866 3d Webb Cullins (Mabel) barber Clinton Brantley Webb Forrest driver Jacob Hirsch r8 Murray's al Webb Fred L (Tulip C) phys 725 Bibb bldg r218 Georgia av Webb Homer (Leola) lab h302 Tindall av Webb Isabella smstrs r931 Columbus rd Webb Jas R (Lillian) pastor First St Methodist Ch h861 1st Webb John P (Dora) carp h866 3d Webb Jos H (Ida) carp hll2 Montpelier av Webb Jos H (Addie) carrier P O h417 3d av Webb Julia student rl'12 Montpelier av WEBB J RUFUS (Emily), Chairman Finance Com- mittee Liberty Savings & Real Estate Corp, Pres Central City Undertaking Co, h519 Monroe (Y) WEBB J TOM JR (Mary S), Circulation Mgr Macon Daily Telegraph, hl65 English av, Phone 3933-J Webb Marian C student r218 Georgia av Webb Obie opr Sou Bell Tel Co r613 Arch Webb Onnie r rear 330 Dempsey av Webb Otis L (Eva) formn h323 Randolph Webb Paul L (Belle) elk h235 Washington av Webb Raymond (Gussie) driver h311 Hanson Webb Theoda (Corena) pdlr h rear 330 Dempsey av Webb Walter C (Nora) meat ctr r866 3d Webb Wm lab r608 Norris Webb Wm B (Rebecca) carp hl980 3d Webb Wilson (Pearl) lab h433 Alabama Webster Alvin A (Myrtle) rl017 Elm Webster Danl (Mary) lab h303 Elbert Webster Lonnie O (Julia) mech h213 Cedar Webster Perry G (Nellie) blrmkr h439 Calhoun Webster Ruby slsldy Dannenberg Co rll9 Plant Weddington Con multi opr Dannenberg Co rllO Bu- ford pi Weddington Georgia S hllO Buford pi Weddington Gladys sten Dannenberg Co rl'10 Bu- ford pi Weddington Wm J (Caroline) bkpr h206 Pierce av (V) Weddington Wm W student r206 Pierce av (V) Weeks Chas H (Susie) mill opr r26 Bellevue rd FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) Weeks C F rl325 Broadway Weeks Hugh (Susie) millwkr r Adams Boarding hse Lake ,, ^ ,, Weeks J M elk C of Ga R R Co r R D 3 Weeks Wm A F farmer rll8 Violet av Weeks Wm R (Fannie) firemn hll8 Violet av WEEMS ARBIE E (Ellen F), Prop Hotel Southland and Frances Hotel, h567 Broadway, Phone 3047 Weems Clifford E coremkr rl707 2d WEEMS HORACE E (Florence), Mgr Southland Hotel, h416 Blackburn, Phone 5328 Weems Minnie lndr rl606 1st Weevilnip Co of America J W Ray mgr mfg chemists 509 5th Wehrcamp Angeline student r902 Boulevard (NH) Wehrcamp Paul (Margt) forgemn h902 Boulevard Wehrcamp Paul jr student r902 Boulevard (NH) Weinhrenner Luther flagmn r618 Duncan av YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES p o s1 m w %3~ n TO s > O 73 CO >E 9, Q pi( z go c 73, s>; , . ss S 73 SSOtSo CO ~zj H Weinhrenner Mary L (wid Luther) smstrs J P Allen & Co h618 Duncan av Weinstein Julius student rl35 Rose Park Weinstein Max (Weinstein & Starr) hl35 Rose Park Weinstein & Starr (Max Weinstein, Herman Starr) pawnbrokers 520 Poplar Weir see also Ware Weir Cynthia H (wid M A) prin John W Burke Sch h694 Ridge av Weir Robt L mech Ellis Motor Co r Log Cabin Hts Weir Thea elk Sou Belil Tel Co r Log Cabin Hts Weisiger Wm P (Connie) mach hl2i/2 Nevaro flats Weiss Frank (Louise) blksmith h370 3d av (WH) Weisz Cecelia A music tchr 800 Orange r do Weisz Frances E sten Dure & Beeks Co r800 Orange Weisz Genevieve tchr r800 Orange Weisz Jas G organist h800 Orange Weisz Mamie A bkpr r800 Orange A natural by-product of the Directory Business is the pi si o >> o r Z 2 to r > 0CO2 > Z S' oto 0o2n (r U 3 S * etf JC Qh CO s a &M ^ (1925) R. L. POLK & CO.'S Williams Morris collr r7 Park Hill av Williams Mose (Della) lab hl36 Phillips la Williams Mount J (Izela) hlpr h601 (315) Colquitt Williams Moye student r432 Ross Williams Myrtle h303 Hendley Williams Nadine T slsldy Dannenberg Co rl09 Napier av Williams Napolean delivery boy r508 Academy (EM) Williams Narcissus lndrs hl74 Moore av Williams Nathan (Mazie) carp h209 College Williams Nathan C (Henrietta) h409 E 2d (EM) Williams Nettie tchr rll5 Douglas Williams Ollie (Ardecia) lab hi Tracy's al Williams Oscar (Mary) lab hl64 Lynwood av Williams Oscar E attndt Highland Oil Co rll5 Not- tingham dr Williams Otha porter r507 Flanders (EM) Williams Otis M barber Palm; Barber Shop r90'l Cherry Williams Paul (Lucile) barber h610 Norris Williams Paul (Ida) carp h504 (252) Hall Williams Paul H (Nina) sec-treas Williams Mfg Co h432 Ross Williams Pauline opr Sou Bell Tel Co r327 American blvd Williams Pauline smstrs r220 Shamrock Williams Pearl lndrs r348 Flanders (EM) Williams Perry hlpr r803 Pine Williams' Pharmacy J L Williams mgr 2640 2d Williams Pink (Ella) lab hl71 (173) Green Williams Pratt (Willie) lab h509 Stephen Williams Rachel L (wid Robt L) hl07 Virginia Williams Reuben E (Laura) wood wkr h325 Maple Williams Richard (Henrietta) draymn hl234 1st Williams Richd (Louise) lab h361 Hazel WILLIAMS RICHARD A (Mattie L), Real Estate and Insurance 40-41 Fourth Natl Bank Bldg, Phone 5192, hl27 Stonewall pi, Phone 205-5W (See left side lines and page 83) Williams Robt (Edith) brklyrhll5 (5) Penn Williams Robt (Lula B) lab hl209 1st Williams Robt (Mary) lab h361 Hawthorne Williams Robt lab r250 Johnson av Williams Robt (Sarah) lab h438 Tindall av Williams Robt (Clara) porter r427 North H More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4 x/%% on Savings MACON CITY DIRECTORY (1925) 973 Williams Robt A (Myrtle) trainmstr h607 Forsyth Williams Robt E dairymn rl09 Napier av Williams Robt E (Pauline) sawmill opr h327 Ameri- can blvd WILLIAMS ROBERT H (Laura A), Pres-Genl Mgr Williams-Guttenberger Music Co, h321 North ay, (NH), Phone 4030-L2 Williams Robt L elk r247 Madison Williams Robt L woodwkr r325 Maple Williams Robt Y (Pearl) mach opr h939 Columbus rd Williams Rogers (Ida) chauf r266 (666) Hall Williams Rosa rll5 Douglas Williams Rosa Indrs r706 (442) Hall Williams Roxie Indrs hl014 Elbert Williams Roy r307 Forsyth Williams Roy A (Edna) r Log Cabin dr Williams Roy G (Ethel) v-pres Mitchell Williams & Mack h401 Hill Crest av Williams Rufus (Lizzie) cook r203 Telfair Williams Russell porter r313 Madison Williams Ruth Indrs r206 Amos Williams R E Mrs hemstitcher Singer Sewing Mach Co WILLIAMS R HOWELL (Ruth), V-Pres Williams Jewelry Co, h345 Hines ter, Phone 1865-W Williams R Wesley slsmn hl20 Cleveland av Williams Sadie mill wkr r438 Tindall av Williams Sallie cook r559 Cheatham al Williams Sami (Mary) r270 Brief Williams Sami (Ida) hl26 Edgewood av Williams Sami bellmn rl71 (173) Green Williams Sami (Mattie) lab h322 Ash Williams Sami (Lillie) lab hl73 Hazel Williams Sami (Addie) swtchmn h201 Gant City rd Williams Sarah rl40 Hines ter (V) Williams Sarah Mrs h.812 3d Williams Sarah Indrs r504 (252) Hall Williams Sarah Indrs h531 Gilmer Williams Sayles (Minnie) lab h243 Mitchell Williams Sherman (Lula) lab h558 Smith row Williams Sol junk r52 Davis (NH) Williams Sol (Fannie) lab hl7 Gas House al Williams Susie cook h428 Lawton av Williams Thelma mill wkr r200 Elliott (EM) Williams Theo r530 Monroe FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT It. L. POLK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L Polk & Go. Publishers 536 S. Clark St. Chicago, 111. (1925) R. L. POLK & CO.'S Williams Theo E (Lizzie B) dist mgr Buckeye Cotton Oil Co rl04 Delaware av Williams Theoplius chauf r568 Siam Williams Thos (Bertha) hl02 Franklin Williams Thos (Susie) porter hl85 Dempsey av Williams Thos H (Bertie) hll5 Richmond Williams Turner (Essie) carp h852 Norris Williams Turner (Sylvia) lab h515 Flanders (EM) Williams T McRae student r Y M C A Williams Velien D mgr Nash Meat Mkt r458 Ocmul- gee Williams Vertie' r201 Carling av (HH) Williams Violet Mrs sten Macon Telegraph rl20 Cleveland av Williams Virginia student r557 1st Williams Virginia student r303 Hendley Williams Walter (Lula) lab hl72 Ellis av Williams Walter (Ella) lab h354 Hawthorne Williams Walter (Hattie) waiter h803 Ash Williams Walter E (Fannie) uphol h636 Pio Nono av Williams Walter E jr sten Taylor Iron Wks & Supply Co h805 Pio Nono av Williams Walter H elk hl06 Lee Williams Wash (Annis) farmer h Columbus rd Williams Wesley lab r204 Gant City rd Williams Wm rl88 Gordon Williams Wm (Stella) janitor h402 Tindall av Williams Wm lab r460 Alabama Williams Wm (Mattie) lab r295 Craft la Williams Wm (Judie) lab h432 Chestnut Williams Wm (Lizzie) lab h616 (255) Crisp Williams Wm lab rll2 Edgewood av Williams Wm (Beatrice) lab r307 Edison Williams Wm (Essie) lab r512 Maynard Williams Wm (Lula) lab r223 O'Hara la Williams Wm lab r329 Tindall av Williams Wm (Lucie) plstr h4 Gunn's al (V) Williams Wm A (Evie) formn h59 Pio Nono av Williams Wm A (Sweetie) janitor hlOO Whitlock Williams Wm A (Eliz) phys 719 Ga Casualty bldg h422 Duncan av Williams Wm C (Florence) secrtreas Adams-Riehardson Lmbr Co h215 Hendley Williams Wm H mech Used Car Clearing House Williams Wm L (Lorane) blrmkr hll9 Colquitt E. R. PEARCE TOPS BUILT anCdARRSEPAANIRDEDt.ruTAcIkLsORp-MaiAnDteEdSEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS-TRACTORS If it's a Ford or for a Ford, we have it. PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON CITY DIRECTORY (1925) 975 Williams Wm T sten r730 Courtland av Williams Wm V (Birdie) elk Ga Loan & Trust Co h401 Suwanee av Williams Wm W insurance agt S N Adams & Son r 226 High Williams Wm Z (Flora P) contr h272 College Williams Willie lab rll06 (3) Elbert Williams Willie lab rl06 Lee Williams Willie lab r509 Stephen Williams W Lamar (Sallie F; W L Williams Art Store) hl40 Hines ter WILLIAMS W L ART STORE (W L and H G Wil- liams), Pictures, Frames and Art Goods 107 Cotton av, Phone 58 Williams Zack (Elsie) carp h868 Douglas av Williamson Benj F jr slsmn Enterprise Packing Co res Lizella Ga Williamson Bernice Mrs bkpr Federal Clo Store rSOO1/^ Cherry Williamson Cary K (Iva M) eng hl34 Charles (SM) Williamson Chas A (Lucille) car repr h2457 2d Williamson Clifford T (Myrtle) blrmkr h2554 Broad- way Williamson Corbett student r712 Main Williamson Felton student r712 Main Williamson Geo (Kath) slsmn r251 New Williamson Inman & Co H W Freeman mgr cotton buyers 710 3d Williamson Jasper (Lillie M) eng rl44 Holt Williamson K Clifford (wid Wm W) r560 College Williamson Lula student r712 Main Williamson Nita elk Volunteer Pharmacy r318 Spring Williamson Robt G (Anne) h211 Rogers av Williamson Ruth spinner rl21 Holt av (NH) Williamson Sol (Viola) mech h559 Siam Williamson Thos H (Lula) supt trans Macon Ry & Light Co 511 Mulberry h.712 Main Williamson Thos H jr student r712 Main Williamson Wm O (Neta) collr Central City Security Co h318 Spring Williford Jas M (Marion) countermn Lohs Cafe r501 Fort Hill Willims Annie K cook Henry Williams rR D 3 Willingham Alf R (Kate C; Willingham & Payne) pres Willingham Loan & Trust Co h410 College The most comprehensive reference work on tne banks of the world Contains Condensed Statements of AM Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. rx & CO. Polk Directory Bldg. Detroit, Mich. lil bl .UOj 3g< 3tyO KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 976 (1925) R. L. POLK & CO.'S Willingham Alf R jr student r410 College Willingham Anne T Mrs r846 College Willingham Baptist Church Holt av cor Lawton av (NH) WILLINGHAM BATTERY CO (E P Willingham), Willard Batteries and Service 516 1st, Phone 447 Willingham Benj B (Nillson S) insurance 516 1st h 436 Washington 'av Willingham Broadus E (Annie) h214 Vineville av Willingham Broadus E jr (Rosalie) h248 Vineville Willingham Building 569 Cherry Willingham Calder B (Eunice) pres Adams Duck Mills h415 College Willingham Chas L (Lula) elk College Hill Gro h415 Forsyth Willingham Chas L jr student r415 Forsyth Willingham Curtic A linemn W U Tel Co r668 Walnut Willingham Elmer T (Ruth R) auto repr 663 3d h5 Spring apts Willingham E Pringle (Pauline; Willingham Battery Co) h302 Bond Willingham Fred E mech Ellis Garage r Central City Hotel Willingham John P (Hallie) mach Taylor Iron Wks & Supply Co hl44 Magnolia Willingham Jos r510 Mulberry Willingham Jos elk Burden Smith & Co r Plaza Hotel Willingham Kath r410 College Willingham Lewis student r415 Forsyth Willingham Loan & Trust Co A R Willingham pres A L Jackson sec T B Elfe treas 461 3d WILLINGIIAM OSGOOD P (Ida), Pres Willingham Sash & Door Co, h829 College, Phone 384 WILLINGHAM OSGOOD P JR (Helen), Y-Pres Wil- lingham Sash & Door Co, hl39 Jefferson, Phone 3912 Willingham Paul D (Sallie) h545 College Willingham Sarah W student r436 Washington av Willingham Spain sten rl39 Jefferson WILLINGHAM SASH & DOOR CO, 0 P Willingham Pres, 0 P Willingham Jr Y-Pres, J C Kemme Sec-Treas, C Y Alexander Asst Sec, B L Johnstone Asst Treas, Office and Store 457 3d, Phone 3976 and 278, Factory 7th and Cherry, Phones 157 and 1572 (See top edge and left top lines) mcAtCeoauarptstnyaoy.lfmookgoribnacidlloelsRnkto.iaofnLiwndm. snsPeeOmorrcfsLuhAKcaakn.urdt&eovismaeClso.uOeba.l,ibeSlelDceetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtsMsrkqIunCffeaHoowrr-r. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 977 WILLINGHAM T MARION (Frances), Sec-Treas Cen- tral Sash & Door Co, hi, 232 High, Phone 2871 Willingham Wm H r329 College Willingham W Arth (Lora) carp h668 Walnut WILLINGHAM & PAYNE (A R and C B Willingham Jr, W S Payne Jr), General Insurance and Surety Bonds 461 3d, Phone 360 Willis Anna maid r408 Virgins la Willis Annie' r202 Duncan av Willis Annie P rl05 Corbin av . Willis Arlington A br mgr Hammond Oil Co rl27 Knott Willis Ashmore W baker Am Bakeries Co rill 2d Willis Auburn (Lucile) elk r535 Georgia av Willis Bernice r207 Madison Willis Bessie smstrs rl318 3d Willis Callie lab h207 Madison Willis Clarence (Mary) lab rllO Blount Willis Dennis cook r759 Ash Willis Edw (Edith) trav slsmn h251 New Willis Edw E rl30 Winship Willis Edw W (Matilda) formn hl07 Park av (CN) Willis Elijah B (Maggie) blksmith h264 Wood Willis Fannie maid r228 Ellis av Willis Frank (Julia) carp h706 Guernsey la Willis George (Lutie) elk rill 2d Willis Geo lab W W Jackson Willis Geo A (Mattie L) agt Southeastern Exp Co h 107 Lamar Willis Geo A jr elk rl07 Lamar Willis Geo C (Bellevue Drug Store) r859 Cherry Willis Geo C (Willie) elk hl333 3d Willis Gordon rill 2d Willis Gordon F (Nettie) formn hl27 Knott Willis Harry (Eddie L) elk Corbin Supply Co h203 Duncan av Willis Henry A firemn r690 College Willis Hittie (wid Madison) r825 Columbus rd Willis Hunter L r535 Georgia av Willis Jacob T (Mary) formn h515 Hillger av Willis Jas pressing 872)4 Hazel h do Willis Jas T (Leila) slsmn h305 Hendley Willis Jessie firemn r58 Schofield Willis John mech r633 4th av (U) ' FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK. & CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELI WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DUO S78 (1925) R. L. POLK & CO.'S as a WILLIS JOHN J (Susie; Macon Chero-Cola Bottlfne Co), hl211 Vineville, Phone 878 wm Willis John W blksmith Taylor Iron Wks & Supply Co h202 Duncan av Willis John W jr ship elk Coleman Meadows Pate PLACE Drug Co r202 Duncan av Willis Josephine cook r207 Madison THE Willis Julia (wid John) r617 Prines Willis Laura (wid B F) rl704 2d Willis Laurence rl411 Edgewood av DIRECTORY Willis Lela Mrs cashr Lee's Dept Store r305 Hendley IS THE Willis Leon W (Charlsie) rl07 Park av (CP) Willis Lillie T (wid Steph W) h307 Ross GREATEST Willis Lizzie cook r58 Schofield Willis Lucille slsldy rl07 Park av (CP) MARKET Willis Manda Indrs h28 Long la Willis Margt cashr rl07 Lamar PLACE Willis Margorie student rl07 Park av (CP) Willis Marth student rl07 Lamar IN THE Willis Maude r207 Madison Willis Maybel sten r202 Duncan av WORLD * Willis Milledge C housekpr r422 Ross Willis Monroe C (Troy B) slsmn rl309 Vineville av (V) Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had > * Willis Nettie' Indrs h228 Ellis av Willis Onnie H asst supt Central Cotton Oil Co r866 3d Willis Robt L (Linda) blksmith h422 Ross Willis Robt R (Ruby) garage 756 Broadway h331 American blvd Willis Roxie dom h300 Turpin Willis Ruby phone opr rll3 Ponce De Leon av Willis R Herschell rl07 Park av (CP) Willis Sanford h633 4th av (U) The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year Willis Thos (Cora) lab h316 Edgewood av Willis Thos (Nellie) plmbr hl41 Bartlett la Willis Viola Indrs h420 Hawthorne Willis Wagner L elk Natl Benefit Life Ins Co r207 Madison Willis Wm B (Marybelle) elk Flournoy Auto Co h535 Georgia av BUkitb PUBLBHEK Willis Wm C (Daisy R) mgr Franklin Life Ins Co 308 Ga Casualty bldg hl05 Corbin av Willis Wm F (Florie) A G Rhodes & Son hl27 Curry pi (NH) PolkDirecbnjHP DETK)IT f MICH- More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. TERMINAL TRANSFER COMPANY Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656!/2 CHERRY ST. PHONE 3041 MACON, GA. MACON CITY DIRECTORY (1925) 979 Willoughby B T elk C of Ga R R Co rl64 High s x Willoughby Eliz timekpr Sou Ry r W C Livingston Willoughby Emily h523 Ash Wills Nora maid h Forsyth Willums Jas W (Fannie B) eng hl006 Ridge av Willums Wynelle student rl006 Ridge av WILLYS-KNIGHT AUTOMOBILES, Yates Motor Co Distributors, 707 3d, Phone 1446 Wilmore' Henry (Mollie) porter r rear 7 St Paul Wilson A1 F (Bessie) mgr Idle Hour Country Club Wilson Albert (Ella) barber 252 5th h216 Garden (EM) Wilson Alberta lndrs r216 Garden (EM) Wilson Amanda r232 Grants Wilson Andrew J (Sarah) h319 Reid Wilson Annie sten r458 Edgewood av Wilson Annie L lndrs r451 Barracks al Wilson A Ethridge produce buyer r O C Wilson Wilson Bazemore elk Paragon Pharmacy rl51 Cole' Wilson Benj harness mkr Otto Isaacs Harness Co Wilson Blunt (Emma) supplymn h rear 123 Broad (EM) Wilson Carl auto top repr r2090 3d Wilson Carl T appr rl57 1st Wilson Carrie S opr Sou Bell Tel Co Wilson Celia rl58 Lynwood av Wilson Chas (Bessie) driver Macon Telegraph h215 Ellis Wilson Chas (Essie) lab hill New Wilson Chas (Louise) lab h46 Waterville rd Wilson Chas B (Dollie) trimmer hl20 Concord Wilson Clayton S pdlr r 0 C Wilson Wilson Clifford L (Flossie M) gro 3494 Houston av h do Wilson Daisy slsldy McCommon Bros r Y W C A Wilson David W elk r511 Calhoun o Wilson Delious (Matilda) firemn rllO Thomas Wilson Dora Mrs opr Sou Bell Tel Co rl57 1st so Wilson Douglas S (Lela) lab h308 Wood al Wilson Earl O (Henrietta) agt N Y Life Ins Co hl51 > Cole Wilson Edgar r660 Oak Si Wilson Edgar P mgr Acme Investmnt Co r852 2d Wilson Edna P Mrs assorter Ideal Lndry Co r431 Carling av PI Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. FOLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY ' Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 9S0 (1925) R. L. POLK & CO.'S Wilson Edw (Mittie) elk M Hatfield h511 Coleman la Wilson Edw hlpr hl52 College Wilson Effie Indrs rl42 Plummer's al Wilson Eland (Bettie) lab h352 Hawthorne Wilson Elijah flagmn r253 Broadway Wilson Eliz r212 High Wilson Ella rl36 Oakland av Wilson Ella Mrs spooler h214 Jackson Wilson Ellen (wid Mathew W) h35G Fairview Wilson Elmer A (Dora) reprmn rl57 1st Wilson Erin toll chf opr Sou Bell Tel Co r654 1st Wilson Ernest H bkpr Acme Investment Co r852 2d Wilson Estelle rl20 Tatnall Wilson Estelle Indrs hl09 Short la Wilson Estelle R (wid Herbert A) h212 High Wilson Ethel treas R L Wilson Inc r800 Ridge av Wilson Eula dom r222 Division st la Wilson Evelyn student r361 Church Wilson Fannie cook r772 Park Hotel al Wilson Fletcher C (Florence) h554 1st Wilson Florine student rll7 Washington av Wilson Frank driver rl03 Charles Wilson Frank C (Thelma) trainmn Macon Rv & Light Co h219 Belmont av Wilson Frank G r663 Spring Wilson Fred elk Hammond Service Co rll4 Cole Wilson Geo (Belle) rl33 Jones Wilson Geo (Opal) firemn h511 Calhoun Wilson Gussie r555 Oglethorpe* Wilson Harrison L barber C B Berry r237 Chestnut Wilson Henry lab rl07 Bennett al Wilson Henry S (Verna E) swtchmn h2010 2d WlISTatnalinry W <`Sallie') ro 809 Broadway hl20 Wilson Homer P (Velma) baker Am Bakeries Co hl23 Magnolia Wilson Ivan own a C (wid Sidney) r583 Boulevard N H Wilson Jack H (Annie) hlll4 Oglethorpe Wfison Jackson hse wtchmn Dempsey Hotel r555 Oglethorpe' Wilson Jas (Pearl) carp r458 Bay Wilson Jas (Anna) carp h237 Chestnut Wilson Jas (Ella) lab rl56 Bay Wilson Jas lab rl22 Rock Hill la Wilson Jas M (Julia) sten r324 Carling av (HH) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS f Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy It. Ii. POLK & CO., DETROIT, MICH. MACON CITY DIRECTORY (1925) 981 Wilson Jeremiah L (Mary S) slsmn Singer Sewing Mach Co hll7 Washington av Wilson Jesse E (Maude) lab h211 Madison Wilson Joana (wid Jos) r28 Mellrose Wilson Joel F (Dollie F) auto pntr r300 Flanders (E M) Wilson John lab r311 Division Wilson John textile opr h751 Hawthorne Wilson John E (Eliz) carp h2 Balkcom av WILSON JOHN E (Margaret), Insurance and Real Estate, Agt Travelers' Ins Co, Caledonian Ins Co, Firemen's Fund Ins Co, Fidelity Phenix Fire Ins Co, Northern Ins Co, Ga Casualty Co, 207 Citizens & Southern Bank Bldg, Phone 214, h618 Forsyth, Phone 1629 (See bottom edge) Wilson John M (Mattie) inspr City Health Dept h324 Carling av (HH) Wilson John W elect eng r554 1st Wilson John W (Mary) mech h755 Clinton YATES MOTOR CO. 707 THIRD ST. PHONE 1446 OVERLAND FRANKLIN WILLYS-KNIGHT AUTOMOBILES *3 KV O O H m Si* 52 f > z o o z c 2PzI Co z > a Wilson Jos dairymn rll94 Milledgeville rd Wilson Jos W r78 Bay Wilson Jos W lab r318 Wall Wilson Jos W (Mary) trav frt agt L & N R R h597 College Wilson Julius hlpr rll8 Adams Wilson J Bernard (Pearl) solr Ideal Laundry Co r431 Carling Wilson J Edw (Louise) dept mgr Burden Smith & Co h414 Forest av Wilson Kathleen Indrs h28 Woodliff Wilson Kath rl51 Cole Wilson Lark F (Permelia) collr Union Furn Co rll4 Latta pi Wilson Laura dom r216 Garden Wilson Lawrence driver T L Wood Wilson Leon D (Louisa) cashr Bagley Willett & Paine h400 Hill Crest av Wilson Lizzie Indrs h248 Church la iPoVnI > r r j>omiHon Q C/1 S(DT C-4l cn A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 982 (1925) R. L. POLK & CO.'S Wilson Lizzie Indrs rl04 Holmes av Wilson Lizzie Indrs hl43 Middle (V) Wilson Louis porter r304 Jackson Wilson Louis B mach r663 Spring Wilson Louisa (wid Golden S) hi 803 2d Wilson Mabel Indrs h202 Palace av Wilson Mabel student rl57 1st ' Wilson Mamie Indrs h3 Short st la (EM) Wilson Margt (wid Taylor) h2090 3d Wilson Maria (wid Sylvester) r234 Telfair Wilson Marion carp r237 Chestnut Wilson Major (Mary) chauf r201 Lee Wilson Mary Indrs h364 Bay Wilson Mary Indrs h5 Cherokee av (SH) Wilson Mary mach opr hll2 Cutters la Wilson Mary I sten r212 Calhoun Wilson Mary L dom rl07 Short la Wilson Matthylde r800 Ridge av Wilson Mattie Indrs rl04 Hazel Wilson Mildred L sten W U Tel Co r663 Spring Wilson Minnie Mrs hlpr r217 Jackson Wilson Montie (Fannie) mill opr r419 Shell av Wilson Mose P (Mary) dairymn hll94 Milledgeville rd Wilson Moses D (Dora) trav slsmn hl57 1st Wilson M Luther (Mary) blksmith h212 Calhoun Wilson Nell slswmn Dannenberg Co rll4 Holt Wilson Nettie maid h509 Coleman al Wilson Norman (Cornelia) janitor h413 Ward Wilson Oscar swtchmn r931 Columbus rd Wilson Oscar C (Emma) farmer h Log Cabin blvd Wilson Otis lab hll2 Mitchell Wilson Polly Indrs hl31 Clark la Wilson Randolph G musician rl4, 478 College Wilson Reuben r422 (1318) Steins al Wilson Rheba elk r361 Church Wilson Richd (Ellen) h58 Spring Wilson Robt E trav slsmn Otto-Isaacs Harness Co r 663 Spring Wilson Robt L (Sarah) pres R L Wilson Inc r800 Ridge av Wilson Ruth student rl65 2d Wilson R L Inc R L Wilson pres Mrs S W Whitehead sec Ethel Wilson treas real est 22 Jaques bldg Wilson Sallie B (wid Sami B) r618 New As natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO.. Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON CITY DIRECTORY (1925) 983 Wilson Sallie F (wid David) r511 Calhoun Wilson Sarah r500 Chappell Wilson Sarah lndrs hl2 Chestney Wilson Sarah opr Sou Bell Tel Co r554 1st Wilson Thos (Annie) carp hlOO (485) Short al Wilson Uriah C (Nannie) h555 Oglethorpe Wilson Warren (France's) hll8 Adams Wilson Wm lab h325 Main (EM) Wilson Wm E (Zana) h663 Spring Wilson Wm T (Ada) hl21 Holt av (NH) Wilson Wm W mach r215 William Wilson Wimberly W (Estelle) credit mgr h216 Corbin av Wilson Wynell student r 0 C Wilson Wilson & Co Edgar C Carr mgr whol meats 268 5th Wimberg Jennie elk rlOl Lamar Wimberly Alex porter r220 Lee Wimberly Andrew J (Mamie) carp r332 (258) Pio Nono av Wimberly Bertha lndrs r220 Lee Wimberly Brown cotton broker se cor Pine and 3d h322 Hardeman av Wimberly Brown jr cotton buyer r322 Hardeman av Wimberly Chas (Irene )lab hl39 Woodliff Wimberly Edw (Reby) lab h264 Madison Wimberly Eliza dom r845 Fort Hill Wimberly Eliza soft drinks 527 Hazel rl256 2d Wimberly Eug A (Mary K) slsmn h Massie apts Wimberly Fred (Kate) lab r3 Harris row Wimberly Fredk (Eliza) hl256 2d Wimberly Geo A jr elk Fourth National Bank r802 Spring Wimberly Henry (Fannie) pastor h.220 Lee Wimberly Isaac (Laura) carp h341 Green (CH) Wimberly Jas L lawyer r Hotel Arcadia Wimberly Jennie dom r220 Lee Wimberly Jos lab r552 Hammond Wimberly Jules lab hl2 Plant al Wimberly Julia (wid Brown) r322 Hardeman av Wimberly J H Rev pastor New Hope Baptist Ch r Lee (EM) Wimberly Mary dom r220 Lee Wimberly Mary nurse Macon Hosp r340 Corbin Wimberly Minter (wid Wm M) h427 College Wimberly Olin (Anna) lab h7 Harris row "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. You*; City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 9S4 (1925) R. L. POLK & CO.*.S Wimberly Thos (Ella) farmer h340 Corbin av Wimberly Wossey cook r340 Corbin av Wimbish Eug A (Lillie) supt h Forest Hill av Wimbisb John lab r rear 554 Orange Wimbs Arrie (Martha) lab h514 (239) Hall Wimbush Anna hlpr Enterprise Packing Co Wimbush Edw (Sallie) lab h542 Grant Chapel al Wimbush Elnora cook r235 Bartlett Wimbush Flossie cook r235 Bartlett Wimbush Frances lndrs h209 Holmes av Wimbush Gussie maid r235 Bartlett Wimbush Hattie lndrs h235 Bartlett Wimbush John (Mura) bkpr hl40 Jefferson Wimbush John lab r326 Monroe Wimbush John (Florence) lab li467 Railroad av Wimbush Laura r326 Monroe Wimbush Lee (Dillie) hlpr h316 Corbin av Wimbush Martha hl6 White Wimbush Martha lndrs h49 White Winberg John L (Mary) gro 102 Hazel hl09 Capital av Winberg Louis (Jennie) gro 600 3d av (V) h416 Hazel Winbrew Jeanie lndrs h363 Maple Winbush Pled driver rlOO Roberts Winbush Ulysses (Carrie) pdlr rlOO Roberts Winchester Jas R slsmn rll9 Vista Circle Winchester Thos H (Laura) civ eng hll9 Vista Circle Winders J Fred slsmn Burtons Inc r974 Walnut Windford Odell (Sarah) lab h423 Hicks al Windham Jas J (Glynn) bkpr M E Goode & Co h206 Newberg Windham Sarah nurse Middle Georgia Sanatorium r do Windman Mamie (wid Warren) h715 Pine Winfield Gladys maid r203 Edgewood av Wing Augustus M (Laura B) pres Bearing Supply Co hl206 Ridge av Wing Clifford r407 Forsyth Wing Eliza h404 Ash Wing Harry M slsmn h407 Forsyth Wingate Gordon (Louise) mill hd hi Ford la Wingate John textile opr r765 Hawthorne Wingfield Jesse T cond r715 Pine Wingo Augustus rYMCA Wingo Wm (Laura) chf elk Sou Ry System rYMCA R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 49S6-4957 - , 34 A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON CITY DIRECTORY (1925) 985 Winkfield Emmett (Florena) restr 315 Broadway h 555 Broad (EM) Winkfield Geo (Stella) lab h307 Elbert Winn see also Wynn Winn Augusta (wid Cooper D) h380 Orange Winn Eliz registrar Wesleyan College r380 Orange Winn Fannie lndrs h443 Forest av (V) Winn Ida lndrs b306 Strayers al Winn Mentrous maid r345 Bright Winn Pearl (wid Wm) r319 Walnut Winn Sami J (Minnie L) hl422 Oglethorpe Winn Stewart D (Frances) sec-treas Otto-Isaacs Har- ness Co r380 Orange Winn Virginia lndrs h369 Craft la Winship Dilland student r224 Georgia av Winship Emory h224 Georgia av WINSHIP EMORY (Estate of), R M Yule Mgr, 1009 Georgia Casualty Bldg, Phone 4467 Winship Herring (Florence W) phys 306 Bibb bldg h203 Cherokee av Winship Kath student r224 Georgia av WINSHIP NATHAN R (Mary N), Sec Elks Lodge, h 271 Hardeman av Winship School Jessie Rice prin Pio Nono and Beech avs Winslett Janie R smstrs rl020 Ash WINSLETT USHER T, County Tax Collector, Office 263 2d, Phone 1089, res Masseyville rd, Mogul Sta Winslett Wesley C sheetmetalwkr rl020 Ash Winslett Wm W (Anna) gro 1020 Ash h do Winstead Clarence P teleg editor Macon News r468 Walnut Winters Carrie lndrs h26 Massee la Winters Chas lab r620 Hammond Winters Robt lab r634 Hammond Winters Robt (Lily) night wtchmn r615 Elm Wisdom Festus chauf r480 May av (W H) Wisdom Julia dom r8 Reynolds al Wisdom Milton (Pauline) lab r480 May av (W II) Wisdom Oscar (Birlee) lab h456 Steins al Wisdom Rufus shoe repr r480 May av (W H) Wise see also Weis and Wyse Wise Amanda (wid Warren) h924 (460) Columbus rd Wise Cottage 1138 University pi & O to n FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION to DETROIT R. L. POLK & GO. CHICAGO W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 986 (1925) R. L. POLK & CO.'S "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Wise Edw M Rev (Louese) assistant pastor Mulberry St Methodist Church r318 Cherokee av Wise Jas lab r924 (460) Columbus rd Wise Jas (Nellie) lab hl33 Kahn's al Wise Jos (Annie) lab h522 Plant al Wise Margt r305 Bond Wise Ray lab r924 (460) Columbus rd Wise Sami gdnr r Masonic Home rd Wise Victoria (wid John H) r24 Holt av (N H) Wise Walter hlpr r437 (441) Elbert Witherspoon Elvin D (Ollie) slsmn r312 Napier av Withington Annie L (wjd. J S) h ws Lang av 3 s Os- borne pi Withington Jos S mgr JAhn Malloch & Co r Mrs A L Withington Withrow Chas E Rev (Mary) pastor Belmont Av Free Methodist Church hl36 Oakland av Witman Jack M (Tressie) trav slsmn h307 Crescent av Wofford Oil Co Frank McKeniiey mgr 701 Broadway Forsyth rd ne cor Hartley av 2723 Houston av Poplar nw cor Cotton and 101 Walnut Wofford Pearl Indrs h960 Tracys al Wofford Victoria E Mrs asst matron Masonic Home Wolf Mose (Chyia) shoe repr Meyer Wolf h554V<> Poplar 7 Wolf Meyer shoe repr 554 Poplar r554V2 do Wolf Zehk shoe repr 615 Broadway r554y2 Poplar Wolfe Bertha r355 College ^ Wolfe Edw Mrs h355 College Wolfe Jane E tchr Wesleyan College r232 Georgia av Womack Addie Mrs h214 Knott Womack Andrew J (Mattie E) h513 Arch Womack Attis driver rl53 3d Womack Benj lumber inspr hl611 Broadway Womack Chas W inspr Massee Felton Lumber Co r 1611 Broadway Womack Dora cook rl9 Elbert la Womack Jas J eng r513 Arch Womack P N. slsmn F E Block Co r768 Mulberry Womack R C (Mae) r865 1st Womack Sami (Lucy) carp hl49 (157) Lynwood av Womans Exchange (Cora Walker, Mattie Nutting) 159 Cotton av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of AH Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON CITY DIRECTORY (1925) 987 Womble Starling (Celina) lab h450 Cedar (Unionville) Wood Albert W (Mary) lab h302 (202) Smith (EM) Wood Allen lab Try-Me Bottling Co Wood Arth janitor Rialto Theatre r!14 Holt la Wood A L elk Am Bakeries Co r280 Orange Wood Chas E (Mattie) mech hl34 Steele Wood Cornelia Mrs mach opr rl306 3d Wood Edw lab hl007 Ocmulgee Wood Elmer (Mary) pntr h214 Main (E M) Wood Etta (wid Chas I) h904 Cherry Wood Fredk tchr Wesleyan College r do Wood F W lab r307 Blount Wood Geo H (Beulah) asst formn hl811 2d Wood Geo W mach Taylor Iron Works & Supply Co r Ash cor 1st Wood Georgia (wid C P) rl34 Steel Wood Henry B (Martha J) mach r622 Main Wood Henry W (Ethel; Natl Highway Pharmacy) h 1803 Forsyth rd (V) Wood Henry W (Minnie) carp hl070 Hazel Wood Jack mech r220 1st Wood Jas (Dolly) lab r322 Hammond Wood Jas mill hd rlO Lake City Wood Jas E (Hapsie) elk Sands & Co r2010 2d Wood John A Rev (Leila R) supt Hephizah Orphan- age hll5 Crumps Pk av (C P) Wood John T (Lizzie) slsmn Gulf Ref Co h823 Main (E M) Wood Julian H elk C of G R R Co rl811 2d Wood J N Mrs elk Independent Lndry Co res Riverville Wood Leon (Bessie) firemn h419 Edgewood av Wood Leonard student r215 1st Wood Lula mill hd hlO Lake City Wood Maggie hlOlO Walnut Wood Maggie cook rl007 Ocmulgee Wood Marie iK sten r904 Cherry Wood Martin A Rev (Virginia) pastor Vinewood Av Baptist Church hl02 Pierce av (V) Wood Mary dom r305 Fairmont av Wood Mary E r233 Ayers rd Wood Millard A (Eliz) elk Ideal Supply Co res Wels- ton Ga FOR LISTS OF NAMES ANY TRADE*-- ANY BUSINESS -- ANY PROFESSION DETROIT R. I.. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 988 (1925) R. L. POLK & CO.'S Wood Nancy (wid Jas M) h648 Peeble Wood Ola lndrs r624 Chapman al WOOD-PEAYY FURNITURE CO, C D Peary Jr Pres, K Pallen Sec-Treas, Furniture and Rugs 357-363 2d and 160-166 Cotton av, Phone 153 Wood Raburn M (Laura) drftsmn rll5 Lawton av Wood Robt lab r362 Hazel Wood Robt B repr H R Stearns r312 Carling av Wood Rogers L (Erma) mill hd hl4 Lake City Wood Ruba N (wid Wm T) h255 New Wood Thos D (Ethel) eng hll3 Williams Wood Thos E (Georgia) real est hl713 2d Wood Thos H student rl34 Steele Wood Thos J poultry 419 Cotton av r757 Poplar WOOD THOMAS L (Florence B), Plumbing and Heating, Special Attention Given to Contract and Repair Work, All Work Guaranteed 476 Cotton av, Phone 529, h269 Hillyer av, Phone 2472 (See back cover and page 80) Wood Walter r J B Marshall Wood Wm (Lizzie) lab h750 Sparks al Wood Wm porter h211 Lynwood av Wood Wm A (Haverfield Smith & Wood) rl05 Emory av Wood Wm N (Annice) eng h608 Pine Wood Wm T (Marie S) broker 421 Broadway h213 High Wood Winnie nurse Macon Hosp Woodall Ashby B (Nettie) electn R W Hurley h347 Hydrola Woodall Ashby T (Eliz) lab r363 Clinton Woodall Benj (Della) lab h454 Chestnut Woodall Chas J (Minnie) carp hl97 Belmont av Woodall Chas Y (Mary S) photog 414% 2d hl08 Law- ton av Woodall Edw F elk J N Woodall rl20 High Woodall Eliz dom rlOO Thomas Woodall Frances cashr rl56 Crisp Woodall Gadson rl521 Broadway Woodall Henry F (Lucile) gro 803 Main h724 do Woodall Jas M tchr rl20 High Woodall Jas R (Emmie) carp hl56 Crisp Woodall Jas W (Lucia) druggist 268 Main (E M) h 120 High Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON CITY DIRECTORY (1925) 989 Woodall Jas W (Nora) carp h509 Winsliip Woodall Jarred P elk L & N Drug Co rl20 High Woodall John lab r259 Ocmulgee Woodall Melvin soda dispr r556 Ocmulgee Woodall M L sheetmetalwkr r556 Ocmulgee Woodall Paul P (Pearl) rl521 Broadway Woodall Pearl cook r552 Magnolia la Woodall Ross (Annie) carp h301 Cowan Woodall Spence (Bertha) lab r41 Massee la Woodall Wm A (Illah) meat ctr h373 Clinton Woodard see also Woodward Woodard Bertha nurse Middle Ga Sanatorium r do Woodard Boase (Eva) firemn r444 Cedar (U) Woodard Dock W (Annie) blksmith hll6 Gordon (S M) i Woodard Elias (Mary) lab h428 (411) Pio Nono ac Woodard Jas porter Boston Shoe Shop Woodard Madge R Mrs buyer Union Dry Goods Co h 1307 Vineville av Woodard Mary (wid Henry) r444 Cedar (U) Woodard Montez sten Happ Bros rll6 Gordon Woodard Rebecca slsldy Union Dry Goods Co r274 Columbus rd Woodard Simms (Maggie) lab rll5 Tindall av Woodard Thos (Mary) lab h5 Sparks al Woodard Susie maid rl52 Spring Woodell Luther F (Minnie) elk P O h556 Ocmulgee Woodell Melyea L elk Abbott Bros r556 Ocmulgee Woodfin Jessie slswmn J P Allen & Co rll8 Rogers av Woodfolk Henry (Oleva) lab h315 Hanson Woodford Dotie (Ida) lab h432 Lawton av Woodford Harold lab r432 Lawton av Woodford Lula lndrs r405 E 1st (E M) Woodford Wm (Lennie) lab h405 E 1st Woodmen of the World Ocmulgee Camp No 938 607% Main (E M) Woodruff Benj H (Annie L) rll5 Cleveland av Woodruff Chas N florist 650 Forsyth h636 do Woodruff Emma r266 Maple Woodruff Eva matron Home for the Friendless r266 Maple Woodruff Geo S r636 Forsyth Woodruff Harry M (Bessie) florist r636 Forsyth .FOR LISTS OF NAMES ANY TRADER-- ANY BUSINESSr ,-- ANY PROFESSION DETROIT R. L> POI-.lv & CO. CHICAGO WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 390 (1925) R. L. POLK & CO.'S Woodruff Lulu C Mrs h215 Hendley (N H) Woodruff Mabel Mrs h3, 474 Orange Woodruff Robt M r226 North av (N II) Woodruff Theo P (Cleon) bldr h727 Holt av Woodruff T G emp Cudahy Packing Co Woods Danl G Rev (Olivia) pastor Washington Av M E Church hl42 Sycamore Woods Emma r757 Ash Woods Hamp S (Martha) pntr h610 Bailey av Woods Henry (Lula) lab r307 (205) Charles (S M) Woods India dom h392 Telfair Woods Jas P (Lummie) decorator 509 Arch Woods Riley (Bertha) auto mech h22 Elizabeth Woodson Harvey bell boy h Bartlett la Woodson John H (Beatrice) auto repr h202 Coles al Woodson Leon L (Mary) gro 202 (104) Charles (S M) h do Woodson Mattie lndrs rl39 Bright al Woodson Naomi student r Harvey Woodson Woodsn Oscar swtchmn r930 (942) Columbus rd Woodson W H waiter Loh's Cafe Woodward see also Woodard Woodward Arth (Phyllis) phosphate hl54 Clara (EM) Woodward Chas lab rll6 More la Woodward Edgar r2108 Broadway Woodward Edw (Lottie) hlpr r314 2d av (V) Woodward Edw (Dora) lab hl08 Empire av Woodward Eugenia (wid John) r2323 2d Woodward Felix (Willie P) r2108 Broadway Woodward Fred (Mamie) eng h254 Appleton av Woodward Henry (Lizzie) formn hl630 1st Woodward Mary mach opr h8 Clara (E M) Woodward Oliver shoe shiner r251 5th Woodward Thos L dentist 304% 3d h do Woodward Zack (Lizzie) lab h221 North Woody Mamie lndrs hl7 (15) Wise av (V) Wooler J F inspr Fire Dept r910 Oglethorpe Woolfolk Annie r382 Madison Woolfolk Chas (Annie) lab hi 53 Nussbaum Woolfolk Grace cook h382 Madison Woolfolk Hardeman (Zena) orderly hl02 Empire av Woolfolk Jas lab r78 Smith (S M) Woolfolk Juliebelle nurse h608 Cheatham al Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 991_ Woolfoik Lee lab r78 Smith (S M) Woolfolk Martin (Laura) pdlr h934 (502) Columbus rd Woolworth P W Co E C Pippin mgr 514 Cherry Wooten Alex (Eliza) lab h606 Ross WOOTEN CHRISTOPHER C (Pearl), Mgr Wooten Marble Co, hl02 Capitol av Wooten Fleming elk 4th Natl Bank r220 High Wooten Frankie opr Sou Bell Tel Co r560 Oak Wooten Geo R (Mary) h319 Chappell Wooten Jas B (Nannie) carp rlA Violet av Wooten Jas H (Pearl) firemn hl29 Yates av (E M) Wooten Lee (Mary) h.416 Ash Wooten Lovie r270 Main (E M) WOOTEN MARBLE CO, C C Wooten Mgr, Manufacturers of Marble and Granite Monuments and Slabs 765 3d, Phone 3031 (See right side lines and page 75) Wooten Marie slsldy Union Dry Goods Co Wooten Mary J (wid Cornelius) h560 Oak Wooten Thos M r222 Hines ter (V) Workers Cottage (Paynes Mill) Leah D Seaman so- cial worker Mamie Herndon nurse 69 Davis Workingmans Store Aaron Torchinsky mgr genl mdse 418 Poplar Workman Edw M driver h Lawton rd Worley Chas P (Cora) mgr Union Trading Co r806 2d Wornum Cora cook O R Tharpe jr h Flanders (E M) Wornum Geo (Lola) lab h423 Elliott (E M) Wornum Green (Diana) lab h rear 368 Flanders (E M) Wornum Lillian Indrs r423 Elliott (E M) Worrill Ida rll2 Lawton av Worsham Addison T elk Farmers Exch r234 High Worsham Alberta (wid Wm V) hl35 Rembert av Worsham Augusta tchr r234 High Worsham Claudia bkpr (wid Horace) r623 Main (E M) Worsham D Winfield (Birdis) blksmith r321 Coleman av Worsham Lee S (Gray) elk The Ross Co h234 High Worsham Mary bkpr Dr J F Adams jr rl40 Beech av Worsham Maude rl53 Magnolia . FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS ... -- ANY PROFESSION .DETROIT Ii. L. POLK & CO. CHICAGO Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to 9 Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK S92 (1925) R. L. POLK & CO.'S Worsham Mitchell E (Mollie) car repr h332 American blvd Worsham Robt M (Lula) lumber inspr hl40 Beech av Worsham Wm B gro 397 American blvd h348 do Worsham Willie M student rl40 Beech av Worsham W Eug (Daisy) phys 321 Coleman av h do Worsley Anna r243 Ross Worsley Jas H (Liney) collr Goldgar Furn Co hl069 Hazel Worsley Sarah slsldy S H Kress & Co rl069 Hazel Wortham Nettie D (wid Henry) h287 College Worthen Jesse K lab r333 Middle (V) Worthen Lucius (Hattie) lab rl54 (113) Roye Worthey Anne cook hl32i/2 (132) Green Worthy Anna Indrs r558 Hammond Worthy Ella rl6 Frank al Worthy Grant carp r706 Broadway Worthy Valdora Indrs h208 Moughon Worthy Walter B lab r208 Moughon Wray Chas B (Cath) tchr h629 Adams Wren Lucina r517 E 2d (E M) Wren Mittie Indrs h555 Fulton al Wright Abe (Mattie) h Industrial Home rd Wright Ada Indrs hl64 Coles al Wright Addie Indrs h714 Hawthorne Wright Agnes (wid Jas S) marker Crescent Laundry Co rl28 Winship Wright Alice rl21 Chestnut Wright Allan student r324 College Wright Annie maid r954 Ocmulgee la Wright Annie maid rl2 Wise av (V) Wright Arbaun W mgr Natl Benefit Life Ins Co r207 3d av Wright Arth W carp h210 Central av Wright Athos W (Louise) sta mgr Wofford Oil Co h 208 Central av WRIGHT AUTO SUPPLY CO, M C Wright Pres, Auto Accessories, Storage, Gas and Oil 411-17 Poplar, Phone 1796 Wright Benj (Alma) driver h27 Clara (E M) Wright Carrie rll3 Neal av Wright Carrie student rl25 (113) Green Wray Chas B tchr Mercer Univ h626 Adams Wright Chas C carp r261 (161) Center &C0. r Polk Directory > Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON CITY DIRECTORY (1925) 993 Wright Chas E (Mary) service mgr Ellis Motor Co h 110 Log Cabin dr Wright Clarence (Beatrice) lab r426 (23) Short (E M) Wright Clifford student r324 College Wright C B elk Cudahy Packing Co res Cherokee Hgts Wright C Randolph depy elk Superior Court Wright Della Indrs r4 Harris row Wright Dora h954 Ocmulgee la Wright Edgar (Pearl) lab hl8 Ford al Wright Edw lab r527 E 2d (E M) Wright Edw (Rosa) swtchmn h80 Bay Wright Emma E (wid John J) h Log Cabin blvd Wright Estelle matron Methodist Orphans Home r do Wright Eurel porter rl09 (193) Richard Wright Eva cook r Marshall Wright Wright Evelyn tchr rl29 Culver Wright Florene Indrs r540 (136) Grant Chapel al Wright Frank (Sarah) pdlr hl73 4th av (V) Wright Fred C poultrymn r Mrs E E Wright Wright Fred H (Ola) elk hl41 Piedmont av Wright Geo (Connie) hl26 (3) Holt av (N H) Wright Geo bkpr rl04 Courtland av Wright Geo (Fannie) carp rl Bears al Wright Geo S slsmn h Log Cabin blvd Wright Georgiana cook r338 Woodliff Wright Geraldine L (wid Leonard R) slswmn Florida Real Est Co h254 College Wright Hannah r427 Ridge av Wright Harry (Hattie F) seeds 306 3d h644 Forsyth Wright Hattie (wid Wm 0) h508 Church Wright Hattie L student r508 Church Wright Henry L barber Am Barber Shop rl20 Washington av Wright Hilliard bellmn r244 Ellis av Wright Horace A (Monica D) v-pres Standard Handle Co h587 College Wright H Reid rl28 Winship Wright Israel (Rosa) lhr chkr h510 Martha (E M) Wright Jas (Annie) elk h.409 Campbell av Wright Jas (Alice) presser hl21 Chestnut Wright Jas S mech rl28 Winship Wright Jas T (Amanda) carrier P O hl25 (113) Green A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 994 (1925) R. L. POLK & CO.'S Wright Jas T jr gro 125% Green rl25 do Wright Jas W (Mattie) lab h261 (161) Center Wright Jesse E (Aileen L) phys 805-7 Ga Casualty bldg h324 College Wright John (Julia) mech r503 Fort Hill Wright John W (Josie) mill hd h240% Roff Home av Wright J Carlton rl28 Winship Wright J W wtchmn Enterprise Packing Co Wright Kath r440 Duncan av Wright Kerney W janitor h2 Orchard av Wright Lena cook hl25 Cheatham al Wright Leo elk 4th Natl Bank r508 Church (E M) Wright Lessie mill hd r240% Roff Home av Wright Lillie dom r405 (305) Hall Wright Lillie Indrs h405 (305) Hall Wright Maggie cook r2 Orchard av Wright Marie cashr Burden Smith & Co rl28 Win- ship Wright Marie Indrs r405 (305) Hall Wright Marshall (Reada) millwright h Industrial Home rd Wright Mary cook h615 Ross Wright Mary F nurse hl07 2d av (V) Wright Mary L r440 Duncan av Wright Mary W janitress Federal bldg Wright Mattie tchr h503 Fort Hill Wright Maurice C (Adabelle) pres Wright Auto Sup- ply Co h2, 232 High Wright Myrtle slswn Barker Bakery rllO Log Cabin dr Wright Nellie nurse Macon Hosp Wright Nelson (Gertrude) lab h515 E 2d (E M) Wright Nettie cook h608 Flanders (E M) Wright Nora r201 Hydrola Wright Peter (Ella) lab hiO Frank al Wright Pompy (Fannie) pdlr hl50 Lynwood ay Wright Riley (Francis) lab hll3 Neal av Wright Robt A rl28 Winship Wright Rufus (Ethel) mill hd hl045 1st Wright Sara cashr Union Dry Goods Co r508 Church Wright Scrap elk rl40 Magnolia Wright Stella Indrs r620 Prince Wright Steph M (Margt) druggist 503 Broadway h867 Mulberry Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH' SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON CITY DIRECTORY (1925) 995 Wright Susie Indrs hl22 Cowan Wright T Gordon (Anna L; Wright & Reeves) h440 Duncan av Wright Ulysees porter rl20 Virgins la Wright Velma opr The Wm Carter Co r261 (161) Center Wright Victoria h433 Forest av (V) Wright Walter M elk supvr Signals C of Ga rl04 Courtland av Wright Warren (Hattie) draymn hl20 Virgins la Wright Wm gro 201 Elm h do Wright Wm (Walter) hlpr hl208 Broadway Wright Wm (Rosa) lab h321 Ellis av Wright Wm lab h503 Fort Hill Wright Wm lab rll3 Neal av Wright Wm (Lena) lab h515 Smith row Wright Wm lab r2434 Strayers al Wright Wm B (Etter) brklyr hl39 Ross Wright Wm C slsmn Dickey Auto Supply Co r354 Spring Wright Wm H (Mamie) hl04 Courtland av Wright Willie rl!3 Neal av Wright Wilson A (Gertrude C) ship elk J B Riley Drug Co h354 Spring Wright & Reeves (T G Wright H V Reeves) dry gds 416 Poplar Wrigley Henry P (Margt) cond h202 College pi Wrigley Virginia sten Nye Odorless Crematory Co h 324 Forsyth Wroten Josie L Mrs timekpr r457 New Wrye Arvie M r518 Clinton (E M) Wrye Jos r518 Clinton (E M) Wrye Jos W electn h518 Clinton (E M) Wrye Ruby L blksmith r518 Clinton (E M) Wyach John r765 Mulberry Wyatt Dennis P (Susie) elk hl07 Napier av Wyatt Festus mill hd rl017 1st Wyatt John lab r318 Wall Wyatt John W W (Dora) yd cond hl39 Williams Wyatt Maud Mrs millwkr r31 Manchester qtrs Wyatt Maude L (wid Jas T) r321 Pio Nono av Wyatt Robt L (Amy S) spl repr United American Ins Co h.452 College Wyatt Victoria rl017 1st FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 996 (1925) R. L. POLK & CO.'S Wyche Annie C Mrs cashr Peeler Hardware Co rlOO Corbin av Wyche Benj P (Carrie) asst eng MFD Sta No 5 h2214 2d Wyche Bernard M (Dorothy) elk Gulf Refining Co r 245 Winship Wyche Carrie h218 Pear (B M) Wyche Eugenia cook r rear 576 College Wyche Guy C elk rlOO Corbin av Wyche Henry (Linnie) mech h Robinson rd Wyche Jessie tailoress r404 Broad Wyche John waiter h404 Broad Wyche John A (Gertrude) slsmn hl27 Washington av Wyche John C (Eunice) asst frt agt C of G R R Co h 100 Corbin av Wyche John C jr rlOO Corbin av Wyche Lemmie elk Dempsey Hotel Soda Room r2214 2d Wyche Lewis A (Lucile) elk h2837 Houston av Wyche Mack (Ida) eng M P D No 5 h Columbus rd Wyche Mattie (wid J M) hl414 Edgewood av Wyche Prentice E mach rl414 Edgewood av Wyche Roy W (Annie C) elk rlOO Corbin av Wycroft John W (Fannie) elk rl27 Columbus av Wyne Georgia cook h607 Railroad av Wynes Adelline (wid Wm) rll2 Roff Home av (V) Wynes Marie Indrs h8 Gas House al Wynes Raymond rll2 Roff Home av (V) Wynes Wm (Minnie) carp hll2 Roff Home av (V) Wynn see also Winn Wynn Elijah Rev (Ella) pastor Primitive Baptist Church h211 Pond Wynn Eliz E (wid Bossey) h421 Oak Wynn Prank (Viola) h531 Forsyth Wynn Geo O (Jackson-Wynn Co) res Culloden Ga Wynn Goode (Ella) lab r800 Curd (S M) Wynn Henry (Tommie) mech hll3 (117) Heard (SM) Wynn Henry (Bessie) waiter h215 1st av (V) Wynn Jas E (Annie) gro Columbus rd res R D 2 Wynn Jas R (Cora) porter r415 Ward (V) Wynn John H (Evelyn) flagmn r3004 Houston av Wynn John H (Lee A) mech hlpr r200 (5) Smith Wynn Julia cook h200 (5) Smith FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings MACON CITY DIRECTORY (1925) 997 Wynn Lila student r211 Pond Wynn Lillie M cook r200 (5) Smith Wynn Mary (wid Gordon) h410 Beech av Wynn Mattie nurse r302 (202) Charles (S M) Wynn Osborne elk P O r539 (707) Vineville av Wynn P Jas (Nancy) lab h420 Elliott (E M) Wynn Wm M (Ruth) r712 2d Wynne Robt (Jessie) slsmn h200 Clisby pi Wynne Robt jr (Susie) elk Morris & Co ;r200 Clisby Pi Wyre Albert L (Annie) mech hl04 St John Wyre Annie L elk rl04 St John Wyse see also Wise and Weis Wyse Geo W (Dessie) flagmn hl07 School X V Clothes Shop J V Sheridan mgr 454 Cherry Yancey Evelyn student r2420 2d Yancey Thos B cond r2420 2d Yancey Tossie (wid Chas V) h2420 2d Yancy Chas B (Nora) formn r960 Walnut Yancy Emmett W (Nannie) electn h746 Oglethorpe Yarborough Boyce (Maude) dept mgr r825 Orange Yarborough Clara Indrs hl23 Army Lot Yarborough Eug porter rl23 Army Lot Yarborough Sadie r2804 Houston av Yarborough S Jack (Clifford) city firemn hl36 Ellis (S M) Yarborough Wm J (Kate) mech eng h2804 Houston av Yarbrough Alvin H hlpr rl21 Broadway Yarbrough Agnes (wid Henry) rl21 Broadway YARBROUGH C AUGUSTUS (S Viola), Dentist 503- 500 Citizens & Southern Bank Bldg, Phones 3431 and 3085, h438 Vineville av, Phone 5134 Yarbrough Ernest E (Mary E) slsmn W G Lee rl335 2d Yarbrough Flossie student r438 Vineville av Yarbrough Gustie student r438 Vineville av Yarbrough J Albert rl21 Broadway Yarbrough Mae (wid A G) rl07 Broadway h do Yates Andrew J (Bertie) slsmn Yates & Tabor Co r 1717 3d YATES CHARLES H, Pres-Treas Yates Motor Co, r 218 Coleman av, Phone 2062 Yates Chas J (Tommie S) lumber h320 Spring Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 998 (1925) R. L. POLK & CO.'S YATES DURWOOD (Arlena), Y-Pres Yates Motor Co, Y-Pres Center Hdw & Supply Co, h374 Orange Yates Edw lumber checker r320 Spring Yates Elmer E (Lula) ship elk Kingman & Everett r624 Montpelier av Yates Evelyn S sten Idle Hour Nurseries r320 Spring Yates Fred dept mgr Jones Motor Co r360 New Yates G Morgan (Margt) slsmn h404 Forsyth Yates Helen student r29 Arlington pi Yates Jas E (Mary R; Yates & Tabor Co) h29 Arling- ton pi Yates Jas E jr (Gladys) slsmn Cudahy Packing Co h Forest Hill av Yates Josephine cook 1218 Ash Yates Laura (wid Jas M) h246 Willingham Yates Luther (Frances) r605 1st Yates Melvin D slsmn Carter Hdwe & Supply Co r374 Orange YATES MOTOR CO, C H Yates Pres-Treas, Durwood Yates V-Pres, A M Harrison Sec, Overland, Franklin and Willys-Knight Automobiles 707 8d, Phone 1446 (See right center lines and page 54) Yates P B Machine Co S C Darling mgr 461 5th Yates Roselyn S nurse r320 Spring Yates Sarah (wid Geo W) h218 Coleman av Yates Wm E msngr r705 Columbus rd Yates Zonnie D (Sallie) guard h705 Columbus rd Yates & Tabor Co (J E Yates J S Tabor) 274-80 5th Yeager Frank 0 (Myrtie) mach rl07 Rogers av Yeager F H mgr Collins r Lanier Hotel Yeager Louise sten A S Hatcher Co rl07 Rogers av Yeager Wm J (Emmie) mach hl07 Rogers av Yearty Jas T (Nellie) trav slsmn h226 North av (NH) Yearty Rachel Mrs slswmn W T Grant Co r458 Edgewood av Yelin Benj Rev (Vera) rabbi Congregation Sherah Israel hl59 Broadway YELLOW CAB CO OF MACON, GA, E H Baker PresTreas, W M Hodges Jr V-Pres, B C Snow Sec, Fifth St side Terminal Hotel Bldg, Phone 5000 (See back cover, left side lines and page 85) Yeoman S Scott carp r968 Columbus rd Yeomans Allen C agt Bankers Health & Life Ins Co res Myrtle Hill Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eieScetndptroosHpeeacdtsqufaor-r ters for all kinds of Automobile Lists. Our new Ccoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfoHr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 999 Yeomans Helen .student r318 Hydrola Yeomans Henry (Sallie) farmer h212 Jackson Yeomans Sami Ifc (Lula; Yineville Pish Co) r318 Hy- drola Yeomans Wallace C agt Bankers Health & Life Ins Co r514 Pine Yetter Geo P (Dellie) plmbr 458 Cotton av hl415 2d Yin Gee Indry 363 Cotton av h do Yopp Sami M agt Ind Life & Health Ins Co Youghn Wm P (Pearlie) h Grand av (Bellevue) Young Ada Indrs h361 (2) 7th Young Annie mus tchr r218 Belmont av Young Arnel maid r4 Wall St la Young Arth C (Eliz) asst yd mstr h2453 2d Young Bessie maid h439 4th av (V) Young Chas (Docia) lab h359 (3) 7th Young Chas (Fannie) lab hl08 (8) Toombs Young Clarence (Missouri) pdlr h941 (245) Columbus rd Young Cora Indrs r21 Wall st la Young Council lab r364 Hazel Young Emma r941 (245) Columbus rd Young Emma C (wid Thos E) h433 Ross Young Ernest M (Myrtle) elk rl414 Edgewood av Young Everett appr r860 2d Young Glendaii D baker r311 Fairmont av (Bellevue) Young Harry L (Alice) carrier P O h457 Duncan av Young Henry porter rl Hill av (PH) Young Homer J mech Yates Motor Co rl57 3d Young Howard (Addiebell) lab r318 Monroe Young Ina Indrs r364 Hazel Young Inez dom r4 Wall st la Young Inez maid rl24 Sycamore Young Irma Indrs rll7 Elliott (EM) Young Jack (Clara) lab r43 Massee la Young Jas L (Kath) trainmstr Macon Div C of Ga' hllO Courtland av Young Jas L jr sten rllO Courtland av Young Jas R student r205 Oakland av Young Jas S (Frances E) cond h205 Oakland av Young Jennie Mrs hl674 2d Young John (Chanie) porter hl90 (178) Lincoln av (V) Young John (Malinda) lab h200 (305) Neal av tn pi ' a> T m 7 - A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Poor Co. Office, 457 Third St. Telephones 278 & 3976 1000 (1925) R. L. POLK & CO.'S Young John A (Mamie) slsmn h562 Edgewood av Young John A jr firemn r562 Edgewood av Young Jos (Susie) lab h4 Wall st la Young Julia rl24 Sycamore Young Laura Indrs h364 Hazel Young Leotha V (wid Jas) h311 Fairmont av (B) Young Linna hskpr Mrs E W Blount r364 Orange Young Logan lab r364 Hazel Young Louise tchr r417 Ward (V) Young Lula r562 Edgewood av Young Lyman (Mary) pntr hlll7 (116) Woolfolk Young Mack S driver r562 Edgewood av Young Mary cook hl24 Sycamore Young May r203 Hydrola YOUNG MEN'S CHRISTIAN ASSOCIATION, 0 E Maple Genl Sec, P A McArthur Physical Director, Frederick Shannon Membership Sec, W E Griffin Boys' Work Sec, A J Coffee Office Sec, 1st nw cor Cherry, Phone 4937 Young Mittie (wid Edw) r764 Plum Young M Freeman (Mary) h257 Hardeman av Young Ola Mrs asst matron Masonic House Young Oscar hlpr rl21 Telfair Young Percy E (Nellie) plmbr T L Wood h394 Bel- mont av Young Pierce A (Ruth) cond hl413 2d Young Richd (Louise) mach r311 Fairmont av (B) Young Robt (Carrie) lab h230 Park Hotel al Young Robt mech r500 Edgewood av Young Robt J elk r205 Oakland av Young Sarah r303 Patterson Young Tallulah r218 Belmont av Young Thos E (Ethel) v-pres Ideal Supply Co h292 Winship Young Wash lab r Wash William Young Wm (Gertrude) h rear 608 4th av (U) Young Wm (Stella) lab h21 Wall st la Young Wm A (Lillian) firemn r716 Plum Young Wm iK (Dell) elk County Tax Receiver res R D 1 Young Willie brklyr rl24 Sycamore Young Women's Christian Assn Margaret C Hayes genl sec 453% Cherry Young Women's Christian Assn Building 763 2d FOR LISTS OF NAMES } ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON CITY DIRECTORY (1925) 1001 'Young Women's Christian Assn Residence M F Milner matron 763 2d Young Zack B (Lucille) flagmn hl421 2d Youngblood Benj bellmn rl36 Woodliff Youngblood Rufus W (Lois) h625 Adams Youngblood Wm C (Mary) uphol hl60 Sycamore Younis David (Mary) gro 102 Bay h do Younis Edw elk rl02 Bay Younis Emmett elk rl02 Bay Younis Mary dom rl02 Bay Yule Roger M mgr Emory Winship Est r224 Georgia Zachary Henry brkmn r420 Hawthorne Zackey Alonzo (Mabel) lab 400 (100) Texas Zackery Fannie cook r201 (220) Texas Zalomus Geo waiter P A Callianos r340 Duncan av Zalomus Steven waiter P A Callianos r340 Duncan av Zanders Essie Indrs r310 Hanson Zanders Mattie cook h310 Hanson Zanders Wm (Julia) lab h541 Henrietta Zarks Mark (Mary) gro h742 Walnut Zarks Rachel sten Ga Loan & Trust Co r742 Walnut Zarks Robt mgr Empire Furniture Co r742 Walnut Zarks Rose sten North Carolina Pine Assn Inc r742 Walnut Zeager Mary h907 Ash Zeigler Danl (Emma) lab h521 Johnson's al Zeigler Elijah H wood 216 Middle (V) h do ' Zeigler J Russell mgr The Schwab Co rl21 Culver--' Zellner Dolly Indrs h8 Frank al Zellner Dudley driver Parcel Delivery Co rll5 Forest av Zellner Fredk E (Fannie; Zellner's Garage & Battery Co) r Geo W Thompson Zellner Garage & Battery Co (F E Zellner) 509 Cotton av Zellner Lettie Indrs h317 Watson al Zellner Loraine sten 4th Natl Bank r Nevaro apt Zellner Wm M (Addie) gro 115% Forest av (V) hll5 do Zellner Wm M lab h704 3d av (V) Zelner Fannie Indrs hl8 Gas House al Zemlich Carl V (Eliz) tailor 356% 2d hll62 Ogle- thorpe FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO CL 2 P g ^-43fK D ty S' p^ m Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 3 002 (1925) R. L. POLK & CO.'S ZERBAL LODGE OF PERFECTION, Ancient and Accepted Scottish Rite of Free Masonry, Kadmiel Chapter Knights Rose Croix, Marshall A Weir Preceptory Knight Kadash and Macon Consistory, H G Hollingsworth Sec, 710 Mulberry Masonic Temple, Phone 8477 ZIEGLER ROBERT F (Eunice D), Sec-Treas Dunlap Huckabee Auto Co, hl33 Summit av, Phone 1505W Zierer Henrietta student rl46 Deborde Zierer Mamie (wid Henry A) rl46 Deborde Zigler Jane cook h210 Bartletts Zigler Mary maid Fred Patterson h907 Ash Zuber Hinton C dept agt Am Ry Exp Co h33 Pio Nona av Zuber John M elk Piggly Wiggly r33 Pio Nona av The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO POLK'S STREET GUIDE and Directory of Householders OF THE CITY OF MACON 1925 ACADEMY --From 614 510 Isabell Benton 'Ocmulgee west to 511 Chas H Roberts Walnut 513 Lizzie Nelson 102 Vacant 515 G M Green 103 W B Daniel 106 Vacant 109 Mrs Belle Hurst 112 Mrs Cinthia Syl- vester 517 Mary Gilbert 518 Vacant 519 Ella Lawrence 521 John Dennis 523 Margt Myrick 115 B B Renitz 116 L D Baughcum 121 A W Stallworth 122 M B Souther ADAMS--From C of G By, south to limits, 2 w of College 124 Chas Chirbas 100 Henry Bowden 125 D B Harrold 101 Anna Taylor 128 Mrs Marie Goette 102 John Parker 131 R E Mills 104 Prank Carter 134 C E Turner 111 Vacant 135 P C Powell 112 Vacant 141 C D Tyner 114 Nellie Stewart 145 0 V Golden 115 Julius Taylor ACADEMY EAST (E M) -- From Water north to Clinton, bet 1st and 2d 140 Sarah Lewis 146 Cora Payton 150 Wm Harris 151 Charity Sparks 160 Silver Jas 417 Chas Douglas 449 Squire Bush 451 Otis Veal 452 Henry Ware 453 Emanuel King 457 Ottis Collins 458 Chester Ford 459 Mary L White 460 Henry Daniels 501 Jesse Glawson 502 Chas Davis 508 John Williams 116 Mattie Stephens 117 John Pryor 118 Warren Wilson 124 David Greene 129 Eug Calhoun 130 Timothy Butler 133 Larkin Smith 134 Ernest Glover 135 Thos Powers 144 Laura Lawrence 148 Wilson Smith Chestnut 216 J N Geeslin 217 Vacant 219 J G Pugh 220 Vacant 221 T A Johnston 223 Dixie Boston 224 W T Bragg 225 R S Morgan 227 Chas Leech 229 Jos Haskins Oglethorpe 305 H D Chapman 307 Mrs E M Storrs E L Hiller 312 C A McAlister 317 W H Baskin 325 W A Taylor 337 Louise Smith 341 J S Tabor Hazel 405 Mrs Ella Hicks 409 R L Pulliam 417 P E Adams 419 J R Odom 421 J G Harrison Ash 501 R W Weaver 503 B D Ragsdale 503% A P Montague 505 P S Flippen 505% Jos Robinson 507 C T Goode 507% W T Smalley 509 Peyton Jacob 509% A H Newman 517 Cynthia Holiday Hall Elm 613 W A Hudson T A Holton 617 H C Bond 625 R W Youngblood 626 Chas B Wray 627 Dr S N Rubin 629 C B Wray Edgewood av 703 W E Polk 705 R W Lyles 709 E R Spence 711 W B Clark 801 W E Adams PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking ( Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. 1004 Alabama (S M) MACON Anderson (S M) ALABAMA (S M)-- 473 Jas Pitts 342 Rev J A Rountree From Plant It to 475 Frank Holloway 348 W B Worsham Edg'ewood av 3 e of 8 477 Pitt Collins 397 W B Worsham gro College 1 Jas Hamilton 2 Lonnie Keefer 3 Josephine Cullins 4 Minnie Johnson 5 Gertrude Clayton 6 Valley Burkett 7 Estelle Jenkins 8 Reesa Ellison 9 Nathaniel Tinsley 10 Parmalee Battle 11 Geo Fann 12 Wm Odum 13 Malissa Smith 14 Melvin Harrell 15 Frances Bayson 16 Chas Ward 204 Elmo Jones 205 O M Perry gro 430 Alice Janes 431 Rosa Harrison 432 Chas Manard 433 Wilson Webb 435 Laura Gilmore 437 Mamie Bostic 438 Wm Powers clo clnr 439 Davis Cummins ALABAMA AV (V)-- 1318 Vineville av s to C of Ga tracks 104 C W Johnson ALBERMARLE PL (Ingleside) -- From Forsyth rd north to Overlook av 1 w of Belvedere dr ALBERT (S M)--From Boundary to Reid, 2 w of Fourth AMERICAN BOTTLEVARD--From intersection Log Cabin blvd and Grand av n o r th and west through Bellevue 113 M C Tharpe 115 W L King 119 J W Harrison 121 Vacant 122 E E Garrett 125 J E Harvin 203 J L Millirons 399 Bellevue Drug Store 401 J F Perkins 402 J H Redmond 407 W H Brice 408 W F Arnold 411 Vacant 412 F L Minor 415 E C Davis 416 Mrs Minnie Cul- pepper 423 J R Land 424 W H Robinson 425 R B Shepard 437 J B Harper 502 R O Thomas jr 505 J H Sawyer 509 M Crow 511 J B Joiner 515 J B Joiner 715 O E Cox 801 M R Alston 802 Emmett Sasser 815 J T Britt 863 S A Jackson ws Bellevue Public School 1915 S G Pate 441 Geo Thomas 442 Danl Ryder 443 Perry Smith 444 Berry Howard 445 Ella Morris 446 Lillie Gillmore 449 Vacant 450 Mattie Collins 451 Ethel Butler 452 W E Ridley 453 Jos Evans 455 Sills Battle 456 Wm Hazzard 204 A Kelsall 207 Leonard Freeman 211 W A Thompson 216 T E Brown AMOS (V) -- Ward east 1 Vineville av From n of 218 C I Patterson gro 105 Joshua Clyatt 223 F L Minor 108 Carles Bowen 225 R L Whitaker 228 R T Perry 205 Oscar Sutton 206 Frank Tanner 234 John Wald 282 John Blount 238 J E Lord 241 R B Hudson 244 Rev H H Connell 306 Eva Merrill 802 Lewis Johnson 808 Ida Murphy 245 H B Long 815 Hazel Johnson 459 Geo Coles 307 H K Best 460 Cooper Williams 308 J B Harrison 461 Mattie Benn 315 O L Mosley 462 Jack Williams gro 316 S O Kenyon ANDERSON (S M) -- From 2017 Second, west to Nisbet av 463 Roberta Thomas 317 Mrs L H Veale 609 Milton Simmons 464 Jos Finney 326 Vacant 615 H L Logan 465 Anna Richardson 327 R E Williams 620 J R Whittington 466 Richd Hicks 328 Robt L White 628 J F Osborne 467 Henry Collins 469 Jas Collins 331 R R Willis 332 M E Worsham 630 F F Walters 632 Mrs Josephine 471 Virgil Whitby 336 Gus Gilleland Giles KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vz% on Savings Anderson (S M) STREET GUIDE Arlington Place 1005 695 Wm U Nipper 137 Mrs Mary Ohara ARCH--From Broad- 699 J N Etheredge 140 Michel Bloch way west to Junction 701 J E Jones St Paul ends of New and Orange, 9 704 J S Atchison College s of River 709 J M Deavours 202 E E Jenkins 411 W W Tanner 710 Mrs Maggie Mat- 204 T B Pargason 417 C C Halcomb thews 207 Mercer Dormitory 425.A P Wilder 718 R H Bloodworth 252 Vacant rear Meaders Mattress 719 now Padgett 254 R P Orne Co 720 R L Thompson 256 O W Hays 453 M E Gallagher 724 Mrs Lillie Blood- 260 Vacant 455 H O Fulford worth 725 Vacant 734 W H Collins 735 C P Ivey 744 C S Simpson 749 G P Alexander 752 Mrs I A Taylor 757 H A Pittman 760 W H Jones APPLEWOOD (E M)-- From Balkcom to Third av 100 Carrie Waters 102 (105) Whittaker Stevens 107 Mrs S E Balkcom W L McKay 457 Mrs Belle Miller Third 509 J P Woods Mrs M B Freeney 513 A J Womack 521 C L Ennis 551 S A Moore 555 J H Jones 556 Arth Askins 763 Mrs Dorothy Wat- Balkcom 558 Vacant son 209 S W Wasner 560 H C Cooley 764 J L Johnson 211 R P Balkcom 561 Vacant ANDERSON AV-- 213 M L McDaniel 562 W C Dozier Changed to Amos 214 S V Davis Second ANOLA PL (V)--From Corbin av west, 1 n of Clayton -- H H Johnson ANTHONY'S RD (S M)--Continuation of Jeff Davis 215 Wm R Clarice 216 Benj L Spikes 217 Edw Davis 219 J C King 223 M J Hammock 223 (226) W P San- ders 224 Mrs C Preston 613 W A Robertson J E Avera 616 M J Thompson 617 Antonio Cutro 620 J B Meyer 627 Mrs Bridget Mur- phy 655 Danl Cunningham W L Gray ANTIOCH RD (S M)-- 225 Z K Estes 658 W B Gaultney Changed to Gantt City Fairview 690 Mrs Jane Bott rd 358 Rev Wm N Renzer First APPLETON AY--From Columbus nw to Monroe, 1 sw of Orange 400 Wm E Davis jr 401 (308) Mrs H J Nelms ARDVINES' AL--From Elm west to Edgewood av, bet Broad- 105 W W Brown 402 Cleveland Bland way and C of G Ry Columbus 106 Grady Smith 107 D A Warlick 108 Vacant 109 W P Clarke 111 H A Kennington 120 B B Cone 121 Vacant 124 H A Stephens 403 Louis Bonner 404 Mrs Callie Beck ARLINGTON (E Un- 408 Emma Hodges 409 Chas Butler changed to Yates av Powel] 411 Minnie Wilburn ARLINGTON AL (EM) 412 (406) Annie Mar- --From 115 Powell tin north 418 Fred Tinsley ARLINGTON PL-- 124% Vacant 419 Emma McCook From 450 Washing- 129 Mrs J R Black 426 (439) Edw Cody ton av to Forsyth 130 S P Howard 429 Vacant 1 W P McNair 131 C G Swisher 440 Albert Sharp 7 W A Freeman More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1006 Arlington Place MACON Ash 16 Vacant 459 Silas Thomas 665 Wm Hutchings 17 Mrs M H Chand- 522 Pinky Foster ler 523 Ella Roberts 670 Clifford Beasley gro 19 Dr F B Mitchell 20 J R L Smith 21 Vacant 28 M E Everett 536 Chas Munson 538 Julia Davis ASBURY AY--Bellevue 29 J E Yates ASH -- From Division 33 Dr A S Moore west to limits, 13 s 34 F M Daniel of River 35 P E Lee 123 Nettie Bivins 36 Vacant 125 Milton Smith 37 R L Dickey 126 Wm Griswold 42 James Green Gilmer 51 C E Newton Hammond 53 Mrs M E Brown Elbert 54 Louis Avrunin 306 John Daniels 58 M D Jones 308 Lucille Owens 61 Frank Johnson 310 Gladys Smith 62 Elliott Harris Fifth 65 Mrs E B Boynton 311 Anna Harris 66 Wesleyan Teachers' Home 70 B P Walker J K Nix 71 Mrs M R Huguenin 76 Jos Clark 77 J T Moore 79 W C Kilpatrick 82 Vacant 83 S P Sandford Mrs E C Riley 87 W H Fish 88 W E Bozeman 93 M E Thomas 314 Tracy Alford 317 Jesse Blanford 321 Florence Stanley gro 322 Sami Williams 353 Mattie Smith 354 Mary Saunders 358 Anna Anthony 360 John Smith Broadway 400 Vacant 404 Liza Wing 408 Annie Mathis 410 Jos Mays 416 Lee Wooten Forsyth 417 Ruby Anderson ARLINGTON PL N-- From Jefferson s to Georgia av, continuation of Madison 420 Chas Mathis 421 Hattie Woodall 453 Mrs M L Richards 476 F E Blalock Third 1 W P McNair 514 L M Ash . 7 W A Freeman 520 C M Loevin 523 F M Pair ARMY LOT--From 822 Emily Willoughby Ash to Elm 553 J S Smith 121 Osa Hobbs 554 Mrs M E Raney 123 Clara Yarbor- 556 L C Richards ough 559 J F Brice 670% Mrs Georgia Patton First 702 J L Murchison 710 Green Carvest 711 Ada Hammock 713 Mattie Vaughn 715 Lizzie Cooper 718 Wm Smith 724 J G Thornton 726 Dock Jordan 728 Neuman Allen 749 Lucile Cain 751 Allen Ross 753 Stella Combs 755 Sophie Hardwick 757 Marion Griggs 759 Floyd Galamore 760 John Anderson 761 Emmett Martin 763 Wesley Brunson 764 Homer Reddick 765 Gordon Williams 767 Wm Crawford 769 Wm Davis 770 J W English Telfair 803 Walter Williams 807 Sank Frederick 809 Allen Felder 810 Luther Wheeler 814 Wm Reeves 816 Wm Pollard 818 Mittie Brown 819 Rena Smith 822 Lee Hill 823 Sanctified Church 851 Henry Milner 852 Wm Craft 853 Essie Tompkins 854 Claud Brooks 855 Ophelia Taylor 857 Lucile Thomas Jackson 903 Robert Howard 907 Mary Zeager 130 Jesse Frederick 132 Berry Pitts 134 John Jackson 135 Edw Anderson 455 Lula Russell Second 645 A D Akridge 647 H L Richards 649 O S Shipman 651 Mrs Ellen Davis 909 Martha Stephens 911 Jos Dunn 912 H C Davidson 914 Vacant 915 Matt Jackson 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 Ash STREET GUIDE Balkcom (E M) 1007 917 Vacant 919 Vacant 170 Orbon Davis 172 Levi Hunt 233 W M Bartlett jr 411 Jack; Alexander 921 Vacant 174 E M Mack 413 R T Perry dairy 925 Edw Taylor Calhoun 1014 W H Tanner 1016 R W Smith 1018 Williams Hart- well W 1019 Mrs R J Jones 1020 W W Winslett gro 1023 T W Cobb 1024 J C Ward 1028 Vacant 176 Rodger Smith 200 Julia Prater 202 (279) Rosa Reese 204 (278) John Mit- chell 206 (276) Wilson Daniel 210 (280) Vacant 278 Vacant 292 Jos Prince BACON (S M)--From Hanson south to Rutherford, 1 e of Houston av 120 F E Holston 140 Mrs Carrie Sutton Cleveland av 217 E M Burgamy 220 G C Beckum 236 A J Barnes 1054 Walter F Holland 1055 T A Moore 1061 W D Bloodworth Annie S Osburn ASTOR PLACE (E M) --From Astor West to Woolfolk 4 Jas Davis BACONFIELD (E M)-- Spring, north of river 200 R L Smith 1068 1111 1115 1116 Mrs Mollie Hunnicutt Ross Vacant Vacant Rex Mclnvale 5 Mrs C C Douglas ATLANTIC AV (Belle- vue) -- From American Blvd west 1 s of Forest av BAILEY AV (C H)-- From Napier av s to Montpelier av, 4 blks w of limits 401 J W Chambliss 1117 R Li Walker 1118 Vacant 1119 R L Walker gro ATLANTIC AV (S M) BAKER (E 31)--From --From Stratton Broad south to Washsouth, 1 e of Elbert ington, 1 w of Duval 1120 M R Stephens Shamrock 1153 R L Thompson 1155 Rev J C Mays 1165 H J Richter 1171 Vacant 1173 Vacant 1174 Vacant College South begins 1206 Prentice Findley 20 Spencer Durden 914 Lula Tucker 916 Harrison Waters 918 Alma Heath 919 John Williams 920 Mose Cason 922 Jesse Calhoun AUBURN AV (Ingleside)--From Forsyth BAKER PLACE (V)-- Holt av, south to C of Ga Ry BALKC03I AV (E M)-- From 626 Main to Fletcher, 2 e of Hydrola 1 Mrs Lobie Grier 1218 C L Barlett rd north to Tyrone 2 J E Wilson College Blvd, 1 e of Belvedere 5 F J Couch cor Mercer University dr 6 W A Lanham se Tatnall Square cor Tatnall Sq Bap- tist Churcn Adams AYERS BOULEVARD --From Glen Cove dr west 7 E J Thorpe 8 Wm A James 9 T A Smith 12 J W Batson ASH (E 31)--Changed to Edison AYERS ROAD (Bellevue)--From American Blvd west to Col- ASTOR (E 31)--From umbus rd Academy north, 1 w 104 J H Staley of Broad 108 R L Merritt 145 W C Allen 110 Mrs Harriett Wade 146 Elbert Miller 119 W N Curtis 167 Fannie Brown 220 E D Etheridge 168 Velena Whitehead 222 T H Howard 169 Adeline Patterson 224 G M Green dairy 13 W T Meaders 14 A F Shouse 15 J I Floyd Peachtree 102 J A Matthew 103 H L Brown 105 W A Lanham 107 Wm A Ratliff 124 Mrs Eugenia Johnson Drink in Bottles TELEPHONE 287 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 1008 Ballard (E M) MACON Bear's Alley BALLARD (E M) -- 203 Edcor Brown 146 Emmett Flemister From Woolfolk north Monroe Battle 152 Wm Shoemaker to Mitchell, 8 w of 210 Jane Zigler 156 Henry Byrd Fort Hill 218 Benj Troutman 160 Arth Washington 324 Chas Stanford 234 Wm Harris 162 Elijah Gibson 326 (127) Arth Glover 235 Hattie Wimbish 163 Chas Solomon 327 Mack Stallworth 239 J T Davis 164 A D Holly 331 Frank Sanders 242 Jos Dudley Hammond 335 (33W2)illGiaamrfsield 400 Pleasant Grove 260 Sallie Lockett Gantt Mfg Co Elbert BAXTER AY--VineviUe 302 C L Annis gro Baptist Church 421 (121) Wm Virgil 444 Florence Manuel 447 (47) Wm Samuel 452 H J Johnson meats 474 (174) Wm Robert- son 475 (75) Sami Patter- son 802 H J Johnson 803 Alice Stewart 804 Edw Taylor 865 (65) Johnson Goolsby BARBAIN LANE--Bet Mulberry and Poplar BARFIELD AL--From 554 Plum, s to 555 Pine BARNHART'S AL -- From 448 Linden av s to C of Ga By BARRACK'S AL--Continuation of Bird Cage al from Broadway to New 451 Daisy Roberts 455 Arth Kelley BAY--From Southern Ry west to 3d, 11 s of river 7 Dock Byrd 12 Umpster Bryant 14 Edw Moreland 15 Clara Clayborn 16 Adel Telfair 17 Jas Harris 78 Warren Hicks 80 Edw Wright 83 Hosie Evans rms 88 Wesley Jones 92 John Mormon 94 St John Baptist Church 95 Miller Phillips 96 Enoch Adams 97 Wm Johnson 98 Bee Copeland 99 John Payne 100 Primitive Baptist Church 101 Ellis (Shaw 102 David Younis gro 103 Chas Stevens 104 Mary Shinholser 105 Jos Meadows 109 Leila M Gordon 110 Maude Duncan Gilmer 111 F H Dukes gro 305 Macon Ice & Cold Storage Co 308 Chas O'Neill gro 310 Rentz Kindle 312 Rosa Anderson 352 Richd Rozier 355 Mark Henderson 356 Henrietta Barnes 357 Solomon Jackson 358 Jesse Palms 359 Wm Berry rear Junior Short 360 Carrie Cotton 361 Georgia King 362 Chas Washington 364 Mary Wilson 366 Wm Mathews 368 Mattie Lester 414 Robt Spruce 415 Abr Lee 416 Lilly Griffin 420 Lucinda Chambers 421 Rilla Smith 452 Rosa L Hewitt 453 Alex Harris 454 Wm Smith 456 Edw Johnson 458 Ernest Jones 460 Ernest Jones 466 Wm Booker 468 Frances Walker 470 Victoria Evans 457 Annie Jackson BARTLETT--From Na- pier av n to C of Ga Ry, 1 w of city limits 112 John Reed 118 Henry Payton 119 Standard Oil Co 120 Isaac Hanono 133 Wylie Daugherty BAY AL--From 96 Bay n to Turpin BEAR'S AL--From 628 Washington av, west 123 Hattie A Thomas 136 Geo King to Forsyth 125 Sami Holmes 137 Lawrence Turner 1 Ollie Jordan 140 Robt Dudley 140 Hilman Bailey Alf Coats 147 Wm Robinson 142 Frank Butler 3 Alonzo Middle- 149 Edw Patterson 143 Missionary Bapt brooks 172 Bright Davis Church 4 Cisero Evans 201 Geo Thomas 144 Lettie Ross 5 Robt Solomon Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartCceoarpstya.lfoogr aclolRnkt.ianiLnd.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeoHwr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA Beech Ay (H H) STREET GUIDE Belvedere Drive 1009 BEECH AY (H H)-- 819 M G Robertson From Coleman west 820 Vacant to city limits 935 Vacant 115 Vacant 117 G T Powell BELL AV -- From 200 120 W C Sauls Montpelier av south 121 Mrs Adella 105 Pinkie Ross 30y2 Augustus Williams 31 D Williams 32 M C Grimes 33 Vacant 35 J L Caldwell gro Leonard 107 Jos Williams BELMONT AV (For- 125 Jos Grechi mus 113 (175) Carrie Clay merly Pink St) -- tchr 117 Benj Thomas From Winship west, 126 G M Bayne 119 C J McDower 1 s of Columbus rd 130 T J Ray 121 Vacant 195 Beatrice Cain 131 G W Wheeler 200 Wm Banks 197 C J Woodall 140 R M Worsham 236 John Langford 142 200 Mrs Ethel Bell Holt av Rev Luther Stick- ler BELL'S ROW -- From Columbus rd southwest Harris 213 M F Henderson 216 G C Burkes 218 Mrs L Ernest 219 Frank Wilson B P Ouzts 201 E B Jenkins 202 S P Phillips 204 H W Deaton BELLEVUE -- Three 220 Belmont Av Free miles west of city Methodist Ch limits 222 Mrs E Turner 224 H E Turner 207 A C Clements BELLEVUE ROAD -- 209 W M ampler From Forsyth road 221 Mrs Ethel Glover west, to American First Blvd, 3 miles n of city 301 J O Hamlin limits 312 G E Amspoker 1 John Calhoun 314 Mrs Mary Oxley 3 W D Horton 315 P E Markert 5 H E Brown 317 P B Gabriel 8 Mrs Callie Meeks 319 D S Nunn 9 M M Spear R W Gresham Henry Perkins 323 Corinth Prim Bap 10 Edward Hawkins Church 11 J H Drake 328 G P Deeckman 12 Vacant 225 G A Forrester contr 226 Vacant 230 H M Acuff 231 E C McGee 241 R W Hamlin 243 J F Hunnicutt 249 H C McMath 251 C B Elder 293 Elisha Rogers 294 J C Johnson 296 Bettie Tyler Oakland av 330 L W Scheibe 13 Vacant 302 L H Spillers 402 A T Langston 14 J B Braddy gro 314 C D Joiner 410 Mrs Mary Wynn 15 Vacant 316 E C Kennedy 418 J R Ezell 16 R B Barfield gro 391a A L Stanford 419 Bayard Roberts 17 Mrs Mattie Arnett 394 P E Young 430 L S Grace 18 Peter Arnett 396 E N Georiades 432 R S Herrington 19 W L Pierce gro 397 W E Bryant 440 C J Toole 23 G T Hall lunch 398 C P Bethea 448 J A Greene (15) Wade Tom- 399 Vacant 456 Dr R H Mabry linson 410 Harold Cotton 464 J L Davidson 24 (28) Wm Santell 412 M P Murray Mrs Laura Donnan 26 Vowlin Roberts 413 W G West 472 C B Roberts 27 Mrs Fannie Mc- 414 W H Barksdale 505 J W Sandifer Lemore 415 R F Briggs 28 J D Layfield BEECH AV W (H H)-- From Pio Nono av 809 W C Watts 817 I E Hall 29 T W Barber M M Spear 30 J W Mann Callie Meeks BELVEDERE DRIVE (Ingleside) -- From Ridge av west 2 i--, S3 tO pi 250 H J Glenn FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. Lw POLK & CO. CHICAGO 33cn to r Z Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DiffiM as a THE DIRECTORY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * 1010 Bennett Alley MACON Bond BENNETT AL -- From 758 Walnut north % block 107 Hal Roberts 150 Wm Gray 30 E T Beasley Wm Brown 31 W J Vaughn 32 H F Robertson 33 Joshua Cherry 34 Mrs Mary Cribb BLOUNT (S H)--From Nelson, s to Rutherford av, 3 e of Houston av 100 Walter Daniel 101 Jas Tolliver BEVERLY PLACE -- 35 Monroe Lamb 102 Lonnie Rodgers From 219 Vineville 39 Mrs Donnie Simp- 110 Wm Holloway av west to Central of son 122 Chas Hampton Georgia tracks 220 Roland Marshall 114 H D Sherman BIRCH (N H) -- From 300 Carson Garman 119 R H Mason Roff Home south to 301 Ernest Hopkins 127 Vacant Montpelier av, 1 w of 303 Dennis Oliver 130 Vacant Virginia 305 Vacant 135 Jacob Reickert 142 A M Harrison 147 Vacant L J Hazel 122 A P Hornbuckle 123 W M Roberts 124 Wm Barnes 307 John Stephens 309 Golden Adkins 311 Henrietta Hill 361 Alford Sanford E F Hazel BIBB (E M) -- From Main northwest 1 blk, BIRD CAGE AL--From Third to Fourth, bet Poplar and Plum BOARBMAN'S AL From 321 First, bet Mulberry and Cherry sw to Flanders BLACKBURN (N H) 320 (321) Adaline BIBB AV -- From First to Jackson, 1 s of Oglethorpe 3 J A Peacock 4 B W Waller 5 Geo Vaughn 6 Nanie Mitchell 7 J J Cook 8 Henry Davis 9 Sami Taylor 10 Mrs Ethel Davis 11 W J Davis 12 Mamie Haas (Formerly First av, W H)--From 306 Napier av south 350 F C DeBray 352 Harry Clopton 410 Mrs E M Abel 411 J W Stephens 416 H E Weems 418 A M Gillispie 422 A K Abel 477 S T Chafin 478 D C Fry 479 (379) W F Farris Bailey 322 Rosa Jones 324 (121) Robt Brown 332 Elbert Toaster 334 Charity Howard 336 (335) Douglas Darden Orine Anderson 337 Marzell Mills 354 Abr Parker 355 Wm Powers 358 Mattie Sedwick 360 (61) Chas Brant- ley 13 Edw Oxford BLOSFELD AV--From 379 Derice James 14 John Cox 15 Jas pivey 16 J H Hutchison 17 E R Frost 18 Jos Lindsay Central of Ga Ry, s to Bellevue rd 1 e of Lake 12 Wm Blosfeld BONAIRE--From Turpin south, 1 e of Division 105 Mary L Bryant 15 F U Garner 107 G W Oliver 19 J W Cline 20 Mrs Carrie Thompson 15 Vacant 16 Vacant 17 L L Smith 109 John Losey 113 Alex Howard 21 Jos Jossett 22 Edw Freeman 23 Mrs Nora Lyles 24 Rufus Fair 25 Albert Reeves 26 Nathan Brewer 27 D J Collins 28 Richd Brown 29 M M Nooles 18 Jacob Barlow 18% W B Hall 19 B F Mason 20 J A Barrett 21 R C Ogletree 22 J W Sheppard 23 L T Lock 24 R F Whitehead 25 Mrs Mary Beck BOND--From 218 Georgia av northwest to College 138 B P O'Neal 213 Fredonia Apts Apartments: 1 J Morton 2 Vacant 3 D J W Lovelace A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 Bond STREET GUIDE Bowman (E M) 1011 4 Vacant 119 D P Levine 598 J L Elder 5 G L Blossom 120 T I Harris 901 Vacant 6 J D Lanier 127 C Y Alexander 902 Paul Wehrcamp 7 Mrs L G Eden 131 J G Cooner 964 W R Moseley 8 A C Barnes Street continued 217 Vacant 221 J W Nisbet 133 Oscar Rogers 135 W V Dove 148 Henry Bowden 153 W A Spiller BOULEVARD (V), --Changed to Elizabeth pi 227 Vacant 233 Mrs Clifford Ber- ner 239 Jacob Aienson 155 G P Rankin 177 M H Kessler 185 J M Malloy 193 A L Jackson BOULEVARD AV (S M)--Changed to Dixie av Reginald Houser 195 W G Huff 245 C A Martin 197 Vacant 251 Nela Dure 207 J D Blair BOUNDARY--Changed to Edgewood av 255 Vacant 211 S J May BOUNDARY WEST 261 W H Mitchell 215 Hillyer C Warlick (V) -- From Green 263 W E Martin jr 223 J N Barnes east to Wise av 265 Vacant 231 E F Hammond 101 Wm Palmer 267 W S Lee Orange 302 E P Willingham 240 E A McHan 241 Hyman Kessler 247 H P Boedecker 172 J H Holt 174 Thos Bland ISO Louise Marshall 304 Vacant 249 H A Gibson 190 Sarah Adams 305 G G Hardeman 253 T D Walker 200 Frank Hubbard 311 Mrs P W Kendall 259 W S Payne jr 203 John Chappell 315 P M Brown 267 W M Jordan 205 (200) Adaline J T Belcher 269 Vacant Marshall 319 C L Coney 311 N D May 320 M W Richardson 327 F E Williams 322 0 S Spivy '357 Luther Williams 403 G C O Pry BOND (Bellevue) -- 415 H D Weaver From Robinson rd 417 J E Gibbs north 2 w Log Cabin 433 A G Reddy 208 Cora Nelson 210 Vacant 211 Jos Duncan 212 Green Horton 213 Jeff Dixon 215 Henry Duggans in Blvd 453 Luther Williams BOUNDARY AV (V)-- n BOOKER'S AL -- From 420 Hawthorne south to 421 Hazel BOSTICK'S AL -- Continuation of Collin's al, east from Stew- 461 W L Collier 467 C E Hammack 502 O E Cox 531 S W Wells 537 Wm Clemence 549 R E Ingram 553 J E Grubbs Changed to Linden av BOWMAN (E M) -- From Broad north to Jackson, 4 e of Fort Hill 101 John Moore po m w 2 in art's la BOULEVARD (N H) -- From 901 Clinton rd northwest 556 T F Bateman 559 M G White 560 Ernest Bateman 561 B H Schoonmaker 563 R W Lester 107 Jas Jordan 109 Sally Adkins 110 Robt Booker 112 H S Bynes 128 Jos Purofoy 104 F X Daly 108 F C Donnelly 109 F W Williams 564 W H Chandler 568 V L Simmons 569 W W Moody 144 Betsie Carr 150 Lizzie Dixon 224 (124) Benj Glover 112 R R Wallis 113 C Y Alexander 572 T A Timmons 574 Emory Patton 255 (5) Chester Wheeler 115 Mrs Mary Pender- 576 M C Matthews 318 (18) Mary Robin- grass 578 Vacant son 116 A C Crow 583 Mrs Valeria Clay 331 (16) Lee Taylor E I DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 fi O JC{ ^ uojjs m&jj or*- S s < d 13 Q l< |z < P Bfcfea O z oq s O ao UiiE 3 o* rOs Oz zO H H ^ to ^ co H* WS*gStj H c/3 H 2 u 5ii)Hk X"oI2s so UO Qos OS z < < REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. s Broadway STREET GUIDE 517-19 Southland Gar- 653 Vacant age 654 Vacant Broadway 1015 764 M J Mouzon barber Oaa5">S3. 518 Salvation Army barracks 655 Vacant 765 Vacant 656-58 Macon Cigar & 766 Vacant $p> 520 Bibb Bag Co Tobacco Co 767 Wm L Pierce 521 Abbott Bros tin- 657 Low Gar lndry 768 Vacant ners Bird Cage al 659 Proctor & Southard veterns 769 J S Raley garage 770 Vacant 550 parks Motor Co 659% Vacant 771 Tony Union fruits 551 United Barber Supply Co 555 Edgerton Hotel 557 Vacant 561 Vacant 563 Lettice-Goodwin Co whol confrs 565 Rudolph Goepp barber Martin Clning Co Martin Bonding Co 567 Southland Cafe 569-71 Hotel South- land 573 P E Hertz auto supplies 575 Vacant 594 Vacant Plum 601 Dennis Cassidy restr 608 L H Cannon cotton 609 Vacant 610-12 Bloch Hide Co 611 John Gillespie restr 613 C B Lane barber 613% Vacant 615 Zelik Wolf shoe repr 617 Vacant 618-20 Macon Chero- Cola Bott Co 619 Melvin Hatfield billiards S M Grimes restr 619% Bertha Jones rms 621 E Z Piercey barber 660 Williams Mfg Co Oak agrl implts 772 Vacant . 667 Sami Sardis fruits 803 Mrs M Burgamy 671 Vacant gro 673 Vacant 803% N H Brown 674 Happ Bros Co meats overall mfrs 805 John Phillips 675 Vacant cabtmkr Pine 806 Hugh Benson 701 Wofford Oil Co 809 H W Wilson gro filling sta 809% Dalton Jones 702 Herin & Geeslin gro 703-5 Muecke's Antique Shop Sou Doll Hosp 704 Macon Trans & Stge Co clo clnr 810 Hubert Theus 811 Vacant 813 H S Bynes blksmith 816-18 M D Coplan junk 817 Angie Pratt 706 Vacant 819 E W Kitchens gro 707 Hardy Rogers gro 819% Vacant 709 Vacant Tommie Robert- 711 J H Jones barber son 713 Vacant 851 Vacant 713%'W M C^aps shoe 852 Frank Hollings- repr head 715 Vacant 856 L J Ross blksmith 716-20 Adams-Buchan- 858 A E Thornton an Motor Co garage 717 Vacant 859 Hattie Freeman 719 Vacant 860 United Auto Co 721 Dallas Investment repr Co B F Delk saw filer 723 W L Daniel tailor 725 Vacant 753 Clarence Harper 861 Vacant 861% Falbin Harris 865 J D Corr restr 754 Mollie Burgamy rms 755 Minnie Bell gro Oglethorpe 1001 L A Thomas Drug Co 756 Acme Welding & 1003 Dixie Cash Mkt Elec Co 1011 King Hill restr R R Willis garage 1014-28 Taylor Iron Tink Jackson clo 757 Vacant clnr 759 Vacant 650-52 Sou Bell Tel & 760 Vacant Tel Co whse 763 Vacant Wks & Sup Co 1025 L H Short 1027 Sami Davis 3-0* 1029 Jas Smith m oo FOR FISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION STORAGE DETROIT R. L. POLK & CO. CHICAGO > W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, " 111. 1016 Broadway MACON Broadway 1030 J Phillips shoe 1219 T H Carter 1402 A D Jones gro repr barber 1402% Appleton Cal- 1032 Nancy Evans Wm Gullatt shoe houn ' 1033 Bessie Murry repr 1406 Hartwell Ross restr 1220 Vacant 1408 Wm McGee 1034 Dixie Highway 1221 Vacant 1409 Edw Hillard Garage 1223 Forrest Freeman 1420 Jos Walker 1034% J D Carroll 1225 Geo P Estes 1424 Henry Williams 1035 Vacant 1225% Vacant 1425 Edw Simmons 1037 Lacey Brown 1227 H W Johnson 1430 Gilbert Fambles Hawthorne tailor 1431 J A Coleman 1229 Vacant 1432 Amanda Pugh 1122 Wm Smith bil- 1231 L W Rogers Co 1433 F M Allen liards gro 1435 T G Jones 1122% L J Washington 1232 H L Lee 1436 Amanda Barnes 1124 Wm Smith gro 1232% Floyd Green 1444 Christian Pharm 1125-31 J W Ford turn 1234 Janie Walker 1444% Morgan Hall 1126 Edw Redding fish 1235 Vacant 1446 Mer & Mech Sav 1128 Wm Dawson 1236 Dexter Turk Bank 1130 Melinda Green 1132 Saul Garden 1133 Howard Smith 1134 Vacant 1135 Duggan Fern 1136 John Pearson 1138 Sidney Justice 1140 Joshua Hall 1141 Vacant 1142 Emma Greer 1143 J D McKenzie 1237 Vacant Elm 1238 Walter Brown 1239 Vacant 1241 Vacant 1500 H B Sample meats 1502 Lackay & Lackay gro 1243-45 S Saloom & 1502% Lackay Hall Sons gro 1503 Vacant 1245 V A Holloman 1504 J C Mitchell TYipnta barber 1246 A J Ellis filling 1507 L H Krewson sta belting Hazel 1510 Rev Monroe t?pivey 1144 1200 1201 1202 restr Frank Butler Bay Esy Burg dry gds Alex Nathan gro J H Sanford gro 1301 A M Harris drugs 1301% Saied Saloom 1302 J B Bulcken gro Wm Parker meats. 1303 Vacant 1304 Jas Smalley 1306 John Snook 1511 1517 1518 1520 1521 1522 L H Krewson G F Baker B I Waller Berger Benson Mrs America Jones rms J F Davis 1203 M D Hightower barber 1204 Vacant 1309 Lulu Turner 1310 Mrs Annie Pea- cock 1206 Marjorie Hilliard 1314 J W Turner 1525 Mrs L Mehollen 1530 John Sumlin 1531 Alpheus Cum- mings 1208 Wm Wright 1315 Wm R Crumpton 1212 Susie Few 1316 Louis Brady 1213 H L Lee barber 1318 C H Oxley 1213% R L McKinnon 1321 Vacant poultry 1322 A M Vann 1215 Jacob Doctor dry 1325 J W Hamsley gds 1331 A J Cherry 1216 W L Lee soft 1335 Vacant 1532 C M Bodwell 1534 H O Cannon 1536 Mrs F Hickman 1537 F P Peavy 1538 C C Smith 1540 Hyman Bennett gro 1543 Chas McGinnis Edgewood av drinks 1336 J H Profllio 1602 Sands & Co gro 1216% Robt McKinnon 1338 E R Sapp 1603 Vacant 1217 Vacant 1343 Geo DuBose 1611 Benj Womach 1218 Vacant Ash 1613 Mrs Eliz Boyce Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Broadway STREET GUIDE Buckner Alley 1017 1621 Vacant 2125 W R peer 2635 A V Shepard fill- 1624 Sidney Morgan 2127 R E Herrington ing sta shoe repr 2129 B F Caldwell Bernard Read soft 1625 Lillie Corbitt 2130 C O Hight drinks 1630 Vacant 1633 Chas Shelton 1635 Wm J Harvey 1650 I B Roberts 1701 J J Venable 1703 I E Jones soft drinks 1741 Ollie Tindall 1743 J M Moore 1745 L M Stevens 1747 Hubert Warren 1749 J F Pittman meats 1751 H A Pox genl mdse Wood begins 1801 Sumner's Pharm 2131 2132 2134 2215 2220 2223 2224 2225 2301 2304 2308 2309 2321 Smith ends B E Smith C E Leonard H A Jenkins Mrs Nora Irby Harris Mixon Rudolph Muthon E P Hight Vacant Whitehead begins Vacant C A Brice S P Pearson R A Brice J W Brice 2636 Georgia Grocery Co No 8 2637 Vacant 2638 Standard Oil Co filling sta Charles begins Houston av begins BROADWAY--East llacon BROOKLYN AV (E M) --From 519 Academy BROOKLYN AY (Stin- sonville)--From Main north 1807 Benj Hill 1811 Wm L Brown 1818 J D Cross 1820 Mrs S Garrison 1821 S G Scoven Ellis begins BROOKSDALE AY 2437 C M Gaines 2440 W H Chapman 2444 R L Greer (Bellevue) -- From American blvd west, 1 s of Fairmont av 1823 1824 1825 1827 1829 Wm R Scoven Vacant J C Clements Mrs S B May Vacant gro 2447 2480 Mrs Laura Payne N B Johnston Oliver av begins Daly BUCKEYE ROW--Half mile south of Edgewood av on C of Ga Ry Giles begins Stratton ends 1905 J A Freeman 1907 H C Sexton 1911 Dixie Bottling Works 1914 J C Adams 1920 J C Jackson 1922 B W Cannon 1924 E A Jenkins 2001 Elmer Astin 2003 John Fletcher 2007 B H Cannon 2011 E C Hambrick 2020 Vacant 2503 C J Jordan 2520 L M Stephens 2525 A P Freeman contr H H Freeman contr 2526 R A Anderson 2529 Vacant 2552 G W Morris 2554 C T Williamson Enterprise begins 2555 J H Jenkins Central av begins 2603 C W Barton 2604 Mrs M I Kemper BUCKINGHAM PL (Y) --From Yineville at south, 1 e of Clisby 107 J E Walker 108 R J Coates 109 K K Domingos 110 (190) P N Fick 111 A P Tucker 112 (192) R H Mat- thpurti 114 (194) Osgood Clark 115 P G Gates 116 (196) G W Mc- Common 2022 Vacant 2605 J J Holley 2023 J J Herrington 2606 Vacant 2024 Jas Causey 2609 W A Roberts 2026 Georgia Blair 2620 Primitive Baptist Jenkins begins Church 117 F H Hattrick 118 (198) J L Blum 119 B R Napier 120 (200) A A Drake 2105 G B Boutwell Colquitt begins BUCKNER AL -- From 2106 L M Chapman 2627 Mrs A M Welch 2d to 1st bet Poplar 2107 J B Slade 2632 W J Patterson and Plum 2108 S W Miller 2634 Macon Co-opera- 1 Willie Cook 2109 J E Stewart tive Store 3 Gussie Harris FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO We Do It Right R P 0 L L U L M E B R I N & G M 1 H L E L A I T R I 0 N N G S BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1018 Buckner Alley MACON Calhoun 5 Ruby Davis 214 E C Herring CABANISS AV (E M) 6 Wm Jackson 215 W A Cleveland --From 103 Hill west 7 Idrola Little 216 Vacant to Center 8 Richmond Trail 217 W H Underwood 100 J R Borum 9 Henry Sharp 219 J L Williams 101 Wm Sadler 11 Vacant 221 Q R Nolan Lavosia Lamar 15 Robt Burkett 223 H C Davis 103 C D Adams 23 Mary Wells 225 Hugh McLean 103% Albert Cook 25 L M Thrash 302 H V Arnett 104 C L McCall 303 (309) W H Scott 105 M P Terry BUFORD PL--From 601 Vineville av north to 305 Abe Abraham 306 C E Doyle McDonald 308 W A Little 104 Mrs M Haley 310 J L Barron 106 G P Finney 107 G C Amerson 108 Leonard Car- michael 105 S W Hatcher 106 C H Perdue 312 J B Bryan 314 Vivian H Roberts 109 H P Benton 110 Vacant 107 J N Smith 108 J T Garland 109 J W McCook 110 G S Weddington 111 J T Adams 112 Rev G S Frazer 113 J W Popper 115 T A Jacobs 116 iM M Elliott 117 A E Barnes jr 118 H C Fowler 119 S M Johnson 120 Jacob Lazarus 120% Benj Bashinski 121 E D Black 122 W M Dickey 123 Geo Lumpkin 124 T A Wallace 125 Vacant 126 T R Jacobs 127 R L Carter jr 128 O H Weaver 129 C B Jones 132 W H Murphy Clayton BURKNER (Bellevue) -- From American Blvd west 1 n of Industrial Home rd BURNETT (E M) -- From 426 Flanders west to Elliott 302 Arth Marian 303 Mary Robinson 308 Charity Lindsey 310 Lucy Ham 312 Elmer Brown 313 Jas Sanders 315 Amanda Clark 316 Laura James 317 Louise Grier 322 Chas Davis 324 Dolly Jackson 327 Chas Gordon BURTON AV -- From Log Cabin Blvd south to Columbus rd 200 Mrs A E Jackson 405 S M Glisson 408 J C Eubanks jr 111 J T Lyster CALHOUN -- From 270 Maple s to limits 101 Wm Johnson 110 G C Ussery 111 T W Arnett 115 J C McCowan Oglethorpe 209 A B Hardy 212 M L Wilson 216 L A Roach 217 Monroe Brown 220 C C Lisle 221 Chas Walker 222 Harry Billingslea 224 Laura Stewart 225 Jos Turner 226 Vacant 230 Gus King 232 Jas Farmer 234 Melissa Thompson 238 Mattie B Williams 239 Wallace Irvin Hazel 201 C B McElroy 421 G E Ricks 202 I H Adams 460 F L Johnson 310 Wm N Curtis 204 Rev I E Marcuson 463 J B Kendall 314 A L McLendon 205 R B Hicks 500 Reynolds McCon- 316 W B Gardner 206 A R Adams nell 318 D F Ethridge 207 Phelps Wade 208 Dr Timothy Har- den 209 Mrs S S' Signor BUTLER (E M)--From Clinton east to limits, 2 n of Main 323 Hiram Couch 325 G W Heath 326 Lulu Hendrix 327 A H Haynes 210 M J Carroll CABANISS (Monroe 330 Vacant 211 G H Ware Hill) -- Continuation 331 J W Hardeman 212 M R Ross Virgin (V) east to 334 Vacant 213 Oscar Chambers Gustin av 335 J E Hamlle 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO \ a ENGLAND Tj THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 Oalhoun STREET GUIDE Carling Av (H H) 1019 337 Vacant CALLAWAY GROVE-- CAMPUS AV (W H)-- 338 I F Baker 341 G S Wescott North end of Calla- From Edgewood av way south, 1 s of Morgan Ash 412 V L Herrington 415 H L Sanders 416 C E Scott 418 E T Parker 420 W C Dumas 421 T A Brady 424 B T Dumas 426 Mrs Ada B Lan- sing 427 H W Bailey Wm P Patterson 431 R L Bozeman 439 B L English P G Webster 440 Mrs N A Bush Elm CAMPBELL AY (S M) --From Edgewood av south, 1 w of Nusshaum av 201 Henry Phineze 203 Missie Darby 205 Henry Glover 302 Raymond Cooper 305 Robt Lamar jr gro 307 Amelia Cody gro 308 Vacant 309 Jas Vinson 310 Nancy Jackson 320 J W Litman 327 John Hendricks CAPITAL AV -- From Oglethorpe south to Hawthorne 100 R M McKoone 101 Mrs Sarah Smith 102 C C Wooten 103 A L Brown W A Taylor 104 W A McKenna 105 J B Wellons 106 W W Rutland 107 W M McGarrah 108 R L Stevens 109 J L Winberg 111 W P Carroll 112 Vacant 115 Vacant 507 O D Brown 511 Geo Wilson 512 W S Smith 517 J B Read 618 Vacant 519 Alonzo Odom 520 Mary Dogwood 522 & L Jackson 524 Wm Stuckey 526 Austin Jackson 527 Josephine Jordon 528 Claud Logan 531 Wm Thomas 535 Sami Haslam 539 Frank Adams 643 Thos Hill CALLAHAN'S AL (S M) -- From junction School and Second west to Phillips CALLAWAY (V) -- From 531 Yineville av north 330 Wm Faulks Hawthorne 353 Chas Lucas gro 360 E F Mincey gro 405 Jackson Denson 407 Cherry Bentley 409 Jas Wright CARLING AY (H H)-- From C of Ga Ry s to Columbia, 1 w of Edgewood av 141 (2) Mattie Fuller 500 Monroe Burns 142 Lizzie Hughes 501 John McCray 143 (1) Hattie Glover 503 Malinda Birdsong 144 John Harper 504 Jas Sparks 146 Ernest Mills 505 Geo Williams 150 H P Eady 506 Emma Basin 154 J B Fuller 508 Henry Turner Dannenberg av 531 Emanuel Clayton 201 C A Williams 532 Chalmers Hardy 205 R N Bateman 580 H E Ridley gro 705 Reuben Braswell 706 Jas Evans 708 Wm Bivins 709 Mott Flowers 710 Minnie Colbert 712 Wm Gullatt 713 Nancy Brydnt 209 S T Ray 213 J H Molton 215 Watson Walker 217 R P Kendall 219 J E Rogers 237 J E Pilcher 239 C P Baldwin Lawton av 301 R P Brooks 103 Mrs L A Pearce 104 J M Ricketson 107 F K Till 111 Eug Boswell 714 Walter Gates 715 Nathan Samuels 716 Isaac Edwards 718 Rilla Bryson 302 Mrs L A Jones 303 J M Melton 304 Vacant 310 J F Lazenby 113 M J Whitehead 720 Chas Nix 312 F C Jewett 115 Edison Skelley 724 Ada Jordan 315 Mrs Sarah Rushin Clayton av 725 Floyd Richardson 324 J M Wilson 116 W R Allen 726 Chas Thurman 331 F E Burrus 117 N D Mallary 727 John Watkins 333 R W Jones 120 Thos Gilbert 731 Sarah Bailey 336 Mrs I A Bollinger Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Anas.* irs All Questions as to WHOM You Are Looking For and WHERL They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L POLK & Company -H l-H 0 +3 CMgVl 0) cu s< -fl H "S ^cs H co a ctf J3 LUMBER, SHINGLES, LATH Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1020 Carling av (H H) MACON Cedar (Unionville) 337 Vacant CARTERS AL -- From 3 Geo Moulton 339 Vacant Elm to Edgewood ar, 4 Laura Battle 341 L B Ray bet 1st and 2d 101 Sallie Ford 343 S R Slii 121 Vacant 126 John Thomas Coleman ay 401 Mrs R Glyck 405 Mrs Martha Jen- 222 John Hill 224 Shote McCluster 225 Vacant kins 407 E F Carter CATHOLIC AL--From 225 5th west 423 Mrs Aurora Gormly 424 J A Atwater 426 Rev A H McNair 428 W C Knight 431 Mrs E E Martin 432 Mrs I C Nottingham 433 J E Haverfield 436 J H Knight CEDAR (S M)--From Wood south, 1 e of 2d 102 A F Sanford 102a J D Brown 104 C B Brown 109 Vacant 110 Jas Lackay 115 J H Hill 118 W C Richardson 118a Vacant 130 Anthony Davi3 131 Mary Gibson 139 Clifford Bouden 148 Amanda Taylor 152 Oscar Tigner 154 Eddie Blue 164 West Fletcher 166 Jas Smith 167 Vacant 168 Grant Murphy 202 J C Jones 204 Della Mitchell 205 Major Whitty 220 P Felix Allen 228 Jack Lee 241 Wm Jones gro 437 B G Moore 119 W W Harper 255 Marion Horton A D Ray 120 T E Stevens 322 Lewis Stanford 438 G P Burgdorff 121 G W Henderson 339 Jos Hester 453 Mrs M R Griffin 455 Mrs A C Rankin 456 Vacant 457 O A Boone 458 W M McPherson 459 C B Cheney 460 R A Bollinger contr 467 H P Smith Montpelier av 501 Mrs M S Davis 506 W P Lawson 508 W B Beale 567 T H Mosely 589 R L Hall 591 Dennis Flynn 593 W D Domingos 595 J D McKay 122 Vacant 173 Mrs H Hagan 174 C R Campbell 350 Mattie Jones 444 J H Bowden 450 Starling Womble 178 Mrs S Clements 180 J D Brantley 181 F M Irby 185 C H Carver Jenkins 213 L O Webster 218 Vacant 220 P F Allen 224 R G Person 227 J O Barnes 229 Mrs Florence Kitchens 231 P H Baldwin 506 Jacob Hutchings 518 Wm Stevens 533 Webester Cars- well 537 Lula Avant 540 Jas Fambro 552 Edw Leslie 703 Arth Kemp 795 Emmit Bivins 819 Mary Thomas 870 Chas Sanford 1000 Mary Jones 232 J C Harrell 1002 Luther Samuel 233 Mrs Henrietta 1006 Leila Johnson Poppell gro 1012 Amos Hollis 288 C L Russell 1014 Cecelia Holmes 602 Z H Gilreath 605 W H Thompson 606 A J Davis 616 Mrs H D Strozier 617 W H Shepherd 289 J M Peavy 1020 Vacant 293 G T Pate Wyche 310 W J Hubbard Whitehead CEDAR LANE (S M) From Cedar to 2d bet Smith and Ellis 620 Louis Cassini 621 J J Leslie ne cor Free Will Bapt CEMETERY (Monroe Ch Hill)--From Cabaniss 622 W L Barrett 623 V E Leggett CEDAR (Unionville)-- s, 2 w of Gustin av From Columbus rd s, CEMETERY LA--From CARLISLE AV--From 1 w of PIo Nono ar Log Cabin Blvd south, 1 Sami Pennington 1 e of Lamont av 2 John Calaway 125 College north to M4.AaTdTisVoonnlr AuiriUrj More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Va% on Savings Cemetery Lane STREET GUIDE Charles (S M) 1021 46 Cordelia Glen 813 Freeman Craw- 307 G A Farmer 48 (2) Anna Johnson ford 314 J C Baldwin 60 (1) Dilsey Nor- 840 Boyd Mason 315 Vacant wood 841 Jas Scott 316 R F Harrington CENTER (E M)--From CENTRAL AV -- From Arlington n to limits. College n to Linden 317 Mrs Susie Baldwin 318 J O Roberts 1 w of Church av, bet Forsyth and 319 G R Wooten 3 Aaron Hunter Washington av 320 L E Oxley jr Hydrola 208 Athos Wright 322 Mrs N B Joiner 102 J M Hall 104 J B Kitchens 106 Vacant Carden 202 J W McElheney 204 J W Flynn 206 L T Stripling 206 J Clifford Hudson 255 (155) Thos Green 256 (156) Mrs S T Schaefer 257 Lucile Farley 259 (159) A P Smith 260 Wm Ryle 261 J W Wright 268 G W Roberts Lee 300 Vacant CENTRAL AV (S II)-- From 2605 Broadway w to White (Changed to Charles) 203 J F Giglio 205 Lonnie Davis 210 A W Wright 340 G D Smith 345 Mrs Sallie Respess 350 John Harvey 355 G S Crawford CENTRE (Monroe Hill) --Continuation of Poe (Vineville), 1 e of (Justin av 324 L J Jones Reid 412 C E Railey 413 W B Mooney 417 G S D Shelley 421 A A Jarrell 425 R H Ethridge 500 J H Roberts 501 (212) Elnora Bray 502 (501) Wm Hud- son 503 (213) Wm Dorsey 504 (502) Wm Durden 505 (214) Vacant 508 (506) Vacant CHAPPELL AL--From New to 1st and Pine 301 S P Hornsby CHAPMAN AL -- From to Plum 304 A J Steadman 305 S A Wheaton 306 I N Champion 307 J L Cheves 309 Carl Barth 310 J B Croom 353 J E Hudson 354 J C Hooker 360 L L Parker Oglethorpe to Arch, bet 1st and 2d 225 Dock Battle 614 John Morgan 616 Wm Brown 618 Vacant 620 Reuben Hunter 624 Wm Jackson 71 Eva Whitehead 72 Pollie Collier 117 Leola White 224 Jas Williams 225 Hattie Mathes 226 Wm Montgomery 754 Lena Colbert 756 Lucille Wesley 364 Vacant Broad 450 B J Balkcom 451 Mrs Ella Roberts 454 Demas Mataxas 456 Mrs S F Maund Jackson 600 Vacant 602 Benj Glawson 604 Albert Bailey 610 Jacob Pitts 612 Wm Goolsby 690 L L James 750 John Lewis 752 Leo Lattimore 754 Wm Meriweather 756 Melvin Atkins 794 Jas Harmon 811 Edw Ford CHAPPELL (S M) -- From 146 Church s to Whitlock 114 J R Stirk 116 B T Thomas 120 J O McKinney Steele 215 Vacant 217 J C Layfield 218 Mrs Eunice Ezell 219 Ernest Fountain 220 Motto Ethridge 221 J N Jones 224 Henry Joiner 227 D C Wallace 230 Mrs E A Schell 233 O G Faircloth Stratton CHARLES (S M) -- From 2636 Broadway e to Waterville rd 101 Abr Rophie 102 A L Phillips 103 General Johnson 105 F W Fulford 110 H B Beble 124 W W Stewart 125 J O Reese 126 W F Colquitt 127 J A Pace 129 John Tinsley 130 Mrs Annie Binion 131 A A Josey 133 Clinton Lifsey 134 C K Williams 135 C C Cook FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 1022 Charles (S M) MACON Cherokee Av (S H) 136 H M Presley 137 J C Poole 140 J Docia Hancock 142 C E Priester 143 W L Grace 144 H H Smith 145 Mrs E A Barker 146 W J Jenkins 147 W H Reynolds 151 E P Smith 200 (100) T V Bivins 202 (104) L L Wood- son gro 205 (105) Mrs Annie Shelley gro 300 (200) Floyd Oli- ver 301 (201) Geo Banks 302 (202) Edgar Ross 303 (203) Ezekiel Knight 304 (204) Harrison Goodrum 503 (172) Henry Far- 4 J L Fairfax mer 5 Ken Smith 505 (303) Henry 6 Luther George Thomas 7 Kink Adams 507 (209) Jesse 8 Hattie Thomas Stubbs 9 L M Evans 509 (312) Carswell 10 Sidney Harris Clark 11 Bertha Brown 600 (119) Ambrose McGee 12 Edw Hall 18 Edw Bithwood 601 (213) Jas Dean 19 Vacant 603 Cooper Thomas 604 (328) Adolphus 28 Vonza Pugh 35 Emaline Carter Travis 83 Ola Allen 605 (205) Levurg Moore 101 Ella Daniel 125 Lena Wright 606 (321) Sallie Calhoun 607 (958) Wylie Jackson 608 (301) Kath Goodin 609 (309) Carl Wash 611 (301) Emmett Paldo 162 Clifford Hill 206 Mary Smith rear Matilda Phoenix 247 Julia Bostick Elnore Gordon 320 Callie Gilford 559 Gussie Roberts 608 Juliebelle Wool- 306 (206) Margt Jackson 307 (205) Robt Lundy 700 701 (260) R A Stepsens (362) Wilson Bry- folk 1272 Kate Brown 1274 Henry Josey 308 (208) Arth Mosley Antioch School Charles sw cor Mason 400 (300) Eug Johnson 401 (301) Lee Seabrooks 402 (302) Camilla Mallory 403 (305) Annie Holmes 404 (304) Geo Mason 405 (307) Alice Rogers 406 (306) Jas Farmer ant 702 (262) Vacant 703 (445) Geo Bryant 705 Chas Taylor 707 (446) Chas Taylor 711 (606) Lewis Jen- kins 800 (107) Fannie Bur- den 801 (150) Paul Terry 802 (403) John Brown 803 (126) Pinkie Wal- ters 804 (405) General CHEROKEE AV (S H) --From Pio Nono ar w to city limits, 1 n of Kapler av Courtland av 1 Fred Freeman 2 Vacant 3 Leola Watson 4 Mack Reid 5 Mary Wilson 6 Sol Brown 7 Leila Hudson 9 Fred Porter Johnson 805 (124) Elijah 9% Lucinda Lucas 168 Wm B Holmes 203 Dr Herring Win- 407 (309) Dennis Ca- 806 (919) Edw Stew- ter art 408 (308) Jurod Galary 409 (311) Oscar Moore 807 Vacant 809 (129) John Tins- ley 411 (31) Geo Mack CHEATHAM AX--From ship 207 E B Atkinson 208 Vacant 209 E C Scott 210 T E Blackshear 211 G H Coleman 216 W C Pumpelly 500 (480) Geo Mason Plum to Pine, bet 2d 218 C E Baumgardner barber) and 3d Hillyer av 501 (400) John Hollomon 502 (481) Obie Johnson 1 Kinch Allen 2 Jos Sanders Mack Josey 3 Vacant 300 Jas Parker 302 A L Lawson 304 H A Kriebel E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED _ DEALERS LincCoAlnRSk -TReUCrKn S-Te RAlCTOrOHr-SdSOIVhlffaovrPietH'asOit,NaFEoFr1od5r,8d1woer JONES MOTOR COMPANY 557-559 PLUM ST. Cherokee Av (S H) STREET GUIDE Cherry 1023 305 W O Kinney 308 E J Willingham jr 310 M J Ellis 311 R W Barnes 312 H M Koplin 314 G S Ramkin 316 J W Tutt 318 H R Taliaferro 333 Taylor Louise 359 C H Richardson 361 N B Armstrong 364 J D Crump 365 C B Clay 313 Terminal Tailors :& Haberdashers 315 Harry's Cafe 317 Frances Hotel 319 Adams & Poulos fruits 321 Elite Cafe 323 Vacant 325 Nicholas & Nicho- las fruits 350 Geo Bostock shoe repr 351 E A Waxelbaum 306 H J Peavy phys Herring Winship phys 308 Henry Whitehead real est 309 F B West real est 312 Barron & Reagin accts 314 J M Hartley phys 315-18 Life & Cas Ins Co 316 G C Jones osteo 320 Vacant 401 E H Valentine CHERRY -- Principal thoroughfare running & Bro Inc whol dentist shoes 404 United Credit Corp east and west, from 8th w to Spring, 4 s 352 S T Simmons phys loans 405 Seaboard Air Line of river 353 Vacant Ry Co Eighth 355 Schwob Co tlrs 407 A L Cowart den- ne cor Willingham 356-58 I Kessler C Co Sash & Door Co 357 Vacant tist T J Slade dentist Macon Lbr & Mfg se cor Peeler Hdw Co 409 J M McFerrin acct Co / sw cor J P Allen & Co 410-11 Consolidated J C Ramsey dept store Natl Detective Seventh Broadway Agcy 105 Adams Bros Co 115 Ellen Robinson se cor Builders Lum- ber Co Sixth 401 Mitchell Williams & Mack drugs 402 Central Pharmacy 403 Bibb Bldg Harry The Taylor Rooms: ne cor Kinnett-Odom Co ice cream mfrs 205 Roughton-Halliburton Co whse Fifth 201 Jackson & Jackson lawyers 202-3 L C Brock stocks 204-6 Vacant 207 Vacant 300 Swift & Co wbol 208 Ga Railroad meats 209 N C & St L Ry 301 Terminal Hotel Terminal Cafe A& WP R R 210-12 Morris Harris 303 Haverfield Smith ins & Wood barbers 213 Vacant 304 Van Landingham & Hadaway confrs 305 Vacant 306 M G Ellis restr 308 H L Jenkins bar- ber 310 Vacant 311 Florida Real Es- tate Co 312 S J Snead wagon mfr 214-16 Barnes & Barnes Inc ins 219 Vacant 220 J D Rust chiropractor 301 Otis Elevator Co 302-3 Mo State Life Ins Co Southeastern Un- derwriters Assn 304 J P Holmes phys 413 L L Daugherty jr & Co lbr 414 Vacant 415-19 Martin & Mar- tin lawyers 420 T A Hurley phys 501 L & N R R coml agt 504 Schofield-Burkett Constr Co 507 E C Harris phys W J Crocker ins 509 B H Spurlock dentist 511 Timothy Harden dentist 513 D W McCoy lwyr J D Hughes lwyr 515 O S Spivey W E Mobley phys 518-19 Vacant 520-23 Smith & Smith lawyers 524 Vacant 525 Mary Jarrell phys 601 P B Mason ins 601-03 Interstate Lbr Co 604 Vacant More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 1024 Cherry MACON Cherry Bibb Bldg--Contd 605-06 Dixie Fire- proofing Co ' R J Taylor Co bonds E H Taylor office 610 F W Farmer den- tist C H Brown dentist O R Thompson phys 613-17 A England chi- 411Lorraine Shop mlnrs 412Pub Co The Macon News 415 Macon Cafeteria 416 Bernard Jacobs tailor 417-21 Union D G Co 418 Vacant 420 Vacant 304 F D Stephens contr Ga Quincy Granite Co 305 Jackson & Middlebrooks ins 307 Richardson Lbr Co Davis-Richardson Lbr Co 308 E W Maynard lwyr E F Taylor lwyr ropractor 422 D L McRae brkr 310-11 Carl Bloch 618 W H Spillers lawyer W B Sparks real est Real est 312-13 Nottingham & 619-20 O L Clements 'awyer J W Barnett lwyr 622 D D Walker phys J A Hembree phys 624 Vacant 625 J W Martin phys 701 Vacant 702-3 The Letter Shop 704 Vacant 705-6 Monroe Calculating Mach Co 707 Vacant 709 Vacant 711 Viavi Co med mfrs 713-18 R G Dun & Co mere agey 718 Vacant 719 S N Rubin phys 722 C L Toole dentist C L Toole jr dentist B W Greene phys 725 J A Reynolds den- tist F L Webb phys Street continued 404 P G & J P George restr 405 Davis Beauty Shop 406 J W Burke Co of- fice supplies 409 Flynt & Glenone Alley 450-52 Macon Daily Telegraph Macon Daily Tele- graph Pub Co 451 Postal Tel-Cable Co 453 Ainsworth Optical Co 453% YWCA 454 XV Clothes Shop 455 W U Tel Co Tenn Dist Tel Co 456 Sami Shier shoe repr 457 Williams Jwlry Co 458-60 Lee's Dept Store 459 Burden Smith & Co dept store 461 Citizens & South- ern Bank Bldg Citizens & South- ern Bank Rooms: 203 Southern States Life Ins Co 204 Reynolds Tobac- co Co 205-6 Prudential Ins Co C M Adams & Son ins 207 J E Wilson ins Nottingham lawyers 314 Glen T Carthron lawyer E W Butler lwyr 4th 11 M D & S R R Co 411-12 Equitable Life Assur Soc of the U S 414-15 Natl Life & Accident Ins Co of Nashville 503 J T Ross phys 503-6 C A Yarbrough dentist 509 Orman Danl phys 515 G T Miller phys 518 M M Stapler phys W J Little phys R L Cater jr phys 521 J R Holt ofc 522 Mrs M W Halliburton ins 6th fl Jones Park & Johnston Iwyrs 702 Macon Credit Bureau 703 G P Gates dentist 707 Vacant 708-710 H M Reid & Co lbr 710 H D Chapman & Co lbr 717 Met Life Ins Co barbers 208-10 The Bradstreet 721 North Carolina Wardrobe Press- Co mere agey ing Club 211 Chas Akerman 410 Criterion Theatre lwyr 411 W D Scott photog J C Harris lwyr Pine Assn 722 Basil Duncan lbr C R McCord brkr Street continued Dennis & Dennis 214 Real Silk Hosiery 462 Norwood & Mobley archts Co I restr Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoismeso. eblieSlecetnLdipstrtoso.sHpeeOacudtsrqnufeaowr-r cCoaptya.log coRnt.aLin.sPOmLuKch. &vaCluOa.,bDleEdTaRtaO.ITA, sMkICfHor. 1 1 JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS Cherry STREET GUIDE Cherry 1025 464 Galbert's Candy 512 Louis K Liggett Boris Koskin Land Co drugs tailor 466 Vacant 513 Dempsey Grill Royal Billiard 468 Macon Optical Co 514 F W Woolworth Hall 470 Murphey Taylor & Co 576 Bibb Natl Bank Ellis real est 515-17 R S Thorpe & Second N W Mutual Life Cons clo 602-4 Macon Natl Ins Co 518 David Watchel clo Bank Bldg Mortgage Inv Co Mikado Realty Co 519 MaolrorfitstriPutzel Macon Natl Bank Ga Loan & Trust City Inv Co Third ne cor Hotel Dempsey bsmnt Dempsey Hotel Billiard Parlor 502-4 Fourth National Bank Bldg Fourth Natl Bank Rooms: 18-19 W O Cooper jr lwyr 520 J N Neel Co clo rear Parcel Deliv Co 551 M A Blum bil- liards 553 Vacant 555 U-Et-A-Lunch Corp 556 McLellan's 5c and 10c Store 557 Vacant Co Rooms: 207 Macon Assn of Credit Men 208-9 W D Griffith ins W D Griffith & Son ins Sou Mutl Ins Co 314 B J Fowler law- yer 321-24 Harrold Bros 20 Hatcher & Smith 558 L F M Store dry Co ins lwyrs 22 Macon Blue Prt Co gds 404-5 Trust Co of Ga 559 Herbert Smart Clo 406 F F Jones osteo- Co path 24-25 F R Happ 561 Arcade Billiard R H Mason den- archt 26-27 R G Plunkett lwyr 28-29 Sou Underwrit- ers Co ins 30-31 Cornell-Young Co R H Jones & Co miners 32 Baxter Jones Parlor tist 562-64 Ben S Persons M R Schuster Inc drugs dentist 563 Jas Lamis news 421-24 Ryals Ander- dir son & Anderson N Y Hat Clng Co lawyers 565 Harry Sher men's 503-5 C L Anderson furngs phys 566 Trive -s Clothes Store Corp Street continued 605 J W Lovelace den- broker 567% Vacant tist 33 Morris Stone Co 569 Willingham Bldg 605% S B Harrell 34-35 S W Hatcher O C Anderson phys lawyer dentist 607 Andrews & Bel- 37 Methodist Centen- Morris-Flinn Co ois restr ary Hdqtrs chemists S G Sharp shoe 38 W F Thames contr 569% Calhoun & repr 40-41 R A Williams Thomas 608 J C Penney Co real est Street continued 570 Kinneys shoes 572 F C Benson Co 609 Snyder's Readyto-Wear 503 Dempsey Haber- clo 610-12 Vacant dashery W B Keily opti- 613 Fashion Shoe 506 Cherry Hat cian Store Shoppe Cherry Beauty 572% Metro Studio photogs Glyck Veneer Lbr Co Shoppe 574 Clisby Bldg 614 Vacant 508 Jacob Turner shoe M G Bayne clothes 615 Palm Barber Shop repr prsr 615% Vacant 509 Sou Sport Sup Co Central City Bro- 616 A G Rhodes & Son 511 S L Orr Co jwlrs kerage Co furn FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT lv. Tv. POLK & CO. CHICAGO HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIM as a mm PUCE THE DIRECTUBY IS THE GREATEST MARKET PLACE IN THE WORLD Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year RLPoiKifr) PUBLISHERS 1026 Cherry MACON Chestnut 617 Lutlier Williams Bank Bldg 764 Mrs Lizzie Gold- 867 Mrs Gussie Solo- man mon Luther Williams Bank & Trust Co 618 Vacant 620 C A Hilbun optcn 620% Mrs Margt Jones mus tchr Macon Pleating Shop 622 Newman's Millin- ery Alley 650 Jackson & Gordy barbers 652 J H Spratling optcn 652% Lafferty Millinery Parlor Mae Mitchell drs mkr Amer Legion Club 766 J A Cox 869 M Y Blum S A Baldwin 870 Cong Betb-Israel 767 N H Reid Synagogue 768 S B Pell 871 Clem Hackney New Spring 800 E P Vann 901 R E Bankston C B Chandler 903 T C James 802 Inez Neal 904 Mrs Etta Wood 803 Vacant rear John Harris 804 Frank P Bakewell 905 Vacant 805 H C Nixon 906 G L McMillan 806 Vacant 907 O O Collier 807 Vacant 908 Vacant 808 M A Blum rear Mary Johnson 809 C G Clinkscales 909 Aubrey Saunders J J Phillips 809% W A Ryal 911 Philip Fierman 926 Jos Waxelbaum 810 Mrs M L Peak 811 F W Reichert 961 Mrs Sarah Jabovitz 811% S N Gans 963 Jacob Backer 812 Isaac Morris 814 Vacant 965 W C Sbaefer 656 Bethune & Stevens drugs 656% Sou Business College 815 Mrs Hattie Joyner CHERRY (Unionville) 816 Vacant --From Pio Nono ar 818 Cherrydale Apts w, 1 s of Columbus Apartments: rd Cotton av 1 Mrs Emma Her- 666 Macon Food Clinic man 667 Flournoy Auto Co filling sta 668 Nu-Style Delicatessen 670 Vacant 2 Vacant 3 Robt Nussbaum 4 Jerome Herman 5WJ Mountford 6 H P Kaplan 671 672 673 712 713 Crimmins Sign Co Flournoy Auto Co G P Finney cigars Stewart Oil Co First City Auditorium Mrs E P DuBose Street continued 821 H R Watts 852 Chas Marks 852% H A Sher 853 Newman Apts Apartments: 1 H G Stubbs 2 Jas Bradford CHERRY AV -- From Courtland av e to Ninth, 1 n of Columbus rd 294 J T Hamlin 296 E A Engelhart 300 M H Nolter 304 Vacant 306 C L Odom 312 Ernest Lutz 320 J E Baird 322 Mrs Mamie Paschal 324 S F Bates 717 E L Hobby 3 Mrs Helena New- 450 Vacant 718 L H Burghard undertkr man 452 H J Vaughn 4 Mrs M E Harbaum 456 J G Lowe Harrison Mutual Burial Assn 754 Mrs A S Dasher 755 Mrs M A Houser 758 A P Cushman Street continued 854 Walter Kessler 858 K M O'Connell A W Voight 859 J W Swearingen CHERRY'S AL --From 759 Spring e CHESTNEY (E M) -- From Mitchell north, 759 W A Saunders 862 A A Loyd 2 w of Fort Hill bdg 760 Mrs M M Ryon 763 Mrs N R Mann 863 J D Dykes 865 B J Bolton C W Weaver CHESTNUT--From 709 College w to Duncan bdg 866 R H Bond ' 107 J M Dopson PoIIcDirecbnjB DETROIT .FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO TERMINAL TRANSFER COMPANY Southern Business Coilege E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 6b6/z CHERRY ST. PHONE 3041 MACON R Chestnut STREET GUIDE Clara (E M) 1027 115 Mamie Smith 468 Sami Freeman 357 J E Prim 121 Jas Wright 473 Effie Kendall 359 W C Howard 123 Moses Jackson 474 Mattie Howard Willingham begins Tatnall 475 Peter Hawkins 360 L M Delk 207 Chas Davis 477 Oscar Cheatam Randolph ends 211 Cain Morgan 478 Mary Steele 361 T W Cooper 217 Oscar Garner 479 Henry McGee 365 H J Behr 218 W L Taylor 220 S Shier 221 A H Hendricks 222 J R Spier P B Gaffney Mrs L Dossey 480 Wm Dillard 482 Elbert Holland 484 Fannie Smith 485 Fannie Jenkins 486 Benj Tuff Emanuel Smith 375 East Side Church of Christ St John 402 S R Hudson 404 M B Folsom 224 W C Moran CHESTNUT LANE-- 406 J H Hightower 225 Nancy Collins From C of Ga Hy to gro 227 Vacant Chestnut, 1 w of Lin- 408 S F Canfield 237 Jas Wilson den av 412 Vacant 240 M D Huett 3 Ada Garling 415 S B Arnold 243 Wm Whigham 4 Wm Keith Adams 51 Dorsey Curry Broad 506 Julian Stallworth 253 Mort Dorsey 554 (3) Laura Ridley 508 Mrs Hattie Wright 257 Eliza Jenkins 261 Georgia Harris 265 Jennie Jordan 271 Sarah Brown 273 Vacant Linden av 400 Vacant 401 Vacant 403 Perry Lavister 405 Wm Nobles 407 Mary Sasser 415 Corine Richard- sor 427 Vacant 429 Teff Adams 431 Wash Taylor 432 Wm Williams 433 Albert Thornton 434 Sami Richardson 435 J G Kyles 436 S Hubbard 555 Edw Hubbard CHURCH (E M)--From 304 Hydrola north to Fort Hill 100 East Macon Meth Church 104 Rev P F Holloway 105 R A Hendry 106 S P Christian Garden 202 W R Snipes 204 Mrs Lizzie Allen 248 W L Wasner 249 WH Colbert 250 Vacant 253 J M Fountain 254 P H Raspberry 255 East Macon Bapt Church 256 Frank Crowell 510 E B McNeill 512 G A Cochran 514 G A Cochran gro CHURCH (S M) -- Changed to Concord CHURCH (C H)--From Bailey av w, 1 n of Montpelier ay CHURCH AL (S M)-- From Elbert to 4th, bet Church and Steele 200 Lige Davis 212 Mary Washington 214 Jesse Goodrum 351 Jas Daley 353 Robt Sanders 354 Edmond Leary 356 Mary Key 701 Vacant 437 Julius Kimbrew 438 Obe Haynes 440 Mose Jones 441 Danl Irvin 443 Wm Johnson Chestnut la 454 Benj Woodall 455 Jas Hawkins 456 Clarence Hopkins 258 L E Owen 259 Mrs Ella Wasner 260 W F Thompson Lee 302 R F Hill 303 J R Vaughn 304 C E Hightower 305 Mrs Lillian Hol- loway CHURCH LANE (S M) --From Elbert to 4th, bet Edgewood av and Church 240 Susie Barron 241 Jas Cummings 242 Thos Tuft 244 Wm Hall 246 Anna Statemon 458 Ira Bullard 307 J H Boutwell 461 Vineville Bapt Ch 308 B M Thomas 462 Jos Monroe 310 R H Causey 248 Lizzie Wilson CLARA (E M) -- From 464 John Allison 317 Wm Gilbert Bowman to Reese 467 Wm Reese 356 Mrs S C Durrett 5 Jas Purnell Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 1028 Clara (E M) MACON Clinton (E M) 6 Louise Williams 15 (913) Alex Nelson 317 J M Reese 7 John Carswell shoemkr 318 A S Holt 8 Mary Woodward 17 (917) H Thweatt 322 J W McLeod 14 Rubin Chappell 23 (523) Pos Walker 324 J L Land 24 J D Williams 25 Julia Harris 27 Benj Wright 101 Lena Munford 116 Ella Fitzpatrick 151 Roberta Stevens 152 Chas Jackson 153 Wm Cash 154 Arth Woodard 157 I B Patterson 202 Alford Cornelius 210 Edw Vowers 25 (525) Ocmulgee A Bacon M Ch 402 D W Chance 28 (528) Abbie Mims 403 Mrs Mary Kemper 32 (532) Frank John- 405 T A Turner son 410 H C McKinney 36 (536) A L John- 417 E E West son 420 F H Horne 40 (540) Herman 424 H W Baldwin Powers* 91 J W Brown 93 A D Sowell 95 A D Sowell gro 97 W C Drinnon CLEVELAND AY (V)-- From 626 VineviUe av south one block to Talmadge 237 Evelyn Stevens 99 Vacant 100 V M Lane 415 Vacant Rogers 102 H F Strohecker 417 Sol Stanford 101 Mrs L F Sanford J M Berry CLARK LAKE --From Jackson to Hall, bet Fort Hill and Hill 103 Rev J A Smith 104 L P Smith 105 W T Colquitt 106 J L Anderson 103 Vacant 104 Claude Schneider 105 D T Ellis 106 J M Heard 121 Julia Shields 107 O A Armstrong 107 W H M Weaver 122 Lois Lockett 123 Eulis Lewis 129 Eulis Lewis 130 Jas Morris 131 Polly Wilson 204 Beulah Standifer 210 Geo Dreskell 211 Gussie Beebe 212 Stella Ashton 213 Emma Denton 325 Lizzie Goddard 327 Lula Bowen CLARK'S AV (V) -- From 275 4th av north to 5th av 109 C B Moore 110 D D Dunwody 112 Rev T F Callaway 113 Vacant 114 Mrs F F Aldred 116 P C Carswell 118 FED Morgan Corbin ay 202 Mrs O Arnett 206 E B Smith 208 Guy Armstrong 211 Clishy Clarke Callaway 301 J H Pellew 303 Rudolph Oetter 305 G T Stewart 308 B S Deaver 108 Vacant 109 G W Ellis 110 A W McClure 111 Mrs I E Latimer 112 F E Dortch 113 Chauncey Smith jr 115 P S Steed 116 Vacant 117 J H Deming 119 J W Snow 120 Vacant 121 B L Slocum 122 S C Rainey 124 W E Scruggs 126 R B Smith 129 J E McDonald 130 J E Boyd CLARK'S HILL (E M) --From Jackson to Hall, 1 n of Fort Hill CLAYTON (Y)--From junction of 3d and Highland avs west CLEVELAND (S M)-- Mrs Kate Gilbert From Blount w to Houston av, 4 s of junction of 2d and Broadway 102 R R Berry 103 Mattie Andrews CLINTON (E M)--From C of Ga Ry northwest, 5 n of river 24 A B Lafield 27 Mrs Alice Red- 4 (904) Mattie Hampton 107 Marvin Lee R V Mclnvale mond 29 Alonzo Redmond 6 (506) Mary Buck 301 W T Greene 56 Needham Shelton 8 (908) Ruffin 303 J C Stone 110 Ellen Redmond Reed 304 F A Carney 200 Bibb Mfg Co 10 (910) M J Searcy 309 S M Stephens Clinic No 1 13 (513) Alex Nelson 312 A W Matson Lake City ends FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise* Send, to Headquarters for all kinds pf Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. Ii. POLK & CO., DETROIT, MICH. Clinton (E M) 210 Bibb Mfg Co Nursery No 1 213 Bibb Mfg Co gymnasium 215 Clifford Evans 216 John Ward 217 J P Hobby 218 Meth Ch Chapel 220 R E Anderson 222 J T Bailey 224 W L Carr 226 (26) Bibb Mfg Co community house 227 Bibb Mfg Co Day Nursery 230 (24) Allen Layfield 232 (23) J E Amerson 234 John Dukes gro 255 W J Glisson Main 319 Mrs Rosa Dixon 322 E D London blksmith 324 Frank Lavender 325 C G Collins 327 C M Roberts 330 E G Riggins 331 J M Hines 333 E T Pritchett 334 F A Barrow 338 J J Smallwood 341 Geo Ulsery 345 J R Johnston 350 B C Tharpe 352 W J Jones 353 Julian Renfroe 359 J E Anderson 363 Pennie Carroll 372 W C Fox 373 W A Woodall 374 W J Smallwood se cor East Side Pres- byterian Ch 386 H E Dinkins Center 390 T J Hawkins Powell 414 J W E Culpeppei 415 Vacant 417 Vacant 447 A T Latimer shoe mkr Wilbur King electn STREET GUIDE Clisby (Y) 102;) 450 Thos Coleman 907-9 R L Lassiter gro 451 E J Hart 911 A C Freeman C N Middlebrooks 915 King & Elder gro 452 C N Middlebrooks 453 C H Little gro 453% Vacant 454 L E Tidwell gro 455 Andrew Butts gro 456 Vacant 456% H L Johnson barber 456 Augustus Barnes 457 Vacant 46J) S A Walker gro 474 Nelson Parks 476 Lee Atkins gro 477 Vacant 478 O R Sowell gro Second ends Wilbom begins 486 Emma Latimer 506 Clifford Dempsey CLINTON ROAD--Continuation of Clinton (E M) 907 W N Turner 909 W D Ford 910 J A Monsees 965 Bessie Johnson 1000 Primitive Baptist Church 1010 Michell Jackson 1011 Mrs Mary Rogers 1012 Alf Glover 1013 W S Ellis 1014 C L Humphries 1015 E M Pickett 1017 R W Gammon 1019 J I Smith 1020 J E Herrin 1021 A H Herrington 507 508 511 512 518 529 530 534 600 601 606 610 655 700 701 702 703 706 708 Mrs Annie Thomason G H Stevens H J Richardson R H Jenkins Jos W Wrye Mrs Maxie Reddy J L Peterson E R Schell C M Moore Broad Vacant T B Stevenson Wade H Foster Henrietta Griffin Clevelan Norton Astor Clara Brantley T M Roberts J D Morse Mrs E L May Jackson Tuff Augustus Tripps 1022 J E Herrin gro 1023 W C McGaughey 1024 Cleo N Roberts 1025 Edgar Barfield 1026 Clinton Road Cash Grocery 1027 A Baggett 1028 B O Brown 1030 Lamar Clay 1032 Robt Stubbs 1035 Felix Smith 1037 Jas Lowe gro 1039 Edw Wilder 1040 Mrs Ida R Hum- phries Jos King 1041 Robt Lewis 1050 Central City Col- lege 1051 St John's Bapt Ch 1075 Johan Berkner 1101 J H Lowe 721 Lee Grace CLISBT (V)--From 400 723 Jos Ross Vineville av, south to 727 Delphine Grace C of Ga Ry 755 J W Wilson 103 Mrs M R Denton 801 A C Kitchens 106 G I Hardeman 809 A T Rodgers 108 C A Struby 811 B F Whitten 110 L B Simmons Jackson 116 Hubert Haw- 901 A L Rogers thorne 903 C H Lovell 117 Washington Des- 905 W M Edwards sau A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1030 Clisby (V) MACON College 120 Dr T E Rogers COLEMAN AV (H H)-- 167 Vacant 121 R C Souder From 534 Linden av, 170 Kath Beale 123 J C Rousseau 124 J D Renfroe 131 Mrs C M Harwell 200 Robt Wynne 201 L E Ryals 202 W S Lawson 203 Mrs M E Long 204 Holt Chapman west to Duncan av 91 Vacant 93 Mrs Clara Farrar 95 C L McGinty 97 H L McEwen 99 Vacant 101 H B Mozo 102 E J Cason 103 J W Epting 174 Wm Clemons 176 John White Jones 200 E W Cabaniss 205 R J Danford 208 Vacant 209 Nathan Williams 210 T N Tinsley 212 S L Felder 205 Mrs Henrietta 111 Rev H M Fugate C W Johns Bernd 114 Mrs P B Edwards 215 Dock Anderson 207 Mrs M S Platt 119 N L Roberts Wm Ford 209 R E Aultman 210 Avner Chambers 212 C L Park 120 P H Watson 121 Ella McLean 126 W F Lawrence 216 J E Cheek 217 Vacant 221 Mrs Eliz D Satter- 213 L R Power 127 Mrs Eliz Peeler field 214 Dr J W Martin 215 E P Bidez 216 E C Peppen 216 E C Rose COLE -- From 862 Orange southwest to Maple 104 B P Shephard 114 Gustavus D Fields Mrs M L Dey 115 W Y Myers 122 P T Travis 124 Curtis Dickson 124% H J Smith 125 W C Jones 130 G C Spangler Johnson av 201 J P Sammons 202 R H Hartley 210 T J Cater 218 Mrs Sarah Yates 219 W J Brown plmbr 221 A R Matthews 222 Jas Phillips 223 R C Cropper Carling av 315 S L Robinson 320 W E Beackam 321 W E Worsham phys 322 Mrs D B tewart 224 Vacant 226 Vacant 237 L C Kirven 239 Mrs Jim Marquis 240 Vacant 246 Vacant 250 F E Land 254 Mrs Geraldine Wright St Paul ends 258 Mrs Mary P Cheves 263 Vacant 271 J C Napier 272 W Z Williams 277 R C Berckmans 128 J A Leverett COLES AL--From Ha- 278 Vacant Mrs M E Fuss zel to Oglethorpe, bet 279 Eden Taylor jr 131 J D Collins Jackson and Calhoun 279 C M Preston 132 136 137 143 148 150 151 153 200 202 204 Vacant J S Martin Mrs Ella Simpson P R Purser C R Elder Vacant E O Wilson Mrs Lela M Greia Vacant Maple Mrs Mattie Eu- banks J T Kitchens Oglethorpe COLLEGE--Seven west of Second, from Rose Hill Cemetery to For- syth, southwest to Oglethorpe and south to Ash Rose Hill Ceme- tery 125 Jos Watts 141 Mary Cray 145 Ella Layfield 152 Edw Wilson 153 Gilsie McBride 156 Cora Gaines 160 Roy Moore 280 Dr C L Anderson 283 B F Barden 284 T E Artope 287 Mrs Nettie D Wor- tham 290 C T King 296 W H Sloan 298 W L Ellis Bond 300 A M Peeler 305 Lafayette Terrace Apartments Apartments: 1 E A Taylor 2 R A Heinsohn COLEMAN AL -- From 161 Vacant 3 M E Bleakley 524 Cotton av to First 162 Susie Jennings 4 P B Mason More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. College STREET GUIDE 5 Vacant 11 Paul Craig 7 Vacant 12 Fred Jordan 8 Vacant 14 A Newman Street continued Street continued 310 C B Caldwell 478 The Ellisonian 314 Mrs A H Brown Apartments: 317 S T Coleman 320 Mrs Henrietta 1 Vacant 2 Vacant King 3 Vacant 322 Mrs A W Adams 4 E F Brantley 324 Dr J E Wright 5 Glen Toole 329 0 P Willingham 6 W G Lassiter 335 W C Marshall 341 C M Wiley Magnolia ends Washington Park 354 Mrs E J Cook 355 Mrs Edw Wolfe 600 Wesleyan College Washington av 360 Mrs Jim Marquis 601 Wesleyan Dormi- 362 M E Outz tory 363 G H Echols 507 C H Hall F E Rhine J T Ross 509 T H Hall 515 Mrs M J Hill 367 S S Dunlap 520 Wesleyan College 370 C L Whaley 375 W R Rogers 376 A C Felton Dormitory 521 E R Jordan 524 Vacant 401-5 Massee Apts 404 W J Grace 409 Mrs M D Adams 410 A R Willingham 411 A W Smith 414 Mrs N J Estes 415 C B Willingham 418 W R Cox 525 Mrs E V H Glover VanHoose (School of Music 527 Clarence Morgan 530 Mrs J S Lamar 531 T H Boone 534 Mrs I M Coleman 545 P D Willingham 425 Vacant 550 H L Barfield 427 Mrs Minter Wim- 554 L I Waxelbaum berly Dure la 445 W F McQuillian 555 T D Tinsley Georgia av 556 O A Park Jefferson begins 558 W B Sparks jr 452 R L Wyatt 560 W A Harris 456 D D Adams 563 W J Massee 468 W B Sparks 570 B C Smith 470 C R Ellis 576 Mrs A P Tennille 476 College Hill Apts rear Eugenia Wyche Apartments: 587 H A Wright 1 Sarah E Reese Mrs L L Dempsey 2 T W Ellis jr 597 A L Burnet 3 Walter Jones 4 E W Sammons jr R R Montague J W Wilson 5 Glenn Toole Forsyth 6 Vacant Cotton av ends 7 Maud L Edings ne cor St Paul's Epis- 8 J K Williams copal Church 9TB Miles 610 CE Roberts 10 J P Greenleaf 624 J N Neel College 1031 632 Warren Roberts 635 Rev C H Lee 643 St Paul's Episco- pal Parish Home 656 J B Riley 657 Mrs E C Adams 659 C H Bateman 662 Richd Oliver 664 H P Derry phys 666 D S Jones Appleton av 670 Isadore Brinen 679 A M Erwin 680 Mrs M E Craig 681 C H Humphreys 683 L L Carrington D A Michael 686 J L Smith 687 R W Jemison 689 A P Bell 689% Vacant 690 J R Howard 692 A & P Tea Co Moseley's Market 694 Smith's Pharmacy 696 Mrs C M Mickle- john 698 Vacant C of Ga H E Shamrock Chestnut 709 Frank Taylor 711 R J Taylor D W Herndon 715 L C Greene 719 V E Armstrong 720 W F Geeslin 722 Vacant 723 J D McMurray 724 Vacant 726 A E Moncrief 727 T T Carstaphen 728 H P Derry jr W H Watson 735 W N Hart 736 Mrs M K Ward 737 Mrs Ida Kelburn 739 L W Rogers Co gro Nash Sausage Co 742 Mrs Belle Chat- field 745 Jas N Riggins C J Nicholson 747 E D Huthnance The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be pound The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 1032 College MACON Colquitt (S M) 748 Mrs M Wippler 1127 Attoway Cottage 44 R B Rhodenhiser 751 T C Drew 1128 J I Adams 46 W E Jackson 752 Tatnall Sq Pres- 1130 D A Hilley 240 M T Betts byterian Church 1131 mith Cottage 244 R N Hogan Oglethorpe 1132 O C Beasley 246 D F Marshall Gulf Refining Pill- 1133 McDaniel Cottage 337 T J Whittier ing Station No 4 1134 S E Kent 339 J D Allen 836 Alexander School Edgewood av 341 R S Cheatham No 2 1234 Mrs S C McLean 343 T B Sherwood 838 C B Rhodes 1236 Mrs Amanda Put- 344 J R White 840 iM J Redmond nam 345 G W Mayo 846 J R Bowdre 1237 G M Israel 346 W O Ward Hazel 906 J W Salter 910 M B Medlock 912 F J Holder 1238 1240 1241 1242 P L Knight Wyley Bishop W N Lyles C F Stokes 347 R E Morgan gro 348 C P Chailan 401 Primitive Bap Ch 403 A C Cranford 920 Albion Apts Apartments: COLLEGE PLACE -- COLLINS LANE--From From Ross w to Col- Jefferson to Jones, 1 Robt Casson lege, 12 s of Ocmnl- bet Madison and Mon- 2 Chas Chandler 3 J F Brumbark 4 Mrs Mattie L Johnson Street continued gee river roe 108 J T Avent 109 F M Martin 110 Mrs Ellen Brown COLQUITT (S M) From 2612 Broadway C L Sego e 926 R E Findley 111 Mrs Daisy Sample 102 J W Lester 930 Jordan Apts Shamrock 110 C L Bartlett Apartments: 1 H G Carter 2 M J Parr 3 Danl O'Connell 4 Dana Adams 200 W T Raines 201 W A Green H W Stucky 202 H P Wrigley 203 Mrs Lettie Tarver 112 L D Adams 115 J W Sanders 116 Mrs M E Roberts 119 W L Jenkins 120 M F Bullard Street continued 936 J W J Taylor 940 Centenary Metho- dist Church Ash 204 B D Knight 205 J C McDaniel 206 Vacant 207 Vacant 209 Wm Sherrer Mercer University COLLEGE SOUTH -- 1004 John Jackson From 1171 Ash s to 1008 Geo Barnes limits 1015 Hattie Mays 24 Minnis Gregory 1016 Lucy Mims 26 Wm P Huff contr 1020 Eug Akin 1024 Marietta Cannon 1025 Rafe James 1026 Lucinda Battle 1027 Vacant 1028 J M Booker 1042 H H Booker 1045 L J Stevens 28 W P Hunt 30 G W Peddicord 31 Nancy Mills Hall 32 J T Smith dairy Tiny Smith music tchr 34 Mrs Eliz Lingo Wm M Harrington 121 E G Scoven 124 C B Watson 125 A E Hatcher 134 T F Hollings- worth 135 Mrs M E Hinson 136 Chas Davidson 137 J T Stapleton 138 A Dean 139 J C Driskell 141 M P Philmon 142 W S Edmonson 143 J B Sanders 144 G P Estes 201 Lee Ross 300 (104) Albert Reid 301 (609) Ruby Hollo- way Elm 35 Mercer College 302 (608) Jerry Ross 1120 Holland Carter Cottage 303 (607) Eug Frazier 1121 Tolefree Cottage 40 C E Clements 304 (606) Jennie Har- 1123 Hard Cottage 43 McNeill Cottage ris 1126 0 H Gates Rev H F Jelks 307 (603) Lee Ross R. L. POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Colquitt (S M) STREET GUIDE Corbin Av (V) 1033 400 (455) Emma Fen- 319 W L Wilder ney A W Schmidt 401 (501) Annie L Johnson 402 (521) Arth Clay 403 (502) John Wal- ters 405 (520) Anna Davis 407 (504) Buster Johnson 400 (304) J H Stephens 411 (104) Isaac Stephens 501 Edw King 327 Mrs Anna Allen 328 S E Wellons 330 H J Walker 334 Mrs S E Means 339 A R Wellons 340 .Mrs E L Smith 341 Mae Eaton 343 W N Scrivner 345 T E Kelly 348 R E Collins 350 W W Langston 352 W G Philips 601 (315) M T Wil- COLUMBUS BOAD -- liams Continuation of Mont- 938 (926) Tabernacle Rescue Home 939 (933) R Y Williams 940 J W Jackson 941 (245) Clarence Young 942 Adell Riley 943 W R Riley 944 W J Jackson 945 Montpelier Garage 946 (595) Mrs S J Hales 947 O R Riley gro 948 Emma Jackson 968 S L Taylor 970 (721) Oliver 603 Vacant 605 (111) Vacant 607 (1101) Enick Paul 609 (107) Alene Wil- pelier av, from Pio Nono av west 701 Cherokee Pharm- acy Sims 972 Vacant 974 Wesley Slocum 976 Otho Riley gro liams 702 T M Raines gro 992 Early Calhoun 700 (208) G W Dean 702 (206) Herschel Gilbert 703 (424) Florence Hill 704 (204) Ranee But- ler 706 (204) Washington Dean 707 (205) John Turk 709 (203) Vacant 801 (2845) Jas Pounds 703 H E Smith 996 H Huff blksmith 705 Z D Yates 998 Vacant 711 Mrs Ella Kitchens 801 (400) Eudora Walker CONCORD (S M) -- From 522 Elbert, west 803 (129) Walter to Broadway Slocum 108 Walter Sims 805 (100) Robt Jack- 110 Reuben Brice son 112 Vacant 820 Philip Chapman 116 Wm Scoggins 822 Edw Blue shoe 120 C B Wilson repr 124 Mrs L K Simmons 825 Henrietta Rhodes 128 E B Carter 918 (919) Clarence 130 H K Sessions COLUMBUS --From Orange west to Oglethorpe, 1 s of Forsyth 250 (Mrs A J Dewberry 252 Vacant 258 W T McCreary 261 Jas Lamais 262 Vacant 264 Vacant 265 M C Few 266 S E Clark 270 Vacant 272 G C Fennell 274 Mrs N E Taylor 280 Rebecca Gordon gro Appleton 315 Vacant Slocumb 920 Chas Rice 922 Vacant 924 (460) Amanda Wise 926 (870) Henry Cal- laway 930 (942) Vacant 931 A D Webb 932 Sami Klein 933 Walter Sanders 934 (502) Martin Woolfolk 935 Mary Mosley 936 (510) T E Tidwell gro rear C H Avery 937 Albert Moseley 138 E L Ward 146 C W Ellison CORBIN AV (V)--From 529 Vineville av n (formerly Virgin) 100 J C Wyche 102 W T Tharpe 104 J B Whitehead 105 W C Willis 106 W B Childs 107 E L Davis 108 A W West 110 H N Mitchell 112 F D Stephens 113 C B Orr 114 A T Corbin 115 P H Sanford 116 W M Norris FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS... -- ANY PROFESSION .DETROIT R. L. POLK & CO. CHTCAUO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be (Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1034 Corbin av (V) MACON Cotton ay 117 R C Jones 14-15 J F Urquhart 27-32 Dasher & Mann 118 S C Fowler lawyer lawyers 119 0 H McAfee H B Bell lawyer 5th fl Security Loan & 121 K R Rader Street continued Abstract Co 204 H L Slocumb 107 W L Williams Art Street continued 206 W T Johnstone Store 151 Industrial Life & 207 J B Turner 109 Idle Hour Nur- Health Ins Co 208 W M Means series 153 Industrial Loan & 209 E B Redding 111 Masonic Hall Invt Co 210 B C Stewart 113 Mozo-Cater Co John W Ramsey 211 A M Williams furn Coal Co 212 G C Jones 115 Electric Dry T W Stokes ins 213 J T Riley jr Cleaning Co 154 F T Vincent Real- 214 W M Brown 117 D A Warlick & ty Co 215 B S Russell Son photogs Ned Vincent ins A T Ross 119 Geo Schelling 155 Cable Piano Co 216 W W Wilson 217 T S Sloan shoemkrs 156 Reliable Outfitters G R Schelling clo 157 Kenmore Burns 301 E R Carr 302 H C Jewett 304 H L Chichester clnrs Inc real est 123 Singer 6' M Co 159 Woman's Exch 123% P W Goette tlr 160-66 Wood-Peavy 311 Julia Golden 312 Alford Brantley 315 Harvey Robinson 316 Lee Wimbush 125 Clifford Walker Furn Co bicycles 161 C H Gregorie den- 127 Elks Lodge tist 131 H E Lowe Elec Co 163 O'Pry Htg & 340 Thos Wimberly Clayton Ocmulgee Park Wall 150 Macon Sav Bank Bldg Macon Savings plmbg Co 165 Fry Bros bicycles 168 Johnson Durham & Burke furn COTTON AV--First w of Second, runs south- Bank Rooms: west to Spring 1 W D Nottingham 103 Ridout-Marshall Drug Co 105 Hardeman Bldg Rooms: 1 N A Avant real esl 2 R D Feagin lawyer jr inv 8 Howard M Smith Co loans Manchester Mfg Co cotton yarns 9-10 Kinney Realty Co Guerry Kinney & 3-4 Clements & Co ins Clefiients lwyrs 11 R H Mabry den- L U Bloodworth tist lawyer 14 C H Perdue den- 5 Hunter & Daly tist lawyers 15 W D Wells den- W E Bartlett tist lawyer 17-23 E R Respess 8 Palm Purchasing dentist Co salary brokers 18 H H Johnson dentist 169 Johnson Durham & Burke furn 171 Miller Bros plmbrs 173 Rialto Theatre 179 Vacant Cherry 201 Ellis Building Piggly Wiggly gro 201% C R Ellis archt J W Rogers phys 203 Vacant 205 Barker Bakery 205% Vacant 207 A & P Tea Co 209 Vacant 210 A L Glasco brbr 210% Mrs L M Atwood pleating 211 Bankers Ins Bldg Bankers H & L Ins Co Kaigler's Business 9-12 Vacant L W Moore den- College 13 E W Tipton tist 212 C D Kenny Co lawyer 23 J A Selden phys teas- R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 Cotton av 212% E J Atwood pliotogr 213 Coral Gables real 214 Ga Gro 216 Central Ga Bak- ing Co 218 Tony Tsistas restr 222 Nash Sausage Co L W Rogers Co gro 224 Dinty Moore's restr 226 Arthur & Rainey restr 226% S J Stewart lawyer J J Bell dentist A J Stephens lawyer 228 J F Alexander gro R M Schelling shoe repr 228% J L Hainline wall paper Alley 359 Try-Me Bottling Co 361 Dixie Ice Cream Co 361% A S Brown archt 363 Gee Yin Laundry 365 Vacant 369 Brad Wall Inc auto sups Poplar 407 G E Amspoker auto sups 407% G T Stewart auto batteries 409 W T Harden poultry 411 Vacant 411% Vacant 413 T J Hunt barber 415 Moses Miles soft drinks 417 Moses Miles bar- ber 419 T J Wood poultry 421 C R Sanford tlr 425 A H Bell tailor 429 W N Johnson tlr 451 Peoples Drug Co STREET GUIDE Courtland av 1035 451% J H G Williams 520 W D Morris shoe phys repr 452 R W Hurley electn 522 Vacant 452% Colored Y M C A 523 C J Jenkins soft 453 Liberty Sav & drinks Real Est Corp 523% G U O of W M 454 tS'am Chung ldry of E of A 455 Peoples Health & 525 J T Shropshire Life Ins Co plmbr 456 H G Tanner shoe 527 Kyle's Drug Store repr 528 Frank McBride 457 Cent City Under- blksmith 458 taking Co G F Yretter plmbr rear 529 Lizzie Collins J R' Burnett sew- 460 Paul Duval & Son ing machines furn reprs 529% Wash Brown 461 Vacant 530 Aug Combrevi gro 462 Vacant 531 Wallace Powers 463 Vacant 534 Tremont Temple 463% P L Smith Baptist Ch 465 S C Clemon real 538 Vacant est 553 Rena Powers 466 C B Berry barber 561 Patsey Crawford 466% Fannie Jones 565 Stewart A M E 467 Gustav Polenz Church umbrella repr Tharpe W H drugs 468 Hubbard Under- Spring taking Co Pine 469 Falkner Tin Shop Forsyth begins A J Mumford lunch COURTLAND AV -- 474 Diamond Market Co From C of Ga Ry s to Montpelier av 476 T L Wood plmbr 478 Aaron Danneman meats Plum New 100 Vacant 101 St James E Ch 102 M G White 103 B W Murrah 104 J M Hartley W H Wright 501-07 Triangle Service Co 506 Vacant 105 J R Hicks jr 106 D W jlill 107 Vacant 509 Zellners Garage & & Battery Co 108 M B Hammond 109 Dr Ernest Corn 510 C H Hutchings & Sons undertkrs 110 J L Young 111 Rev W W Silliman 511 L R Newby plmbr 112 W E Harrold 511% Della Phillips 113 Vacant 512 Vacant 114 Roland Mahone 513 Macon Cycle Co 115 Vacant 513% Vacant 667 J L Lowrance 515 J T Saxon printer 669 H O Jones 516 Vacant 670 Mrs Mary Schaub 517 R J Banks wtch- 678 Felton Buff mkr 679 S H Haddock Telephone 2687 J. T. MOLTON, Mgr., 348 Oak C. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill \york Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to 1 Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK &C0. Pols k Directory Bldg. Detroit, Mich. 1036 Courtland av MACON Crescent av (C H) 695 Vacant 269 Mary Byas 295 Annie Sanders 696 G W Alexander 300 C M Ritchey 298 Nellie Troutman Beech 301 Ross Woodall 299 Jas Lawrence 708 G S McCowen 303 John Mack 300 Thos Andrew 709 J A Maddox 305 Wm Bronson 302 Louis Williams 717 M L Lester 390 Rosa L Early 305 Jos Marsh 730 W T Millican 398 Henry Mitchell 306 Lutie Mays 731 L C Sheehan 430 Hurdie Billingslea 310 Mary Marshall 742 C F Petzinger 431 (129) Major Allen 312 Wm Wilcox 743 E T Ticknor 761 W J Barnes 777 A C Lasher 782 Vacant 793 B M Rankin 794 W R Golson 806 J E King 815 L P Jones 840 0 W Marshall 841 F W Walthall 842 J F Emerson 843 C M Bullard 845 B W Greene 846 Louis Jackson 850 Louis Jackson Napier ws 1 s Cherokee Bapt Ch COWAN (E M)--From Clinton east to city limits 3 n of Main 106 John Morris 108 Charlotte dowers 110 Vacant 501 Amil Johnson gro 516 S T Barnes 522 (222) Chas Haw- kins 593 Sami Ross 595 (5) Clarence Reese 618 (117) Danl Gross 620 (110) Horace San- ford 358 Nelson Peck 365 Lula Felton 366 Robt Parker 369 Virginia Winn 393 Frank Edmonds 401 Vacant 403 Martin Ellis 404 Hester Thomas 406 Vacant 408 Preston Chaney 698 Jones Tabernacle 441 J T Gray 699 Daisy Gunter 448 Marie Sanford 721 (120) Jos Simmons 485 Henry Robinson 523 Walker Johnson 723 (122) Mattie 525 Alice Hill 725 800 801 803 805 806 809 Lowe (118) Andrew Bryant Felix Whittey Vacant Jos Sinclair gro (115) Jos Tharp (116) Carrie Carr (104) Patsy Perry CRAIGS LANE (S M) --From Ells s bet 2d and White 50 Chas Green 53 Lula Fountain 54 Geo Tucker 56 Ann Mobley 59 Vacant 112 Edw Middlebrooks 114 Vacant 116 Lula Hunt 118 Gus Range 120 Eula Williams 122 iSVsie Wright 124 Jas Rollin 126 Jas Rollin gro 128 (228) Jos Ward 820 Viola Sanders gro 852 Vacant 854 Wm Brown 856 Jesse Pennymon 909 (8) Thos J Smith CRESCENT AV (C H) --From C of Ga Ry south to Montpelier av 916 (316) John Brown 115 G R Barnwell 917 (317) Oscar 117 D A Tarver Brown 119 G G Nutting 993 (16) Wm Nelson 998 Loranzo Black- 121 G B Smith 123 J W Graham 130 Jas Moncrief shear 127 E L Jarvis 136 Berry Brown 153 F A Whitaker 138 Albert McCrary CRAFT LANE (V)-- 157 A L Green 140 Jake Davis 205 A C Bowan From 301 Hardeman 194 (108) H L Rau av west to Forsyth 196 (120) C L Smith 257 Isaac Adams gro 73 Thos Kelly 198 D C Morgan 259 Annie Hatcher 75 Jesse Hardison 200 C G Shepherd 261 Noble James 79 Chas Davis 202 R M Hitchcock 263 Lula Ridley 85 Thos Mallory 204 J M Greene 265 Arth Ford 167 Sallie Johnson 206 C E Smith 267 Mary Ferrell gro 269 Vacant 208 E J Miller KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open AH Day From 9 to 6--4V2% on Savings Crisp (S M) STREET GUIDE Curry pi (N H) 1037 CRISP (S M)--From 511 (401) Morris Sties 117 Mrs F H Thomas Houston av e to An- 602 (274) Edw Outley 119 B E Miller tioch, 3 e of Enter- 604 (273) Augustus 121 J A Bryant prise Reeves 123 F F Powers 100 A S Boynton 606 (300) Perry How- 125 T W Barfield 101 G C Roberts ard 127 Mrs M Jones 105 G C Cleveland 608 (217) Dock 129 Mrs S R Calhoun 107 R E Baisden Shortes 131 C C Hatcher 109 W A Graves 611 (4) Grant Wil- 133 B F Taylor W E Richards W T Alton liams 612 Vacant 135 Herbert Tinker 136 Mahala Card 110 P W Mathews 613 (256) Arth Samp- 137 C D Boyd 111 J T Barge 112 Vacant 113 J E Cunningham 114 E H Harmount 115 J R Long 116 T D Lazenby 117 J C Holleman 118 W C Ivey 120 Vacant 156 J R Woodall 158 J T Walten 202 S L Dyes gro 300 (603) Fannie Bur- ton 301 Lee Henderson 302 (262) Josephine Bransford 304 (625) Wm Wash- ington 306 (623) David Bon- ner 307 John Holloway 309 Henry Allen 401 (8) Chas Harvey 402 Wm Westey 406 John Manson 408 (11) South Side Garage 413 (10) Vacant 500 (471) Luther Johnson 501 (401) John Hollo- mon jr 503 (413) Russell Banks 505 (404) Allen Williams 506 Vacant 507 (409) Isaiah Lin- ton son 614 Allen Thomas 616 (225) Wm Wil- liams 618 (155) Vacant 700 (499) Mattie Kel- ley 702 (489) Wm Walker 704 (189) Eug Threaks 705 (110) L W Brad- ley 706 (108) F S Green 708 Hattie Jordan CRUMPS PARK AV (C)--From Ridge av north, 2 w of Park av 101 Danl Walton 103 E F Armstrong 107 M R McCord 108 E F Jones phys 115 J A Wood CULPEPPER'S LA (V) --From 139 Pierce av west CULVER (V)--From 461 Vineville av north to Third av 102 Rev R M Long 104 G A Baynard 105 H F Martin 106 Chas Akerman 107 H C Herrington J J Gillard 109 J T Holt 111 H Smart 113 W E Moore Mrs Jean West Hightower RaineJ CURD (S M)--From Jeff Davis w to Division, 4 s of Edgewood av 312 Vacant 313 Felix Brown gro 414 Geo Calhoun 446 Vacant 800 Lewis Cater 801 Robt Lambkin 803 Vacant 821 J A Franklin 823 W W Kimble 824 Ewell C Jones CURD--(Unionville) -- From Dempsey av n to Robert, 1 w of Pio Nono av 220 Arth White 259 Jason Calloway CURD'S AL--From 305 College north to Madison 120 Jordan Ussery 126 Susie May 128 Sylvia Howard 130 Anna Thomas 167 Mary Rozier 232 Vacant 301 Lula Bush 302 Frank Cubie 306 Eliz Jones 323 Henry Scott 324 Cleveland Pink- ston CURRY PLACE (If H) --From North av e to Clinton rd 127 W F Willis 509 (607) Lewis Mrs Vie Harris 129 H A Jones Moore 115 Mrs Cliffie Cole 131 Lillie Lamar o 73 O cr o a <& CD m5 O^ *0 n5G T1 > AUTHORIZED DEALERS ^Jfor lists of names AI N'YtvTRAt D(E. -- ` ANY, BUSINESS' ' ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO FOR FISTS OF NAMES ANY TRADE ^ -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1038 Cutter's Green (E M) MACON Davis CUTTER'S GREEN (E DAISY PARK--Contin- 222 Florence Hicks M) -- From junction uation of Pine from 224 Houston Harris of Main and Church s Spring north to Or- 317 Chas Beckham 105 Mabel Elder 301 W T Morrison 303 H B Brunson 306 Mrs Millie Schmidt 308 U R Hatfield 310 J T Smyly 311 J D Payne 314 Duffy King 315 P L Henderson 318 W H Cutter ange 96 Ira B Gaultney 98 Vacant 99 L L Kah 100 E C O'Neal 101 Morris Barnett 102 M S Chiles 103 Vacant DALEY'S DITCH -- (S M)--Changed to Peacock 319 Mrs Gladys Stringfield 320 J W Davis lunch 321 W H Lynch 322 Jacob Lynn 323 P W King 324 G W Gibson gro 326 C W Hatfield 327 R E Addleton 328 J D Boatwright gro CUTTER'S LA (E M)-- From 602 Main n 112 Mary Wilson 120 E J Land 121 M T Taylor 200 V L Bates 202 W G Dudley 203 Alvin Dixon DALY (S M) -- From Broadway w to 2d, 1 s of Ells 117 Clarence Estes 119 Mrs Rosella Cronin 122 Mrs M Sinclair 125 Grace Sulivant DASHERS AL -- From 354 Oak south to 323 Oglethorpe DAYID (V)--From 251 Fifth av north to Vineville branch DAYIDSON'S AL - DAIRY LANE -- From 107 Green east to Orchard av 130 R H Gibson 131 J W Richardson 139 Lee Upchurch From 253 Oemulgee east to river DAYIS (E M) -- From DAISY (S M) -- From Prince south to Plant 2 s of College 227 Leroy Thomas 701 Gennie Hamilton 703 Fannie Wiggins 710 Josephine Smith 711 John Fudge DAMOUR LANE--From 4th n to 3d bet Ocmulgee and Walnut 1 Minnie Holt 2 Nathan Smith 3 Wm Shannon 4 G H Smith DANNENBERG AL (H H)--From Holt av Clinton north beyond limits, 1 w of Broad DAYIS (N H) -- From Masonic Home rd east to Clinton rd, 1 n of Boulevard 52 Alonzo Williams 58 Wm Davis 60 Albert Gross 712 Beverly Swint east, 2 s of C of Ga 62 Esley Clements 714 Fred Billingslea By 63 Shell White 718 Elijah Williams 722 Peter Hauser 324 R E Addleton 325 J F Holland DAYIS (Payne Mill) From Payne av s, 1 e 723 John Crawford DANNENBERG AY (H Brigham 725 Sami Billings 726 M D Ribbon H)--From 301 Linden av west 48-49 S B Johnson 50-51 W F Martin 800 Jos Liptrod 801 Wm Thrash 1 W W Lyster 2 T R Scoggins 3 Eliz Berkner 52-53 J M Martin 54-55 J J Mullis 56 R J Perkins 803 Vacant 11 D B Newberry 58 T J Cobb 805 Vacant 811 Ezekiel Bedney 813 Evie Allen 12 John Newberry 13 B F Blair 215 Flynt Anderson 217 John Farrell 60 G C Langford 61 C D Stewart 63 J O Newman 65 L H Hambrick 815 Clarence Gray 219 Winnie Walters 67 Vacant Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 Davis STREET GUIDE Division 1039 69 Workers Cottage DEMPSEY AV -- From 107 Geo Herrington 70-71 I M Cagle Pio Nona av east to 109 Sallie Reid 72-73 John Q Adams S College 114 R L Smith DAVIS (S M)--From Houston av e to Mikado av, 1 s Troup 100 C M Smith 102 J T Smith 109 R F Butt 2 John Howard 5 Jas Smith 40 Lizzie Rose 58 Ike Davis 60 Vacant 77 L E Davidson 79 O M Jackson DISROON AL -- From Spring to Franklin bet Walnut and Ocmnlgee 6 Mamie Hunter DIVIDEN AV -- From DAVIS AL--From Ocmulgee north to river bet 5th and 6th 3 Wm Hooks 5 Ophelia Evers 11 Bud Johnson 267 Vacant 268 Henry Gordon 319 Fields Towns 432 Lucy Stanley 105 Florence Cullen 107 Robt Burleigh 145 Jas Jones 173 Walter Hughes 185 Taylor Williams 200 Vacant 220 Annie Perkins 222 Vacant 224 Roger Jones 226 Roger Jones gro 240 Jas M Ross Cherry to Walnut bet 5th and 6th DIVISION (Tybee) -- From Son Ry Yards s to Edgewood av 2 n of Hammond 103 Mary Davis 140 Jesse Brown 207 Lon McQuirter 209 Jesse McGee DAVIS AL (E M)-- From 273 Garden 246 Jesse Burns 247 Jas Jones north to Wilbom 323 Frank Scott 324 Essie Barker 210 Wm Slayton restr 214 Henry Hicks 216 Wm Slayton 218 Mary Collins DAVIS LAVE -- From 328 Cora Gray gro 220 Gordon Corker 258 Ellis (V) to Vine- 330 Jennie Smith 222 Jas McBride ville br rear Theoda Webb 54 Wm Fields 57 Nora Richey 58 Simon Felder 332 Vacant 334 Georgia Childs 340 John Banks 60 Edw Harrell 62 Bessie Shitless 63 Cosie Cosby 709 Simon Hicks 809 Wm Hand 1060 Oscar King DEBORDE (S M) -- From Broadway east 1515 John Howard 1517 Langford Mosley 223 Henry Reid 229 Laura Smith 231 Wm Byrom 233 Annie Searcy 235 Edmond Morrell 237 Sandy Sales 240 John Healey 243 Richd Floyd 244 Adolphus Colbert 245 Jayde Wilson to 2d, 2 s of Giles 144 Mrs Sarah Shef- field 146 S Leon Harper 148 J A Curl 154 A M Cranford DESSAU PLACE -- From 243 Hardeman av to First 3 W E Pendleton 5 C M Brown W K Kinman Geo Holmes 311 Chas Mathis bdg 314 Floyd Dixon gro 316 Floyd Dixon 608 Preston Rogers 609 Harry Williams 610 Standard Handle DELAWARE AV (V)-- 9 Mrs Mary Brown Co From Oak Haven av 11 Sigmond Gillespie 614 E S Carr west, 1 s of Vineville av DEWITT (E M)--From 98 V S Thorpe 104 Vacant 27 Hydrola west 104 (107) Jennie 615 Napoleon Bailey 619 Julius Grant 620 Macon Cooperage Co 106 T H Robertson House 621 M L Grigsby 108 A H Jones 105 Trudie Estes 623 Laura Sheton gro 208 J H Myers 106 (105) Doc An- 625 Lulu Brown 210 Isaac Flatau drews 626 Alberta Allison Drink QssSXa in Bottles TELEPHONE 287 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk &Co. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 1040 Division 1 MACON Duncan av (H H) 627 Jas Walker DIXIE ROW -- From 475 David Jones gro 635 Daisy Thompkins Ocmuigee west bet 481 Alex Thweatt Edgewood av begins 1st and new 668 Rev Wm Richard 750 Vacant 29 John Daniel 674 (507) B E Shorter Buckeye Cotton 30 Lena Threets 868 Zack Williams Oil Co 770 The Texas Co Massee Felton Lmbr Co ft Fowler Lumber & Plywood Co E B Smith Lumber Co Arnett Mfg Co 33 Edgar Simpson 37 Fredk James 39 Davis Knight 41 Vacant 43 Vacant 76 Wm Copeland DOUGHERTY (E M)-- From 315 Church w to Center DOVER--From Ayers rd south to Villa av DUFFY'S AL -- From Elm to Edgewood av, bet Telfair and Jackson DUNCAN AV (H H)~ From C of Ga Ry s DIVISION Changed (S M) -- to Alabama DOUGLAS AV (V) From Junction -- of Division ST EAnE-- From Division bet Moughon and 4th av west Bay and Tnrpin 103 Preston McCloud 101 Daisy Brown 107 Mary Gorley 1 w of Edgewood av 7 R Comer 8 Geo Davis 108 Dollie Ellis 110 John Smith 112 Melissa Riley 114 Mrs Willie Taylor 102 Thos Johnson 110 Wm Bullock 195 Eug Goolsby 197 John Harvey 115 A S Williams 117 David Swain gro 166 David Swain clo clnr Dannenberg av 201 Vacant 202 J W Willis 203 A R Cain 222 Walter Tinsley 204 Annie Bailey 206 Vacant 242 Della May 244 Amy Pitts 248 Emma Risby 260 Martha Williams 262 Willie Tucker 264 Silas Bryan 268 Ella McCrary DIXIE AV (S M) -- 208 Garrett Holmes 259 Eliza Maddox gro 306 Luther Plummer 309 W H White bakery 321 Miriam McGruder 339 Richd Foster gro 342 Milas Jones 343 Martha Farley 351 Pearl Holmes 210 J H Folks 217 O F Jackson 219 C M Greene 221 T T McCallister 224 R L Maddox 226 C L Adams 230 Mrs Sarah Davis 233 G C Ginn 240 Lafayette Green 243 Herman Huhn From 2719 Houston 405 Sidney Dennis Lawton av av west to city limits 411 Lizzie Howard 302 Vacant 103 J 0 Etheredge 105 J L Hancock 419 Oscar Howard 421 Peyton Reynolds 429 Marcus Sharpe 303 Vacant 307 Julian Ward 308 Vacant 110 J F Atkinson 435 Wm Randall 310 J B Thurmond 111 W T Parnell 441 David Holston 311 Vacant 112 J E West 113 Jos Mannheim 115 John Barton 444 Vacant 445 Sami Johnson 448 John Smith 450 Alma Shorter 312 L A Fetner 317 M J Sires 319 Mrs A L Watson 325 E J Rau 116 H A Beall 453 Ophelia Collins 340 P C Gallianos 117 Wm M Knowles 125 W H Hysler 135 W S McDonell 150 W H Spillars 447 Wm Edwards 461 Chas Mounts 465 Sidney Mounts 469 Wm Johnson 473 David Jones 342 G L Souther Napier av begins 401 Mrs Ella Churchill 403 Mrs M M Elliott 405 J R Freeman Automobile owners are select prospects for many kinds of merchandise. Send to Headquar* ters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET Duncan av (H H) STREET GUIDE Edgewood av 1041 407 Mrs Ella Hart 409 W H Middle- brooks 411 H D Cotton 413 Mrs S 0 Adams 414 C W O'Daniell 418 Mrs Cora Adams 419 J T Herrington 420 G H Parrish 421 L 0 Pfeiffer 422 W A Wright 429 Vacant 435 C A Bryan 439 A T Copeland 440 T G Wright 442 A E Maury 445 J H Parham 451 T C Robertson 456 E H Harrell 457 H L Young Mrs Bessie Royal 460 T V Argo 465 W R Kent 466 W B Abbott 467 E D Ponder 468 W M Wiggins 469 H E Donnan 473 D P Rogers DUNLAP AL -- From Cotton av west to Or- Elbert 301 Greely Harris ange 301% Mack Taylor gro 452 Moses Lucas 303 Ocean Taylor 553 Rena Powers 305 New Zion Baptist 561 Geo Holmes 562 Arth Williams 564 Walter Anderson 565 Henry Williams Church 307 Lena Lofton 308 Thos Jordan 309 Essie Colbert 616 Albert Curry 311 Lizzie Mohorne 653 Jas Stokes 314 Emma Dean 673 Mary Wilburn 316 Thos Willis 675 Annie Murphy 318 Claude Porter DUVAL (E M) -- Bet Broad and Washington, 1 n of Green 122 Peter Reese 152 Henry Napier 214 Hattie Evans Broadway 417 Mrs E L Grant 419 Leon Wood 421 T J Bright 423 (453) O R Stokes 425 (457) H W Morgan 440 W T McDonald 215 G W Benford 448 G E Sherwood 217 Mamie Hendricks 218 Anna Thompson EAST BOUNDARY (V) --From Yineville br north at city limits 452 Mrs Ellen Richardson 454 H G Hollings- worth 456 W C Smith 458 S T Groce 475 J M Cox 477 Mrs M T Holloway W M Durden Montpelier av 501 P G Ken 502 J R Cheeves 503 J R Bragg 504 J F Laney 505 Mrs Lizzie Under- wood 507 H W Battle 592 W W Howard 594 Mrs M M Tittle 602 G T Rodgers 610 G R Horton 611 W H Shadburn 613 Mrs Effie Carey 615 Mrs M J Abel 618 Mrs M L Wein- brenner 620 H W Kinman 621 A H Broach 623 Vacant DUNLAP -- From Milledgeville rd to limits on C of Ga Ry EDGEWOOD AV-- (Formerly Boundary) --From Division west to limits, 1 s of Elm 105 Otis Pryor 109 Wm Goolsby 111 Rev W G Gibson 112 Lucile Williams 113 Leonard Sales 119 Geo Brooks 120 Pies Jones restr 121 Edgar Clark 123 Elijah Dudley 124 Ida Williams gro 126 Sami Williams se cor J S Schofield's Sons Co gratings 201 JoChnoaWl CHRo aammmseoynd 202 Leola Morgan 203 Lizzie Brown 210 Gulf Refining Co 225 Stokes Oil Co 263 Ga-Car Oil Co 500 D M Munn Third 506 W I Spikes W F Spikes 509 J J Rhodes 513 (553) K P Dorman 515 (557) Mrs M L Kellebrew 520 Mrs R D Beall 525 S E Hatfield 526 Mrs Julia Brown 556 Lee Kitchens 558 Mrs N M Johnston 560 A P Booker 562 J A Young 601 (667) Roy JaScekcsoonnd 722 Vacant First 724 Nancy Tolliver 730 Mollie Miles 701 (731) Luke Myers 703 (741) Dennis Mabry 705 (749) Roy Mabry 738 Walter Stephens 740 Isaac Reddy FOR LISTS OF NAMES AKY TRADE^-- ANY BUSINESS^ -- ANY PROFESSION Detroit R.L.PQLK&CO. Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 wm PLACE THE DIRECTORY IS THE GREATEST MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year PTJBLKHEftS 1042 Edgewood av 1 MACON Elbert (S M) 742 Annie Reddy 748 Daisy Momand 750 Vacant Ross av EDNA PL--From Log 1154 Carlos Allen Cabin blvd south % 1155 Fannie Street mi w Lamont av 752 Mrs Annie Allen 1156 Durden & Abbott 101 J A Odom 753 Vacant gro 103 Vacant 754 Mrs A Smithey 1158 Benj Bussell 105 A J Chambers 755 Jos Thomas 1162 S D Sturkie 117 L W Carter 756 R A Grant Tindall av 136 R L Lester 757 Wm Morrison 1200 (1136) J D 196 E A Kent 758 Vacant Hughes 197 W F Lewis 767 Vacant 1202 (1240) W H Davis 203 T H Bradley 769 Vacant 1204 (1242) J ,S Smith 215 J F Coppock 771 Vacant contr 226 Mrs Willie Love- 773 Abner Jackson 777 Mattie Spain 1211 (237) Seals Cottage 780 J B Barnes gro Telfair Andrew Cottage University pi 802 Mrs Mary Gunnels College lace 239 J H Berkner 244 B C Thorpe jr 251 A C Allman gro 1307 (307) McGinty EIGHTH -- From Cen- 804 Oliver Milner Cottage tral City Park west 2 805 Danl Shanks rear Ryals Cottage blocks 806 Chas Potter 807 Matt Hill 808 Amos Alexander 809 L A Brown 810 Clinton Walker 1311 (311) Morgan Cot- tag EIGHTH AV -- From rear Duggan Cottage Napier av east to 1317 (317) Manley Cherry 3 n Pio Nono Cottage av 812 Odessa Thomas 814 Vacant 815 Sallie Tyler 816 Mary Cummings 818 Prank Tompkins 1321 (321) Ga Cottage 1353 (353) McCall EIGHTH AV (Belle- Cottage vue)--From Indus- 1354 (354) Tyrone Hall trial Home rd north 1355 (355) Mosley to Atlantic av 820 David Thomas 822 Alberta Thurmand 824 Eug Cain 826 Vacant 828 Henrietta Holmes 830 Georgia Raiford House 1356 Gambrell Hall Adams ends 1406 B F Sutton 1408 Mrs Courtney Richardson ELBERT (S M)--From Hawthorne south beyond limits, continuation of 5th Hazel Nussbaum begins 1411 J O Milligan 211 Claude Jones Telfair 853 Eug Franklin 855 Kerry Cooper 857 Jack Ross 859 A J Hart C D Rogers 1412 J O Robertson 1413 B H Epp 1414 Mrs Mattie Wyche 1415 J L Moore 861 Wm Curry EDISON (E M)--From 865 Lula Wallace the river east 867 Adam Howell 105 Vacant Jackson 122 Essie Hurndon Calhoun 124 Chas McCreary 1015 E W Davis 126 Mary Gray 1017 Miley McElroy 215 Vacant 1019 John Moore 352 Vacant 212 Henry Jackson 214 Frank Bell 301 Wm Ford 303 Daniel Webster 305 Allen Elzie 307 Geo Winkfield 309 Robt Stubbs 311 Emma Thomas 313 Wm Harris 315 Vacant 317 Wm Tolbert Ash 419 Dora Nash 1021 Chas Gardner 1023 Willis Jackson 1025 Lottie Stephens 353 Jackson Searcy 363 Henry Reed 366 Vacant 423 Mattie Turner 431 Boise Balkcom 435 Tobias Grier PoIkDirecbniB DETROIT MICH' A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 y2 CHERRY ST. TELEPHONE 2391 Elbert (S M) STREET GUIDE .Ell (S M) 1043 437 (441) Mattie 1104 (2) Stokes Pier- ELIZABETH PL (V) -- Shoates son From Hines Terrace Elm 1106 (3) Robt Sol- w, 1 n of Vineville av Edgewood av omon 107 J M McFerrin 502 Mamie Price 504 Willie Ingram 506 Augustus Roberts 508 Jas Davis 510 Vacant Waterville rd begins Church begins 600 (1270) Eug Spry 602 (1280) Wm Lin- wood 604 Frank Cook 648 (1270) Hilda Vai- son 650 (1280) Ola Brown 701 Sami Hall gro 703 Joshua Anderson 704 Robt Collier 705 Ellis Sanders 706 Livey Clay 708 (713) Love Tory 712 Sami Jordan 714 (701) John Taylor 720 (705%) Chas'Fen- ney l Steele 803 Alonzo McBride 805 McKinley Coffee 807 Wess Hughes 809 Anderson Brown 811 Cleveland Brown 813 Jennie Jackson 1108 (4) Robt Trawick ELBERT LANE (S M) --From Hall w to Chappell, 1 s of Reid 13 Lee Boyd 15 Elbert Byas 17 Vacant 18 Marion Larry 19 Jas Ross ELIZABETH (S M) -- From Telfair s to Division, e of Plant 22 Riley Woods 131 Mrs Mary Gary 144 Harrison Mathews 146 Arth Glowers 148 Jas Clark 150 Pomie Simmons 157 Thos Durham 159 Edw Howard 167 Wm Harris 169 Lizzie Love 213 Jos Turner 218 Rev J J Williams 220 Geo Hill 300 Sylvia Virgle 304 Vacant 320 John Smith 324 Wm Hunter 326 Lillie Reddick 328 Benj Davis 108 Vacant 109 T J Crowley 193 J M McMillen 195 R L Higgs 197 L J Bernd 202 Dr C L Toole ELL (S M) --- From Broadway w 106 W F Horne 114 C H Horne 117 T B Mann B F Teele 119 Wm Bargeron 121 Mrs Codona Bateman 128 J W Davis ' 130 Vacant 132 Mrs Ruth Allen 135 S J Dennard 136 W H Lavender 138 S Jack Yarborough 140 J V Russell 142 I L Davidson 144 L W Snyder 146 M F Waldron 147 J W Brown 151 F Sellers 165 R L Gholson 167 E O Hooker 171 J C Moore 172 G T Jordon 815 General Cain 330 Edw Jackson Second Stratton 902 Kate Washington 904 Walter George 905 W T Rabun 907 J B Griffin 909 G W Gibson 910 Marvin Stanley 936 Major Sanford 940 Wm Fitzgibbons gro 1011 N A Weathers gro 1014 Roxie Williams 331 John Grant 332 Jas Goolsby 417 Frank Carter 418 Mary Gantt 419 Wm Irvin 421 Geo Gartrell 422 Susie Irvin 450 Cleveland Murray 521 Vacant 541 Andrew Larry 543 Chas Maxwell 565 Danl Ellis 219'J E Waits 221 H N Moulton 229 W A Smith 231 G W Burgess 237 F D Mitchell 240 L J Jones 246 W O Hunnicutt 250 J N Gilleland 253 C R Holloway 260 J c Holloway 262 L D Selman 269 F E Irby 273 P L Jenkins 1015 Ellen Butler ELIZABETH (W H) -- 274 C D Cook 1100 (1008) Claude Hill Changed to Oakland 275 J N Herndon 1102 (1009) Vacant av 276 J C Hicks DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 1044 Ell (S M) MACON Elm 277 J N Tamplin 235 Sallie Carswell 232 Vacant 278 J W Nixon 236 Hattie Driskell 235 London Pollock 279 E E Horne 255 Geo Whitaker 236 Vacant White 256 John Mitchell 240 Jerry Davis 301 S E Hughes 418 Jasper Boswell 244 Jos Lavender 302 Mrs Electra Watts 420 P J Wynn 245 Robt Burke ELLIOTT (E M)--From 422 Mary Banks 423 Geo Wornum 247 Lizzie Peters 250 Sanders Carswell 428 Main n to First 102 Sol Walker 425 Morris Wallace 427 Moses Roberts 251 (257) Keziah Killins 103 Jos Culp 104 Millie Johnson 451 Charlotte Baugh- 254 L W Taylor cum 257 (251) Allen Coley 106 Vacant 258 Mack Gostin 108 Wm Patterson 109 Cornelius Dunn ELLIS (S M)--Changed to Violet av 263 Paul Singleton 264 L A Jones 114 Fannie Bonner 115 Anna Little 117 Carrie Davis 119 Emma Dunn Cornelius Dunn gro 120 Peter Jackson 122 Irving Appling gro Jackson Searcy ELLIS AV (V)--From Monroe to Lynwood I e of Fourth av 1 Carrie Lewis 3 A L Maddox 5 Ella West 7 Wm Stubbs 9 L H Gibson II Monroe Etheridge 124 Georgia Kinsley 18 Vacant 303 John Bentley 304 H T Jolly 313 Scott Fletcher 320 Anna James 321 Wm Wright 324 Vacant 325 Anthony Ken- drick 350 Vacant 354 H M Redding 196 Vacant 83 David Mangham ELM--From Harris to 197 T E Bankston 112 E B Coleman limits, IF s of river 200 Mary Jackson 114 Horace Williams Va-Car Chem Co 201 Nathan Howser 116 Carrie White 6 Edw Jordan 202 Norman Harris 130 (18) Bessie Ap- 8 Ella Jordan gro 203 Cora L Washing- pling 10 W L Edwards gro ton 133 Calvin Tremble 14 W L Edwards 204 Laura Robertson 134 Emma Rhine 100 Emma Johnson 205 Quintus Newman 139 Beulah Davis 102 Mattie Rudolph 206 Ladie Holmes 142 Dr W A Davis gro 207 Gertrude Andrews 164 J S Hall 104 Mattie Johnson 208 Wm Clowers 170 John Coker 105 Durham Callahan 209 Floyd Brooks 172 Walter Williams 106 Wm Barr 211 Mary Barnes 178 Minnie Smith 107 Mary McGee 212 Nathan Ellis 209 Clarence Early 108 Wm Tarver 213 Aaron Warren 211 Howard James 109 Alex Mathis 213% Jesse Davis 213 Zeater Carter 111 Henry Elzie 214 Wm Nash 215 Chas Wilson 112 Wm Rudolph 215 Veney Jones 218 Henry Jordon 115 Edgar Roberson 216 Sallie Harris 219 Sallie Berry 119 Harrison Ross 217 Claude Chambliss 220 Sarah Brunson 120 Mary Reed 218 Wm Smalley gro 221 Foster Alfriend 124 Geo Day 219 J H N Turner 223 E M Maddox 152 Nathan Butts 221 John Dukes 225 Chas Johnson 153 Fletcher Talbert 222 Nonar Roberson 227 Isaac Cooper 157 Sarah Malone 223 Jas Davis 228 Nettie Willis 160 Julia Marshall 224 Simon White 229 Robt Gray 162 Rosalie Morris 226 W M Hall 230 Ida Carson 227 Tullie Cornelius 231 Fannie Gardner 163 Wm Hargrove Hammond Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET Elm STREET GUIDE Elm al 1045 201 Wm Wright gro 203 Carrie Hudson 205 Liza Smith 655 Bert Simmons 657 J T White 659 G W Bailey 955 R A Scott 956 L H Shipman 957 W M Ray 207 Allen Burke 660 T Simmons 964 Vacant 209 Sami Mullin 661 W J Cooper 966 Ruby Presley 211 Herbert Stough 664 W A Hardeman 968 J J Bullington 213 Rena Hillman 216 Jos Hill 217 Ada Lowe Elbert C of Ga Ry G S & F Ry 314 J A Anthony 320 Sarah Sanders 353 Rainbow Coal Co 355 Ruby Powell 357 Edw Byron 359 Kate Sanford 665 E E Jones 667 Mrs Laura Posey First 700 Vacant 702 Minnie Heysen 708 D D Anderson 710 Margt Bell 712 E G Phillips 718 Henry Collier 753 Arth Dean 755 Nannie James 757 Ebenezer Baptist Calhoun 1017 D H Bush 1018 Mrs Sula Jones 1020 Mrs Eliz Behr 1021 Vacant 1057 J H Fretwell 1059 V M Marlow 1063 E S Shouse 1064 J P Henderson Grocery Co W M Craps 360 Thos Veal Church Boss 361 Emma Johnson Telfair 1103 E B Doolittle 364 Columbus Johnson 802 R P Sessions gro 804 Beatrice McKen- 1112 E H Chancelor 1116 Walter Raleigh Broadway 409 J A Jones 411 R N Etheridge 415 R W Campbell 416 H C McWilliams 417 Vacant 452 P M Jenkins 454 J T Sessions ney 809 David Mitchell 810 L R Spinks 1120 Eug Defore 1157 J L Smarr 1158 C W Cobb 811 John Hambrick 814 Mrs Hattie Heard 1159 Mrs H V Godfrey 1160 J H Belote 816 Frank Floyd 818 Mrs Dora Doke 851 J J Bivins 1161 W C Byrd 1164 E A Thornton 1178 Mrs Louise Bright 457 Vacant 852 E E McDonald College 459 J T Ryles 853 Johnson Carpet & 1200 Penfield Hall 467 Mrs Florence Pace 469 H M Kitchens Rug Clng Wks 854 Marjorie Hender- Mercer Infirmary 1420 Mrs E J Sutton Third son 516 G B Lumpkin 858 H L Slocumb ELM (E M)--Changed 520 G S Bolton 521 W E Boland 859 G H Lankford 863 W C Huff to Flanders 523 Chas Pentacost 553 J D Skinner 554 Mrs Claudia Dodd 555 D G Pritchard 864 Alphonso Ussery ELM AL--From Ash to 865 C H Ring 866 W E Threlkeld 868 W V White Elm bet First and Second 558 W L Barrineau 869 Mrs Ola Hawkins 635 Oscar Carter 560 Calvin Goodson gro 637 Vacant Second 610 J A Stallings Jackson 908 H P Stallings 639 Vacant 641 Minnie Robinson 612 Carl Jones 911 E C Brown 643 Wm Middlebrooks 615 J D Sanders 914 Laura Lewis 647 Julia Baldwin 618 J L Brundage 619 Vacant 620 Vacant 621 A P Simmons 915 E B Mason 917 W E Bartlett 920 W C Schermer- horn 649 Matilda Latimore 651 Robt Stubbs 653 Vacant 653 S S Nipper jr gro 952 W S Herin 655 Vacant 654 Vacant 953 R L Ramey 657 Geo Morris 317-319 Third St. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1046 Emerald (E M) MACON Fargason (V) EMERALD (E M) -- 180 W M Hargrove EUCLID AY--Bellevue From 306 Flanders to Arlington 104 Jesse Brown 106 J I Lawless 108 Vacant 110 Artli Thomas EMORY -- From Jeff Davis west, 1 s of Plant 182 Wm Branan 184 Herman Roberts 185 F S Hull 186 Mrs E H Smith 188 E W Smith 190 E W Butler 192 L D Moore 194 Mrs Etta Allen 195 T E Craig EVERGREEN LANE-- From 2900i Houston av south 141 Adolphus Smith 142 Sami Jackson 143 J W Frazier EXPRESS AL--From Fourth to Fifth n of 101 B G Pope 103 H C Mullins 104 J W Meaders 105 Mrs Eliz Bryant 108 J O Meaders 109 T B Paul 110 J W Sumner 112 J A Culpepper 118 R G Kent 119 G M Martin 120 Mrs Ellen Kent 121 Vacant 122 O R Batchelor 125 F M Rivers 160 Mrs Carrie Rob- erts 162 Mrs Loretta Ar- thur ENTERPRISE (S M) -- Old Union Depot From 2554 Broadway FAIRMONT AY (Belle- e to Walterville rd vue) -- From Lake 100 R E Boutwell 102 C T Adams west to Grand av 1 s C of Ga tracks 104 T C Turner 105 H M Ellis 300 F W Ward 302 T W Johnson 106 T A Land 304 P S Pannelle 107 B L Robinson 108 J W Carter 305 W E Bartlett 307 J L Biddy 109 W E Heath 311 Mrs Lee Young 110 Olene Dixon 111 R J Molton FAIRVIEW AY (E M) 112 J S Swaine --From Fletcher to 113 Vacant Main 1 e of Balcom 115 Alex Brown es Cherokee Fertil- 116 E L Dyer izer Co plant 115 Jack Hurlbert EMPIRE AY (V)--Fr 320 Third av south 101 Jas Simmons 102 Hardeman Woolfolk 103 Thos Harris 104 Tempie Lawrence 105 Aug Robinson 106 Edw Lewis 107 Rosa Cross 108 Edw Woodward ERNEST ( H)--From Montpelier av north beyond Napier av, 2 blks w of city limits 110 Robt Battle 112 Otis Hill 113 Jas Edwards 148 Austin Hogan 150 Leonard Jackson 152 Duncan Gates 153 Frank Beldy 224 Edw Flewellen 109 Dotie Turner 226 Mrs Dollie Ken- 203 Wm Brooks 207 W E Davis 351 Paul Simpson 352 Jas Collins Peachtree 353 W T Smith 354 Jas Murray 356 Mrs Ellen Wilson 357 Toonie Bush 358 W A Simpson 359 J J Connell 360 Mattie Blount 361 W H Smallwood ENGLISH AY (Y) From Oak Haven av w 1 n of Yineville av 102 S M Arrington drick 228 Richmond Kendrick 306 I W Williams FARGASON (V)--From Lamar east and west 1 n of Yineville av 204 (212) Allen Allen 104 Mrs M M Frierson 308 Ellis Davis 206 (211) Henry Har- 106 H A Key 607 Bertha Brown ris 108 J J Coke 207 (329) Jas Clowers 155 R R Dunwody ERNEST (Log Cabin 210 Ida Wilder 160 Vacant Hts)--From Log Cab- 211 (331) L Dennis 165 J T Webb jr in way east 1 n of 212 (225) Pearl Law- 175 H N Taylor jr Log Cabin blvd son More goods are bought and sold through the Classified Business Lists of the Directory thay any other medium on earth. IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. Fargason (V) 213 (235) Sami Abrams 214 (226) Alf Gouder 215 (237) Willis Pen- nington 216 (223) J L Mills 217 (243) H Pinkston 218 (212) Emma In- gram 219 (241) Elisha Pate 220 Amanda Avant 222 Adolphus Mc- Cowan Eug Bowman 224 Warren Avant 226 (219) John Mapp 228 (232) Robt Vaughn 230 (234) Miles Lundy 232 (236) Pierce La- mar 234 (238) Benj Butts 236 (244) A Pinkston 238 (240) Danl Smith FEB AV -- From 702 Holt av east % Mock 105 W H Hardin 115 R L McQueen FIFTH--From river s to Hawthorne 3 e of Second nw cor Natl Milling Co Empire Candy Co Ocmulgoe ne cor Tomlinson Paper Box Co 114 Andrew Patterson 116 Sylvester Brown 149 H A Gibson Vine- gar Wks Paradise al begins 151 C S Butler soft drinks 152 Charlotte High- tower 153 Mark Kessler dry goods 155 C E Wilder J L Anderson oils 156 Finley Whitman 157 Arnold Dock meat 159 W M Hall gro 160 Irene Byars STREET GUIDE Fifth 1047 161 Connossie Howell 361 Union News Co barber Yellow Cab Co of John Jordan shoe Macon repr Cherry 163 Haywood Dixon Terminal Station soft drinks Macon Terminal 165 J L Simpson gro 167 Vacant 169 Mark Zarks gro Co W U Tel Co hr Union News Co Walnut Travelers' Aid -- Ga Grocery Co 202 Natl Biscuit Co 203 E J Birrick gro 205% W M Sawyer clo Am Ry Exp Co Terminal Trans Co Terminal Tkt Off clnr 207 R B Lester restr 209 Wm J Jones gro 211 Simon White gro 213 Geo Harris soft Terminal Info Bu Terminal Sta Barber Shop Rooms: 101- drinks 213% Foster Giles bar- 102- dept ber 215 Vacant 215% Vacant 219 Jos Brown restr 223 Viola Crumbley div supt 107-15 C of Ga frt dept 119 Am Ry Exp rt agt 125 C of Ga Ry supt 225 Vacant 245 Central City Iron & Metal Co 127-31 Sou Ry System pass dept G S & F Ry 247 Lillie Goosby 202-6 C of Ga (Macon 248 Margie Blount Div) Alley 251 Jos Brown 253-55 Frank E Block Co whol confrs 257 Hampton Garage 259 Gulf Refining Co 264 Modern Grocery Co whol gros 265 Macon Water- works Shop 268 Wilson & Co whol meats 270 Macon Flour & Feed Co 274 Yates & Tabor Co whol gros Mulberry 205 C of Ga div supt 209 C of Ga spl agt 211-12 C of Ga train mstr 213 Macon Terminal Co tkt acct 214 C of Ga dispr 215 iC of Ga div rd mstr 216 C of Ga rd mstr 217 C of Ga div supvr bldgs etc 218 C of Ga supvr bldgs etc 223 C of Ga div acct 224 C of Ga claim dept 314 Am Ry Exp gar- Street continued age 451 Bateman-Freeman Wall Co 355 Bib News Co Macon Orange & 359 Southeastern Exp Banana Co Co whol gros Automobile owners are select prospects for many kinds of merchandise. Send to HeadquartCearstalfoogr aclolnktianindss omfuAchutovmaloubaibleleLdisattsa.. OAusrknfeowr copy. R. L. POLK & CO., DETROIT, MICH. W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 1048 Fifth MACON First 453-55 Morris & Co 151 E L Harrell 472 Volunteer Phar- whol meats 155 Mrs N Sloan 461 P B Yates Mach 157 M D Wilson macy Fire Dept hdqtrs Co rear Florence Grace Poplar Poplar 164 F F Holmes 503 J H Bailey Coffee Mrs Addie Hilley 506 Al Sihah Temple 508 Vacant Co 509 Weevilnip Co 511 Vacant Express al ends Plum Pine C of Ga Frt Dept Macon Milling Co Oak and Oglethorpe sw cor Hammond Oil Co 1015 E H France cut stone Hawthorne Central Georgia 168 Shepherd Belcoun Walnut 202 Mrs L F McBride A G Martin 203 Vacant 206 R C Goepp 209 Leonard McManus 210 Rosalie McCranie 215 J E Pair J D Clark 216 Mrs Nora Meath 217 Mrs A E Hamilton 220 Mrs L Burkett rms 510% Am Investment Co 512 Vacant 514 H R Stearns auto repr 516 Willingham Bat- tery Co B B Willingham ins 518 Vacant 552 W F Peacock 554 F C Wilson 555 J B Kitchens 557 C E Williams 567 A E Kelly Oil Co 252 Mrs Irene Bass 568 J H Arnold FIFTH AV (Bellevue) -- From Industrial Home rd north to Atlantic 1 w 4th av E A Sconyers G F Parker 258 Mrs E J Whitehurst Mulberry J M Culver 569 J A Jones 570 R P Moore Plum 601 Cong Sherah Is- FIFTH AV (S H) -- 320 Vacant rael From Enterprise to 321 J H Wagner 604 Wm G Lancaster Ifelson 5 w of Water- 352 Vacant 605 Elmore Brown ville rd 353 Vacant 605% W K Horton FIFTH AV (S M) -- From Plant south to 1st 1 w of 6th av 116 N B Meadows 354 Jordan Realty Co Jordan Ins Agency 357 Mrs T V Beall 361 Mrs L C Riley 117 W E Ridley 362-78 Ellis Motor Co 119 Mrs Lula McCook 369 J S Adams W M Mott FIFTH AV (V)--Chang, J W Stargle ed to Ellis av nw cor Y M C A FIRST--From river g Cherry 608 Beverly Martin B H Bowers 613 J C Patterson 616 Mrs Lulu Schell 619 Kelly Hardwick 620 T J Johnson 622 Vacant 624 A C Durden 626 C H Bridgers 654 P G McNelis 655 A E Jones to limits 1 w of 2d 451-53 C W Stroberg 658 Denis Cassidy Ocmulgee auto pntr 659 LeRoy Culpepper 101 T E Loyd 452 Melts' Sanitary 668 Jas Cassidy 103 A S Jones Baking Co Inc 669 W T Morgan 105 E L Mallard 454 J W Collins gro Pine 106 Isadore Segal 456 J G George fish 702 Mrs H A Branan 107 H J Tague 458 Vacant 706 C T Cummings 119 Sami Barnett 464 Georgia Grocery 712 P J Cassidy 121 P L Self 466 Oscar Bradley gro 717 Geo Beddingfield E W Freeney 122 M C Sheffield 468 Macon Volunteers 720 W P Warlick Armory 722 Mrs Beulah Mull- 124 F W Veal 470 Vacant enix Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 First STREET GUIDE 723 Minnie Rice 1326 Geo Bailey 753 Mrs Anna Evans 1327 Levi Lewis 754 A F Newton 1329 Nona Bell 759 Mrs Susie Stevens 1330 Leslie Payne 760 Mrs Bell Johnson 1331 Hanson Sams 771 G B Jewett Oak 820 W C Burns 822 0 L Brooks Jos Stiles 852 W E Shelverton 859 First St M E Ch 861 Rev J R Webb 865 M F Arnold 866 Vacant 867 J J Kimball 868 Mrs Alice Bowman 870 G W Kelley 874 E R Layfield Arch 1333 Edw Bell Ash 1413 Lillie Weathers 1414 B F Merritt coal Elm 1524 Calvin Cobb 1526 Vacant 1528 Obie Hill rear Raymond Jones 1531 Barney Horton 1535 G N Snow 1537 J T Harper 1539 Chas Cherry 1541 Vacant 1543 Ellen Johnson Edgewood av 920 Vacant 1600 Frank Barge rear T J Fowler 1604 Frank Newton 960 W D Irby 1606 Annie Howard Oglethorpe 1630 Henry Woodward 1011 Arth Fincher 1013 J T Reeves 1015 T E Gregg 1017 Georgia Barrs 1029 J H Sanders 1031 O O Arnold 1632 Vacant 1633 Vacant 1634 Thos Harper 1638 Henry Lane 1640 Vacant 1642 Arth Gasaway 1037 Geo Harris FIRST AV (C P) -- 1039 Mrs E L Welch From Forsyth rd n to 1045 Rufus Wright Ridge av 1047 Vacant 100 C N Callaway 1203 Wm Storey 107 W R Flanders 1205 Sirena Newsome 109 M L Lifsey 1207 Idus Chester 1209 Robt Williams 1211 Tobie Fann 1226 Walter Jenkins FIRST AV (N H) -- Changed to Blackburn 1230 Miller Gordon 1234 Richd Williams 1238 Janie Jinks Hazel 1303 Andrew Barrow FIRST AV (S H)-- From Enterprise to Nelson 1 n of Waterville rd 1304 Friendship Bapt Church 1307 Danl Sherman 1311 Jas Thomas FIRST AV (Tybee) -- From Massee la east 1 s of Turpin 1313 Mamie Smith FIRST AV (V)--Con- 1314 Benj Russell tinuation of Jefferson 1315 Lucius Davis 1 n of Hardeman av 1316 Thos Ingram 101 Susie Sanford 1322 Chas Jordan 114 (139) Louis Hern- 1324 Jas Adams don First av (V) 1049 131 (134) Benj Philipps 134 (14) Albert Reves 139 Mattie Sanford 140 (143) Arth Hicks 141 (140) Alex Percy 142 (112) Terry Brookins 143 (142) Fannie Goodwyn 147 (150) Anna Ray- ford 150 (171) Warren's Meth Chapel 152 (173) Howard Coates 173 (152) Hattie Brown 213 Arth Hicks clo clnr 215 Henry Wynn 217 Victoria Hayes 219 Nancy Banks 224 T J Slayton 226 A L Glascoe 227 Geo Gary 239 (230) Walter Capel 236 T E White 238 Vacant 241 (239) Julian Wil- liams 244 Wm Brown 247 Kate Ross 250 R C Atkinson music tchr 252 Vacant 255 G W Banks 260 Wm Spivey 264 Adam Mann 268 Peter Dunham 273 C J Jones 280 Josephine Davis 281 Louise Smith 284 Z C Clay 289 Jos Smith 290 Wm Jones 296 Lula McGregor 297 Bost Holloway 299 J T Gray gro 307 L B Green 309 (317) Geo Sutton 311 (321) Geo Sutton gro A natural by-product of the Directory) Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit We Do It Right BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 R 0 L L E R & M 1 L L I R 0 N S P L U M B I N G H E A T I N G 1050 First av (V) MACON Ford al 312 (306) Maggie 109 W T Lowe 514 Mattie Stubbs Roberson Lake City begins 515 Turner Williams 313 (327) Sarah Wal- 213 Mrs Lizzie Brown 519 Eug Parker ler 216 Henry Smith 520 Lucy Mims 314 (310) Bishop Tay- 231 R H Weaver Ash lor 233 J O Mathews 529 Ulysses Harris 315 (333) Edw Fields 235 Cora Liles 530 Angeline Soloman 317 (335) Mary Hum- 225 (241) Homer Shel- 531 Horace Stephens phrey ton 532 Jas Hudson 318 Bessie Curtis Main 533 Seaborn Green 324 Arth Shatteen 300 M T Barlow 534 Walter Thompson FIRST AV (W H) -- From Dempsey av south to Anthony rd 124 Lila Haygood 126 Robt Cornelius 128 R Scarborough 303 Mrs P B Blanchett 304 Annie Osborne 306 Geo Brown Emerald begins 314 M A Dawson 343 J E Barlow 345 Vacant 535 Mary Batton 536 Arrie Powell 537 Chas Barron 540 Henry Dean Second 607 Alice Stallworth 608 Nettie Wright FIRST EAST (E M)-- From river north to Broad 1 w of Clinton 101 Ella McGarr 301 Fannie Huff 308 Preston Appling 404 Arthur White 405 Wm Woodford 406 General Chapman 407 Mary Hardwick 409 Eliza Hendricks 409% Wm Turner 410 E K Threat 411 C S Gilyart 413 Robt Jackson 414 J P Solomon 415 Jas Cook 416 Chas Gordon 417 Minerva Vann 501 Edw Morris 503 Alice Allen 509 Corinne Sparks 511 Sol Dunn 517 Rebecca Harden 523 Henry Foster 525 Anderson Miller 526 Ira Gross 531 Frank Harris 346 F F Barlow 347 Emma Mitchell 348 Eli Dowdell 350 R M Smith 351 W M Barlow 353 John Evans 355 R B Shurling 357 Augustus Couch 359 Vacant 359% Mrs Minnie Newsom 364 Jennie Harris 366 Ross Pitts 368 Enoch Smith rear Green Wornum 368% Bernie Gray 370 Lee Walters Violet 422 Amos Williams 424 Anderson Cars- well 426 Richd Hughes 428 Isaac Bijo 432 Bijo Bros gro 436 Ellidia Gallamore 437 Berry Morgan Powell 440 Wm Stevans 442 Wesley Burden 609 Wm McCullough 609% Vacant 616 Cornelia Baldwin 624 Susie Campbell FLETCHER (E M) -- From Dunlap t o Jones av 1 s of Pluintree FLORENCE (S M) -- From Piedmont av n to Boulevard 110 G T Barker 114 J E Palmer 115 Mrs Julia Wal- dron 116 I, N McLendon 120 P A Freeney FLORENCE AV -- From Piedmont av s I w of 2d FLORIDA AV--From 1306 Vineville av s to C of Ga R R tracks 105 H D Marshall FORD AL--From Massee la e to limits 1 s FITZGERALD AL -- From C of Ga Ry w bet Oak and Pine 443 Robt Littman 446 Lethia Lewis 503 Dempsey Purnell of Turpin 5 Vacant 6 Sally Turner 506 Julius . Frazier 7 Logan Finney FLANDERS (E M) -- 507 Wm Owens 8 Mamie Randolph From C of Ga Ry w 508 Thos Merriwether 9 Lizzie Roberts to limits 509 Wm Daniels 10 Vacant 105 Wm Tinsley 510 Mattie Stubbs II Lula Bell 107 B A Adams 511 Paul Thomas 12 Vacant 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO a ENGLAND Tj THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 Ford al 13 Jos Streeter 14 Richd Collins 15 Douglas Nelson 16 Geo Minian 18 Edgar Wright 51 Henry Martin FORD LAIfE -- From C of fia By s 1 e of Pio Nono av 1 Gordon Wingate 2 John Campbell 3 Georgia Barrs 4 J C Kendrick 5 A B Cooper 6 Sylvester Watts FOREST AV (Bellevue) --From Grand av w 1 s Brooskdale av 175 Vacant FOREST AV (V) -- From 247 VlneviUe av north 50 Ballard Normal Sch R G VonTobel 66 L H Mounts 68 (102) Edw Campbell 70 (305) Vacant 72 (140) Annie Smith 74 (138) Vacant 76 136) Jas White 78 (134) Emory Mims 80 Vacant 82 E G Smith 84 (130) Willie Turman 86 (128) John Ellis 88 (126) Carrie Lewis 90 (124) Price Culver 92 (122) E W Felton 94 (120) Vacant 96 (118) Mary Rishy 98 1161 Willard Boynton 100 T A Bennett 101 Anna Goodman 104 Richd Finney 105 Thos Dunn L H Little STREET GUIDE Forsyth 1051 106 A R Dickerson 417 C E Durell 108 Emma Powers 418 R V Elledge 109 Chas Smith 419 J W DeFore 111 Matilda McKinney 420 H H Harris 113 Aug Stubbs 421 Dr N T Carswell 114 R L Thomas 423 W T Pitts 115 Mary Weather 425 J S Sikes 115% W M Zellner 431 Wm Huguley gro 433 Victoria Wright 117 Wm Felts 435 Carrie Myrick 119 Chas Culver 437 Julia Bailey 120 John Battle 121 Vacant 123 A C Ashley 127 Aaron Jones 439 John Scott 441 Julia Neal 443 Fannie Winn 445 Hettie Lester Eug Pitts 129 Mabel Carter 131 Albert Dawson 133 (138) N W Green FOREST HILL AV -- From Forsyth rd at Park northeast 135 Frank Williams FORSYTH -- From 137 Willie Pitts Spring nw to Vine- 139 Fannie Battle ville av continuation 143 Sami Clemons of Cotton av 190 M L Cooper gro Spring and Pine 203 Edw Powers 102 Gresham School 204 Simon Grimes 205 Cath Johnson 114 P K Early 118 Oscar Bradley 206 Lee Solomon 126 Lanier High Sch 207 Jos Lipsey Orange 208 Nelson Lewis 200 Vacant 210 Love Shamlin 201 C L Tinsley 222 Fannie Cook 202 A & P Tea Co 224 A G Mason 204 Ga Grocery Co 303 Wm Chaney gro 206 C W Roberts 310 R J Mayo 207 C H Swain 313 Nettie Lashea 210 C E Eubanks 314 W H Thomas 218 W G Solomon 315 H G McBride 221 S R Jaques 396 H E Warwick College 398 T J Hobbs 305 N H Clay 400 D S Condon 307 Mrs Eliz Wiliams 402 C H Carson 310 M E Mason 402i/2 E L Sandefur 311 W W Solomon 403 D O McCook 313 W C Andrew 404 Mrs H W Gibson ' 314 Mrs M F Collins 405 L H Little 317 Mrs A H Murphey 406 E H Forbes F A Sprague 407 R F Patton 318 C F Sheridan 408 W J Collins 321 Vacant 409 Kenmore Burns 322 Vacant 410 T L Funderburke 324 Virginia Wrigley 411 R B Holliman 325 S A Crump 412 W J Skinner Arlington pi ends 414 J E Wilson St Paul begins 415 J R Mattox 400 A R Newton 416 J E McCormack 404 G M Yates Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory Answers AH Questions as to ; WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet R. L POLK & Company CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1052 Forsyth. MACON Fort Hill (E M) 406 K R Sloeumb 625 Vacant FORSYTH ROAD (V)-- 407 H M Wing 626 B C Jones Continuation of Vine- 410 W L Thaggard 629 Mrs A W Jones viUe ay Progress begins 630 Carlton Robinson 1500 Jos Dannenberg 411 W D Griffith 631 Mrs R J Grace 1506 N H Greene 415 C L Willingham 632 J L Hainline 1508 Theo G Manley 416 Mrs E M Ether- 636 C N Woodruff 1512 Robt L Love idge 637 R B Hightower 1514 T W English R A Moore 639 L E Pellew 1601 H T Conner 419 R T Cline 643 Frank Roberts 1603 (1103) R D Camp- 420 David Waehtel 421 E E Hedemann 422 A S Hatcher 644 Harry Wright bell 646 Vacant 1604 Vacant 647 C B P Hutchens 1605 W A Callaway 425 J M Pugh 426 J W Hanson 648 J W Ridout 650 C N Woodruff 1607 J M Horton 1608 S B Merritt 427 Mrs M C Brooks florist 1701 E S Bayne Monroe 500 B L Haddock gro 501 A N Hummel 503 Vacant 505 Vacant 507 Mary Anderson 509 Lucy Hart 511 Jos Collins 513 Josie Humphries 515 Georgia Ross 524 Murry Hayes 525 Lillian Jackson 527 Anna Johnson 528 A L Branan 529 Lena Brown 531 Frank Wynn 532 Claude Spillers 533 Bella Rosen gro 540 Lewis Melvin 544 T J Edenfleld Linden av 603 Vacant 604 W L Sutton 605 T C Johnson 606 W O McDonald N E Southard 607 R A Williams 608 Mrs Margt Paul- lin 610 Vacant 611 E J Rainey 612 Fredk Deck 615 Lizzie Speer 616 W A Gamble 618 J E Wilson 651 Lee Irvine 653 C B Holleman 654 Mrs Matilda Elfe 655 Vacant 658 J T Riley 660 J F Mercer Virgins la 701 Mrs L A Banks 702 Mrs M S Ferrill 709 Vacant 710 J H Timberlake 711 Vacant 712 Vacant 714 C J Rolston 715 W T Green 716 A M Domingos 717 Vacant 720 Vacant 722 W C Redding 726 J W Clisby FORSYTH LANE -- From Forsyth n to Tinsleys la bet Monroe and Arlington pi 141 Hannah Henderson 142 Martha Reeves 143 Jos Williams 144 Vacant 146 Sarah Watson 148 Benj White 241 Morris Ellis 243 Vacant 1703 Vacant 1705 A C Everett 1707 W B Davis Fowler-Wainright Handle Co Case Fowler Lbr Co 1803 H W Wood FORT HILL (E M) -- From 628 Main north to Clinton 120 T H Smith 121 J H Burns 122 A C Washburn 123 J E Booth 124 J D Liles 125 E T Arnold 126 Sidney Sanders 127 B H Tyner 128 Jas Butler 130 Vacant 131 O L Lyles 133 Mrs Leila Massey 202 J M Washington 203 N I Boothe 206 W A Trawick 207 J R Roberts St Johns begins 301 W P Scarborough 302 Maurice Holloway 303 T J Goodwin 304 J C Jones 305 W S Pool 306 J F Heyser Broad 619 Mrs M A Turner 246 Rebecca Colson 401 W H Vallette 620 D M Stahle 262 Robt McCary 402 J B Roberts 622 J A Harper 264 John Dargan 404 S O Brockman 623 A K Hawkins 423 Vacant 406 Geo F Leslie J L Henry 426 Kate Cole 412 Robt T Jones LISTS OF NAMES ANY BUSINESS -- ANY PROFESSION R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR'1 Open All Day From 9 to 6--4V2% on Savings Fort Hill (E M) STREET GUIDE Fourth av (V) 1053 450 Fort Hawkins Sch 841 (812) Sami Gor- 608 Wm Young 500 Fort Hawkins don 609 Edw Rawls Cash. & Carry 843 (844) Thos Curry rear Danl Pounds Store 845 Chas Robertson 611 Bosnie Battle 501 J R Durden 502 Susie Durden 503 Mattie Wright 505 O C Wells 506 Isaac Johnson 507 T H Butts 509 Wm Warren 512 Crecy Bankston 513 John Dunn 514 Arth Sawyer 516 Arth Sawyer gro 519 Army Washington 600 Morgan Dewberry 602 Rufus Griggs 604 M G Goler 605 Robt Brown 606 David Rutledge 607 Edinburgh Hub- bard 608 David Redding 609 Edinburgh Hub- bard gro 610 Sanford Solomon 611 Wm Lowe 612 Robt Jones 614 Richd Jones 616 Geo Hines 631 Elbert Byers 633 Wm Culp 635 Allen Cornelius 637 A K Blount 639 M C Jackson 641 M C Jackson gro 717 Thos Smelter 719 N L Ratcliff 721 Wm Standifer 723 Horace Farley 724 East Macon Sch 755 J H Holton 757 Mitchell Butler . 759 Abr Billingslea 800 Ada Hill 802 Wm Cullins 804 David Pound 806 Wm Singleton 900 M M Burdell rear Lena Clark 901 Webster Debvikin 614 Chas Hughley 905 Duncan Brown 615 Steph Jordan 921 Beni Parker 616 Phillips Martin 931 M L Hightower 618 Matthew Hite 933 Frank Brown 620 Lige Jones 971 Wm Dillard 622 R C Mosley 973 Robt Langston 623 Chas Wells 981 R B Lester 625 Herbert Bentley 1020 Margt King 626 Lawrence Evans 1048 Julius Glover 627 Uriah Marshall 1050 Neal Harris 629 Fred Marshall 1052 Benj Manuel 631 W C Edwards 1056 Frank Thorpe 633 Sanford Willis 1071 Wm Connor 635 Andrew Drew 1220 Minnie Eppings 636 Lee Hays 637 Allen Jones FOSTER'S AL -- From 638 Lee Steele 822 Hazel south to 639 (221) Harry Butts Ash 641 Frank Smith FOURTH--Changed to Broadway 643 Mary Burnett 645 Jesse Shakespeare 646 Lillie Hight FOURTH AV (Belle- 652 John Humphreys vue) -- From Industrial Home rd north to Atlantic av 1 w 3d av FOURTH AV (V)-- From 363 Monroe northwest to Ward 110 Leila Grant FOURTH AV (Napier 111 Lawrence Edison Hts) -- Changed to 112 Anderson Walker Patterson 115 Thos Mitchell FOURTH AV (S HiChanged to Henderson 116 Peter Griffin 118 Quince Walker 122 Theo Mills 123 Henry Wallace FOURTH AV (S M)-- From Plant to First 2 w of 6th 126 Jack Solomon 130 Phyllis Squakes 131 C E Green 133 Eliza Lamar FOURTH AV (Unionville)--From Demp- 137 (139) Mill Griggs 139 (137) Jesse Hen- sey av north 2 e of Pio Nono av 600 Thos Tennis 602 A B Chapman derson 141 John Cummings 142 Napoleon Samp- son 807 Gertrude Wiggins 808 Eug Moss 809 Wm Bird 603 Wm Smith rear Mattie Chappell 604 Susie Sweet 145 Ephraim Lockett 155 Anna Ganaway 156 Cora Carroll 810 Sami Taylor rear Vacant 158 Geo Gilmore 836 Tempie Davis 607 Demus Harris 161 Vacant 838 Mary Cleveland rear Corene Brookin 162 E D Walker Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 1054 Fourth av (V) MACON Fulton al 164 Alex Jones 607 Wm Cobb FRANKLIN (S M) -- 167 Allen Bedding- 609 Albert Walker From 3632 Houston field 610 Chas Thomas av east 173 Frank Wright 611 Mattie Hudson 401 Mrs Bethena 179 Chas Jackson 612 Wm Howard Thurmond 205 Henry Hampton 614 Jas Evans 403 Mrs M J Dixon gro 618 Vacant 207 Dosie Kerchen 209 M A Clark 224 Connie Troutman 227 Levi Ingram 229 W B Savage 231 Addie Davis 232 Jos Brown 235 Badger Goodwin 236 Robt Laws 240 Robt Naylor 241 Roscoe Carter 243 Wm Larshale 254 Fredk Ricks 619 Chas Howard 620 Chas Benns FRANKLIN ST LANE --From Franklin to Hill bet Walnut and FRANK AL--From 363 Ocmulgee Forsyth east to Georgia av 1 Lizzie Kendricks 2 Jos Thomas 3 Simeon Jackson 4 Richd Parks 5 Vacant 6 Horace Gordon FREEMAN (S M) -- From Williams w to Harrel 101 I E Jones 105 I E Jones soft drinks 107 J M Tidwell 7 Geo Snell FRETWELL AL--From 255 D W Walker 256 Walter Johnson 257 General McDonald 258 Wm Idette 8 Dolly Zellner 9 Claude Mays 10 Peter Wright 13 Hattie Brown Elm to Edgewood av 1 n of Ross FULTON (E M)--From 259 Mary Henderson 14 Homer Jas 260 Matilda Whitfield 16 Geo Bryant Lexington av west to Clinton 1 n of Wool- 262 Blake Watkins 18 Robt Bonner fork 263 Tottie Dial 20 Jas Mathis 105 Anderson Dezon 264 W H Alexander 22 Frank Slocum 152 Chas Folds 266 Della Smith 141 Rosa Griswold 269 John Kelley gro 213 Jesse Hudson 216 Madison Kizzie 219 Isaac Adams 275 Nellie Cummings 214 Clara Thornton 221 Vacant 276 Claud Brown 329 Marshall Harde- 224 Paul Miles 278 Albert Hunt man 501 J W Shoats 306 Allen Searcy 503 Robt Ganns 308 Danl Harris 314 Georgia Smith FRANKLIN -- From Rose Hill Cemetery 505 Anderson Kizzie 506 Thos Jones 320 Shederick Grays 322 Sarah Lockett 323 Equator Peck 325 Wm Ferrell 341 Sami Brooks 343 Annie Holliman 347 E Stanley 407 Jas Seals 415 Ulysses Timber- lake 439 Bessie Young 439% John Wiggins 440 Evelyn Barnum 441 Annie Jackson 453 Vacant 455 Lena Lovett 551 Clinton Brantley 551% Vacant 560 Vacant to Walnut 4 w of 2d 101 Mrs Maud Wil- liams gro FULTON (S M)--From Houston av e to Kemper av 1 s Grady 102 Thos Williams 100 J E Treadwell 107 J H Clemons 108 Mrs Mary Maund 110 Wm Mason 111 J H Clemons gro 112 F W J Dishroon 117 Vacant 118 Beeman Johnson 119 Rosetta Myers FULTON AL -- From 552 Oak south to Arch 1 Ollie Jordan 2 Wm Nesbit 3 Georgia Martin 5 Pennie Mapps 6 Addie Taylor 120 Vacant 7 W B Nelson 151 Mary Midley 8 Walter Matthews 161 Vacant 252 Thos Dumas 10 Sallie Moore 14 Hattie Everett 34 Mamie Smith 256 Edw Collier 69 Albert Whittaker E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS-TRUCKS -TRACTFOoRrSdsoivhIffoarvPietH'asOitNa.FEoFr1od5r,9d1woer JONES MOTOR COMPANY 557-559 P1UM ST. Fulton al STREET GUIDE Giles (S M) 1055 515 Rogers Hardy 254 Oscar Murray 263 Colonnade Apts 555 Mittie Wren 258 Maggie Wilburn Apartments: 558 Frank Oliver 273 Jesse Hankins 1-6 Vacant GAILLARD (V)--From Highland av to Neal 275 P L Holmes 277 Frank Daniel 290 Jas Kitchens gro 7 M E Jones Street continued 265 Mrs M S Burke GANT (E M) -- From 105 Arlington east 108 J C Herb 112 R G Potter GAS HOUSE AL--From Walnut south to Cherry bet 6th and 7th 274 M D McCaw Orange 300 R S Thorpe 309 Geo Tribble 314 Mrs M F Grady GANTT CITY RD (S M)--From Enterprise s bey limits 1 c of Broadway 100 Lucius Smith 102 Wesley Burntley 104 Arth Johnson 106 Vacant 108 Jas Simmons 110 Floyd Simmons 201 Sami Williams 202 John Grier 203 Carrie Pickett 204 Anna Hughley 206 Mary Smith 210 South Side Grocery 231 Frank Cater 260 Hezekiah Green 261 Bora Bentley 300 Nelson Greenwood 302 Alonzo Gallory GARDEN (E M)--From 225 Church north to Fnlton 111 Thos Lindsey Nannie Reynolds 114 Wm Hinson Allen Howard 115 G C Bonner 8 Marie Wynes 9 Melissa Ingram 10 Dock Cherry 11 Nancy Harris 12 Jos Briscoe 13 David Orange 14 Easter Lewis 15 Susie Belle 16 Laura Davis 17 Sol Williams 18 Fannie Zelner 19 Gussie Johnson 20 Sami White 31 Mattie Smith 37 Vacant 38 Wm Brown 133 Luther Roland GEORGIA AV -- From Spring west to junction of Washington and Linden ay continuation of Mulberry 124 W H Felton 130 Mrs E S Shorter 140 Thos Massey 146 J T Killen 150 M P Hall lawyer Bond ends Elizabeth pi ends 218 Mrs Emma Row- lenson 322 A J Lyndon 323 G T Miller College 415 M H Anderson 425 Vacant 451 Arth W Chaplin 453 Mrs Sarah Kess- ler Madison ne cor First Church of Christ Scientist 501 R L Bateman 507 P S Little R R Dugger G E Rosser 517 B L Thombley 521 I M Putzel 525 Mrs N L Hogan 527 O H Hogan 531 R L Halliburton 535 W B Willis 541 T E Billings 547 H C Parker Monroe 605 Jacob Hirsch 607 E H Parrott 613 J H Brown 629 Walter Simmons 639 Vacant 659 Wm Thomas ga- rage 116 A C Broach 117 F W Mills 118 Mary Williams 221 Mrs M F Johnson 224 Emory Winship 232 B E Roughton GEORGIA PLACE -- Two miles w of city limits on Bellevue 119 J T Finney 121 J H Walker 238 W D Lamar 250 A D Schofield car line 122 J C Stubbs 261 Georgian Terrace GILES (S M)--From 124 Edw Hunnicutt Apts 1831 Broadway to 125 T G Reddy Apartments: Second 1 s of Wood 126 Pierce Day Cl H S Shipps 310 R H Brown 127 M F D Sta No 1 C4 Rev Elias Jaffe 311 J T Simmons Center D2 L M Rosen 312 Louis Tissereau 215 Pitts Hightower D4 R H Johnson 313 G W Evans 216 Albert Wilson Street continued 316 H C Hudson 240 Edw Hart 262 Mrs J V Smith 317 I H Melton jr gro < More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r The most comprehensive reference work on me banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. M a. m KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 1056 Giles (S M) MACON Gordon (H H) 320 C M Burnett R L Thornton cor Child Welfare 402 Jas McCrary 410 Aaron Hollomon 412 Etta Clark 628 Janie Maynard 629 Jerry Cleveland Council 414 Wm Curtis GLEN (E 51) --- From Third Cedar begins New ends 501 Apartments 1 J W Allen 2 Vacant 3 J G Braswell 4 J L Whattey 5 Mrs Mattie mister Street continued 502 W L Mitchell 506 D H Riley 510 O M Batson 514 Vacant 416 Ralph Bowden 418 Gus Walker 421 David Green 437 Florence Ball 441 Benj Walker 442 Peter Smith 443 Carlton Reese 447 Wm Carswell 449 Lizzie Thompson 453 Geo Boston 497 Jas Hayward 498 L C Coates 503 Isaiah Bryant 505 Mamie Herrington 513 Woodfork east 113 Hade Murray 115 Wm Grady 116 Aaron Peeples 123 Leonard Lewis 126 Eug Burkett 158 Clara Hunt 160 Anthony Waller 168 Maud McCarty 322 Jos Jones 415 Susie Shelton 416 Anthony Tharpe 765 Geo Hill 518 J I Hunnicutt 552 M Q Carpenter GELMER -- Continuation of Seventh from 151 Tupelo south to Edgewood ay 214 Morris Bateman 216 Nelson Thomas 220 Geo Davis 507 Easter Long 511 Minnie Payne 513 Lizzie Coates 515 Mary Maynard 517 Margt Williams 519 Jas West 521 Norman Butler 525 John Williams 526 Emma Ware 527 Danl Brisby GLEN COVE DRIVE-- From American blvd n to Forsyth rd 203 M W Johnson 204 J G Elmore 210 H J Doty 301 W A Crawford 303 M A Palmer 307 B G Lee 222 Geo Whitehead 531 Sarah Williams 224 Grover Ross 533 Willie McCook 226 J E Manning 602 Sami Boykin 230 Marshall Williams 603 Wm Thomas GLYNN AV (L P) -- From Log Cabin blvd e 1 n Habersham 233 Sarah Brown 605 Wm Hardwick 2 Mrs M E Nowell 240 Clarence Brown 606 Lonnie Banks 6 Julian Potts 303 Chas Mims 607 Ezekiel Ruther- C J Bayne 305 Arth Duncan ford 7 R M Martin 307 Andrew Snowden 310 Perry McDonald 312 Danl Tolliver 315 Chas Fair 318 Addie Ward 320 John Ross 321 Wm Gibbs 322 Eva Render 608 Dennis Gardner 609 Robt Akins 610 Wm McMickens 611 Wm Bryant 612 Wm Billingslea 613 Andrew Dudley 614 Henry Weaver 615 Annie Penn 9 Cliff J Walker 10 Mrs Etta Garrett 22 O G Cooper GORDON (Cherokee Hts) -- From Bartlett's la west 1 n of Bellevue av 323 Chas Lucas 616 Raymond Lowe 121 Simon Jackson 325 Henry Lee 617 Mary Odom 185 Jennie McNease 327 Ralph Tolliver 329 Leila Finney 331 Alex Holmes 332 John Hart 618 Wm Hall 619 John Parker 620 Emma Shivers 621 Zula Price 187 Geo Avant 188 Wm Cole 301 Jerry Bailey 338 Robt Smith gro 622 Lou Milner 304 Eug Gates 339 Fannie Lewis 340 W B Person 623 Henry Bryan 854 Jas Masby 624 Josephine Petty 342 Amos Ponder 625 Minie Luke 344 C A Dempsey gro 626 Preston Banks 357 Clark Smith 627 Eliz Cooper GORDON (H H)-- Changed to Oglethorpe CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS Gordon (S M) STREET GUIDE ' _ Green 1057 GORDON (S M)--From 3d w to 2d 1 e of Edgewood av 115 F H Wade 116 Dock Woodard 130 E H Rousseau 131 J F Pittman 132 Mrs Fannie Fox 133 O S Tidwell 135 E R Gilman GRACE (S M)--From Second to Fourth 3 s of Steele GRACE (V) -- Changed to Ruby GRACE AL--From Elm to Ash bet Telfair and Jackson GRACE PL (S M) -- From Piedmont av south 1 w of 2d 100 C A Thomas 120 J R Bowles GRADIE'S ROW (S M) --Rear of Southern Cotton Mills GRADE -- From Houston av e to Kemper av 1 n of Fulton 103 W W Hatton 105 J S Gornto 112 Vacant 120 Vacant 121 R F Hamlin 122 W H Buchanon 123 A M Graves 124 J W Hightower 126 H A Hamlin 128 Mrs Carrie Campbell 206 Absent 310 W F McDaniel 500 D G Belknap GRANT AV (V)--From Fourth av north 1 e of Ward 100 Beda Etta College GRANT CHAPEL AL ( SM)--From Second south 1 n of School 228 Vacant 229 Pauline Love 231 R P Ludlow 235 J H Hall 405 Sami Goodwin 524 Grants Chappel A M E Ch 525 Edd Ferguson 526 Wm Smith 527 Harris Turner 528 Laura Coleman 530 Narcisos Ward 531 H L Harris 532 Fuller Sweetwine 533 Vacant 535 Jesse Jones 537 Vacant 539 Phillis Cook 540 Lula Dorsey 542 Edd Wimbush 543 Luke Eve'rett 545 Otis Aiken 2229 Vacant 2231 W M Garner GRANTS (V) -- F r o m 103 Douglass n to Sherman 123 Crawford Burney 124 Leonard Lavender 126 Hubert Lavender 127 Wm Dawson 161 Robt Walker 163 Thos Lockett 165 Jas Sims 180 Jos Gordon 182 Benj Crowder 185 Emma Frederick 191 Smith Stevens 207 Walter Rogers 225 Edith Turner 227 Ethel Jackson 230 Robt Dudley 232 C B Berry GREEN -- From 261 Madison north 100 Annie Threatt 102 Rosa Ashton gro 111 Green St School 113 Vacant 114 Jos Mahogony 115 C B Lane 116 E F Miller 117 Vacant 118 Dock Jenkins 120 Ella Gardner 121 Sami Nesbit 122 A R Jones 124 Nathan Kinchen 125 Lela Hughes 125% J T Wright jr gro 126 Thos West 128 Henry Ferrell 130 C H Smith 132 Henry Ferrell gro 132% Anne Worthey 134 Lettie Means 150 Roscoe Griffin 153 Pleasant Card 155 Lula Sims 157 Oscar Jacks 158 Wm Wadley 160 Martha Sullivan GRAHAM'S LOT--Rear 225 5th GRAND AV (Bellevue) --From junction Log Cabin blvd and American blvd north to Ayers rd 100 Rev J S Lewis 200 Sami Simpson 202 Mrs Maggie Brice 204 L F Fordham 128 J H Hicks 129 Jas Pitts 130 Julia Macy 131 Jas Roberson 132 Rev T T Ivey 134 Jas Ryals 136 Buford Randall 140 Ella Parks 145 Alonzo Jackson 155 Ivory Butter 157 Ellis Strozier 159 Elbert Jackson 161 Columbus Hill 164 Zena Screen 168 Andrew Hender- son 169 Collins Baker 171 Pink Williams 172 Lindsey Carswell 173 E W Williams 176 Ophelia Sellers 200 Fannie Harris 210 Jos Holt 211 Augustus Evans FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK Si CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DM11 1058 Green MACON Hall (E M) as a 214 Noble Hawkins 217 Vacant 109 J B Annis 110 C E Long 18 Viola Hall 20 Sami Johnson MMLI 220 Vacant 221 Nellie Jackson 223 Lewis Jackson GREEN SMITH'S AL-- From 374 Monroe n 102 Evans Kimbrough 105 Garfield Brown pm THE DIRECTORY IS THE GREATEST 226 Fannie Davis 227 Vacant 228 Americus Tatum 228% Benj Glover soft drinks 229 Floinall Jackson 238 Ina Frederick 240 Jas Ray 242 Vacant 244 Scott Thomas GREEN (C H)--From Bell av W 2 s of C of Ga Ry 100 John Walker GREEN'S LANE--From College to Monroe 1 n of Georgia av GRESHAM L A N E -- From Spring n to Orange bet Rose Park and Forsyth 624 Edw Hall 625 Mattie Holland 626 Josephine Danforth GRIER-- Continuation of 9th 106 Randall Brown 108 Wm Lowder GUSTIN PL (V)--From Holt av to Virginia la 1 s of Forsyth 1 Vacant 2 J W Spruce 3 O C Stallworth 4 Mrs Mattie Rob- erts 5 A A Jones HABERSHAM AV (Lanier PI) -- From MARKET PLACE IN THE WORLD * Every Day 112 Lillie Sledge 200 Mary Battle 202 Beatrice Newton 220 E C Mott 221 Wm Fuller 222 Washington Clow- ers 224 Lucy Brooks 226 John Johnson 227 Vinson Leonard 304 Chas May341 Isaac Wimberly GUERNSEY LANE -- From Elm to Edgewood av bet First and Telfair 154 J H Stokes 156 Alex Greely 158 Vacant 160 Mariah Hicks 704 Jas Burney 706 Frank Willis 708 (705) A N Bryant Log Cabin blvd els Glynn av 113 R L Bullock 115 Mrs Dora Harrell 118 J S Ivey 120 J L Cooner 121 A O Pittman 122 J B Jones 123 T O Drawhorn HALL (E M) -- From Melrose se to limits 1 in the Year 345 Sarah Ross GUNN AV--From Har- n of Jackson the Directory Tells Where All Kinds of Goods and Service Can Be Had ) * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year GREEN (E M)--Changed to Wilson deman av to Forsyth 2 w of Edgewood av GUNN'S AL (V)--From GREEN (Payne Will)-- Hardeman av east to From Payne av S 1 e 3d av 1 n of Middle Davis 1 Oscar Little 80 J C Benton 2 Walace Robison 82 W C Whitehead 3 Fannie Howard 84 Vacant 4 Wm Williams 86 R A Saxon 5 Rufus Stone 88 R W Mason 6 Chas Jackson 90-91 J H Bryant 7 Effie Dixon 92 Vacant 8 Geo Wall 93-94 Mont Tillman 295 Julian Turner 99 Mrs Emma Daugh- try GUNN'S HILL (S Mi- 95 Mary Hall South to limits e of 101 Cora Brooks 14th 125 Vacant 225 Annie Thomas 264 (664) Walter Crittle 266 (666) Jas Ander- son 268 (660) Wm Moss 303 (583) Lucinda Kendricks 331 (531) Henry Jack- son 35 (150) Calvin Bat- tle 400 Chas Solomon 401 (218) A L Meri- wether 402 (21) Edw Red- ding 102 J S Simone 403 (19) Chas Ford 103 J F Stallings GUSTIN AV--From N 405 (305) Lillie BLPoikaCo 104 J A Peacock 106 J W Perkins Boundary to River rd Wright 14 Charity Mosely 407 (307) Andrew PUEKHEBS 108 Mrs Mary Raynor 16 Wm Phelps I Roberts More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656J/2 CHERRY ST. PHONE 3041 MACON, GA. Hall (E M) STREET GUIDE Hardeman av 1059 409 (309) Wm Middle- 320 Jonas Mayo HANSON (S H)--From brooks 321 Upsey Galmore Blount west to Hous- 411 John Brooks rear Mary J Alexander ton av 3 s of junc- 420 H C Bivins 322 Enoch Smith tion of 2d and 4th 422 (15) Frances 326 Henry Eason rms 300 Edgar Butler Ford 334 Fannie Cheatham 301 R A Hubbard 451 (251) Geo Gil- 338 Ada Byron 302 Mary Thomas strap 342 Mollie Evans 305 Obie Ross 456 Roxie Howard 344 Jack Lamar 307 Dock Sanford 458 Paralee Marshall 345 Frank Goodwin 308 Lila Redden 497 Oscar Robinson 346 Luther Wiliams 309 Eunice Harris 499 Jos Green gro 347 Jesse Watts 310 Herbert Johnson 504 (252) Jerry Jack- 349 Ernest Morris 311 Raymond Webb son 506 (250) J M Parker 508 Gray's Chapel Meth Ch 511 (411) John Pat- terson 512 (240) Mamie Billingslea 514 (239) Arrie Wimbs Hazel 416 Lee Lucas 418 Geo Clarke 420 Ernest Parker 422 Mary Tharpe 434 M L Carswell 436 Edw Walker 438 Emma McKay Ash 312 Wm Sanford 313 Geo Harris 315 Henry Woodfolk 316 Jas Mathis 317 Vacant 324 R A Watson 326 W H Jones 327 Mrs Lucy McCul- lough 328 Oscar Sapp 551 Lizzie Thomas 500 Wm Sandford 330 Mrs L A Pittey 604 Katie Barnes 510 Jas Gordon 332 A F Watson 606 (225) Chas White- 516 Jas Wilder 337 Emmett C Avera head 518 Sami Sanders 347 T C Maddox 608 (227) Grace Ford 550 Chas Tolbert gro 350 J B Ross 610 (136) Leonard 552 Thos Rice 356 W R Hudson Billingslea 612 St James Sancti- fied Ch 628 (128) Allie Free- man 663 Walter Crittle 665 Annie Reynolds 667 Sami Lowe 690 Julian Bell 693 Win Davis 695 Clifford Ross 697 (127) Robt John- son 699 (131) W M Reed 706 (442) Sylvia Cur- , tis 735 Taylor Hall 750 Wm Hatfield HALL (S M)--Changed to Atlantic av 557 Rhody Smith 558 Georgia Lewis 561 Albert Sutton 566 Julius Perkins Elm 602 Lewis Evans 608 Sarah Caldwell 612 Cornelius Lowe 616 Chas Tolbert 620 Rosetta Howard 624 Jas Collins 628 Oscar Sanford 634 Emanuel Gordon 640 Lula Singleton 641 Wm Hammond 642 David Hall Edgewood av 701 Josh Lilly 703 John Roberts 410 Mrs S A Hardy 412 Mrs L F Collins HARDEMAN AV--Continuation of Georgia av 1 e of Forsyth 100 Chas Andrews restr 102 Drew & Robinson furn 103 A J Walker shoe repr 105 Wm Braswell restr 107 Vacant 111 Vacant 115 Sami Karesh gro 117 Vineville Fish Co 119 Vacant 123 Vineville Pkg Co whol meats 124 Hardeman Phar- HAMMOND--From Tu- 721 Hugh Oliver macy pelo south to limits 4 738 Lee Johnson Virgin begins e of 2d 130 Henry Gordon 315 Nathaniel Burnett HAMMOND'S AL-- 140 (120) L W Rogers 317 Alf Roberson From 652 Third av e Co gro 318 Zeak Townsend to 653 Fourth Middle begins Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog* contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. ? 3 I C/3 rf*t3*"* CO > O o > o tn H W > C2n/3 sc > C/3 w o > r H *< > A H m re eoS3r W00 TERMINAL TRANSFER COMPANY POLK'S dental UTRTMNCtttn>eW^a-TgTTnHEIsIaiROETdDsNNAaTtyMTeeaErs ,1%*9>2 *5c< PRECIOUS mj^ReYtaFOlRsM POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 1060 Hardeman av MACON Hawthorne 203 Vacant 3 Edw Morgan HATFIELD AL (S M) 205 Ga Grocery Co 4 W M Flint --From Chappell east 209 Mrs M L Pitts 5 Annie M Sullivan to Elbert bet Strat- 212 W J Stripling 6 Mary L Butler ton and Reid 217 Vacant 7 Mike Jenison 187 Arth Mitchell 236 W F Houser 9 Wm Rucker 189 Green Reynolds 238 C L Bunting 10 Matie Carter A F McGee 240 W W Hackett 11 Mary Felton 14 Aaron Brown HAWKINS (E M) -- From 248 Main north 243 Vacant Dessau pi begins 245 Mrs Lila Sharpe 247 J R Holt 249 M J Mikel 250 Hannie Pritchard 254 Dr O C Gibson 255 O W Massey 257 H G Williams M F Young W R VanLanding- ham F B August 268 P H Gambrell 270 H J Baldwin 271 N R Winship Craft begins 300 A E .Barnes T R Turner 301 Dr M A Clark 311 Mrs S P Pendle- ton 316 Mrs H M Lane 319 M F Hatcher 322 Brown Wimberly 339 G S Jones North begins 340 Mrs L G Harde- man 341 J L Halcome 342 C H Andrews 346 Mrs Bessie Cole 347 Vacant 354 Vacant 356 Vacant 360 Mrs M R Shurley 362 Gulf Refg Co 42 Anna Jackson 66 Wm Moore 93 Danl Grace 94 Emma Redding 95 Lucile Searcy 96 Jas Brown 240 Anna Johnson 242 Ceola Spurley HARRIS LANE--From Turpinn n to Southern R R bet Harris and Division HARRIS ROW --From Tnrpin east to Sou By 1 Ethel Johnson 2 Henry Amos 3 Berry Adams 4 Sami Turner 5 Lula Griffin 6 Anderson Wilcox 7 Olin Wimberly 8 Jos Brown 9 Ernest Anderson 502 Della Adorn 504 Mary Phillips HARROLD (S M) -- From 242 Jeff Davis south 98 T M Coleman 100 J E Collins 104 W E Robert 106 P D Johnson 107 C C Dorman 109 B R Irby HAWKINS AV--From Roye n to C of Ga tracks 1 e Bartlett 102 Freeman Smith 104 Albert Rush 114 John Dennis 115 Sylvester Middle- brooks 118 Vacant 191 Emma Newson 193 John Powers 195 Ida Jones 207 Vacant 211 Lucious Newton 216 Willie Barnes 220 Tillman Shannon 300 Miles Hawkins 301 J H Dawson 302 Frank Smith HAWTHORNE -- From Elbert west to junction of Telfair and Tazel 1 s of Oglethorpe se cor Dixie Coal Co Fifth 325 J W McCook Lbr Co 349 John Thurman 350 Manda Broadnax 352 Eland Wilson 354 Walter Williams 356 Mary Griffin 361 Walker Johnson Robt Williams 365 Thos'Taylor filling sta 364 Pitts & Buxton HARTLEY AY (C P)-- Broadway From Forsyth rd n to 412 Rebecca Bell Drug Co Ridge av 1 w of Park 413 Mrs R L Ashley Forsyth ends av 418 Viola Hubbard Vineville av begins 106 C C Martin 420 Viola Willis E C Latimer rear Chas Boone HARRIS ALLEY -- 108 J H McElreath From 3d w to 2d bet 204 Thos Watson 454 Vacant 455 J A Sims blk- Pine and Oak 2 Minnie Holland Spivey Dobbs 206 Thos Cass smith 458 Sarah Nelson FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Hawthorne STREET GUIDE 466 Rev Calvin John- HAZEL -- From Divi- son sion w to Koss 12 s Third of river 505 W M Fair 8 Oilfield Prim Bapt 506 Fulton Baptist Ch Church 507 Geo Sumlin 16 John Kaigler 509 Mrs J F Powell 17 Fannie Jones 511 Simpkins 18 Henry Searcy 515 Vacant 83 Emanuel Joiner 520 Bessie Murray Gilmer 522 Annie Dismuke 100 Waller Aldine 524 Daisy Jones 101 John Williams gro 528 Jas McWhorter 102 J L Winberg gro 551 Virgil Powell Sch 103 Cicero Hall 563 C L Annis 104 Mallie Hill 569 T M Maze 105 Susie Fairfax Second 610 S T Bass barber 612 Mrs Mary Fair 613 Jennie Johnson Bee Collins 616 H J Collier 622 T F Ard 654 Mrs Lula Clark 658 Mrs Ada Jordan 662 W J Horton 668 Ellen Lewis 671 Bibb Mfg Co No 2 First 704 J R Bragg gro 706 Hattie Frederick 708 Edw Newsome 710 Janie Thomas 712 Wm Prater 714 Addie Wright 716 Wm Parker 718 Eliza Howard 720 Jas Cheney 106 Ernest Tolliver 107 Thos Ball 109 Nina McNeal 110 Ross Paul 115 John Holmes 120 Lee Lucas 135 Jos Byrd 136 Arth Wilcox 137 Leroy Burgay 141 Annie Wilcox 161 Lewis Stanley162 Wm Watts 163 Abner Slocum 164 Macedonia Bap- tist Church 165 Wm Ross 166 Henry Davis 168 Sami Adams 170 Sarah Chapman 171 Wm Lee 173 Sami Williams 174 John Cummings 175 R L Brown 722 Ernest Norwood 176 Emma Miller gro 723 Ellis Crosby Hammond 725 J B Hooks 201 Robt Jones 726 W P Patterson gro 203 Jas Davis 731 W A Reed 205 Julia McDonald 733 W J Caldwell 208 Jas Floyd 739 W I Evans 211 Wm Gadsen 741 J B Boutwell 219 Wm Walker 749 O W Heath 220 Rev H T Taylor 751 John Wilson C of Ga Ky 759 Vacant G S & F Ky 761 D M Maddox Elbert 765 Mrs Pearl Griggs 301 Procter & Gamble 767 Raymond Collins Co soap mfrs 773 M L Aultman 306 Georgia Neal 775 G S McCoy 310 Annie Dixon Hazel 1061 311 Robt James 313 Oliver Spivey 314 Mark Stroud 319 Jos Jolley 320 Jesse Stroud 354 Wiley Durham 357 Henry Curry 359 Paul White 360 Gordon Pinkton 361 Richd Williams 362 Mollie Roos 363 A P Proctor shoe repr 364 Laura Young 369 John Cole Broadway 414 Jacob Doctor 416 Louis Winberg 417 C H Swain 418 W F Garvin 419 T M Allen 420 Mrs Maud Beasley 421 Ruff Martin 452 G W Green 453 Mrs Freddah Wal- ters 455 H C Menten 457 Vacant 458 J S Carroll 460 Mrs Irene Mosley 462 Mrs Johnnie Bailey 471 Wm Daniels 473 Maggie Brown Third 503 Dock Walker 511 Georgia Killian 513 Patsy Barnes 520 J Y Williams 523 Lizzie Duncan 527 Eliza Wimberley soft drinks 548 Gordon McCar- thy 550 Jerry Pickett 552 James Copeland 554 Lloyd Williams Second 609 Mary Jackson 611 Sarah Maynard 612 Steph Holland 615 Jas King 618 M C Carvest 619 Rosa E Lee 620 E C Carvest gro A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. l. POLK & CO., Detroit MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1062 Hazel MACON Henderson's Row (S M) 652 Hazel St Sell 862 Vacant 1058 Jas Seay 653 Harry Williams 864 Vacant 1059 Mrs S C Abel 655 Mary Washington 866 Susie Few 1060 David Jackson 657 Vacant 868 Susie Few gro 1064 Vacant 659 Lillie Coleman 870 W H Wester gro 1065 J M Smith 667 Benj Johnson 872 Owl Drug Store 1066 Vacant 670 Sophie Adams gro 872% Jas Willis clo 1069 A L Hughes First clnr J H Worsley 702 Lizzie Casey 704 Wm Cherry Hampton Hawes 1070 H W Wood Jackson Koss 706 Vacant 902 J B Beasley gro 708 Wm Stewart 904 Anna Hester HEARD (S M)--South 710 Robert Jones 910 Sami Flanders of limits from Hous- 712 Vacant 914 John Holmes ton rd east 714 Essie Hardrich 716 Geo Carter 718 Fannie Armstrong 720 Lizzie Davis 724 David Hiney 726 Vacant 728 Anna Overstreet 730 Clayborne Hen- derson 732 Vacant 734 Lucius White 770 Bennett Chanin gro Telfair begins 802 David Bolden 806 Arth Wesley 808 Arth Wesley bar- ber 821 Vacant 823 John Singleton 825 Dewitt Arnold 827 John Jones 833 E Frank Sumlin 917 Vacant 102 Harry Clark 919 Daisy Jones 920 Maurice Griggs 921 Wm Clyde 104 Mrs J F Jones 105 J T Collins Ahral Sutton 923 Clara Whitehead 925 (953) Wm Bill- ingslea 927 (955) Lucy Jones 929 Thos Adams 931 Thos Bowden 954 Henry Farr Clifford McDaniel 960 Mrs Eliz White 961 Hattie Williams 106 C K Malone 107 C M Keister 108 W M Jones 109 A J Long 110 C I Burnette 113 (17) H M Wynne 114 A D Josey 121 W D Pace 123 E S Wheeler 962 963 970 971 972 973 Dock Etheridge Williams & Flem- ming C W Brooks Edw Pearson clo clnr E T Parker gro I Simmons Merch- andise Co HENDERSON (S M)-- From Enterprise to Nelson 4 w of Waterville rd 200 (704) Benj Holmes 201 (701) Haywood Heard 835 Chas Smith Calhoun 203 (703) Cath Little 837 Wm Redding 1004 E H Carter 300 (11) Wm Roberts 839 W W Sanders 1007 W V Miller 841 D H Davis 1010 C T Mize 843 Mrs Rosa Sander- 1012 J W Bunch 307 Rev E W Hoyt 404 (206) Howard Booker lin 1013 C T Andrews 406 (208) Wm Bate- 845 Dell Peeples 1014 Pies Butler man 847 C M Smith 1015 H F Berry 408 (210) Wm 848 Jefferson Baker 1016 R G Morgan Arnold 851 Geo Wheeler 1017 Mrs Eliz Barfield 410 Wm Arnold gro 852 J W Allen gro 1019 Mrs Lizzie Tucker John O Braswell 1020 S C Caldwell HENDERSON'S HILL 853 Vacant 1021 J W Millirons --South Macon 854 Vacant 1022 W C Turk 855 Mrs L G Maddox 1023 Vacant HENDERSON'S KOW 856 Wm Dinniard 1052 Joshua Slappy (S M)--From Antioch 858 C W Jones garage 1053 L H Garfield rd east to Waterville 860 E W Jones 1056 Duncan Greer rd natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. Hendley STREET GUIDE Highland av 1069 HENDLEY (Napier HENRY (S M)--From 218 R H Kingman jr Hts)--(Formerly 2d, Houston av e to Gantt 219 Rev J A Harmon av)--From RoffHome City rd 1 n Heard av 220 E M Williams av s to Beech av 170 Newbery M E Ch rear Nannie Hughes 155 R R Stewart 185 T B Henry 225 Mrs M L Price 165 W J Cochran 201 J W Randall 226 Mrs A H Williams 175 R K McAfee 203 J A King rear Anna McDonald 185 Cliff Clark 195 J H Leigh 201 B T Watkins 203 E 0 Smith 207 Vacant 209 E 0 Smith 215 Lula Woodruff 300 G B Alexander 301 W E McDuffey 303 C W Williams 305 J T Willis 307 J O Miller HENDRIX AL -- From 239 College n to Monroe 2 Lawton Carter 28 Mary Hill 38 Lessie Andrews 24 M L Ross 226 Wm Taft 227 Julia Chatman HENRIETTA (S M) -- From 603 Telfair w to Division 212 Cornelia Roberts 213 Grant Holloway 513 Jas Riley 536 Rev H F Taylor 537 Amanda Tumor 538 Clifford Duncan 539 John Jackson 540 Lucius Hall 541 Wm Zanders 542 John Lane 553 Alonzo Pardue 554 J D Tinsley HICKS AL--From 600 Montpelier av south 423 Odel Winfrey 640 Lula Brown 641 Chas Perkins 642 Geo Hardin 644 Frank Taylor 645 Edw Goodloe HIGH -- From New southwest and west to Orange, 1 s of Washington av 101 First Baptist Ch 120 J W Woodall 121 Rev W R Owen 126 A J Davis 127 Mrs M E Hurley L K Johnson 130 Vacant 131 C C Gewin rear Honey McCrary 132 Caroline Patter- son 140 J C Edwards Plum ends 141 J A Reynolds 142 A F Devlin 144 Mrs A B Lane 147 W M Conner Dr O R Thompson rear Lewis Herndon 148 Vacant 152 T B Ellis. 158 Maude Hines 162 Mrs Mamie Har- per 231 J E Hall 232 Marshall Apts Apartments: 1 T M Willingham 2 M C Wright Street continued 234 L S Worsham 235 J N Birch 236 Vacant 247 R K Hines 257 Mrs M E Horne 261 Vacant 263 W S Payne 265 First Christian Ch HIGHLAND AV--From 910 Orange southwest to Oglethorpe 120 S P Strickland 123 C E Knight 124 C G Walden 126 W F Waldorf C H Fallen 127 C H Hall 128 E B Campbell 129 Mrs Minnie Myers 130 Vacant 132 Mrs Dollie Burns 134 L O Smith 135 Mrs Mamie Greene 136 J P Howell 139 G T Banks 140 Vacant 141 A C Ivey 150 Mrs Gertrude Hoge 555 Fred Sanders 556 Wm Hudson 557 Wilbur Warren 559 Alf Bell 561 Jack Coney- 164 J H Belote 168 Vacant 172 C & Cason Spring HIGHLAND AY (Log Cabin Hts) -- From Log Cabin dr south 1 201 W A Crutchfield w Thomas 563 Nell Davis 202 Mrs L S Damour 55 E M Rauton 567 Benj Little 565 Precious Strange 601 Vacant 603 Sallie Smith 605 Mattie Russell 203 M M Stapler 206 Mrs Martha Shin- holser 212 Mrs E R Wilson 213 W T Wood jr 101 L E Tindall 103 Mrs M J Gray 109 C H Gillon 111 C R Bush "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy II, L. POLK & CO., DETROIT, MICII. f A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit 1064 Highland av (N H) MACON Hillyer av (C H) HIGHLAND AY (N H) 107 A H Clark HILL PARK AY--From --From 901 Boule- 109 C H Denicke Spring w to Bond 4 vard north 120 H G Muerke s of river 100 W E Tyner Courtland av 1 Whittle School 101 Mrs M C Burney 152 Marie Geo 3 Jas Henderson "More 102 C C Bowdoin 110 F S Peek 154 Mattie Smith 200 O P Beall 5 Vacant 7 Viola Stapleton Goods I are HIGHLAND AV (Y) -- Changed to Clayton 201 F H Richardson 204 Mrs Alice Mars- den HIGHLAND AV (S H) 205 E L Cox 9 Mrs L D McCallum 11 Mrs Lillie Johnson 17 J P Blackwell 27 Clarence Turner 1 Bought and ---Changed to Crisp 206 L C Dodge 208 I D Greene HIGHTOWER (S M)-- 220 D W Anderson From White to Hous- 224 Fannie Hunter HILLIARD (E M) -- Continuation of Hill E M ! Sold ton rd 100 B T Holloway 101 Irene Wade 255 Hyman Marshall HILLIARD AL--From 265 W F Walton 819 Fourth to 842 3d 275 Mrs Carrie J Ren- ; Through the Classified Business Lists of the Directory Than Any Other 198 J J Holmes 202 W L Smith 301 C F Chapman E L Sherling 305 S J Self 307 T C Maddox HILL -- From Ocmulgee s to Walnut 5 w of Second 110 Myrtle Edwards 118 Lewis Gtaith 120 Maude Dinkins 122 Ralph Carswell 152 Matilda Burton 154 Wilson Walker 156 Edw Sawyer 158 Rachael Atkins HILL (E M)--Changed to Womack froe HILLYER AV (C H)-- 290 E B Harrold South from Hill Crest Hillyer av 303 C J Bloch 304 B T Bethune 306 Benj Goldman 307 J M Whitman 310 J J Barrett 311 E T Cooke 316 Alep Dowell 320 G G Stanton 324 Stanley Wallen- stein 327 R W Moore 328 V R Napier av to Montpelier 222 Edw Ward 267 Mrs L P Mims 269 T L Wood 270 W M Jennings 271 Moses A Michael 272 H T Mathews 273 Carrie Collier 274 Riley Haden 275 A R Menard 276 C W Foster 277 W L Fitts 279 H T Mathews 280 J Q Lumpkin 329 (377 C E Paine 281 L U Bloodworth 331 (393) H M Reid 283 D F Lehman 333 (395) O A Cole- 286 C C Coleman man 290 C J Motton contr 334 M M Kaplin 300 E B Durham Medium On Earth" HILL (Y)--Changed to Fargason HILL AL -- From Hill to Orange 1 n of Walnut HILL CREST AY (C H) 368 C C Arnett 400 Albert Dudley L D Wilson 401 R G Williams 403 Vacant 404 Vacant 405 Vacant 301 L H Crumley 302 J F Barron 303 R T Stull 304 W W Bennett 305 D A Walker 306 H L Byron 307 Felton Pound 309 Logan Goodman --From Pio Nono av 407 A M Goodman Mrs Maria Hert- west 3 south of C of 409 E T Watson Ga Ry 411 R A Watson 102 M G Goldgar 460 Vacant wig Beech av 400 R B Dame 103 E P Mosley 488 Louise Dumas 401 H C Stewart 104 Ophelia Reichert 492 Albert Dutley 403 R H Hillman 105 A L Mack 496 Alice Clarence 404 J T Mainor 106 C H Schofield 498 Chas Murphy 405 S L Orr Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Hillyer Av (C H) STREET GUIDE Holt Av 1065 492 J W Daniel 201 R W Evans 205 Mary Lewis 493 G C Hertwig 203 H D Hansford 209 Frances Wimbush 494 Lincoln McConnell 204 Vacant 211 Causey Barton jr 495 E T Flanders 496 H 0 Hunter 497 T M Raines 498 J J Farren 500 Rev L A Harrell 505 W W Walthall contr 506 C L Chapman 507 H H Hippie 508 A E Moore 509 M B Minton 510 W R Haynes 512 Vacant 513 Vacant 515 J T Willis 517 C H Sockwell 601 H S Shinholser 603 T M Jones 605 T M Perry 205 J W Fulghum 207 Mrs P A Prator 208 M D Jones 209 Ardell Armstrong 211 S A Middlebrooks 214 B M VanBuren 215 Grattan Hammond 216 P Holliday 218 J W Lee 219 D M Saunders 220 C R McCord 221 J T Johnston 222 T O Candefur 300 Mrs Geraldine Wheeler 302 J B Neighbors 303 Vacant 304 T W Arnold 306 J S Dodd 308 C C Cunningham HOLT -- From Orange southwest to Maple 4 w of First 114 J T Ware 118 Mrs C S Moxley 119 C G Cain 121 H C Griffin 122 J H Settle 123 S A locum 124 Mary Hinson 126 Mrs B C Crawford 127 W E Osbourne 128 C A Edwards 132 Mary Murphy 138 V S Smith 144 E G Staedtler 144 J A Thompson 150 Mrs A C Donnelly 156 L P Donnelly 606 C C Phillips 607 W J Fritts 611 (590) J W Casey 310 H T Tabor 333 C T Snowden 345 R H Williams 347 C H Andrews HOLT AL -- From 461 Vineville av n to Highland av HINES TERRACE (V) --From 619 Vineville av n to McDonald 106 I L Domingos 109 Rev W M Ainsworth 110 Vacant 114 Mrs M S Jelks 348 Nolen McCrary 349 J P Williams 350 L A Irons 351 Mrs L M Williams 353 G W Rowell 407 A R Norris 410 J T Davison 414 L A Shirley HOLT AV (V)--From 734 Forsyth south to C of Ga Ry 102 D J Flanagan 106 C C Broome 108 Mrs B Detling 108B B L Long 110 H A McManamy 115 L H Burghard 116 Rosa Massenburg 120 Mrs Ella L De- Haven HOGAN'S AL -- From Pio Nono av west 1 s of Cherokee av 112 Rev Chas Lane 136 Vacant Gnstin pi begins 216 Southland Knit- 121 J H Spratling HOLLIS--From Hous- ting Mills 124 Francis Herring ton av w to Mont- 127 J D Owens 128 Baxter Jones pelier av 1 s of Ellis HOLT AV (Napier Hts) --From C of Ga Ry to 131 W C Turpin jr HOLMES AV (V) -- Montpelier av 1 w of 132 Albert McKay From city limits w of Duncan av 133 W W Noyes St Stanislaus College 7 Mrs Isabelle Hale 136 T S Bush to C of Ga Ry 8 Shaw Stewart 139 W C Slocumb 100 Margt Dorsey 9 C B Black 140 W L Williams 102 Oliver Brantley 10 A B Chatman Boulevard begins 104 Annie Howard 11 Minnie Tanner 142 O C HancockX 105 Benj Crawley 12 A J Monfee 143 W E Stewart 126 Lilly Howard 13 J T Dupree 144 T B Lovelace 128 Jos Radford 14 Cliff Tidwell 145 E B Burden 203 Mary Latimore 15 E M Dennis 157 F J Lowe 204 Sylvia Sims 16 Jas P Cannon FOR. LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. Ij. POLK & CO. CHICAGO Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be jFound The Classified Business Section is tlie Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1066 Holt Av MACON Houston Av (S H) 17 Mrs Lucretia 714 L P Creter 2906 C W Smith Rhodes 716 C C Hammond 2908 G E 13'mith IS Raymond Glass 723 Lutheran Ch of 2909 T L Hill 19 Jesse Martin The Redeemer 2911 J H Smith 20 A I Carter 725 G R Harvey 2915 T F Rodgers fill- 21 P M Addleton 727 T P Woodruff ing sta 23 F P Jordan 784 Harry Garden 2916 G E Castellaw 24 Maggie Valentine 785 G N Thomas Cleveland ends 25 Eug Bowden 786 J F McFarland 2918 Enrico DeVeruto 26 G C Wade 789 L R Baird 2920 R M Holloway 27 J A Favors 790 H L Dennard 2921 W H Lawrence 42 A J Carter 792 N W Johnson 2923 G A Tunison 47 Mattie Land 114 (631) Mrs M L Carpenter 116 L J Grady 121 W T Wilson 122 (1) Mrs Carrie Bethune 124 (2) H F Defore 126 (3) Geo Wright 128 (4) Mrs Lee Ad- dleton HOLT LANE -- From Walnut south bet 6th and 7th HORN (C P) -- From 1201 Forsyth rd northeast one block HOUSTON AV (S H) (Formerly Fourth)-- From jet of Second 2929 J T Nettles 2931 W C Butler 2998 Vacant Rutherford begins 3000 Vacant 3001 Z D Sharpe 3002 Mrs Mamie Turner 3003 J P Hadasits 3004 M iS Dunbar 3005 W J Hamlin 3007 G J Jones 200 (5) Mrs Fannie and Broadway south 3011 Butler & Smith Hedden 204 (6) B L Glass 205 (29) J J Elliott 207 R B Hunt 209 (31) B O Busbee 212 (62) G R Lynch Lawton av 500 R W Edenfield Willingham Bapt Church Boys High Sch Napier av 604 Vacant 606 Vacant 607 C L Ledsinger 608 J P Scott 609 R S McWilliams 610 R E Ogletree 611 H W Robinson 612 M A Thames contr 613 C E Wilder W T Moody 614 C S Thurman to Gordon 2642 O C Bazemore 2646 E C Harris 2719 Mrs Margt Sand- ers 2721 L W Grady 2723 Wofford Oil Co filling sta Boulevard av begins Crisp begins 2725 D F Pinholster 2803 S H Simmons Mrs Mary West 2804 W J Yarborough 2808 H B Sample 2810 W E Saeger 2829 S H Hightower Nelson ends 2831 Mrs M E High- tower P J Morgan 2834 W J Malone jr 2835 J P Morgan gro 3019 C H Fuller filling sta 3020 Vacant 3021 Vacant 3024 N T Treglown 3026 J F Dupree 3028 O F Smith 3030 J R Westbrook 3031 Vacant 3032 A J Collins 3034 R E C Burnham 3035 J F Herring 3036 H G Hobbs 3038 T E Brown 3039 Mrs Madelina Herring 3040 L W Hendricks 3041 J M Baldwin 3042 C W Dyer 3043 W W Phillips 3044 J T Rachels 3047 Newberg Sch Newberg av Beech Hulburt begins 3145 J C Calhoun 702 C F Griffin 2837 L A Wyche 3200 C I Burnette gro 703 A L Hedgepath 2S38 K B Busbee 3201 L C Combs 704 D T Belle 2839 Mrs Marie King 3203 W A Hammond 705 D F Bruce 2846 The Texas Co 3205 A D Harper 707 J A Johnson Hanson ends. 3303 C T Christian 711 C J Rogers 712 W P West 2900 J F Herring gro 3307 J H C Williams 2904 Vacant 3308 B H Huff contr R. L POLK & Company FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 613-618 a ENGLAND BIBB REALTY THE CHIROPRACTOR Will Remove the CAUSE of Your Disease BLDG. PHONE 4557 Houston Av (S H) STREET GUIDE Jackson 1067 3311 G W Bernhardt 153 Mrs F E Johns 327 J C Johns 3400 Mrs Susie Bed- 156 B A Moore 328 Homer Gurganious ingfield 158 C H Camp 341 W L Slocumb 3401 L Beddingfield 3481 G J Jones gro 3492 Vacant 3494 C L Wilson gro HULBURT (S M) -- From 2835 Broadway west 342 Wm St Clair 343 Claud Maddux 344 E Macon Presby Church 3494% C W Barton jr 3496 G W S Hightower gro 3498 Mikado Pharmacy HURLEY LANE--From New to Spring bet Oak and Orange 345 Jesse Roberts 347 A B Woodall 349 O B Collin 357 H C Burns 3500 3502 3503 3508 J T Freeman C H Trawick J T Ellis R D Barnes Heard begins HYDROLA (E M) From DeWitt nw Applewood 31 Mrs Ella Ward 101 O G Mixar gro -- to INDUSTRIAL HOME RD (Bellevue) -- From American blvd west 3601 E L Hamlin 3602 W E Voellinger baker 3604 J W Denson 3606 Fred Farley 150 198 200 201 Wesley Adams Burley Croom gro Peachtree begins Mary E Day Flay Croom INGLESIDEAV (Ingleside) -- From Ridge av east to Vista Circle 3608 Mrs I D Reeves 202 R B Lavender INVERNESS AV -- 3611 L M Hamlin 203 N H Lyles From Hill Crest av 3704 Vacant 204 Paul Rice west of city limits to 3705 Jones & Head gro O C Mixon Montpelier 3707 R F McWilliams 206 Paul Rice 101 W B Orr 3708 Vacant 3710 J L Wallace 3800 W T Steed 3802 Vacant 3803 F R Aids 207 Dock Arnold 208 Mrs Mary Fullan 209 Mrs Linda Heath 210 Mrs Lizzie Wood 211 J E Wilson 103 T M Ezell 109 J S Gibson 110 R Y Sherwood 111 E C Kent 113 B A Joiner 3805 O L Harris 3808 G A May 3809 R J Dupree 212 Edw Day 115 Simon Moore 213 Claud Combs 118 T L Wallers 214 Mrs Hattie Hunni- 119 R B Bonner 3810 E R Bragg 3811 T E Turner 3900 Lucius Loverett 3901 J H Pinson 3902 Vacant 3909 A B Henry HOUSTON HD (S H)-- Continuation of Houston av cutt 120 E G Higgison 216 J F Hood J M Clance 218 Albert Blackshear 220 Raymond Sum- 121 Vacant 122 Mrs Mary Holmes mers 222 John Ryle 226 Mrs Bertha app 123 Vacant 125 Vacant 228 Mrs Willie Brower JACKSON -- From 230 Mrs Leola Barker Maple at junction of HUDSON (P H)--From Green to Wise av 2 w of Madison 232 Jesse Kite 242 Jas T Ryle 246 Mrs Eldora Long H O Allen Oglethorpe to limits 212 Henry Yeouman 214 Mrs Ella Wilson 217 Wm M Garrett HUDSON'S AL --From 153 Green east to Gustin av 250 W L Griffin 254 Mrs N Hawthorne R A Akridge 256 Robt Carr 218 (232) W E C-arrett 223 Vacant 227 Vacant '232 Mrs Minnie Lang- HUGUENIN AV (H H) 258 Mrs Emma Wil- ford --From Napier av s liams 234 Geo T Barentine to Beech 304 Dewitt McCrary 235 Vacant 101 Vacant 318 Mrs L A Mercer 239 Vacant Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the banks of the world Contains Condensed Statements o{ AH Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking r Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L POLK 1068 Jackson MACON Johnson S M) 241 Robt Walker JAMES -- From Log JEFFERSON -- From 243 Fannie Billingslea Cabin dr south 1 w College w to limits 1 Hazel Highland av n of Georgia av 314 Jas Kelly gro 315 Edw Cody 316 F J Smith soft drinks 317 Chas Cochran JASAMINE (W If) -- From Oakland av w 1 n of Belmont av 380 P J Meek 111 B R Chestney W T Johnson 122 Vacant 123 Mrs Kate B Mun- ford 318 Walter Andrews 319 Sami Richardson 320 Jas Davis 321 Sami Culpepper 325 Geo Davis 327 Jas Shinholster 329 Ida Riggins 330 Emma Miller soft drinks 331 Trent Cornelius 332 Wm Lee 336 Edw Taylor 338 Vacant Ash 400 Chas O'Neal 410 John S Raley 414 A .M Arnold 418 H C Kenny 420 W R Bittick 411 Mrs E L Jackson JEFF DAVIS (S M)-- Continnation of 1 elfair from Anderson southwest 99 Homer Jones 101 Vacant 102 R D Wilkinson 103 O N Croom 106 C E Littlefield 158 R D Dunn 159 Rev J R Hunt 160 S M McGrady 162 Mrs Annie Hayden Plant begins 203 Rev J A Sconyers 206 C J Anderson 209 Leo Deas 215 Z A Bray Williams 129 Mrs B N Proudfit 139 O P Willingham jr 140 John Wimbush 143 J G Ruan Madison 214 Victoria Johnson 215 Thomas Nelson 216 Alex Field 217 Green Cannida 218 Martha Pingston 222 Herman Davis 224 Wm Johnson 227 Bertha Johnson 228 Annie Laney 229 Geo McBride A P Cunningham 230 Jos Griffin 233 Abr Smith 234 Oliver Benford 413 E R Brantley 228 G F Gilleland 235 R L Smith 417 J G Miller 239 D P Ray 238 C R Sanford 421 L A Miller 240 J F Kent 239 H E King 426 Grady Belcher 241 W A Brown 242 Ophelia Russell 430 W M Horne 242 H C Gordin Monroe 431 Vacant 253 E L Jones 439 R H Millirons 246 Mrs E L Fendt JENKINS (S M)--From 443 J F Jackson 248 Vacant 2120 Second west 505 C 0 Tucker Elm 249 Westminster Presby Church 118 S C Gilmore Third 514 Mr3 Mattie Noltee 515 M H Hollings- worth 250 Ernest C Walton 251 H D Addleton Tenney av begins 215 E L Malone 218 W R Higgison Cedar 523 Frank McGinnis 252 W T Baker 302 J T Dix 525 Mrs Ida Johnson 254 J A Lowe 305 Mrs Leila Cox Mrs Alma Beasley 256 Benj Lindsey 309 -Chas Crawley 521 O W Hill 257 W D Thomas 315 C S Mullins 534 J A Monroe 258 G C Toole 322 Mrs Sadie Snyder 538 Thomas Stokes 260 W H Middlebrooks 324 W R Evans 542 J P McCardel 311 O F Byington Edgewood ay 323 R C Morrow JOHNSON (S M)--From 329 Paul Middlebrooks Idgewood av to JACKSON (E M) -- 337 Mrs Jennie Stap- Prince 2 s of College Changed to Cowan ley 104 Rosa Jackson 345 J S Sweeney 125 Vacant JACKSON (V)--Chang- 407 A B Shepard 131 Vacant ed to Sycamore 414 C A Hanner 208 Robt Scarvey &C0. Polk DirectoryBldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4V O- tfi iinf Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 Dim 1074 McGhee (C P) MACON Magee Av (S M) as a McGHEE (C P)--From 153 Troy Nelms Forsyth rd n 2 w of 154 Jos Bryant 310 Josephine Calhoun MET Park av 155 Henry Bailey 103 J Claude Thames 158 Ruth Smith 312 Wm Solomon 313 Henry Brown 105 P S Crambes 160 Sidney Holston 315 A L Smith 107 A B Jobson Jones 316 Fred Warren Gustin av begins 317 Jas Mooney PUCE McGrath (s m) -- ne cor Riverside Ceme- 318 Jas Lockhart From Edge-wood av tery 320 Sou Negro Singers THE south to Bright 1 w 204 Marinda Williams of 2d 206 W P Hutchings Chorus Henry Gardner DIRECTORY IS THE GREATEST MARKET McKAY'S AL -- From 520 Ash south to 528 Elm McKENNA AL -- From 819 4th west to 3d McLEAN AL--From 717 1st to New 210 Georgia Hunter 207 Callie Willis 209 Rube Wallace 211 Jessie E Wilson 212 Danl Corbin 213 J A Ray 214 Rev T A Thomp- son 215 T K Persley 217 Wm Brown 222 Carrie Brown 325 Wm Balkcom 328 Henry Rouse 329 S M Gantt 330 Essie Sweet 332 Lester Hamilton 334 Courtney Blash 335 Lizzie Cornelious 337 Wm Davis 338 Willie Cornelious 340 Mary Searcy PLACE 228 Henry Williams 321 Emma Howard 224 R S Smith 226 Edw 6'immons 341 Geo Harvey 342 Lee Howard ffl THE WORLD * Every Day MACELR0Y--4 miles w of Court House on Forsyth rd MACON AV--From Log Cabin Blvd south 1 w of Bailey av 228 Patience Brown 230 Henry Taylor 247 Ga Academy for the Blind 254 Eug Easter 256 Lula Warfield 258 Henry Cornelius 260 Daisy Leach 352 Emmitt Faulk 354 Alex Lake 355 Donnie Fluellen 356 Sallie Ross 357 Ellis Sikes 358 W H Horne 361 Homer Jones 367 John Jackson in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year MADDEN AV -- From 616 Montpelier av s to Jasamine 102 J D Kendall 104 G H Preston 105 J G Shepherd 106 J W Burnham 107 J W Strickland 108 C E Chandler 109 J W Johnson 110 Dennis Burke 111 E W Tipton 112 C F Smith 115 Mrs Ada Davis 117 E A Graham 119 O D Seaborn 121 P N Coley 123 D B Perry 125 H C Perry 261 T A Ashton 262 Aurora Hicks Green begins 263 Jackson Finney 264 Ed-fl Wimberly 266 Wn_ Hargrove 269 Benj Harley 270 Benj Hughes 272 Lovie Hughes 274 Wm Felps 275 Wm Davis 276 Robt White 278 Lulu Jenkins 280 Sarah Henderson 282 Chas Holloman Woodliff 302 W J Grier 304 Witt Kissie 305 Lewis Bond 306 Etta Floyd 371 W R Robinson 375 Till Holmes 377 Eug Hall 382 Grace Woolfolk 383 Grace White 385 Nancy McKinney 389 Robt Muse 393 Boisy Nixon Second av 405 Lizzie Warren 411 C B Hill 413 H M Rutherford 423 Wm Scott 425 Wm Sparks 427 Cleveland Hollins 428 David White429 Fannie Bailey 430 Louis White 441 Eliz Keating Jefferson MADISON--From Rose 307 St Mark's P E MAGEE AY (S M)~ Hill Cemetery s to Church From Heard av s to Georgia av 8 w of 2d 308 Ralph Bembry Lymoore av 1 e of PUBLISHERS 152 Wm Risby 309 N M Everett gro Houston av PoIkDirecbmE DETROIT A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 % CHERRY ST. TELEPHONE 2391 Magnolia STREET GUIDE Main (E M) 1075 MAGNOLIA -- From 216 Mrs L F Reynolds 248 L R Hatfield gro junction of Spring 220 J W Cannon Elliott begins and Cherry w to Col- 222 R S Matthews 264 J W Turner lege 7 s to river College 266 Vacant 104 Mrs Rose Genone Maurice Mooney 108 L B Brooks Mrs M J Bailey 110 D W Jeter 114 L G Cusson 116 Raleigh Black- welder B B Fairman 120 Vacant 121 Mrs G L Benton 122 D F Holsenbeck A L Hutchison 123 J L Breen H P Wilson 129 J L Brooks 130 H T Lane 134 W D Jarratt 137 R J Laster 140 T V Fagan 142 Vacant 143 S L Carter 144 Mrs Lizzie Maddox 146 Georgia Stephens 149 W C Turlington 153 F L Collins MAGNOLIA LANE -- From Orange to intersection of Cherry at Nisbet pi 5 Evana Glover 6 Eliz McCormick 7 Lou Burton 8-9 Fannie Hodge 10 Fannie Smith 14 Bessie Brown 15 King Barber 16 Minnie Jones 24 Lizzie Curry 25 Katie Lorance 112 Odessa Clark 113 Eliz Jones 150 Eliz Bryant 201 Wm Henry 202 Ned King 205 Mattie Bradley 227 Taylor Fletcher 301 Geo Thomas 552 Mary Cook 554 Silas Smith 557 Jesse Dumas J P Willingham MAIN (E M)--Princi- 156 Frank Chambers pal thoroughfare east 157 J H Hughes from river 161 W B Brooks 123 W E Boardley 162 Mrs M E Culver 125 Vacant 165 Mrs E E McWil- 130 W T Watts 268 J W Woodall drugs 268% Vacant 270 Josephine Sicu- rella 280 Texas Filling Sta 282 W E Hamlin Flanders 301 H B Byrd 302 W J Gruhn gro 303 Lem Matthews 304 East Macon Pack- ing Co 306-8 Dixie Roll & Cot Co 311 J H Simmone 312 Acme Furniture Co 316 A J Stalworth barber 317 Max Keefer 318 Geo Stefano Fla Fish & Oyster Co 319 (325) Jos Hightower 320 Hollemans Pharm 325 Wm Wilson 326 Barkers Bakery 327 W A Spiller 328 Georgia Grocery No 6 liams Water 332 Rogers Grocery 166 PM Crossley 167 J I Beck R E Spearman 171 L H Short 172 M L Southwell 175 I E McKellar 178 R~ M Glenn 181 J T Dent 182 Macon Water Works Shop 185 Louis Cohen 189 Mrs L B Hose 190 J W Hawkins 193 Mrs I M Arm- strong 198 L A Massey Frank Thomas Orange 202 Vacant 203 G M Keeling 206 U D Tracy 207 Geo Loyd 208 Vacant 214 Elmer Wood 218 Mrs Clara Travey 224 Mrs Louise Harp 234 W M Scrivner gro 235-65 Bibb Mfg Co Plant No 1 236 N T Isaf shoemkr Elm ends 244 W U Tel Co br 246 Budrow Thompson barber rear Sol Sanford clo clnr 336 DeWitt McCrary Drug Co 340 H A Kennington genl mdse Clinton 403 J W Hunnieutt 405 R L Butler 406 Vacant 407 M M Booth 408-10 Fuller's Garage 409 J H Nasworthy 411 John Spikes 416 J L Johnson 426 W J Brewer barber rear Hattie Hawkins 428 M A Byrd Hydrola DRESS IN STYLE DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 CUJJCJ u--BIIS More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. < d 1076 Main (E M) MACON Manchester Qtrs (V) 503 J A Grffin 804 R C Evers 3 Aaron Reese 509 G W Harden 805 Thos Jabo 103 Stinsonville Sch 513 Chas Matthews 807 W M Harris 105 J A Brooks 521 Henry Elton 811 J G Morrison 107 Leila Johnson 551 H D Howell 811% J G Morrison 109 Florence Ray Garden 553 Mrs Emma Webster gro 813 H C Chambliss 815 J T Glance 818 Fannie Couch 111 Fannie 6'tinson 113 Eliza Gaston rear Grant Johnson 115 Stinsonville A M 559 W D Smith 820 A N Sanders E Ch I IS H gU 3| Cutter's al begins 600 Jos Davis 601 Child Welfare Council 602 J H Bishop 604 J D Thompson 605 Thos McConnell 606 J H Holt 607 B T McConnell gro W H Cannon 607% Woodmen of the World Camp 608 J A Mallard 609 Masonic Lodge 612 C D Brown 614 J B Nundorfer 618 Leroy Tyson 622 Mrs S J Neel 623 J W Ford 624 J M Day 625 Jos Batson 627 Frank Watson 628 G L Wasner Fort Hill begins 629 W P Whitten 701 0 R Tharpe gro 703 O R Tharpe 704 C W Schaefer 708 W L Cranford 709 E D Burnett 711 F H Meyer 712 T H Williamson 713 Chas Maxwell 716 E C Haddock 717 W A Barrentine 718 L S Hill photog 822 G A Cook 823 J T Wood jr 825 W S Manderson 826 B W Patterson 827 J A Liles 828 W C Liles gro 830 J F Thornton 835 W T Harrison 837 J E Kitchens rear West Braswell 839 Jas Ross 841 Homer Anderson 843 Annie Franks Norris 900 C C Turner Short 1000 Eug Rice gro 1002 Thos Russell 1004 Janie Smith 1006 Joshua Lundy 1008 Ernest Williams 1010 W F Hall gro 1012 Thos Sidwell 1014 J S Gray 1016 David Lingo 1018 Richmond Calhoun 1020 W E Brown 1022 J A Aaron 1024 Arminta Rogers 1026 T J Jackson gro 1028 Dunlap Hill Fill Sta Broad ends 1106 W T Burke gro 1108 Manuel McCraw 1110 Vacant 1112 Chas Edwards MALLOY'S ALLEY -- From 420 Ash to 453 Elm MANCHESTER QTRS (V)--Bet C of Ga Ry and Yineville av e of Oak Haven av 1 Sami Roberts 2 C C Fambro 3 D H Arrington 4 H J Partain 5 T E Glass 6 Oscar Moore 7 J H Arrington 8 O T Shaw 9 C C Collins 10 W A Summer 11 J C Carter 12 Sarah Battle 13 Maggie Cox 14 W J Ward 15 S F Mailey 16 Chas Cochran 17 Geo James 18-19 Chas James 20 II L Cochran 21 J T Hammett 22 Cretia Rose 23 Louis A Williams 24 J W Potter 25 Carrie Radford 26 C S Nelson 27 E J House 28 J W Minton 29 T M Moore 30 Lee Stevens 721 Mrs M E Kelly MAIN (Stinsonville) -- 31 Mrs Delia Priest ^ c/j 5? m S(-r,, a* wsha*hsw Fail-view 722 M W Cowan 724 H F Woodall Maynard Main thoroughfare beginning % blk n of end Auburn av and running west through the settlement 32 J J Hutto 33 P E Tripp 34 Texas Oxley 35 W T Adams 36 L L Long JOotnUaascn 801 C B Washburn 803 H F Woodall gro 1 Chas Johnson 2 John Howard 37 H D McSwain 38 Mrs Fannie Napier DU 2 < < Merritt Coal & Wood Co. B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET Manchester Qtrs (V) STREET GUIDE May 1077 39 Louise Jackson J P Hurst MASONIC HOME RD-- 40 Mary Giles 16 W M Lawson From Boulevard (N 41 C L House 20 C M Trawick H) northwest MAPLE -- From Ogle- 25 A P Herin 32 J H Carelock 105 Mrs M M McCabe 107 J H Lowe thorpe nw and w to 33 T A Hadden 254 W L Waters Ross, 1 s of Orange Highland ay ends 117 R J Cooper Latta pi ends Oglethorpe 119 C C Leverett R D Dixon Cole 40 Mrs Emma Freeman 41 Mrs Millie Price 44 P J Smith 49 A G Fowler 56 F H Riley 57 C M Atwater 281 W G Robarts 285 Leonard J Kendall1 287 Mrs E L Lawson 290 S E Patton MASSEE LANE--From Turpin south, 1 w of Sou Ry 202 A J Ryals MARSHALL AV (C P) 12 Mamie Thornton 204 H W Beall --From Forsyth rd 26 Carrie Winters Jos Stubbs north to Ridge av, 2 41 Mamie Vinson 252 Clinton Hollomon w of Park av 43 Wm Thomas 258 H E Gunn 103 Vacant 44 Elijah McGee 261 J R Burnett 104 K F Dunlap 45 Savannah Newton 266 Home for the 105 T J Copeland 46 Geo Thomas Friendless 267 W W Weaver 268 J J LaTaste 269 Mrs M L Brooks 270 Wm W Doles Calhoun begins Park Place 317 W R Sapp 318 Henry Clay 319 L M Spillers 320 Willie Anderson 322 Oscar Redding 325 R E Williams 326 Henrietta Simpson 331 Jordan Ussery 335 Allen West 336 Jennie Stokes 337 Harrison Mitchell MARTHA (E M)--From 120 Powell west, 1 n of Arlington 305 Lula Carline 450 Spencer Humphries 451 E H Miles 452 Calvin Gardard Obie Life soft drinks 455 Mattie Davis 457 John Stone 501 Randolph Clowers 508 Emery Hightower 510 Israel Wright 512 Frank Pearson MARY -- Changed to 47 Wm Jenkins 48 John Nixon 100 Mary Anderson 101 Wm (Smith 102 Sonny Mann 103 Mamie Robinson 105 Marshall Hard- wick 206 Rody Howard 228 Speer Perry 293 Henry Lee 297 Minnie Jordan -549 Janie Foster MASSEY (E C R) -- From Fourteenth w to Seventh, 1 s of Pine 338 Clarence Thomas 339 Arth Sanders 341 Fort Carver 354 Vacant 357 Julius Adams 363 Jeanie Winbrew 366 Mary Williams 368 Maggie Dudley 370 Mary Nelson Prince MAY (Unionville) -- MASON (S M)--From From Pio Nono av Enterprise s to lim- east, 2 s of Columbus its, 8 e of Broadway 104 Peter Telfair 103 (15) Anderson 105 Matthew Dubose Proctor 106 Oscar Brown 110 Danl Waters 107 Henry Williams 201 (333) Lucius 108 Belle Marshall Ringwood 110 Carrie Mathews MARION PLACE (W 300 (7) Marshall Mill- 111 Hattie Stephens H) -- Montpelier av irons 112 Janie Franklin south, 1 e of Oakland 302 (304) John 115 (111) Dock Freeny av Holmes 117 (114) Ella 9 Roscoe Stall- 304 (240) Dock Dob- Thomas worth bins 119 (115) Henry 14 S H Kays 306 Robt Jackson Simmons 317-319 Third St. Automobile owners are select prosjjects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy It. L. POLK & CO., DETROIT, MICH. MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1078 May Av (W H) MACON Middle (E M) MAY AV (W H)--From 510 Ned Wiggins 33 Vacant Columbus rd s, 2 w of 511 Mila Nelson 34 C F Tomlin Plo Nono ay 512 Geo Mays 35 D E Russell 338 Danl Boyd 516 W G Glover 36 T R Owen 407 Wm Brown 519 Essie Boatwright 37 Mrs Eliz Davis 409 Chas Bray 411 Lillie Varner 520 Robt McCaff 521 Eug Hutchins 3387yJ2 C L L Meeks Bentley 413 (12) Albert Ran- 524 Walter Harris 39 E F Trawick dolph 526 Hodge Bryant 308 L L Smith 415 Ora Hurston 527 Nathan Ridley 417 Frank Hollaman 529 Sally Early MELROSE (E M) -- 462 Henrietta Hawkins 464 Son Porter 470 Vacant 480 Geo Rutledge 484 John Rutland 486 Bettie Rouse 604 Rufus Thomas 606 Jos Higgins 608 Lewis Harper 610 Willie Walker 612 John Dunn 614 (339) Jas Watson 530 J H Fuller 531 Rachel Haddock 532 Geo Lawrence 535 Ellen Butler 536 Chas Etheridge 538 W A Sheppard 555 Jas Smith 557 Jas Smith gro 611 W N Pitts 613 Lizzie Thornton 615 Vacant 616 Alice Fulton 618 Chas McKay From junction of First and Washington north 260 Chas Finney 265 M J Miles 376 B W Sidney 378 Timothy Bennett 380 Cecelia Williams 381 J P Harris 385 Pearl Green 386 Robt Byrd 387 Sallie Hammett MAYNARD (E M) -- From 724 Main north to limits Broad 131 Jos Law 619 (622) Lawson Curtis 625 Thos Glover 701 Jos Carswell 703 (588) 6'ol Smith MERCER (Bellevue)-- From American Blvd south to Atlantic av, 1 e of Grand av 133 R T Byrd 705 (75) J H Solomon 302 H C Marshall Main 707 Sarrie Vickers 216 Alex Kitchens 791 (134) Edw Davis MERRITT AY -- From 220 F F Sims 800 Lewis Campbell Ridge av east (Mer* 222 E B Thigpen 801 (139) Sheppard ritt's Addition) 224 (51) J A Patter- Turner 122 L F Ham son 802 Wm Deshazar 124 L E Hall 226 (52) H L Leslie 228 (53) G T Sanders 291 (56) Benj Mixon 340 Alex Glover 342 John Hunt 344 Nancy Sharp 348 W H Hunt 352 Junior Durham 354 Murray Waters 356 Jas Stone 358 J N Pitts 403 Georgia Emely 491 (700) I C Rayford 803 (141) David 128 Vacant Pinckney 131 G W Pearson 810 (801) Chas Wil- liams MIDDLE (E M)--From 815 (143) Squire 316 Burnett east Richardson 875 (575) Wm Bow- man 877 (577) Lewis Ed- wards 897 (979) Sami Childs 899 (775) John Porter 950 Open Air School_ 5 Walter Bivins 115 Ebony Gainey 415 Connossie Howell 437 Lula Smith 448 Henry Williams 509 Primrose Hollis 527 Exbel Ferguson 528 Booker Carter 500 T L Benford MELROSE (Bellevue) 529 Sami Hightower 504 C E Benford --From Central of 534 Mack Cox 506 Wash Evans Ga Ry s to Bellevue 619 L M Holloman 507 Elnora Benford rd, 1 e of American 621 Grant Jennison 508 Andrew Pitts Blvd 622 Jos Dorsey 509 Vacant 28 W L Revell 623 Danl Weathers A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Macon Transfer & Storage Company HEAVY HAULING IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE Phone 4951 256 Second St. Middle (V) STREET GUIDE Mitchell (E M) 1079 MIDDLE (V) -- From 325 Perry Lewis 1140 Mrs Pearl Gear 123 Hardeman av n 333 Isaac Latimore 1141 J L Guerry 110 Vacant 336 Jas Cotton 1142 G W Cook 114 Coleman Evans 340 Henry Jackson 1143 J T Donaldson 115 J C Trawick gro 340% Felix Thomas 116 Wm Lockart shoemkr 119 J F Brown 342 Danl Mims rear Howard Lacy 1144 J B Johnston 1145 J T Cox VP ) 121 J W Travis 344 Moses Hill gro 1146 T C Ard 131 Annie Robinson 349 Alberta Porter 1148 C E Summers 135 T M Hatfield 375 W M Smith 1150 R G Stripling 136 Mattie Carswell 379 Sylvia Brown 1152 Ira L Martin 141 Tho.s Pierce 381 Brag Thurman 1154 Jas Kitchens 143 Lizzie Wilson 383 Geo Grant 1155 Belle Massey 145 Mary Myers 1156 J G Brantley 146 Mariah Audley MIKADO AV --From 1161 I W Thompson 148 Geo Moore Grady south to Davis, 1163 J C Horne 150 Jas Jason 1 e of Houston av, 1165 J W Leslie 153 Mamie Jordan Mikado Place 1194 M P Wilson 154 Raymond Mills 202 L A Dix 155 Virginia McComb 203 Mrs L M Denson MINDOK (Tf H)--From 156 Sami Tapley 204 W E Flowers First av west to Pio 158 T A Lumpkin 205 C S Lyons Nono av 159 John Malone 204 Milton Spivey gro 206 Rev W M Shannon 208 Hector Toomer 209 Adeline Williams 210 Hattie iS'tarks 211 D D Lavender 214 Edw Warthen 215 Claud Spivey 216 E H Zeigler wood Cornelius Walker 221 Edw McWorter 225 Arth Walker 235 Wm Tharp 235% S Campbell confr 237 John Campbell 238 Lawson Fields 240 Edgar Green 242 Lois Benton 254 Jos Finney 255 Abetha Conigay 256 Alice Maynard 257 Dora Randle Third av 300 T C Smith 309 Rosa Johnson 310 Wm McEvoy 315 John Manning 316 Chas Martin 317 Vacant 320 Danl Walker 321 C J Lucas 208 Vacant 211 J W Boland 300 Mikado Baptist Church 301 J G Shinholser 303 Mrs J P Hutchings 305 C B Gruce 307 E W Gordon 309 O H King 311 J P Henderson 407 J L Smith 409 J B Jeffries 411 T A Shoupe 422 L F Durden 424 A F Durden 501 E W Campbell 505 J L Tidwell 509 G W Stokes 520 C B Dampier 601 R L Griffin MILLEDGEVILLE RD (E M)--Continuation of East Main 1114 Mrs Annie Tidwell 1120 W F Hadaway 1127 T J Rankin 1128 C L Edwards 1129 Elbert Hall 1132 J H Ticknor 1136 R F McCowen 1138 H S Gear 1139 A W Melton MITCHELL (E M) -- From Eeese along city limits to west side Clinton rd 3 D S Pinkston 5 Henry Price 102 Wm Jones 103 Sami Hightower 104 Vacant 106 Cecil Benton 107 Robt Thomas 108 Vacant 109 Wm Sanford 110 Jos Walton 112 Otis Wilson 135 Mary Murphy 136 Vacant 202 Anderson Evans 204 Jesse Walker 240 Bell Moss 242 Mary Stallworth 243 Sayles Williams 246 R J Ford 352 Benj Mack 401 (121) Wm Pitts 403 Vacant 405 Vennie Card 407 Soloman McCoy 451 (25) Jas Middle- brook 453 Vacant 455 Vacant MOVING STORAGE FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. Tv. POLK & CO. CHICAGO j POLK'S Dental Register OP THE UNITED STATES AND CANADA ms The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 1080 Mitchell (E M) MACON Monroe Hill (V D) 458 May O Edwards 332 Henry Thomas Macon Fire Dept 497 (28) Randall 333 A D Kendrick gro Pump Co No 2 Lowe gro 336 Jos Thomas gro Washington av 501 Sami Wiggins gro 337 Henry Ivey 505 Malinda Banks 502 Henry Johnson 339 Silas Holt 509 Milton Spivey 504 H E Bell gro 341 Ella Cornelius rear John Brown 542 G W Jackson 348 Danl Corbin restr 515 Claude Rogers 545 Mary Bland 352 Minnie Billinger 518 Mrs Alice Milkins 547 Sami Dinar 354 Robt Smith 519 J R Webb 552 Emma Watkins 554 Bessie Williams 602 Lind Davis 606 John Smith 608 Moses Brown 610 (500) Henry Reeves MITCHELL AL--From 452 Elm to 453 Linden 356 Sarah Bailey Fourth av begins 363 W L Mathis 367 Mark Raiford 368 Florine Griswold 369 E S Gray 370 L N Farrior 371 Laura Love 372 Edw Gordon 374 Rev W R Forbes 520 Vacant 522 J E Dellinger 523 T L Jackson 528 Lee Lain 530 J S Williams 531 Eliz Johnson 533 Rebecca Simmons 539 Wm Jones 543 Hattie Cook av 377 S E Piercy 552 J T Hall MITCHELL LANE (V) --From 924 Highland av west 379 Fred Brooks 380 Mary Walker 383 L A Elliott 384 A G Spencer 555 Julia Pruden 558 J H Evans 559 Lucy Dixon 561 Berry Clay MITCHELL LANE (E M) -- From Mitchell beyond limits, lb blk west of Fort Hill 1 Elijah Jones ~ 2 David Bland 3 Lena Hutchins 4 Sam Chappell 385 Carlton Jones gro 387 Carlton Jones Second av 403 Sami Black 407 R W Miller 408 Hattie Clayton 410 Ollie Ball 412 John Morris 562 P L Lain 563 Mattie Johnson 565 Geo Hightower 567 Jas Perkins 568 Mattie McCarty rear Wm Bailey 569 John Allen 414 Ernest Dobbs 571 Viola Gilchrist MOCCASIN SLIDE -- 415 Annie Humphries 573 Lucile Shannon From Fifth to Sixth, 416 Robt DeVaughn 578- Annie Brown bet Walnut and Oc- 417 Jordan Smith 582 Wm Allen mulgee 418 Chas Keith 586 Frank Johnson MONROE--From Wood- 419 Hudson Industrial Forsyth liff south to C of Ga School 609 Henrietta Bailey Ry, 9 w of Second 424 Oscar Shivers 611 Vacant 307 Twigs Oliphant 428 Katie Howell 613 John Glover 309 J H Adams 432 Mattie Cody 615 Robt Cary 311 Felix Jones 436 Missouri Williams 617 Vacant Fifth av 440 First Congl Ch 618 Alex Day 312 Sidney Smith 453 Mary Solton 619 John Jones 314 Susie Coleman 455 Frank Nelson rear Vacant 316 Palmer Lane 318 Scott Griffin 320 Ernest Jones 322 Richd Dent 467 B B Barksdale 475 L F Graddy Jefferson av Georgia av 624 Green Bryant 626 Donald McCary 630 Vacant 324 Alex Fulton Macon Fire Dept MONROE HILL (V D) 325 W L Matthews gro Auto Co No 2 --West side Gustin 326 Margt Gantt Macon Fire Dept av, 1M miles n of 327 Hoyt Edwards Chem Co No 2 Linden av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Montpelier Av (H H) STREET GUIDE Moore Av 1081 MONTPELIER AV (H 412y2 Bradfield Gro MOORE (E C R) -- H)--From Linden av Co From Fourteenth west, 1 s of Coleman 414 B M Elliott west to Seventh, 2 s av 415 Mrs Effie Cox of Pine 101 Standard Oil Co Oakland begins filling sta 416 Vacant MOORE AL--From 451 102 West End Mkt 417 T F Davis Spring east to New 103 J M Tucker 417 H P Stapleton 104 H C Lloyd 420 W W Sissons MOORE LANE --From 105 Vacant 427 Mrs Sallie Mc- Ocmulgee west to 106 Mrs M M Chambless 108 J C Holloway C W Williams 109 C B Drew 110 L J Whiddon 112 J H Webb Common Elizabeth begins 516 J P Hunnicutt gro 517 S F Billingslea 519 (518) T H Carlisle Virginia av 525 J L Saunders 526 J J Cheney Walnut, bet Spring and Franklin 100 Flemming Adams 101 Bud Stubbs 102 Vacant 103 Lenzo Lewis 104 Sunnie Johnson 113 C S Collins 527 J D Fordham 105 Mary Mathews 117 L W Rogers Co 528 C L Byrd 106 Evelina Bell gros 600 G C Meaders 107 Morris Howard Johnson av 604 W S Perry 108 Albert Stephens Bell av begins 606 Mrs M F Wilder 109 Vacant 200 Melton Gro Co 605 J F Denton 110 Frank Shorter 202 R L Clarke 203 J P O'Neal 204 A C Fogarty 205 (255) Virgil Mur- ray 206 W L Parker 208 Vacant 225 Virgil Murray Carling av 301 Mrs Minnie Strong 314 J M Cox filling 606 (608) H D Joynton 607 Chas Owen Madden av begins 608 H D Joynton 609 A G Reid 610 H J Groh 611 (609) J O Kelley 612 M F Leverette 614 Lester Tidwell 616 (608) C E Mathis 111 A L Jackson 112 Mabel Walker 113 Aaron Little 114 Josephine High- tower 116 John Sims 117 Vacant 118 Walter Chandler 119 Wm Brown 120 Robt Hickson sta 618 (610) F N Burch MOORE AV--From Jeff 316 Vacant 619 J M Draughon Davis av west, 1 s of 318 D A Barnes gro 620 (612) F F Abel Plant 319 Albert Munsch 629 R H Phillips 54 Stella Denton 320 A & P Tea Co 622 R L Miller 110 Kizzie Hamilton 321 Mrs L Holley Guy Mosley 623 W W Odom 112 Lee Nash 624 (616) J H Hensley 113 Mary Little Duncan 625 G T Stockbridge 400 W W Abel drugs 626 (618) J H Kidd 401 H L Jenkins rear Kidd & Taylor clo 402 W W Abel clnrs 403 J E Harrison 628 S H Morton 404 (410) E A Donnan 405 W C Edwards 406 (412) Chas Owens 408 (414) Vacant 410 Ernest Donnan 630 (622) Mrs Ida Abel 631 J C Godfree 632 C R Johnston 633 J C Godfree gro 115 Minnie Killens 116 Mary Richards 117 David Lightfoot 131 Annie Jackson 174 Narcissus Will- iams 175 Vacant 226 Emma Logan 233 Henry Mauldin 411 W M Durden 634 (626) H W Vol- 543 Lydia Lewis 412 R L Bradfield kens gro 555 Eunice McDonald Irsl Pi6-i7S FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO We Do It Right R P 0 L L U L M E B R I N & G M 1 H L E L A I T R I 0 N N G S BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1082 Morgan Av (WH) MACON Mulberry MORGAN AV (W H)-- 232 A. Margt Bartlett 452 L W Rogers Co From Edgewood av 232% John Moughon gros west to city limits, 1 315 John Freeman 452% L J Hancock s of Win ship 526 Mary Wade rms 221 Jos White 227 Calhoun Stewart 233 Perry Davis 239 Robt Gibson 248 Bettie Bailey 249 Wm Lowe MULBERRY -- From Seventh west to Spring, 1 n of Cherry 100 Macon Gro Co 101 Ella Oates 103 Alf Goodin 456 Sami Barnett dry gds 456% Isaac Fromshon optician 458 Isaac Morris dry gds 287 J H Shepard 105 Ella Robinson 460 D M Stewart rms 291 W R Warren The Stadium Oakland av ends 303 J G Herndon 304 W B Rainey 107 Mollie Parker 108 John E Flowers 109 Laura M Jackson 111 Carrie Martin Fifth av 462 McNelis & Bartlett jwlrs 462% F W G Bartlett 466 Quality Market 466% Vacant 313 H U Scruggs 388 O B Smith 397 H E Ragsdale 317 Sami Shuford 398 R L Hamlin C A Whitehurst MORRIS--From Indus- trial Home rd south MORRIS (E M)--From Fort Hill east 305 Vacant 307 Vacant 309 Vacant 311 Vacant 315 Hotel Macon 317 Vacant 350 Bibb County Jail Broadway 400-2 S E Evens dry gds 401 Cassidy's Garage 402% Vacant ne cor Federal Building Post Office Rooms: 228 U S Dist Ct Clk 231 U S Petit Jury Rm 234 U S Grand Jury Rm U S Comnr 236 U S Dist Court 246 U S Int Rev Serv 324-25 U S Dist Atty MOSELY--From Johnson W H e to Dempsey 404 Edw Miraglia gro 404% Sami Deeb 406 Fit Right Tailors 328 U S Weather Bureau 331-33 U S Marshal 110 Ned Liptrot 112 Felix Ballard 115 Fleming Howard 117 Vacant 172 Wm Brown MO UGH ON (V) -- North from 476 Third av 122 Crawford Evans 128 John Jordan 130 Newton Jackson 132 Carrie Smith 134 Isaac Brantly 208 Valdora Worthy 210 Jacob Bailey 218 Mary Etheridge 220 Jos Duval 221 John Taylor 407 Jas Cassidy restr 408-10 C Huhn & Son hdw 409 U-Driv-It System 411 Dayton Scale Co Remington Cash Register Co 412% J M Martin 414 Mulberry Mkt 415 Ideal Storage Service 416 Blue Front Lunch Room 418 N Cameriero gro 419 D M Kessler garage 420 Sanitary Mkt 422-24 Macon Shoe Shop & Army Store 334 U S P O Inspr Third 501 Stewart Oil Co 502 Palmetto Pharm 504 F C Davis phys Dixie Dental Lab H P Hansard den- tist W J Hamilton real est 506 Vacant 507 J S McCullough auto repr 508 Vacant 509 I O O F Hall 510 Plaza Hotel 511 Macon Ry & L Co trans dept 512 Am Barber Shop 223 Lillia Simmons 422% Union Trading 513 C B Arnold 224 Victoria Bostick Co 513% Vacant 225 Everett Dennis Alley 514 Edw Loh restr 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSIOfN DETROIT R- L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 45S7 Mulberry 516-22 Ga Casualty Bldg Odom Realty Co Rooms: 101 Washington Des- sau real est 102 Sam S Chandler & Co ins 103 Beneficial Loan Society 104 G S N G Armory 105 Vacant 107 Underwood Type- writer Co 109-10 Am Optical Co 201-6 United Am Life Ins Co 207 Fidelity Loan & Investment Co 208 Dick & Dick chiropractors 209 N Y Life Ins Co 210-13 Ga Casualty Co 214-18 Brock Sparks & Russell A E Gilmore jr lawyer L T Gillen lawyer 219-20 F F Herndon 301 C L Bartlett law- yer Alene Hardin law- yer 303 Vacant 304 Vacant 305 Geo Washington Life Ins Co 306 Ga Investment & Trust Co 307 Vacant 308 Franklin Life Ins Co 310 J C McAfee phys 311 Florida Real Est Co 312 Vacant 313 Higgison Const Co 314 Mrs V R Napier lawyer E A Ross office M R Ross office 315-17 Vacant 318 F B Mitchell phys Telephone 2687 STREET GUIDE 319-20 L C McAfee phys 401 Alex Blair archt 403 Vacant 404 Jeff Standard Life Ins Co 405 Vacant 406 E B Weatherly lawyer 407-8 W W Meri- weather phys 409 Macon Sand Co 411-13 T D Walker jr phys R S Muckenfuss phys 414 Vacant 415 Liggett & Myers whol tobacco 417 J D Carlisle law- yer E C Herring law- yer Arth Lewis lawyer 418 Vacant 419-20 Vacant 501-2 DeFore & Estes lawyers 505 Ernest Corn phys 506 T S Felder lawyer 508 C L Pennington phys J M Sigman phys 511 Vacant 512-13 Fuller Brush Co 513% E B Arnold 514 Sami Patterson pub acct 515-20 Coml Credit Co 601 Nye Odorless Cre- matory Co 604 Pearsons-Taft Co loans 606 Ga Kaolin Co clay products Morgan & Morgan Ins Agcy 608 Am Natl Ins Co 609-13 W S Dickey Clay Mfg Co Mulber1ry 1083 614-18 Hall Grice & Bloch lawyers J Y Roberts law- yer 619 C H Hall lawyer 620 Vacant 701 Vacant 704 W B Childs dentist 706 Haven Villa Corp real est 708 W L Thaggard acct 709 Bibb Lumber Co 710 Vacant 711-12 Vacant 713 B P O'Neal ofc 714 L D Moore lawyer 715-17 Strozier & Dea- ver lawyers B C Snow lawyer 719 W A Newman phys W A Williams phys J C Anderson phys 801-3 O P Beall ins New England Mut Life Ins Co 805 J E Wright phys R G Newton 805-7 M A Clark phys 808-9 S W R R Co Hardeman & Williams ins 811 H P Derry phys T E Blackshear phys I H Adams phys 813 Natl Acc & Health Ins Co Mann Bros ins 817 Vacant 818 R K Hines lawyer 819 Ellis & Glawson lawyers 901-2 T S Lowry jr ins Union Central Life Ins Co 905 W G Post phys J E Walker dentist 906 Vacant 907 E F Goodrun law- yer J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Your City Directory An&g^rs All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet R. L. POLK & Company LUMBER, SHINGLES, LATH I-H U P * Oh. cm Sen a t.t o * a J-SCO T3 H *> Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 10S4 Mulberry MACON Mulberry Oa Causally Bldg-- 554 Turner & Lyles 14 J P Burnett law- Contd restr yer 908 J M Cutler jr 556 W R & W B H H Sapp real est loans Holmes dentists 15 H F Strohecker 909 W L Bazemore Macon Dental lawyer phys Depot J L Lawton law- 910 E L Dans invest 911 J J McKay ins J 0 Gandy ins 913 Roush Brkge Co 914-17 Harris, Harris & Popper lawyers 918-19 Weaver & Craven lawyers 920 W T Johnson lawyer 1001-4 Ga-Carolina Lbr Co 1005-6 Penn Mut Life Ins Co Bagley Willet & Paine ins 1008 Harrold Bros Co ins 1009 Emory Winship Estate 1011 P O Holliday lawyer R W Moore lawyer 1012 A W Chaplin osteo 1014-17 C H Richardson jr phys T E Rogers phys H G Weaver phys 1019 Benj Bashinski phys Street continued 517 Alex Kell shoemkr 517% Mrs Etta Gam- mage 519 Sam Lee lndry Harry Spivey tailor 557 Birch Ins Agcy 558 Palace Barber Shop Liberty Pressing Club 559 J B Hart & Bro undertkrs Macon Mut Burial Assn 560 McClure Office Equipt Co 560% Vacant 561 G C Amerson contr W H Jordan plmbr 561% Vacant 562 E C Olmstead printer 563 G G Hardeman Co real est 563% Macon Retail Food Dealers Inti Corres Schls H D Cutter civ eng 564 Vacant 566 Washington Bldg 1 J M Hancock lawyer J E Horne lawyer 2 Gillon & Ohurch- well lawyers 3 T J Cochran law- yer Rooms: J A Monsees lawyer P J Nelson lawyer yer 16-22 Vacant 24-28 Vacant 29 E L Gostin civ eng 30 Vacant Street continued 565 City Realty Co Mrs E T Park real est U S Mtge & Tr Co Calvert Mtge Co Ray Irby plmbr N Y Life Ins Co H F Rutland law- yer 567 K of C Hall 568 Sanitary Barber Shop Sanitary Pressing Club 569 A T Holt Co real est 571 L A Jones tailor 572 H H Harris shoe repr 574 Chapman's Pharm Second nw cor Court House (For occupants see 2d nw cor Mulberry) 610 Southern Land Co Rivoli Improv Co Dure & Beeks Co ins Leon S Dure Co Nevaro Apts Co Realty Inv Co 519% Vacant 521 Ideal Supply Co plmbrs supplies 523 Hatcher-Turpin 4 Vacant 5 Vacant 6 Vacant 7 Vacant 612Ga F & A M Grand Council of Ga R & S M Co real est 525 Hotel Lanier 8 W A McClellan lawyer Grand Chapter R A M Hotel Lanier Ci- 9. Vacant 613- gar Stand 552 Vacant 10 T A Jacobs jr lawyer auto supplies 616 Pythian Castle 552% Eagle Hotel 12-13 Vacant Ga.-AJa Bus Coll More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% Gn Savings Mulberry STREET GUIDE Mulberry 1085 617 The Grand Bldg 506-7 U S Veterans' 753 Mrs M J Smith Grand Theatre Bureau 756 Vacant Sou Bldg Sup Co 508-10 Life Ins Co of 757 W P Fleming Artope Monu- Virginia 759 Vacant mental Wks Rooms: 201 Vacant 202-4 Vacant 205 WD Lamar office 206-8 J L King phys A R Rozar phys 209-10 O F Keen phys C H Walker phys 211-12 Vacant 213-14 Vacant 215 Vacant 301 Vacant 302 J W Slinsholser 303 J N Talley lawyer U S Referee in Bankruptcy 305 Chas Cork lawyer 306 J N Napier office 307 John Malloch & Co cotton 308 J C Butts C S practnr J P Snelling C S prastnr 309 Vacant 310 A H Heyward law- yer 311-12 B B Renitz lawyer 313 -15 Vacant 314-16 W C Pumpelly phys 401 Vacant 402-6 Herbert Respess phys T H Hall phys J A Fountain phys 407-9 Vacant 410 Christian Science Reading Room 411-12 Am Red Cross 413 E J Arnold 414-15 Vacant 416 Vacant 501 F J Bishop contr H C Bishop typewriters 502-3 S B Palmer phys 504-5 Carolina Life Ins Co 511-12 Wallace & Wallace lawyers 513 Macon Academy Music Co 514 C W Shelverton archt 601 McCowen & McCowen coins 602-3 Vacant 604 N T Carswell phys 605-7 Vacant 609 Vacant 610-11 J L Holcombe acct 612-13 Interstate Life & Acct Ins Co 614 F Y Harrington phys J B Ward phys U S Insecticide Bureau Street continued 619 Vacant 620 Vacant 652 Vacant 654 Burroughs Adding Mach Co 658 J T Oliphant med- icine mfr O C Gibson phys 663 Hotel Arcadia 667 Mrs Avey Barnes 669 Calna Nolan 670 First Presb Ch 671 Vacant 673 Mrs Mary Bell ne cor Mulberry Street Meth Ch 702 T J Carling 710 Masivic Club Zerbal Lodge of Perfection 716 M N Gans J W Burch 717 Rev Walter Anthony 718 O J Coney 720 Mrs E Cranford 722 Mrs Mary Bell 761 Mrs F M Poland 765 Mrs A M Fulling- ton 768 Mrs Fornnie Tay- lor 769 J J Branan 774 W E Mobley New 802 Mrs Fannie Bigby 804 W F Dannenberg 805 Idabelle Porter 810 Alex Block 814 Progress Club 817 R E Wallace 821 Mrs S Q Chiles bdg 855 Katherine Court Apartments Apartments: 100 Abe Lesser 101 L M Rosen 102 Albert Fisher 103 J W Rawls 104 Mrs E M League 105 Vacant 106 Mrs Martha Hixon 107 Mrs Ida Corbett 200 W C Long 201 V O Davis 202 Mrs Anna Powell 203 Vacant 204 Vacant 205 Ray Carter 300 Eli Elkan 301 J H Freid 302 P A McArthur 303 W E Kennedy H E Burson 400 E A Traver 401 L B Thompson 402 Mrs L M Means 403 Vacant 404 Mrs Anna Powell 405 Vacant Street continued 856 Mrs K M Rober- son 860 Sami Guthman 864 J A Cox FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS , -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, 111. 1086 Mulberry MACON Napier Av (N H) 865 G C Almand 225 V B Jones 130 Vacant J W Randall 227 H Williams 131 M R Baer 866 Steph Popper 236 (136) J H Bras- 134 J W Calaway 867 S M Wrigiu well 135 J E Sires 868 C E Crawley 245 (217) L Searcy W J Snyder 869 Roy Washington 314 Geo Howard Holt av 869% H T Harris 316 Lillie Garthan 200 H F Roller 871 Mrs E R Bennett 348 (318) Guy Taylor 202 H G Atkins 873 J P Haffy 352 Zack Hill 204 Vacant A C Henderson 354 (322) Kate Rob- 206 Vacant F R O'Quinn ertson 208 J E Deas MULBERRY LAN E-- From Sixth to Seventh bet Mulberry and Walnut MURRAY AL -- From 752 Third east to 723 Fourth MUTUAL AY (Y) -- From Forest av west, 2 n of Highland av 100 Arth Threatt 101 Hattie Davis 102 Amos Hurley 103 (123) M Holmes 105 (107) A Lawrence 106 E Redding 119 Vacant 129 Clarke Threatt 131 (105) Dinah Fam- bro 133 (111) V B Doug- lass 135 (115) J Griggs jr 137 (121) Louise Califf 139 (119) Darnie Thompson 143 (133) Robt Pat- rick 203 (303) Arth Lock- ett 204 (104) Della Hill 205 (226) E V Wells 456 (133) Pomp Walker MYRTLE (E M)--From 105 Balkcon av to Hydrola, 1 s of Main 2 (11) Carlton Langford 5 Mattie Childers 6 Harmon Jenkins Mrs F B Burns 8 C S Cain 9 H B Holton 101 Walter Thomas 105 (99) Mattie Atwell gro MYRTLE (S M)--From 3308 Houston av west 115 W P Owens 121 W L Ketchie 123 Kail Head 125 Archie Watts NAPIER AY (N H)-- From Coleman av west to Inverness av and city limits 106 E C Jones 107 D P Wyatt 108 W N Jones 109 Mrs A G Williams 110 W E Dixon 111 H C Andersen 113 Cherokee Filling Sta E Vine begins Blackman 301 Napierian Apts Apartments: 1 E L Gostin 2 J J Flahive 3 Norwood Jones 4 J T Wages 5 Mrs M E Jones Street continued 306 E P Cook 311 F J Bishop 312 Mrs L B Johnston 318 J E Taylor 324 R E Tomlinson 330 O L Ellis 336 L A Walker Virginia av 401 C M Nutting 403 J S Strozier 404 G A Kennington 405 W P Gaillard 406 J H Cary 407 Mrs Aurelia Breedlove 410 Vacant 412 Vacant 414 A S Mason 461 C T Darnell 463 T C Hunt 464 L E Schwartz 465 J J Chambers 467 A B Allen 501 H F Ahearn 503 Mrs Sarah Martin 505 S B Fielding 207 (224) F C Smith 114 R J Domingoes 507 Mrs M E Morgan 218 (18) Lavina La- 115 H E Turner drugs 511 W B Birch mar 116 J C Smith 513 S E Odom 220 Tabernacle Bap- 122 Mrs E A Vandiver 514 B F Merritt tist Ch 124 A B Coe 515 Louis Snyder 221 Nathan Evans 126 H S Lamb R L Scott 223 (213) Chas Mor- 128 Mrs A E Driggars 516 Alex Blair ris 129 T F Davis 517 B J Dasher E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS-TRUCKS Fordsorvilf it's a Ford -TRACTORS hfoarve ait.Ford, or we JONES MOTOR COMPANY 557-559 PLUM ST. Napier Av STREET GUIDE Nelson (S H) 1087 518 C W Johnson 930 College Hill Gro NEAL AV (V)--West 600 Pasco Palmer No 2 from Forest av 3 n 601 L M Cox 940 Atlantic & Pacific of Highland av 659 W A Roush Tea Co 660 B R Truesdel 1001 J L Anderson 662 J W Renfroe 1002 Vacant 663 G W Hubbel 1003 (1217) Vacant 664 P W Stripling 666 G S Goodyear 668 C A Odom 1004 J L Shivers 1005 J M Britt 1006 Mrs T M Dean 670 Cherokee Hts 1008 Mrs Kate Wads- Meth Ch worth 685 A B Moore 1017 Mrs Anna Rachels Pio Nono av gro 701 E G Benford A C Rachels 702 Vacant 1024 Mrs Cora Nobles 704 J C Walker 1101 (604) J L Ander- 705 W F Elder son 706 C R Fountain 708 Louis Langley 1102 J P Plunkett 1103 Thos Maynard 101 Vacant 104 Vacant 105 Lou Perkins 106 Julius Armstrong 113 Riley Wright 115 H W Lucas 129 (329) Frank How- ard 131 (331) W L Banks 133 (300) Sami Jones 136 Virginia Brigham 138 (374) Wm Balk- corn 140 (375) Arth Brown 147 Jos Brown 151 (152) Edw Will- iams 710 F C Grimsley 711 L A Shepherd 714 C H Megrath 715 J M Sigman 716 F S Cater 720 C H Parker 722 W L Chandler 724 Mrs M McCowen 726 J C Estes 728 Mamie Holt 730 Rev H S Allen Hillyer av 802 G S Burnette 804 J E Macken 806 S Schwartz Courtiand av 808 R L Hanberry 1104 Vacant 1108 A D Johnson 1109 Vacant 1114 Mrs Lillie Sanders 1120 Thos Maynard 1150 R E Clark cement products 1155 O G Grant 1157 W H Rossman 1159 E L Biggerstaff 1161 Vacant 1217 A C Rachels 1224 Mrs Mittie McCol- lum 1225 J H Hollingsworth 1236 Mary Vaughner 153 (100) Sami Howard 184 (84) Abner Anderson 190 (330) Ananias Peterson Street continued 192 (333) John Hughes 194 (335) Vacant 200 (305) John Young 202 Vacant 204 (135) W M Pitts 223 Edw Atkins 225 Irvin Dixon 227 Thos Smothers 809 J S Schofield jr 810 S J Baker 811 Mrs M A Harris 812 R A Clark 814 R B Cowan Eighth av begins 901 J C Page 903 J N Bennor 906 J J Higgison 908 H F Northington 910 W M Collins 911 A R Moore 912 S C Kimbrew 914 Grady Smith 925 Grady Gillon 920 Donimgos Phar- macy NAPIER AV E (H H)-- From junction Vine and Napier av west to Holt av 501 Rogers Grocery br 503 Georgia Grocery br 505 Atlantic & Pacific Tea Co 507 (501) W E Andrews 509 (505) O C Stubbs 511 (507) E L Moore 513 (509) J A Rey- nolds 517 (513) H L Batts NELSON (S H) -- East from 2834 Houston av to Waterville rd 100 G F Hill 101 Mrs Annie Hunnicutt 102 E L Burke 103 Mrs E S Roberts 104 C E Kelly 105 Emory Wilder 113 Frances Watson 115 W R Childs 117 C F Roberts 119 T E Finney 121 (159) Foster Elbert More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. M X o X SL LO zu g|5 KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 1088 New MACON New NEW -- From river 355 J B Hall 554 Scott's Drug Store south to Orange 1 w rear Julia Martin 555 W J Bass of First 356 Barnes Apts 556 Colored Pythian 5 Butler Ruther- Apartments: Temple ford 1 Vacant Just a Minute 52 Jas King 2 Terrell Weaver Lunch 54 Wm Rogers 3 E J Nelson N C Mut Life Ins 58 John Pitts 62 Eliza Lowe 4 Mrs Ruth Barnes 5 C L Chapman Co Pilgrim Health & 65 Frances McCor- 6 D C Miller Life Ins Co mick 69 Eug Jackson 7 Mattie Gaskins 8 D B Whatley Chatham Mut L & H Ins Co 73 Geo Cooper Street continued J H Owens real 75 Lum Hardwick 359 A P Heck est Ocmulgee Mrs M P Schaupp Grand Lodge Col- 104 Walter T Reid 360 W H Jackson ored K of P 106 Edw Lovelace Cherry Natl Benefit Life 110 Martha Johnson 111 C'has Wilson 114 Maggie Morris 115 Cleveland Moore 121 Robt Walker 1 Mrs Kate Dorsey 2 Vacant 3 Mrs Fannie Car- roll 4 Vacant Ins Co Atlanta Life Ins Co Guaranty Life Ins Co 122 Mary Floyd 419 W H Hawkins J S Williams phys New St Lane rear Carrie Battle W N Frayser phys 150 Henry Lewis rear Carl Smith 421 S E Evens 423 W C Kemp R L Smith lawyer 557 C A McClellan 153 J J Tuten 156 Wm Rodgers 427 E D Leonard 440 L E Nowell Plum 600 Gulf Refining Co 157 J T Pool 442 Isadore Hirsch filling sta 164 S W Wicker 444 E L Wilder 606 C W Arrington 170 J T Pool gro 448 C F Pratt 608 Ga Mut Ind Ins H S Johnson shoe 452 W F Rushing Co repr 453 JAB Riley 610 Benj Davis Walnut 458 J W Hunnicutt 614 Muecke & Sons Co 201 Vacant 456 O H Parr 618 S J Dame 203 H H Dupriest R L Pringle 652 C P Lucas 205 Harry Gordon 457 Mrs Emmie Carter rear Wm Perkins 212 Vacant 458 J H Chason 653 R S Smith 215 W C McKinney J A Boone 654 B W Barfield 219 David Fleischer 459 Vacant Porter Ivey 220 Vacant 460 Mrs Elinor Black- 656 0 T Lavender 251 W C Kaler shear 658 Jos Thomas Clem Hackney R Mills 661 J H Otto Edw Willis J L Lindsay 669 G R Schelling 253 Mrs Addie Maas H W Tillery Pine 254 Morris Harris 461 H M Griggs 700 Macon Hosp 255 Mrs R N Wood 257 J A Tebeau 270 E L Ray Mulberry 314 Vacant 318 J J Daly 321 I C Holt 322 A L Harris Poplar 504 Thos Covert 510 Vacant 518 Lucy Jackson 520 Edw Hall 521 J F McCarthy 522 Mamie Abron 552 Vacant Nurses' Home 714 C R Massenburg 720 Ma_con Hospital Colored Nurses Home 753 J T Minor 754 Theo Partin J O Clements Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ctCeoarptsya.lfoogr aclolRnkt.ain1iCnd.ssPomOfLuAcKhut&ovmaClouOba.,iblelDeELdTisaRttsaO..ITOA, usMrkInCfeHowr. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS New STREET GUIDE North (V) 1089 7541/2 C H Laird NEWBERG (S M) -- NISBIT PL -- From 756 J V Sheridan From 3047 Houston Georgia av to end of 756% Mrs Lillie Riv- 104 J E McMullin Cherry bet Spring gj*g 108 W B Chapman and Orange 757 C A Herndon 110 R C Lanier 106 Vacant Mrs Claudie Rod- 111 T H Watson 110 S C Heriot gers 760 0 T Lawson 765 J C Clemence 766 L E Hopkins L D Clarke 771 J W Howard Oak 816 L P Clark 817 Mrs Annie Ken- nedy 819 W M Towery 820 Mrs Victoria Bil- lingslea 821 M J Callaghan 852 Mrs Lyda Lindsay 852y2 A J Ellis 854 Harry Raynes 855 T A Corley Lois Smith 858 S A Parrish 860 W T Branam Mrs L B Gihson Grady Waits 862 E L McGee R L Smith 867 J B Franklin 869 C 0 Bazemore NEW (S M)--Changed to Cedar 115 O B Belmont 198 H M Smith 201 L M Holmes 202 J T Molton 204 W W Hawkins 206 J J Windham 209 W C Hays 219 T E Cox 302 L P Huff 305 S L Kitchens NIAGARA AV (E M)-- From Main south to Peachtree NINADELL AV (N H) --From 08 Montpelier av s to Belmont av 111 Cecil F Whaley 115 T E Chambers 117 H V Clark 119 Rev W P Nipper 120 D W Lanier 205 Barnie McKinley 209 Vacant 215 C W Smith 225 D W Barton NINTH--From Central City Park west NORRIS (E M) -- From 677 Main north 220 Rev J T Saxon 227 Henrietta Buggs 228 Milas McCrary 229 Archie Samuel 301 Wesley Harroll 303 Vacant 305 Eliz Johnson 307 Mitchell Vinson 309 Jas Dozier 310 Chas Sanders 311 Chas Collins 313 Wm Virgil 314 Lewis Brimmer 315 Carrie Chapman 317 Tillman Brooks 319 Robt Tinsley 321 Wm Calhoun 405 Henry Harper 505 (105) Vacant 507 Addie Bell 598 Jesse Hanpock 599 Henry Chaney 601 Rev Down John- son 603 Hattie Smith 608 Wm Solomon 610 Paul Williams NEW ST LANE--From First w to New bet Ocmulgee and Walnut rd west 2 E M Thomas 3 Edw Battle 4 Roht Stone 5 Anderson Rishy 18 Vacant 19 Vacant 48 Richd Brown 57 Richd Brown 145 Zeik Stewart NINTH AV--From Napier av s to Cherry av 4 w of Pio Nono av se cor Anderson's Service Station 105 D A Barnes jr 107 T F Craft 109 J W Noles 111 C L Bradford 329 Zenobie Burks 859 Gladys Elrod 352 Vacant 453 D L McRae 603 Mrs Pearl Davis 701 Lewis Chilious 852 Turner Williams NORTH (V)--From 839 Hardeman av north to Fourth av 100 J L Langston 102 C H Hardison 136 Lizzie Grier 138 Thos Burke 140 Rev B A Boles 142 John Pickett 157 Effie Rachels Second 208 Arie Culpepper 146 Emily Blunt NINTH AV (Bellevue) 210 Florence O Neal 147 Wm Valentine -- From Industrial 214 Julius Whigham 442 Sami Thomas Home rd n 1 w of 215 M B Jordan 545 Ezekiel Stewart Eighth av 217 Jas Pearson * FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT lv. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 DIMM 1090 North (V) MACON Nussbaum (S M) as a 218 Andy Avery 117 Alexander School NOTTINGHAM DRIVE 219 Thos Davis No 3 (E M)--From North 221 Zaek Woodward 124 J 0 Huey av south to Masonic MMLI 223 Jennie Yinie 225 Wm Gray 232 H W Lawson 252 Rose Cleveland 126 Arth Stamm 128 Jos Galloway 131 W J Beeland 137 W L Cheatham Home rd 109 J S Mansfield 111 C E Norten 113 S D Dell PUCE 253 Alice Smith 254 Geo Whitfield THE ! 256 Madge Jackson 257 Otis Freeman DIRECTORY 259 John Griggs 263 Vacant 271 Viola Sanders IS THE Third 320 Frank Toomer GREATEST 321 Geo Campbell 322 Mt Temah Primi- tive Bap Ch MARKET 334 Clem Williams 337 Henry Marshall PLACE gro 339 Ellen Green IN THE 355 Nicie Hunt 357 F B Kyles Fourth WORLD 419 Sallie Phillips * 421 Annie Amos 426 Clara Bush Every Day in the Year the Directory Tells Where 427 G R Neel 428 C J Jenkins 432 Millus Grant 435 Georgia Brown 436 Leola Ray All Kinds 438 Rev L R Parker of Goods and Service Can Be Had Greater Allen Chapel A M E Ch ,NORTH AV (N H) -- 145 Mrs E M Burney 149 O M Marshall 115 J B Ward 117 J B Parker 170 P W Jones 119 Curt Mueller 171 Wallace Miller 172 W Ross Chambers 173 Fletcher Hicks 175 A L Terrill 177 Vacant 179 T D Loyall 184 P L Hay 200 Vacant 205 Vacant 212 Sarah P Kelly 213 Mrs Mary Wana- 121 Wm W Brown 123 Thos Morgan 125 A W Glass 127 Leonard Berg 129 J H Griffin 131 F H Lee 133 C W Barber 137 Fredk D Pitts 205 Jos Mertz 207 G D Plant 209 A F Boone 219 Mrs Mary Moore maker 216 Vacant NUSSBAUM (S M) -- 217 W P Conrad From 830 Edgewood 218 O F Vance av to Plant 219 D C Glendening 121 Chas Richardson 225 S J Fried 123 Wm Walker 226 J T Yearty 153 Chas Woodfork 227 W A McClellan 157 Liddie Jackson 231 Vacant 159 Ed McCrewel 240 Davis Ingram 208 Jack Holt gro 305 H D Smith 309 J D Lamon 321 R H Williams 325 H G Jackson 329 S B Hunter 342 Jos Douglas 345 M E Anderson 211 (203) Thos Dumas 214 Jas Robinson 216 Permon Lunsford 229 John Vinson 301 Camilla Clayborn 313 Sanders Akridge 315 C M Lewis gro 317 Jerry Lamar * From Baconfield n to NORTHERN AV (E 31) 319 Richd Smith Boulevard --From 259 Jackson 323 Roland Snipes The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year 99 North Side Filling Station 101 J P Silas E P Scott 103 Homer Hardison 105 J O Hodges 107 North Highland Grocery 109 Highland Phar- macy north 125 Elsie Taylor 214 Horace Stevens 216 Alonzo Durham 220 Kelly Ford 226 Jerry Phelps 422 Marion Henderson 520 Joshua Turner 522 Wiley Ross 325 Jos Fountain 345 Riley Johnson 400 Little Rock Bap Ch 408 Geo Ward 414 Vacant 415 Albert Pennyman 724 Fred Sanders clo clnr 726 Solomon Scott MJkiCo 111 Georgia Gro Stores No 13 NORTHWEST BOUND- 728 Susie Davis ARY--From 544 For- 730 Wm Hardwick PUBLISHERS 113 Highland Oil Co syth south 732 Chas Lucas PolkBireclomSM DETROIT i V 'MICH* J FOR LISTS OF NAMES ANY TRADE r ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/a CHERRY ST. PHONE 3041 MACON, GA. Nussbaum STREET GUIDE Oakland Av 1091 770 Mary Thomas 772 Riley Johnson 774 Mattie Lamar 560 Mrs M J Wooten 811 Vacant 563 Vacant 814 Mrs E L Ryals 565 J C Evans 814% W L McTyier 776 Rosa Baker 778 Henry Davis 779 Mabel Williams 780 Vacant 782 Wm Jenkins 784 Francis Reeves 786 H H Wilcox gro 787 Rosa Harris Second 618 J M Pope rear J H Daniels 620 C L Asbell W L Solomon 652 C L McWaters 653 Geo Poulos 655 Mrs Josephine Schneider 815 Carl Dohn 818 Mrs E C Adams 820 Mrs Minnie Bal- lard 821 T E Greene J M Baugheum 851 C W Robinson T W Grimmett 853 J B Garrett OAK -- From Tenth to Orange 1 s of Pine (not open from Fifth to Tenth) 347 Adams-Buehanan Motor Co whse 348 C J Molton Lumber Co Macon Stock Yds 360 Irene Harvey 361 Roberts Coal & Transfer Co Broadway Marion Seagroves 854 B M Lewis 659 W L Daniel 860 J C Garner J P Mitchell 861 J H Rathe 660 E L Hendricks R W Hunnicutt 663 L F Parker 869 E A Murdock 666 J P McGoldrick 871 M L Connolly G B Weaver 890 Stanford Wiggins 667 J C Walker 672 D P Ruff J D Vinson First 708 R T Momand D D VanDine OAK AV (Ingleside)-- From Fourth rd n to Ridge av 1 e Tyrone blvd 104 J C Clements 105 G F McKnight 406 Vacant 415 Mrs Mary Oates 417 Mrs Leila Rich- ardson 418-20 Macon Coca- Cola Bottling Co 421 Mrs E E Wynn 453 Peter Nicholas 456 R P Hodges 457 W B Bullock 458 Vacant 460 Vacant 461 Mrs Bessie Morris 462 Mrs Mae Stephens Third 504 Mrs L A Hanse 512 J F Alexander 515 Kate DeBeruff rear Wm Sanford 516 W R Goodwin 519 J C Gardner 521 H B Hillard 522 T P Beal 717 Mrs E G Steed 106 R C Harris W C Briggers 718 E M Johnson 721 Mrs M E McNabb Mrs M L Smith 752 Mrs K F Fried 753 J L McCreary J J McCreary 759 Vacant 760 G W Doster OAK HAVEV AV -- From 601 Vineville av s to C of Ga Ry 33 Vacant 114 C A Morris 117 T H Hall 118 J B Harris 119 W H Beeks 761 Bernard Robertson G P Swails 762 Vacant 764 Moses Barnes acct 768 J D Minor C C Haley 769 W J Cousins E W Branan 771 Mrs M A Coffey H F Cherry 771% A L Dent 772 Vacant New 123 C N Guttenberger R L James 124 S M Solomon jr 201 A E Bird jr 203 Vacant 205 Vacant 206 B S Holleman 207 Mrs M A Roberts 209 T W Hawkes 234 S L Arrington English C of Ga Ry 300 Atlantic Cotton Mills 552 Mrs Fannie Jones 804 D E McGregor OAKLAND AV (For- 553 L F Sink 555 S M Thomas 558 J F Reeves 559 Vacant A C Raby 806 J W Stevens 808 R P Johnson 810 J N Steed merly First av) -- Vor111 and south from Jesamine 2 w of Carling av Cl Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog- contains much valuable data. Ask for a copy It. L. POLK & CO., DETROIT, MICH. s* 0 SL co ST r DO > o o > o Pi H 73 > iZn PI 73 in B > *< H -nO 0* 0 CO 00 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 1092 Oakland Av MACON Ocmulgee La 98 Mrs C Wheeler 452 Vacant 909 Vacant 100 J W Wheeler jr 458 Mrs Emelia Us- 911 Andrew Coleman 101 I D Fincher sery 915 Elmira Thomas 103 J F Brown Third 916 D E Scott 125 J F Roquemore 516 Evelyn White 920 Porter Holloway 129 Vacant 520 R L Iverson 921 G W Hill 131 F I Gilbert 522 Leola Bryant 923 John Nixon 132 C M Newberry 548 J I Singletary 925 Pink Albany 133 C W Jones 552 Maggie Williams 931 (963) Edw 133A Harry Briggs 556 L F Woodall Tucker 135 R G Davis Second 952 S C Clemons 136 Rev C B Withrow Academy begins 962 Walter Jones 137 W D Ezell 138 J C King 139 A G Strickland 152 P F Childs 154 J S Freeman 156 J S Bryan 158 J W Tinsley 187 (607) C A Jobson 197 C S Arnold Belmont av 201 J D Brady 205 J S Young 247 T E Burch 251 W G Connell 252 R L Hurst 253 Paul Stallworth 255 H E Johnston 268 J W Best OCMULGEE -- From Seventh av to Orange 1 s of river Seventh cor W F Elder Lhr Co ne cor G Bernd Co whse Sixth 201 Robt Jackson 203 Robt Frazier 207 Chas Jones 209 Chas Martin 211 Richd Hadden Hettie Isbul 212 Wm Ellison 213 Mattie Hooks 214 Sami Welcher 614 Vacant ne cor Ideal Lndry Co First 702 Jas Jones 704 Roberta Terry 756 Rev E D White 758 Jas Andrew 760 Vacant 762 Vacant 766 Solomon Chandler 768 A M Neal New 803 Ernest Grier 805 Luther Thomas 807 Beatrice Fleming 810 Sami Walls 811 Homer Farror 812 Thos Fuller 813 Eliz Commings 814 Jas Raines 815 Annie Ridley 819 Mary L Davis 820 Mary Robinson 822 C E Jackson 824 Jas Middlebrook 852 O F Beasley 853 Jonnie Bailey 854 Jos Calloway 856 Maggie Rivers 857 Donnie Reynolds 859 Bertha Hall 861 Carrie Redd 863 Isaac Abraham 865 Eliz Smith Spring 962y2 Minnie Bell 964 Mamie Cochran 966 Robt Edwards 967 M L Ross 968 Mose Stephens 970 Squire Henry Franklin 1005 Chas Hudson 1007 Edw Wood 1012 Julius Turner 1014 Wm McKinley 1016 Carl Newson 1018 Ezera Price 1020 Jas Howes 1021 Green Childs 1022 Emma Stubbs 1051 M R L Co's barn 1054 Lillie Chambers 1058 Vacant 1060 Vacant 1062 Jas Walker 1066 Howard Gray 1068 Carrie Street Hill begins Rose Hill Ceme- tery Orange 1130 Andrew Carpenter 1160 Thos Holmes 1162 Henry Johnson 1164 Chas Parson OCMULGEE LANE -- 1 n of Spring 369 Edw Green 257 C J Preston 901 (913) Chas Tol- 536 Lee Jackson rear Florence Ashley bert 921 Harriett Wallace 259 Isaac Foreman 903 (912) Vacant 951 Annie Sheftin 267 Isaac Davis restr 905 (911) Fannie 953 Jas Stenson 271 N I Parr Berry 954 Dora Wright Fifth 907 (910) Mamie 955 Eug Johnson Broadway Johnson 957 Quinnie Rosier FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Oglethorpe STREET GUIDE Oglethorpe 1093 OGLETHORPE -- From 726 W A Brown 1017 Wm Mathis Fifth west to limits 728 H 0 Conner 1018 John McCall 1 s of Oak 730 A L Phillips 1019 Lonnie Nelson 306-8-10 Bibb Grocery Co 325 Central Bedding Co Broadway 414 S W Teasley 416 J M Farley 438 Vacant 440 Vacant 446 Vacant 448 Used Car Clearing House Co garage Third 510 Vacant 512 B W Coleman 514 G I Dozier 515 Vacant 516 W G Hunt 517 Vacant 518 Y R Coleman 520 (552) F L Tyner 525 J D Carr 732 G W Jones 1020 Vacant 734 J W Jackson 1021 Clarence Stokes 736 Elery Dunn Jackson Highland av ends 1052 I L Carroll 738 Gary Garner 1053 Mary Harvey 740 G W Roundtree 1056 W F Strong 742 Mack Cummings 1057 Lou Wilder 744 Wm Prather 1062 C B Amerson 746 E W Yancey 1064 Mrs Leila Averett 748-50 Vacant 1068 Jas Simpson 752-54 J O Snow 1072 Minnie Gordon gro 756 Mrs Lizzie Crosby Ross 758 Laura Crosby 1105 P S Lockerman 760 Jack Long 762 Tobias Fair 764 C S Haygood 770 D P Cheshire Maple Jackson 901 Sanitary Milk Depot 902 Vacant 906 T M Bateman 1106 John Ard G W Lindsey 1109 Sylvanus Prince 1114 J H Wilson 1116 D W McCoy 1120 C L Gray 1123 W F Hooten furn repr Shamrock Columbus 553 B F Slocumb 910 J F Wester 1157 Jas Lowe 555 U C Wilson 912 Vacant 1159 J C Crawford 557 H K Rewis Cole ends 1162 K V Zemlich 560 W E Davis 915 R L Garrett 1163 Ella Brown 562 T P Stubbs 916 Vacant Chas Miller 570 Vacant 918 W H Britt pntr 1166 Gustavus Floros se Georgia Grocery 952 W R Amerson 1171 Edw Crutchfield No 9 Holt Gulf Refining Co Second 954 G H Russell filling sta 608 D G Bowman 612 Talulah Linch 616 A H Dewberry 617 F R Askew 957 Mt Olive Bapt Oh College 959 Sami Brown 1219 W J Bradley 962 G W Camp 963 J Harrington 1223 J O Harris Tatnall 619 Louie Crawford 965 J O Varnadoe 1309 Oglethorpe Pri- 623 L W Page 966 Vacant vate Infirmary 625 Vacant 970 T M Donnelly Co 1321 Mrs L H O'Neal 630 W R Parker gros 1357 Mrs W J Juhan 649 Edw Collins 653 M L Cargle 970y2 R H Stone 971 Mrs Lula Waters 1363 J W Hicks Adams First Calhoun 1401 S W Garrett 688 Bibb Mfg Co crown plant 706 Bibb Mfg Co 1004 Vacant 1005 Mae Driggars 1009 David McCrary 1403 Mortimer Goldman 1405 F B Steger Community bldg 1010 B W Hilborn 1407 Vacant 716-18 S A Connor 1011 Edw Street 1409 PI L Lester 720 Mrs A E Mason 1012 C W Greene 1416 Mrs Eloise Jack- 722 Woodie Phillips 1015 Ralph Watson son 724 Wm Wilkes 1016 O J Jenkins 1422 S J Winn A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit U3 o z o < X o Q o d z U* Oh O U J d Sr* S3 ** rj uz Do d JE W QkUJ 0U5J W co o b O C/2 OS Q U3 ftS D c/i S D Z < MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1094 O'Hara La (S M) O'HARA LANE (S M) --From Edgewood av south bet 3d and Broadway 88 Mary Sneeds 124 Jas Smith 125 Abr Booker 134 Wm Thomas 223 Wm Williams 406 Lula Jordan 421 Walter Harris 422 Dink Jacobs 434 Dock Morris 465 Wm Haslit OLIVE (E M)-- From Clinton east to Hydrola 1 s of Main OLIVER AV (Log Cabin Hts) -- From Ernest north 1 e of Log Cabin way OLIVER AV (3 M) -- From 2480 Broadway east to Chappel 72 Viola Thomas 74 Sami Galry O'NEAL'S AL (E M) -- From 713 Main south OPERA HOUSE AL-- From 253 2d to First ORANGE--From jet of Jones and Ocmulgee south to Cotton av, thence se to First 205 Chas Harris 207 Cath Stevens 211 Senie Hargrove 217 Jas Lewis Ocmulgee 220 Edw Simpson 221 Maggie Allen 222 Stella Lillis 223 Geo Anderson , rear Edw Ingram 225 T J McCormick 226 Nazread Bembri 227 Anna Clowers 229 Anna C Miller 230 Jane Smith MACON Orange 232 Enoch Copeland 403 Mrs M C Merritt 234 Wm Smith 411 J P Holmes 236 Jos Dennis 415 W R Holmes Dr 238 Dock Barnett 240 Jackson Hicks 421 Mrs E A Gantt 456 W H Oliver 246 Ideal Smith 460 W S Stinnett 252 P W Hurt 463 F S Holmes 255 Mrs H M Hopkins 464 M L Morris 257 J W Crocker 465 J O Vann 258 C B Vineyard 470 J G Kollenberg W C Corley G A Lokey F M Hubbard 471 W S Ehney 259 Vacant 260 Vacant Walnut ends 261 C P Bloodworth 267 F D McCard 271 Sol Hoge 275 P W Stubbs 280 C R Davis 280% C C Haisten 281 M C Balkcom 284 E B Codington 285 Vacant 288 Vacant 473 Frank Blackstone 474 Apartments 1 H G Flynt 2 Vacant 3 Mrs Mable Wood- ruff 4 Ennis Morrow Street continued 475-79 Washington Apts Apartments: 1 Vacant 2 Vacant 3 Vacant 297 Vacant 4 W M Barton Bond 5 C C Jones 304 Peter Frank Jack Bennett 307 Mrs N C Burr 6 B E Mathews 313 Mrs E C Cunningham Street continued 480 Vacant 317 Vacant 483 W R Hardin 31S J A Doster 484 W M Fitts 320 Mrs C F Ross 321 Wm Mitchell 486 Vacant 489 S G Sharp 322 Ida L Holt 494 Mrs A Annie 350 Chas D Cork Hamilton 355 Rev A J Hart L E Hooten 359 C D McCowen Washington av 360 Vacant 361 Vacant 506 R L Walker music tchr 362 Vacant G D Lee 364 Mrs E W Blount 510 Mrs M E Rankin 369 G A Rankin Mrs A B Riley 371 J M Dasher 372 D I Lee 374 Durwood Yates 514 Lollie Taylor F W Coleman 516 Mrs J A Parish 375 B P Richardson 520 Colonial Apts 376 W C Turpin 378 J F Hart Mrs Fannie Ogden J B Hunt 380 Mrs Augusta Winn C H Hurschbarger W T Swint High ends Georgia av 525 Vacant More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. Orange STREET GUIDE Orchard Av 1095 533-47 Neyaro Apts 571-77 The Palisades 862 G W Hardeman Apartments: Apts Mrs L J Adams 1LS Dure Mrs L H Collins 863 H C Hamrick 2 Mrs Virginia Gu- 573 Herbert Bryan J Q Smith gel 577 F E Chambers 865 Mrs C H Galle- 3 Elmore Dawson Daisy Park ends more 4 Mrs Anna Coburn 579-87 Forsyth Ter- 869 Mrs C E Holmes 5 Vacant race 870 M D Coplan 6 Vacant 7 Vacant 8 Mrs R A Ramsey 9 W D Rhoads B J Wigbels 10 Vacant 11 F S Kelly Apartments: 1 C L Tinsley 2 Mrs A V Sikes 3 W H Underwood 4 Mattie Hill 5 H C Boone 605 Vacant 871 H A Shouse 871% Vacant 873 F B Barnes 873% M H Hood Latta pi begins 877 J W Rogers J W Byrd 12 Herman Schall real est 12% W P Weisiger 14 J B Clark 15 B L Hendricks 16 E P Stone 17 J B Ingle H H Clarke 18 L L Gibson 19 C B Etheridge 20 Mitchell McRae 21 Mrs Rebecca Strozier 22 L E Dover 23-24 Mrs Maude Swain restr Street continued 546 Vacant 548 J C Murphey 550 C C Harrold 553 Mrs Sallie Davis R E Sheehan 554 W S Goodall rear Silas Palm 559 laurine Apts Apartments: 1 Vacant 2 G A Blackwell jr 3 Robt Johnson 4 Rev A C Baker 5 Mrs Anna Lifshey 6 M E Reinhard 7 Vacant 8 Mrs Cora Boter- weg 9 Vacant 613 N M Leverin G L Carver Mrs M L French R L Clifton J B Hart jr 617 J L Watson 621 Mrs Eugenia Etheridge 622 Ella Amason 628 J H Lucas 629 T L Ross 632 J W Layfield 636 B S Gostin phys 637 M H Pearce Rose Park 639-45 Mount de Sales Academy Park Place 711 Vacant 719 T S Sweeney New 900 Mrs A M Baldwin G W Etheridge 901 Vacant 902 C B Harper 903 F W Colquitt 905 C D Sumner E S Hamilton 906 Henry Whitehead 907 Vacant 909 Mrs R J Gostin 910 Vacant Highland av begins 911 W S Pritchett 912 W T Harden 914 Vacant 931 G P Fuller sw cor S B Price Li- brary First 727 Vacant Spring Holt 800 J G Weisz 804 Mrs Bernice Wil- liams 805 J B Horne ORANGE ST LANE-- From 240 Orange s to Hill bet Ocmulgee and Walnut 252 Vacant 254 Georgia Tilson W H Smith ORCHARD AV --From 808 W M Prator Hudson al north to 815 G J Waxelbaum limits 1 e of Greene 822 Mrs E J Brown 1 Bass Taylor 824 H L Stephens 2 K W Wright E J Denson 3 Laura Bostick 825 G C Britt 4 Leila Jackson 826 T C Ott drayage 5 Vacant 827 A A Benedetto 6 Mamie Brown 852 B H Talley 7 Edw Spencer 10 C C Morgan C M Kimball 8 Robt Jones Street continued 856 C C Tindall 9 Wm Perkins 560 J J McKay T M Price 10 Aslean Holt 568 R L Anderson 860 W O Stevens 12 Maggie Walker The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH ana SEPTEMBER by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile lists. Our new Catalog contains muck valuable data. Ask for a copy K. L. FOLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of AH Kinds of Merchandise and Service Meet 1096 Orchard Av EMAOON Patterson La (V) 16 John Jones 105 A M Johnson 151 A J Taylor 31 Eliz Nelson 107 E W Willis J W Bollinger 49 Jos Foster 108 F R Jones 153 Mrs Victoria May- 118 Chas Wilcox 109 A M Sikes nard 120 Vacant 122 Geo A Patterson 124 Sandy Sherman 126 Jacob Sutton 127 Vacant 128 Jack Tucker 131 Vacant 150 Marie McCarthy 201 Danl Jackson 283 Wm Jackson 284 Chas Jamieson 401 Laura Bailey 447 Twiggs Bostick 449 Jas Harris 204 Paul Hearn 209 P W Pratt 210 P D Allen PARKER AV -- From 420 Hammond s to Plummer's al PARK HOTEL AL -- 2 Jas Wiley From First west bet 3 Emma Short Cherry and Poplar 4 Leola Trice 121 Moody Hopkins 5 Jennie Calhoun 123 Vacant 6 Martha Smith 127 Jos Taylor 7 Neal Bailey 129 (15) Eula Style , 9 Clarence Hatton 131 (12) West Ellen 10 Anna Carter 132 Vacant 22 Sarah Richardson 134 Vacant 136 Vacant PARKWOOD AV-From OSBORNE PL (Ingle- 151 Frank Allen side)--From Tyrone 175 Eliza Thompson Forsyth rd south to C of Ga R R blvd east to Woodland ay 1 n Vista Circle C D Peavy jr OVERLOOK AV (Ingle- 176 Margt Graddicks 177 Wm Kelsey 178 (157) Pitts Lee 200 Thos Midds 250 Lizzie Atkins 256 (154) Eliza White PATTERSON (Napier Hts) -- North and south from Belmont av to Dempsey 109 Bertie Bouten side) -- From Belve- 264 (770) Lizzie Gra- dere dr w to River- ham 199 Rev Wm King 201 Wm Thorpe dale rd dr 2 n Forsyth PARK PLACE -- From Columbus to Maple 213 John Vaughn 219 Chas Range 220 Fizi Fields PARADISE AL--From 1 w of Sprirg 222 (221) Wm Scott Fourth to Fifth, het 105 Mrs Georgia Wat- 223 C O Harris Ocmulgee and Wal- kins 225 Cornelious Hud- nut PALACE AV (Belle- vue) -- From Dover west 1 s of Ayers rd W L Dunagan Orange 106 S L Becker 110 T R Thigpen 110% Vacant son 226 Harris Holt 227 Willie Lockett 229 Walter Thomas gro 106 Mary Miller 112 J H DuBose 231 Dock Anderson 172 A J McPherson 114 W J Robinson 233 J T Williams 174 W E Brady 116 R L Cain 303 Mary Sherman 176 P J Hubbard 117 Mrs A M Ahern 304 H T Randall W H Hubbard 118 Mrs Oath Ander- 305 John Miller 180 T C Olmstead son 312 Richd Byrd gro 182 J E Bryan 120 W E McCord 315 Walter Plummer 200 Henry Turner 123 R E Sheridan 317 Rev J B Borders 202- Mabel Wilson 128 Mrs M J Watson 318 Joshua Trippe 204 Henry Pierce 129 E A Sheridan 319 C W Davis PARK AV (Crump's Park) -- From Forsyth rd north 1 w of Blind Academy 135 J F Cargile 344 Wm Robinson 135% Vacant 356 Pleasent Banks 137 Mrs Margt Taylor 441 Wm Jones 137% Girvis Slocumb , C L Bassett PATTERSON FANE 100 O B Wallace 141 Eva A Souther (V)--From 805 Third 103 Mrs S T Clements 147 J E Harrison av east R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Pauline Av (W H) STREET GUIDE Piedmont Av (S M) 1097 PAULINE AY (W H)-- PEACOCK (S M) -- 640 J E Lewis Changed to West End From Enterprise s to 641 Lee Ringwood ay Nelson 1 e of Gantt 647 Mrs Sallie Saw- PAYNE AY -- From Bellevue rd to Green City rd 104 Jos Green 107 Essex Grier 109 Rachael Ellis yer 648 Benj Hubbard 656 T P Molton Telfair PAYNE QUARTERS-- Two miles north of city at Payne Mills 113 Julia Davis 222. Eug Dean 300 Henry Williams 301 (220) Melissa PENN (Y) -- From Highland av north to Neal PEACHTREE (E M) -- Green 111 Morgan Hurse From 200 Hydrola to 304 (159) Wm Gol- 115 (5) Robt Wil- Third av den liams 101 Bealey Sapp 306 Walter Munson 119 (9) Lizzie King 102 D G Croomes 425 Judson Braziel 230 (830) M Clyde 110 E A Barfield 427 Leroy Johnson soft drinks foundry 473 Nancy Frazier 232 Jas Clyde 123 Bose Bowers 124 I A Gidens 125 R L Bass Balkcom PEAR (Elm)-From Elliott east to Flanders 1 north of Main 202 Elberta Morris 238 (838) Henry Gray 300 Forine Rogers 302 John Hughes 203 Jack Brewer 205 R W Smith 206 Claud Nelms 207 Wm P Gresham 208 J S Marsh 250 R D Warren 251 Wm D Logan 257 J D Johnson Fairview av 260 W T Reynolds 301 Eliz Meadows 302 B P McKinney 306 Jas H Gunter 307 Jas Nelson 308 P E Porter 401 Louis Dorsey 402 Wm Solomon 407 Prank Smith 409 Mrs Mary Wil- 204 I M Chatman 208 Rosa Conner 216 Susan Goode 218 Carrie Wyche 219 Arbina Holt 220 Chas Pitts 268 Amanda Hub 270 Ernest Mitcham 315 Wm Rouse 719 Lula M Black- shear PEARCE (E M)--From 238 Main north -108 W C Hardy 110 R D Ward 112 J D Moat 114 C H Jessup 264 Henry Pruett 265 Nagel'b Isaf 266 Carl Ray PETERS AL (E M) -- From 508 Clinton PHILLIPS (S M) -- From School to Grant Chapel 100 Wm Nelson 156 John Gunn 158 Henry Jones 160 Vacant 161 Jack Moon 162 Vacant 163 Guss McCoy 165 M B Hodges PHILLIPS AL (S M) -- From Jordan al south PHILLIPS LANE (E M)--From 255 Center south to Church liams 410 Adam Thomas 411 Robt Clark 412 Mollie Banks Henry Collins 413 Wyatt Gray 416 Ernest Clowers 419 Thos Smith 420 Amelia Ford 422 Wm Stewart PEEBLE (S M)--From 1811 2d west to Tel- PIEDMONT AY (S M) --From 2619 2d west fair 100 J M Lyons 603 Mary Toomer Wilder 607 Oscar Leary 611 J H Jefferson 101 W W B Brown 103 R E White 105 E L White contr 106 J B Morgan 612 Milton Green 110 J M Butler 620 Jas Lewis 111 A K Story 621 Jas Brown 115 P P Ashton tn 423 Jos Durham 630 Freeman Smith 118 Mrs Annie Lynch 424 Chas Jones 633 Eva Caldwell 119 J L Crawley , FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT lv. L. POLK. & CO. CHICAGO 38 Your City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kindc of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1098 Piedmont Av (S M) MACON Pine 120 Mrs Ophelia 302 M G Bayne Mitchell 348 B W Lundy 123 D B Durden 350 Ernest McAdams 125 G T Watts 351 R S Dillard 130 G W Caruthers 352 Mrs Minnie Cara- 131 Mrs Allie Lowe ker 132 Mrs L Odom Anola av 135 G R Williams 136 J H Brown 137 W A Martin 138 H E Ridley PINE -- From South west to Spring, 3 s of Cherry 140 J J Jones Bibb Brick Co 141 F H Wright Bibb Basket Co 142 Augustus Myers W S Dickey Clay 143 J H Sanders Mfg Co 144 Allen Jones Tenth to Eighth 145 J T Tamplin Sixth PIERCE AY (Y) -- From 651 Yineville av to McDonald 101 S D Dodds 102 Rev M A Wood 103 L A Mitchell 104 H H Lamb 105 A P Addington 106 Vacant 107 E H McLean 108 Vacant 110 D R Malone 112 J H Thomas 114 F T Vincent Sou Ry call office Seventh nw cor Dixie Cafe & Commissary Central of Ga Shops Central of Ga frt depot Fifth 353 C E Newton & Bro produce 354 M A Pascall 356 Wm Tenson 362 Frances Lester Broadway 116 Abner Pitts 415 Vacant 118 G G Price 121 Meth Orphans Home 123 J T McGehee 125 R W Hawkins 129 Mrs Penelope Wall 135 W F Wasdin 137 F R Nalls 139 J L King 140 Vacant 141 H G Lawrence 454 M L Wells rms 457 W O Kinney Co cotn factors se cor Kitchens & Stev- ens confrs M E Goode & Co cotton Hogan & Levie comn brokers Alexander Sprunt & Son cotn W E Markwalter 142 J B Wall cotn brkrs 149 A P Bernd Brown Wimberly 153 J A Asbell cotn brkrs Boulevard ends Fred Jordan cotn 202 W H Dubose 204 F C McCullough brkr Third 206 W J Weddington 511 G F Gafford 208 Vacant 514 W C Wilkinson 210 S C Davis L E Bragg 212 Mrs K I Roberts 518 Mrs E Z Hardy 300 J A Knox rms 519 Mrs E E Smith 523 E R Pearce auto pntr 552 C E Chambless 553 J M Braddy gro 555 Mrs N E Lasseter 556 G F Robinson J A Thames Second 608 W N Wood 617 Vacant 619 J G Gilmore M M Newberry T L Mays 620 C R Swint 621 J H McCowell 652 J T Pearce J D Boone 653 Vacant 656 E D Gleaton Lulu Jones drs- mkr D W Brandt A A Rouse 657 Mrs Mollie Mus- selwhite W I Brantley 658 W P Temple First 706 Mrs Mollie Hud- son 708 H T Flood J R Lanier T D Newberry 710 T C Evans 712 Mrs Mariah David- son 714 C E Wellons 715 Mrs Mary Wind- man E C Harper 716 Vacant 718 Vacant 720 Vacant 721 O N Morgan 722 Vacant 724 F A Barshow 726 H O Herrington 750 J B Adams Mrs Carrie Haver- field 753 J A McCants Leonides Hightower R. L. POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO a ENGLAND Tj THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 Pine 756 W H Favors G P Porter I A Allen 757 H A Burke 759 W D Argo 761 C C Cunningham R N Perkins 765 Welbert Johnson Hilman Tanner 767 S L Taylor New 801 W T Moseley 803 Mrs Pauline Lord 805 J F Ogburn 807 A D Varn 809 H F Dotts R H Malone 809% J M Robinson 820 Macon Hospital 849 Mrs Julia Gissen- danner John McBrearty 856 Jeff Williams R E Proctor 859 C H Douglass 860 T R Lane 863 Alice Toombs 867 Vacant Spring PINK (W II)--Changed to Belmont av PIO NONO AV (V) -- From 650 Vineville av west to Dempsey av 33 H C Zuber 37 J G Harrison 39 W E Harp 41 L D Cunningham 57 W M Barnes contr 59 R H Stone 101 Adolphus McGee 103 Robt Simmons 104 Taylor Curry 105 Jesse Scott 222 J W Kirkus 224 J O King 300 Max Cohn gro 301 Atlantic Ice & Coal Co 302 Max Cohen 303 Macon Fire Dept No 6 305 Annie Causey 306 W R Billings STREET GUIDE Plant (S M) 1099 308 F R Christian gro PLANT (S M) -- From 310 (225) Z Plem- Jeff Davis west, 1 s mons of Curd 312 (221) Sami Gunnells 314 (219) Bertie Bowden 316 J M Couch 320 (226) Eug Hobbs 113 Mrs Emma Calhoun 115 J B Herndon 117 Mrs Addie Fin- ney 119 Mrs Pearl Cham- 321 Louis Mullin bliss 322 (248) C H Adam- 120 R F Hamlin son 324 (196) H L Adam- son 121 Mrs Sallie Anderson 123 H G Smith Roff Home av 124 J B Smith 326 (224) W H Hall 330 (234) Fletcher Banks 332 (258) John Davis Patterson ends 404 (256) Mary Bris- coe 410 (214) J A Bras- well 418 (220) Minnie Shefton 420 (300) Vacant 421 Vacant 422 (302) Vacant 125 O R Dent Nussbaum 130 J Thos Rogers 136 Alice Supples Nisbet av 203 L F Cranford 204 H W Humphries Campbell 211 E H Meadows 212 J E Sandefer 215 Chas Riley 216 Lucius Lane 218 Grover Peeps 220 Edmund Dean 222 Lucy Reeves 424 (210) Georgia 224 Marcus Goodwin Gro 226 Chas Gauf 426 (208) Clara Sea- 228 Jerome Banks brook 230 Lucinda Shelly 428 (411) Elias Wood- 232 Lawrence Wil- ard liams 433 Anna Parker 234 Melissa Darby 435 (311) Joanna 244 Richd Collins Northern Beech av 502 Cherokee Hgts M 246 Jas Davis 248 Chas Bell 254 Chas Bell gro E Church 505- J L Montgomery 507 C P Millirons 636 W E Williams 650 H M McElrath 805 W E Williams jr 806 Bethel C M E Ch 255 Mrs Leola Edwards Tindall av 301 Green Simmons 302 Jos Ward 305 Nick Lane 308 T A Lindsey 310 J P McDonald 808 (202) Hattie How- 312 J E Barnett ard 314 J W McDonald 810 (120) Chas Jack- Forkner E McGar- son rah 812 (206) Bessie Scho- 315 W F Causey field 319 Alex Smith 816 (104) Vacant 321 Wm Easter Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1100 Plant Alley MACON Plummer's Alley PLANT AL--From 528 452 Schwartz & Phaul 717 Vacant Hawthorne south to plmbrs 718 H O Harden Hazel 456-58 Vacant 720 J P Price 1 Jas Ploward 2 Lowe Smith 3 Daisy Bailey 4 Annie Little 5 Viola Bryant 5 Mary Underwood 464 J B Warfield live stock 468 A S Hatcher Co whse Third 504 Phoenix Cafe G S Thistlewood Mrs Mattie Vin- cent 721 H E Nettles C L Dunham 753 Vacant The most comprehensive refer- 8 Matilda Shinhoser 9 Geo Morris 10 Leonard Martin 11 Wiley Richardson 12 Jules Wimberly 14 Louise Lawrence 506 W V White bicycle rear Cherry Parker repr 754 Chas Golden 513 Vacant 758 Wm Franke 514 J D Shadburn Top Co J L Cribb 764 J H Passing Shadburn & Hud- 765 Vacant son auto pntrs New ence work on the hanks of the world 16 (12%) Wiley Durham 18 Pearl Dennis 230 Jas Bowden 232 Prances Bullock 234 Albert Flournoy 515 H A Gant 517 Macon Bearing & Parts Co 519 Central Ga Auto- motive Co PLUM (E M) -- From Stripling al to Balkcorn ay bet Applewood and C of Ga Ry Alley PLUMMER'S AL -- Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to 9 Banking Price $20 Published semi- 236 Jeff Tennyson 245 Viney Mitchell 518 Mittie Gates 520 Robt Gates 522 Jos Wise 526 Annie Lamar 537 Wm Flagg 539 Beulah Bailey 545 Isiah Cater 562 Emma Rawls PLANT ROW -- From First west of New. bet Walnut and Mulberry PLwUreMst -- to From New, Fifth 6 s of river Fifth sw cor Ga Sou & Fla Ry Co Sou Ry System 352 Jacob Hirsch 'junk dir 551 Cecil Bennett 553 Vacant 554 C H Mann R A Matthews 557-59 Jones Motor Co 560 Capitol Hotel Second 601 Vacant 603 A T Flowers 607 Vacant 608 M L Lane 610 Vacant 613 Mrs M H Strip- ling 617 O D Osborne J Q Beasley R I Shy 620 E W Jackson C B Hammers J K Gooding Thos Grier 653 Sami Ghamin 654 J D Jones 657 Vacant 657% T P Bozeman From 152 Bay South to Edgewood av 63 Jordan Brantley 65 Elder Mitchell 66 Jas Turrentine 72 John Howard 100 Geo Lowe 101 Deal Finney 104 Sarah Ridley 112 John Gordon 120 John Whitehead 121 Wm Riley 122 Mattie Morris 123 Jas Michael 124 Edw Haines 126 Georgia Mayo 142 M J Snead 160 Mary Stephens 164 Horace Hughes 166 Edw Robinson 167 Robt Hodo 168 Hillard Creese 250 Dora Williams 256 Wm Jones annually Broadway 659 Vacant 410 Vacant 660 Vacant 302 Cath Glover 316 President Vano MARCH and SEPTEMBER 418 Vacant 422 J W Gunn blk- 661 Vacant 661% Wm R Few 341 Mary Rump 373 Rilla Jones I by smith 664 T A McGinty 423 Wm Carter Co clo boarding 374 Chas Stafford 375 Georgia Brown I mfrs First 379 Henry Standley i 451-53 Am Bakeries R. L. POLK Co 716 A J Mumford R L Johnston 381 John Maddox 397 Elbert Ross I & CO. Polk Directory > Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Vg% on Savings Plummer's Alley STREET GUIDE 405 B'enj Drake POND (V)--From 400 422 Harris Johnson Ward east one block 423 Thos Hollis 211 Elijah Wynn 504 J H Carter 506 Robt Thomas 507 Julia Butler 515 Orce Holmes 620 Ida Sanford 665 Emma Myers 667 Lee Hadden 214 Chas Shannon 215 Edw Pate 216 Henry Howard 218 Alf Bowman 219 Willis Jordan 220 M L Taylor 221 Lena Milton 712 Nelson Bell 831 Preston Martin POPLAR -- From 12th west to Spring, 1 s PLUMTREE (E M) -- From 103 Fairview east 202 Carrie McGee 204 (201) Minnie Stubbs 503 John Daniel 523 (87) Geo Goosby of Cherry Berta Green lunches Sou Box & Basket Co Independent Chemical Co fertz J M Dasher Lmbr 533 (17) Sami Powell Co 535 (18) Thos Smith Central Cotton Oil POE (V) Changed to Forest av Co T & T Sausage Co Adams Richard- POLK LANE--From C of G tracks s to Chestnut, 2 w of Linden av son Lmbr Co Cotton States Fertz Co plant Ninth 2 Chas Vandoran 3 Sallie Canion 4 Wm Heath 5 Vacant se cor City Stables City Stockade City St Sweeping Dept City Refuse Dump PONCE DE LEON AV City Scavenger (Houston Heights) Dept 102 Lamar Jones 104 Sami DuBose Birdsey Flour Mills 105 C A Theiss 106 B B Maddo 107 S P Anderson 108 L A Cumbie 109 F M Delk 110 Vacant 113 R S Cheatham 114 B S Watson 116 H F Beaty cor 8th Southeastern Compress & Whse Co Pan American Southern Petroleum Co Ross Co bldrs sups S R Jaques & Tinsley Co whol 118 H E Clark gros 120 C T Moss J M Couch soft 122 Vacant drinks 126 W D Scott cor C of Ga Shops 130 Lloyd Newborn Macon Cabt Wks 134 W A Smith Seventh Poplar 1101 102 J H DuBose junk Sixth 201-69 M E Elliott Warehouse Co Fifth 301-307 Jackson-Wynn Co whol woodenware 310 Ga Banana Co 311 Macon Paper Co 313 Burney Bros Co Inc prod 315 Roughton Halli- burton Co prod 336 Cudahy Pkg Co 344 Vacant 346 Howard Prod Co 348 Vacant 350-52 Heard Bros cotton 355 Otto Isaacs Har- ness Co Broadway 401 H L Barfield whol gro 405 Vacant 406 H T Tabor ab- stracts Imperial Loan & Real Est Corp 407 Vacant 408 O R C (Macon Div 123) 409 Taylor Transfer Co 410 Mrs Marie Joseph gro Clinton Teal prsr Clinton Brantley barber 411-17 Wright Auto Supply Co 412 Goldgar Furn Co 414 Boston Shoe Shop 416 Wright & Reeves dry gds 418 Workingman's Store 419 Vacant Alley 420 Globe Furn Co 451 Dannenberg Co 452 Tony Maroon fruits 456 Ellis Cafe 456% W O Swift taxis ;for lists of names ANYl T/ RA, D,E.^-- * i ANY BUSINESS - '-- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1102 Poplar 460-62 Jacob Backer furn 464 Paragon Pharmacy 464% Macon Brokerage Co 466 Ga Furniture Co 468 Philip Barnett jwlr 470 Sou Dry Gels Co Third 502 McCommon Bros dry gds 502% Napier Building J M Brantley furn rms 506 Simon Moore dry gds 508 H Kessler & Co dry gds 510 Union Furn Co 514-16 Union Bargain Store 515 Vacant 515% Vacant 517 Smith & Watson printers E C Olmstead lino opr 518 Isadore Segal dry gds 519-21 Flournoy Auto Co 520 Weinstein & Starr pawnbrokers 522 Empire Furn Co Alley 552 Henry Kaplan pawnbroker 553-55 Carter Hdw & Supply Co 554 Myer Wolf shoe- mkr 554% Moses Wolf 556 Isidore Brinen dry gds 558 H Marshall Furn Co 560 Louis Avrunin pawnbroker 562% Bibb Brkrg Co 564 Sami Chanin dry gds 565 Vacant 566 B F Smith horses 568 Jake's Shoe Store MACON Poplar 570 Vacant 658 C E Murphy ~gro 574 Exch Pharmacy 574% West Brkrge Co Acme Inv Co Second 612 Carstarphen Whse W A Davis wtchmkr H Williams lunch 659 J S Waldorf & Son gro Co whol cigars John Deeb lunch 612% J R McElrod 659% Macon Mach Gun Co armory 660 Ga Shoe Factory loans 661 Thomas Morgan 613 F X Daly Co Inc prod plmbrs J A Whiteside 613% Franklin Guar- nurserymn anty Co 662 Crystal Market Sou Loan & Real Est Corp 662% Central City Security Co 614 Louis Cohen dry gds 614% Cowart Cigar Factory 615 Coggin Printing Co M L Fleming tlr 616 C I Feb furn 617 Johnson Bros re- pair shop 617% Macon Hussars armory 618 R L Johnston gen mdse 619 Vacant 664 Watts & Co salary buyers 666 A L Harris meat 670 Thos Jabo gro 672 Vacant First City Hall City Mayor City Clerk City Board of Water Comnrs City Treas City Marshal City Tax Assessors Council Chamber 620 Walter Kessler City Recorder's dry gds Court 621 M C Few prod City Purch Agt Alley Board of Health 650 Betrus Isuf shoe City Play Ground repr Supt Edw Butler bar- City Health Dept ber City License Inspr 651 Ga Gro No 3 City Electl Eng 651% Floyd Rifles armory 652 A G Spencer billiards 653 C L Smith gro Kash & Karry Mkts 654 Jack Williams City Electl Inspr City Bldg Inspr City Engineer Police Dept Cotton ar nw cor Wofford Oil Co filling sta 715 D B Kelley lunches 757 J W Green 655 R T Momand 759 Mrs E A Clark Fish Co 761 Vacant 655% Macon Mach 763 M L Rogers Gun Co armory 765 Mrs E G Swift 656 Vacant 766 N Christophulos 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 Poplar STREET GUIDE Progress (V) 1103 767 H L Tompkins 118 Richd Hudson 615 Ella Watkins Herbert Lindsey 119 Viola Thomas 616 Dalton Jones 770 Vacant 120 Vacant 617 Emmett Jones IV ew 810-812 St Joseph's Catholic Church Martha begins 205 Chas Moore 210 St Paul A M E 618 Hannah Hill 619 Lawrence Jones 620 Hattie Richardson and School Church 621 Wm Jones 811 Riltmore Apts Apartments: 1 J B Sutton 2 A K Seibert 3 Arth Lewis 4 F S Bradford 5 W A Halm 6 R G Thompson 7 Annie Passmore 8 Vacant 9 C S Mathias 10 W H Mabry 11 Vacant 12 M T Phillips 14 Vacant 15 Vacant 16 E P McArthur 17 Vacant 18 Vacant Street continued 813 Georgian Apts 211 Augusta Evans 212 J H Estes 213 Mt Moriah Bap- tist Church 215 Minnie Daniel 220 D H Gray 224 Mary Pearson 224% David Chism 226 W H Ingram 232 A J Brown 234 Jas Watson 236 T H Harrell 248 Irene Smith 250 E D Stewart 622 Jas Oglsby _624 Evelena Grisby 626 Celia Davis 628 Jas Williams 630 Gus Hopkins 632 H C Coles 634 Emmett Riley 636 Sanford Abraham 638 Annie Johnson 786 Fannie Williams PRINGLE (E M) -- From Fort Hill west to Hill POWER HOUSE AL-- From Power House to Walnut between Franklin and Hill P R I C E (V) -- From 30d Ward e one blk 101 J M Taylor 102 Wm Harper 103 Lloyd Standifer 104 John Standifer 105 Rev A Collier 106 Cecil Spradling 107 Rosanna Hark- less Apartments: 1 G M Roberts 2 F S Klarpp 3 Mrs J B Massey 4 Louise Boutwell Street continued 814 Rev T D Madden 815 J W Harrell 817 Mrs L V Poe 820 C C Bray POST OFFICE AL -- From 4th to 3d in rear of Postoffice POWELL (E M)--From 414 Clinton south to Flanders, 1 w of Center 106 Chas Brantley 108 J H Glenn PRICE (W H)--Changed to Campus av PRINCE (S M)--From Telfair west, 1 s of Edgewood av 11 Lizzie Holmes 20 Thos Gordan 115 Geo Reed 145 Geo Banks 250 Wm Davis 252 Orange Hart 268 Wm Stewart 269 Rebecca Killings 501 Addie Taylor 503 Albert Hightower 505 Roosevelt Canady 507 Vacant 509 Vacant 511 Jerry Bennett 601 Lizzie Lee 108 Frank McElroy 110 Henry Jackson 112 Jeff Greeley 123 Lee Werner 600 Wm Collier 907 G S Mercer PROCTOR (V) -- West from end of Grant av PROGRESS -- From Forsyth south to C of Ga Ry, bet St Paul and Monroe 15 W J McElroy 21 Bradley Newsom 22 J E Brady 26 Mrs C M Newton 27 Vacant 31 Vacant 32 C J Toole jr , 110 F C Crayton 111 Emmett Rouse 112 Jesse Redford 603 Benj Lewis 605 Viril Coley 610 Sidney Fowler PROGRESS (S H) Changed to Colquitt 113 Thornton Ridley 611 Emma Thomas PROGRESS (Vi- 115 Nathaniel Solo- 612 Tho's Davis Changed to Roose- mon 613 Robt Bell velt Drink QsgCO&z in Bottles TELEPHONE 287 POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 1104 Progress A1 (V) MACON Rembert Av (H H) PROGRESS AL (V) -- 312 Hyram DeFore REESE (E M)--From From 907 Highland 314 Barney Whitman Milledgeville rd n, 1 av north 317 J L Watts e of Bowman RAILROAD AV--Con- 320 Nancy Holmes 321 Geo Townsend 102 Mrs M S Reese 110 F E Johnston tinnation of Einnett 3 Della Jones 12 Robt Rose 15 Tony Harper 22 P E Sims 39 Vacant 40 Starling Simon 323 O L Webb RANDOLPH PLACE (H H)--From 431 Lawton av north to Dannenburg av, 1 w of Duncan av REID (S M) -- From Waterville rd w to Broadway 4 s of Edgewood av 25 Chas Ringer 26 Vacant 41 Vacant 3 J T Stewart 27 John Earle 42 Eug Whitehead 4 W T Bartlett 28 Rubin Banks 45 Annie Vinson 127 Jennie Moore 5 B L Sutton 6 W P Meadows 29 Vacant Hall 202 Howard Robison 212 Susie Castelaw 218 Jas Crawford 220 Jesse Lewis 247 Clifford Nixon 248 Vacant 249 Leila Dillard 254 Clara Hardwick 7 J M Durden 9 J C Crawford 11 F C Glover 12 J A McCord 14 (112) Elsworth Hite15 Eula Donaldson 75 Mary Spikes 116 (16) Viola DEalvbiesrt 202 Mary Gaines 207 G R Hickman 208 John Hisler 211 S B Hartis 212 W C Hickman 310 Alex McCrary 466 Ashbury Jordan 467 John Wimbush 468 Edw White 527 Eliz Booker 528 Eliza Carter 530 Otha Smith 531 Thos Byas 607 Georgia Wyne 722 Lucy Range RANDALL AL (N H)-- 17 C V Evridge 20 (14) Fannie Un- derwood 23 S B Hogue 24 (20) Raymond Wainwright 32 (24) J D Stroud 33 (22) R D Lumpkin 35 (lliy2) J T Crenshaw 213 Ada Roland 216 Derias Myers 217 J A Whitten 218 D W Aides 219 Mrs Millie Hat- field 220 C J Hinton 222 (298) G F John- son 224 (300) S C Byrd 225 G T Bush 227 Milton Collins From 309 Pio Nono 102 (104) S B Rodg- 229 G A Epps av south ers 231 J W Shinholser 100 Rosa Taylor 104 (102) Gussie Riv- Chappell 101 (403) Lenus Jack- ers 304 W E Ward son 111 T J Tidwell 309 A H Epps 102 Wm Jenkins 310 G E Jarrell 104 (105) Alf Gilbert RANSOM AV (V) -- 317 W F Reid 106 (104) Robt Rhyn- From Clisby west, 1 319 A J Wilson er s of Vineville av 325 J M Britt 108 (404) Watson Jones 106 G W Head 326 (327) E M C'hristion 110 (406) Jos Collins RANDALL AV (N H) --From Church to RAY (E M) -- From Milledgeville rd east, 1 n of 3d av REMBERT AV (H H) av west to Carling av Broad 1 n of Lee REBECCA (S M) -- RANDOLPH (E M) -- From 360 Church w From Edgewood av s to Plant, 1 e of Col- to Center lege 101 B B Odom 102 W A Key E R Dozier jr 104 Lucy B Allen 109 Mrs Wilma Beggs 310 Mattie A Crib 100 P J McClung 114 G H McMahon Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy II. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET Rembert Av (H H) STREET GUIDE Riley Av 1105 115 F M Ingram 119 Vacant 122 C J Wilder 125 W V Meek 127 A T Ponder 128 Vacant 129 W T Turlington 130 W F Thames 131 A F Copeland 132 Rev B F Foster 133 R P Menard 134 Herbert Respess 135 Mrs A Worsham 136 Vacant 137 M L Hunt 138 S C Bronson 139 Mrs R Pritchett 140 0 E Leverett REYNOLDS AL-- North from Arch bet 1st and 2d 8 Georgia Tilman 126 Susie Hunt 712 Lucy Marsh 728 Laura Ford 775 Cleveland Williams 777 Ethel Hooks 779 Lewis Statum 780 Frank Tyson 782 C F Fuller 784 Dolly Mason 786 Lula Perry 789 Mary Jones 1220 Geo Dean 1221 Dan Parker RICHARD (E 31) -From Jackson north to Hall RICHARD (Unionville) --From Pio Nono av east, 8 s of Columbns rd 100 Mamie Smalley 102 (124) Rufus Mit- chell 103 Lula Jones 104 (122) Ernest Dav- is 105 (141) Nelson Har- 108 (120) Carrie Dav- rear Vacant is 425 J J Pridgen 109 (193) Jas Mom- 427 W P Barnes and 428 Ingleside Meth Ch 110 (197) E E Ross 430 M H Cleveland 111 (409) Wm Dee 506 Ewell Ussery RICHMOND -- From Houston av e to Kemper av, 1 n Grady 100 S C Griffin 102 Vacant 109 H M Blanchard 113 T M Paris 115 T H Williams 116 B H Garrett 119 F P Gardner 120 J M Samples 121 G W Corn 123 J H Mosteller 129 W A Wagner 508 C W Pittman 510 Vacant 513 (705) J H Harden 515 E A Burgtorf 517 L J Horton 525*R H Neel 640 R E Birdsong 642 Leo D Sheridan Cheston A Giblin 642% Vacant 671 N A Dempsey 675 M H Massee jr 692 J H Bailey 694 Mrs C H Weir 696 C H Bruce RIDGE AY -- (Vineville Dist) Crumps Park, 1 n of Forsyth rd 197 Wm H Ernest 200 F H Humphreys 201 J B Stevens E A Reynolds 203 N W Hurst 205 F W Cox 206 O L Blanks 207 T W Stokes 208 E D Brown 209 R E Johnson 210 W A Watson jr 211 HE Nottingham 300 J W Baker 325 C E Thwaite 326 F D Silas 329 J D Athon 362 Lee Davis 402 S J Benford 403 G W Fanning 405 J N Macon 406 A E Dean 410 R H Waterhouse 411 Mrs C E Adams 413 C M Clifton 414 P D Griffith 415 M C Quillian 701 R A Tharpe 702 G F Gilliland 704 W E Connell 706 McAllister Isaacs 728 C C Humphries 731 E H France 732 G P Bussey 739 J R Ellington 741 Myrick Hilsman 743 H C Calhoun 745 Wm F Black 747 Paul Brigham 749 F A Davis 751 R D Russell 753 Lee Bennett 757 John W Ramsey 798 G E Meier 800 R L Wilson 933 J O Cromwell 1004 C C Bennett 1006 J W Willums 1008 B Bowdie 1202 J A Selden 1206 A M Wing 1208 J B Hill 1210 Allen McDonald 1214 E P Mauldin 1216 M J Palmer 1218 J N White 1401 Orvis Robat Hardin 417 V G Tallent RILEY AV (Crumps 106 (7) Nancy Clark 418 E P Bonner Park)--From Forsyth 107 (152) Thos Hol- 423 S H Ferguson rd north, 3 w of Park lis 424 Vacant av FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO cn --.v*j o n3to * ttoo in Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 Dim 1106 Riley Av MACON Roosevelt (V) as a 102 L O Curtis 118 Abram Brown ROFF HOME LANE -- 168 J B Powers pbys 119 Walter Brown From Roff Home av MMET 170 H B Smith 120 Phil Barnes RITCHEY ALLEY (E 121 Edw Nottingham 122 Lucy Jackson M)--From Jackson n 123 Sami Huff w to Pio Nono av ROGERS AL -- From 619 1st east to Spring PUCE THE to Hall, bet Womack and Center 115 Richd Farley 117 Sami Norwood 119 John Williams 124 Eliz King 126 Sanctified Church 648 Emmaline Hart- well ROGERS AY (Y) -- From 561 Vineville av north 102 Karline Smith 125 Vacant ROCKLEDGE AV (Bel- 103 L B Holleman DIRECTORY 127 Richd Dean 129 Dave Fry levue)-- Continuation 104 T J Volk Robinson rd 105 A H Shipman IS THE GREATEST 131 Annie Hall 133 Silas Maynard 135 Lee Jester ROCKY CREEK ROAD --From Houston av w 2 blks s of end of car RIYERDALE DR (In- line 106 W B Morgan 107 W J Yeager 108 J H Pate 109 Mrs T S Fulghum 110 W J Noyes MARKET PLACE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * gleside) -- From Forsyth rd north to Overlook av, 1 w of Albemarle pi ROFF HOME AY (V)-- (Continuation o f Railroad av) -- From Duncan av west be- ROBERTS (Unionville) yond Pio Nono av, 1 --From Pio Nono av s of C of Ga Ry east, 1 north of Co- 107 R H Beach lumbus rd 100 Robt Edwards 101 (102) Chas Weav- er 103 (101) Chas Adams 104 R H Jackson 107 (106) R D Fields 109 (110) Sami Briggs 204 J H Watkins 110 Hugh McDowell 112 Wm Wynes jr 114 Brady McDowell 115 Benj Mathews 116 Reuben Liase 118 Rachel Cotton 163 Bibb Co Convict Camp 165 Roff Home Coun- ty Poor Farm W T Watson ROBINSON RD (Belle- 200 Manchester Sch vue) -- From Log 230 C D Amerson Cabin blvd west 231 Wm Foster gro 123 E Roy Johnson 233 W J Watson 111 W P Duncan 112 Mrs C S Davis 113 C C Corbin 114 T A Coleman 114% R H Hunt 115 R B Small 116 E B Weatherly 117 H W Pittman 118 A A Johnson 119 E C McMillan 120 J C Dismukes 121 Vacant 122 J T Matthews 123 Arth Griffith 124 Mrs Laura Smith 125 R F Jones 126 Vacant 127 Mrs Ruth W Ross 128 C C Forster 129 B B Johnston 130 H C Jetton 131 Vacant 133 J M Buxton The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year ROCK A V -- From Dempsey av south, 3 east of Pio Nono av 102 Jordan Brown 104 Mary Colbert 106 Sallie Jones ROCKHILL LANE -- From 105 Gustin av west 234 Frank Harris 236 R C Couch 239 Mallory Chapel 240 R C Couch soft drinks 240% J W Wright 242 Horace Nelson 244 Edw Bray 248 A F Causey 286 Mrs Edith Wil- Highland av ends Clayton begins 203 R J Etheridge 205 H H Myers 207 Vineville Kings Daughters Home 209 M M Thurman 211 R G Williamson 240 Monroe Perkins BLPoiKiGo PUBLISHERS 1 Lizzie King 10 Fire Baptism Ho- liness Church 109 Wm Cash liams 287 Vacant 288 Beatrice Massey 554 Chas Spinks ROOSEVELT (Y) -- From Penn west 1 n of H'>blni)d PolkDirecbrafflX DETROIT , V -MICH- J A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 Roosevelt (V) STREET GUIDE 83 (114) H Rober- 111 Benj Anderson son 113 Wm Stevens 93 (113) Anderson 115 Robt Smith 112 Hammond (120) Philip Scott ROSE LANE--From 5 120 Vacant Spring nw, 1 n Oe- 123 Vacant mulgee 124 Hattie Billingsla 134 Sarah Johnson 135 Manton Chaney 137 Winston Walker 138 Cary Dudley 139 Benj Ancrum 202 Eli Summers 203 Vacant 205 Jesse Maddox 207 Eug Lile 208 Henry Dillard 209 (258) Eva James ROSE PARK -- Continuation of Oak west from Spring to Orange 115 H W Robertson 125 Mrs E R Nelson 131 F W Drake 135 Max Weinstein 139 Estelle Anderson 143 C H Davis 147 Geo Schall 210 Rev Fred Dud- ROSE PLACE -- From ley 637 Orange west 212 J W Lundy 1 Roy Thompson 213 Reuben Davis 5 AC Baggarly 214 Vacant 6 M H Pearce 215 Milton Brown 7 J D Head 217 (230) Isaac How- ard 220 Jas Lawrence 222 Chas Smith ROSS--From junction of Columbus and Appleton av south to 225 Robt Coates 226 Hattie Bouyer 227 Teazer Stroud 229 Wm Lowe 230 (235) Lula Byars 232 (233) Geo Sand- ers 234 (231) Rev W A James 301 A B Fitzpatrick 303 (116) Henry Threatt 305 (115) Isaac Par- limits 103 J G George Columbus 106 P G George 108 P E Cross 122 Brady McDowell 130 Cath Lewis 131 O D Layfield 131 J T Simpson 135 Mrs A T Kimbrew Maple 139 Wm B Wright Oglethorpe 217 A B Rozar 307 (113) Ned Threatt 314 (114) Calvin Wilcox 218 Wm F Hooten 221 J R Rogers 222 R L Addleton 226 Vacant 227 W S Carlos ROSE CREST AV (S M)--From Edgewood s 1 w of 2d 101 Sim Cleveland 103 Jas Okins 232 W S Mansfield 233 Mrs Ettie Wills 239 Sami Gordon 243 J T Lindsey Hazel 105 Sami Johnson 307 Mrs Lillie T Willis 107 Robt Dye Chas A Pickett 109 Vacant 317 C E Ryle Ross 1107 319 J B Childs 320 A L Booth 321 A P McClelland M F Tyler 324 J J Samples 325 F R Samples 334 N C Hudson 335 Sallie Jones 336 R A Godfrey 338 S B Pettey 339 Mrs Lula Norris Ash 406 Wm H Plunkett 408 M L Hogan 413 Mrs E L Hollo- mon 416 D M Benton 419 J H Goodyear 422 R L Willis 423 Mrs N M Amer- son 429 O L Long 432 P H Williams 433 Mrs E C Young 434 Mrs M A Truman 436 Wm E Everett 437 Vacant 438 J C Burnes 440 H M Oliphant Elm 515 Chas Stark 518 Josephine Jones 519 Frank Mitchell 520 Vacant 521 Henry Jackson 522 B J Jones 523 A L Lovett 524 Chas Schofield 525 Asa Cannon 526 Pies Cannon 527 Alf Selmer 528 Laura Newkirk Edgewood av 602 Aleck Jackson 604 Mose Hughes 606 Sallie Fountain Mrs A M Watson drsmkr 608 Geo Colbert 608% Eug Statham soft drinks 609 Walter Taylor 610 Vacant 612 Jonas Coley 613 Clarence Thomas 614 Mary McGee RESS I TTV A IN 1 1A Y rYLE | JL 406 THIRD ST. | kj | USE YOUR credii TEL. 3026 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. 1108 Ross MACON School (S M) 615 Mary Wright 616 Dollie Dupree 617 Prank Oliver 651 Chas Boyton 652 David Coleman 326 (227) Simon Daniels 328 (240) Gus Marchman Crescent 101 Mrs K C Hughes 102 Mrs S E Moore 103 W H Whatley 104 A L Wyre 105 H M Bedgood 653 Chas Fallings ROSS STREET PLACE --From Ross e bet Maple and Columbus 1 Harry Waldon 2 Caroline Mitchell 400 (164) Thos Duncan Chas Thomas 402 (258) Mahalia Oard 406 (238) Henry Brown 106 B C Jones 107 J G Ryle 109 W R Brown 201 Mrs Willie Brock- mon ST PAUL--From For- 3 Chas Brogsdale 4 John Adkins 5 M S Simmons 7 Vacant 8 Vacant 9 Vacant 10 Prank Banks 11 Sarah Peoples 12 Oscar Myers RUBY (Y) -- From Highland av ne 1 w of Forest av 100 Cicero Parker 102 Morris Thomas sytli w to C of Ga Ry l w of College 1 Mrs Irene Mathews 7 Julia Smith 106 Fannie Brooks 108 W A Johnson 110 Wm Phelps 112 Roht Davis SCHATZMAN LANE -- From 421 Broadway west bet Cherry and Poplar ROYE (C H) -- From Randall av west to city limits ROYE (Y) -- From Pio Tiono av west 1 s of C of Ga Ry 108 S T Taylor RUTHERFORD AV (S M)--From 2928 Houston av e to Blount 101 W E Hendrix 108 Benj Griffin 110 F D Deal 112 Clayton Byrd 114 M W Moncrief SCHOFIELD (Y) -- From Hudson al north 1 w of Gustin av 44 Blanche Redding 46 Vacant 48 Laura Brown 110 Dock English 116 A R Chance 50 Vacant 150 Andrew Oliver 152 (114) Luther Hartry 118 N H Brown 121 H W Horne 123 Mrs F M Dyes 52 Ornex Baker 58 A L Davis 62 Reddick McCarthy 154 (113) Raford 125 J H Batchelor 64 Vacant Hampton 129 C D Griffin 66 Frank Walker 156 (203) Luther Whigham 206 Mrs Arsoline 210 J C Thurmond 68 Vacant 70 Jas Perryman 175 Henry Stephens 300 Mrs Mittie Sorrell 71 Percy Hughes 160 (115) Lewis Roy 162 (117) Vacant 164 Chas Thomas 302 C C Singleton 308 G W Jordan 400 Emily Hogan 72 Mary Griggs 74 Esau Porter 75 Lula Clark 169 Adolphus Mims 242 Frank Carnes RYALS AY--From 106 80 Jos Lewis Ransom av west 82 Lula Oliver 256 Moses Clifton 102 J B Mitchell 84 Ella Hall Bell 303 Wm Lofton 319 (170) Hampton Jordan 320 (274) Sami La- mar 321 (224) Annie Sell- ers ST JAMES AV--(Houston Heights) 101 Mrs Mattie Boone 102 R N McCowan 103 P G Heard 108 L E Cunningham 109 E C Copeland 130 Ella Hall 134 Crawford Adams 168 Pearl Chapman SCHOOL (SM)--From Houston av south 107 G W Wyse 111 Vacant 322 (223) Asa Fountain ST JOHN (E M)--From 115 W F Messer 206 Fort Hill west to 116 W M Gregory 324 (225) Vacant Church 117 L E Sasser B. F. MERRITT, Propr. 1st N.E. Cor. Ash St. Phones 4977 and 4978 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET School (S M) 119 O L Chambliss Chas Doctor C B Ryles Mrs Nora Fowler 253 A W Elliott 254 A E Bloodworth Knott SECOND -- From river south to limits, center of city Ocmulgee 100 S C Drake 102 Mrs M Cunningham 104 A B Lee 105 Mrs Julia Powell 106 W D Wells 108 J G Dunbar 110 W K McCrea 111 W G Elder 117 Mrs C H Owen 122 T O Chestney 123 D J Griffin 124 Mark Kessler 128 P M Chestney 151 Mrs Minnie Mason 155 C T Chappell 163 C I Feb 165 Mrs Florence Joina 169 Vacant Vacant 208-12 F C Lawrence 209 Gulf Refg Co sta 211 Vacant 213-19 Solomon Motor Co 216 H S Apel 220 Macon Ry & Lt Co Macon Gas Co Cent Ga Power Co Cent Ga Power Co Cent Ga Trans- mission Co Ga Public Service Corp Alley 256 Ideal Battery Co Co 258-60 Bibb Printing 258% Eagle's Club nw cor Court House Sheriff Tax Collector STREET GUIDE Tax Receiver Engineer Treasurer Bd of Pub Educa- tion Municipal Court Superior Court City Court Court 'Sten Court of Ordinary County Comnrs County Surveyor Solicitor Tax Assessors Juvenile Court Probation Officer Mulberry 306% Home Art Sup Co 308 L A Tharpe real est 310 Peter Calliano 312 Federal Clo Store 314 New York Cafe 314% Oriole Cafe 318 Vacant 318% Mrs L M Solo- mon mus tchr Fulton Inv Co 320 Hoppy's Place 320% Vincent Cani- pelli tlr Wall 352 Burtons Inc clo 354 Vacant 355 Reliable Outfit- ters 356 Newark Shoe Co 356% Empire Invt Co Carl Zemlich tlr 357-63 Wood-Peavy Furn Co 358 Phila Hat Clng Co 360 Strong Shoe Co 362 Hanover Shoe Str 362% Hinkle & Ruckin phys 364 F A Guttenberger music 365 Johnson, Durham & Burke furn 366 Mrs Dora Reese mlnr 367-69 Macon Elec Co 368 Canitol Theatre Second 1109 370 J H Sherwood mfg jwlr 376 Mitchell, Williams & Mack drugs Cherry S O Brockman barber 410 S S Chappell mfg jwlr 411-13 Natl Drug Store 412 Kash & Karry Market 414 Nutting Floral Co 414% C Y Woodall photog 416 G P Fuller books 416% Struby's Sch of Pharm 416% John Ellis tlr 417 Remington Type- writer Co 419 Dalton Add Mach Co 420 Ga Grocery 421 E T Napier real est 422 H & H R Huhn locksmith E C Brown cigars Duffy King confr 422% J F Lloyd sign pntr Alley 451 J T James auto sups 452 Ind Lndry Co 453 M A Clarke auto livery 454 Vacant 455 Maxwell Bros & Bridgers furn 456 L W Rogers Co gros 459 Am Furn Co 460 Nash Meat Mkt 461 Johnson Bros furn 462 Piggly Wiggly gro 464 Taylor Furn Co 466 Williams Gutten- berger Music Co 467 Hammond Service Co 469 Macon Credit Guarantee Co 317-319 Third St. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1110 Second 472 Bankers Finance Corp 470 Atlantic & Pacific Tea Co W B Dove phys F M Ingram den- tist 473 Dickey Auto Sup- ply Co 474 Piggly Wiggly gro Poplar 501-5 Sou Bell Tel & Tel Co 506 Aug Myers clo clnr 508 Vacant 509 Sou Bell Tel Co dist plant chf 510 Vacant 511 Beeland Conrad Motor Co whse 512 Loyd Newbern bi- cycles 514 D P Levine vulc 515 I O 0 F Bldg Sou Loan & Real Est Co J B Parker loans 519 Crescent Lndry Co 524 Vacant 526 Vacant 528 Mrs Lillian Thorn- ton gro Alley 552 Jones Motor Co br 552% J O Hagan loans 555 D M Roberts rms 556 Vacant 559 Mrs A J Erwin 560 Beeland-Conrad Motor Co W J Beeland contr 566 Wade & Co mach 570 Read-Pettey Fillg Sta Plum 601 Standard Oil fillg 606 Mrs L H Miller 607 D C Turrentine J W Williams 608 W V Reeves 610 W M Branan 611-15 W R Perdue bdg MACON Second 616 M P Harris 869 W H Brown 617 A D Holton 870 Mrs Mamie Le- 619 W V Epps Fevre 620 Lamar Cartledge 871 A H Robinson 622 Vacant Arch 653 W C Horton 902 Tabernacle Bapt 654 Morris Rubin Church 659 H R Powell 903 Vacant 667 Frank Leidy 90S N A Avant 669 R H Stevens 907 D B Dorsey 670 Alexander Sell No 912 J H DuBose 1 913 Andrew Durden 671 Henry Kaplan 916 A G Threadgill Pine Oglethorpe 706 J S Hill 1002 W H Robinson 707 T W Hines meats 712 R A Dix 1009 Vacant 713 J L Fickling 1011 W O Smith 715 Julia McCoy 1001 (1013) L W Rog- 716 J W Bridges ers Co 717 W H Jordan 1015 R R White 717% Mrs Inez Lang- 1016 W H Robinson ston 1017 Mrs M Tiseman 718 E D Gleason 1022 D M Bray 719 Mrs M G Boone 1023 Mrs M Stanley Mrs L R McKay 1024 Mayer Nirenstein 720 Mrs Eva Harris 1026 T H Hall 750 F W Williams 1027 W F Muecke 758 Isaac Odum 1028 Mrs W McCoy 760 (766) Mrs Lucy 1040 Coleman's Keene Pharmacy 763 Y W C A Resi- Y R Coleman phys dence Hawthorne 768 Michl O'Hara Oak 804 G A Hanse 806 J W Rittenberry 1200 Virgil Powers School 1219 Vacant 1221 M N Holmes 807 R T Chappell 812 Vacant 812% John Hurst 814 W T McPherson 814% J. J Bush 818 C O Williams Bernard Jacobs 1222 W W Riley 1223 R M Folkelman 1227 S D Roquemore 1229 Vacant 1231 Vacant 1233 Vacant 1235 Jos Sheppard 820 Myer Lutsky 1237 Mres Hannah Her- 821 Vacant ring 850 R A Cowart 1243 C M Dumas gro 852 O D Howell 1248 Mrs S F Warren 855 B W Smith 1250 Vacant 858 O C Turner 1252 Thos Terry 859 W M Brevard 1256 Fred Wimberly 860 R H Evans Hazel 861 W J Stripling 1304 John Poppell 863 R F Brooks 1305 J B Lawrence 867 Mrs M Bankston 1309 Andrew Eubanks 868 Vacant 1310 Mrs Jennie Curtis More goods are bought and sold through the Classified Business Lists of the Directory thaf any other medium on earth. Macon Transfer & Storage Company IDEAL BATTERY COMPANY ERNEST E. SMITH, Proprietor REPAIRS -- SALES -- SERVICE ^1 oKS Phone 4951 256 Second St. O HEAVY HAULING MOVING Second STREET GUIDE Second 1111 59 1315 T E Collier rear Wm Howard 1316 W S Ehney 1319 Vacant 1321 Vacant 1703 H T Cooper 2104 W E P Hooker 1704 Mrs Ruby McKin- 2105 J R Jordan ney barber 1707 H P Hartley 2106-8 Mrs Iva Ivey 1710 J D Skinner 2107 Macon Co-opera- pC3L 3S 1322 T W Amerson 1713 T E Wood tive Store 1327 D O Bailey 1328 D W Rittenberry 1331 E H Leonard 1333 Robt Humphreys 1335 Mrs Letha Thomp- son 1336 W W Harris Asli 1406 Horace Martin 1407 A C Nipper 1408 C E Langston 1409 R H Hoffman 1411 T M Amerson 1413 P A Young 1414 W F Rutledge 1415 G F Yetter 1421 Z B Young 1426 F R Pritchett 1427 T W Waterhouse 1432 L L Lee 1435 Mrs Birdie Green 1436 Britt Kennington 1716 Vacant 1717 H E Golden 1724 Albert Campbell Ellis ends 1802 B G Taylor 1803 Mrs Lou Wilson 1805 E H Harmount 1808 J B Randall 1809 Florrie Barker 1811 G H Wood Pebble begins Wood 1904 Vacant 1916 W A DeFoe 1917 Vacant 1919 M I Terry 1920 W R Chapman 1921 E F Newberry 1923 M H Britton 1924 Napier Apts Mrs M A Wilkerson Carl Thompson 2109 Vacant 2110 B F Knowles 2111 O O Wilder Jenkins 2120 2d St M E Ch 2132 Jesse Sutton 2133 John W Burke Sch 2134 Mrs Alma Avant 2136 J W Mc-Cann 2138 W J Ray 2140 H W Williams barber 2142 J S Bragg soft drinks 2162 J M Bloodworth 2165 Dempsey Gille- land 2166 Mrs Kate Avant 2169 L P Pritchett Wyche 2173 W V Peavy 2177 B H Campbell 1439 Second Bapt Ch 1925 R W Brice 2210 A F Welch 1442 J F Gilbert 1927 R G Ellis 2212 J W Vinson Elm 1928 Mrs Lizzie Reeves 2214 B F Wyche 1501 J C Giles 1503 C E Snipes 1504 R P Mitchell 1932 C C Hatcher drugs 1997 A & P Tea Co 2218 T E George 2222 Geo Harvill contr 1999 L W Rogers Co 2224 G M Boatright 1505 C A Nipper gro 2226 Vacant 1506 H B Lawson Nash Sausage Co 2229 E N Head 1514 Mrs M B Thomas 1515 C H McClelland 1520 W B Stafford 1521 Leo House 1525 Edw Andrews 1526 Fleming Johnson 1530 Vacant 1531 Mrs Eliz Brown 1534 Vacant Anderson begins 2231 C E Cannon Giles ends 2233 Melham Abr 2004 W M Smith 2243 Cahill & Abraham 2006 W C Evans gro 2007 E B Mercer 2245 MFD Auto Co 5 2009 O P Ivey 2281 Mrs Olie Heath 2010 H S Wilson School begins 2014 J A Hill 2301 G I Pierce 2017 H W Williams 2305 J A Roland 2018 A F Criswell 2310 Avery & Patterson 1535 J J Brown 2022 L J Powell auto pntrs 1538 Vacant 2023 Vacant 2312 W H Reeves 1541 J W C Mathews 2025 J N Reid 2314 C B Daly gro Edgewood ay 2026 Vacant 2322 F A Huthnance 1668 E M Sheffield 2028 W E Clark 2323 R C Teal 1674 Mrs Eugenia 2036 H D Clarke 2324 Mrs E A Couse Young 2035 Plummer's Bright begins Creamery 2325 T P Ryder 2327 H G Strayer *e0r Gordon Williams begins 2330 E C Nix a Amteuarstnoyfmokoribnaidllels koiofnwdmnseeorrcfshAaanurdteoismeso. eblieSlecetnLdipstrtoso.sHpeeOacutdsrqunfeaowrr- w o cCoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, sMkICfoHr. STORAGE W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 1112 Second MACON Second Ay (V) "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 2333 R T Cooper 2334 E L McPherson 2337 J T Grantham 2335 Mrs Spicey Shores 2341 R L Ketchie 2344 W C Wall 2345 B M Newell 2349 Mrs Alice E Cook 2357 J C Moore gro 23571/2 Vacant Ellis 2401 Mrs Mary E Adamson 2403 J P Hyatt 2405 B J Mercer 2415 I H McGrady 2418 J R Stine 2420 Mrs Tessie Yancey 2422 C M White 2436 Alice Johnson 2442 H H Riddle 2446 J T Smith 2449 S L Wilkins 2451 C R Smalling 2453 A C Young 2454 PI M Edwards 2455 J H Smalling 2457 C A Williamson 2480 J C Arnold Long begins 2504 A J Dame 2505 R J Croom 2515 Mrs M R Small- ing H L Barrow phys 2516 H A Gober 2520 J J Toole 2523 Mrs Hattie White 2524 H C Perryman 2528 C C Waters 2531 Mrs M E Horne 2534 W H Fields Central ay 2601 Mrs Mattie Dame 2602 D M Handley 2603 C L Bowden 2604 Vacant 2606 P W Newton 2608 O L Suggs 2615 R H West 2619 J F Eubanks Piedmont ay begins 2634 Mabel White Mem Bapt Church 2635 A C Busbee 2636 Vacant 2637 Mrs Sarah Powers 2639 Mrs Dora English 2640 L W Grady gro Williams Pharmacy 2657 J W Meadows barber G W Morris gro Durden & Math- ews clo clnr SECOND EAST (E M.) --From river to Clinton 1 s of Broad 143 R H Nelson Elliott 223 Janette Bell 231 Thos Nighton 305 John Danley 309 Frank Gordon 311 Ballard Grisby 315 John Lowe 319 John Buggs 320 Ida Ellis 321 Anthony Lamb 322 Arth Goodwin 326 Emmett Butler 328 Wesley Thomas 330 Union Baptist Church 357 Ella Bush 404 Martha Johnson 405 J B Smith 406 Wm Saleworth 407 John King 408 Marcus Veal 409 N C Williams Arlington 410 Jack Binson 412 Wm Billingslea 414 B T Brady 421 Noah Roberson 429 G W Taylor 460 Florence Moore 464 Jas Brown 504 Tobias Glover 506 Charlotte Wil- liams 512 J C Culpepper 513 L M Thomas 514 Vacant 515 Nelson Wright 517 Wm Taylor 518 Nathan Stewart 519 Chas McFallar 520 Otis Hardwick 521 Julius Franks 522 Milledge Campbell 524 Horton Rions 526 Minnie Harris 527 Anthony Ring- wood 528 John Butler rear Geo Ross Hydrola 531 Julia Clowers 534 Jas Sharp 536 J E Russell 538 David Price 539 Owen Waller 540 Edw Brantley 541 Pinkie Nixon 542 Andrew Butts 543 Peter Benn SECOND AT (Bellevue) -- From Industrial Home rd north 1 w of American Blvd SECOND AT (T)--Fr 403 Monroe west 22 Flora Shanks 39 Robt Clark 41 Adolphus Lane 43 Ella Felton 45 Eva Bass 48 Nathaniel Cornelius 50 Vacant 105 Marie Bryant 106 B'ennett Perry 107 M F Wright 107% Louis Robinson 108 Robt Hicks 109 F H Jennings 110 Vacant 114 Richd Barksdale 116 Danl Nixon 117 Jas Marion 121 Jeremiah Gilbert 124 P B Baker 129 Asa Gordon 130 Josephine Hill 133 S A Lockhart 137 Walter Brown 138 Pritani-\ Rogers 142 Bella Stokes 146 Elder Pope 148 Vacant 149 Leila Hurley Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Second Av (V) STREET GUIDE Shell Av (E M) 1113 155 Edgar George SECOND AV (N H) -- SHALLOWELL (E M) 158 Cornelius Jones Changed to Hendley --From Garden west 160 John Lassiter 168 Robt English 177 Sami Rhymes SECOND AV (W H) -- Changed to Virginia to Broad 2 n of Church 220 Alice Maynard av SHAMROCK -- From 221 W C McKinney College south to Ash gro 224 Isaiah Henry 225 Rosa Smith 226 J H Myers jr 231 Jasper Rivers 234 Robt Thomas 239 C H Hutchings 242 Chas Toomer 243 Chas Singleton 245 Jennie Stafford 248 Mary Abrams 253 J W Spearman jr 254 Emma Little 256 Mitchell Whit- field 260 Lee Hall 268 Mary Gray SEVENTH--From river sw to Hawthorne cor Enterprise Packing Co Ocmuigee 21 Wm Hubert 22 L M Moore 24 Raymond Garey 25 Mary Bowden 26 Mattie Alexander 28 Raymond Gilliard 100 O H Parr gro 101 Central City Park Walnut 221 Mattie Lowe 222 Sarah Pickett 1 w of Boss 96 Wm Phillips 98 Maria Dennis 112 Carrie Sweet 122 Chas Johnson 125 Wm Bivins Oglethorpe 212 N M Peacock 216 W H Bloodworth 218 Mrs Mattie Bridges 220 Mrs G R Williams 222 Mrs Mary Prince 223 Bessie Neely 224 W T Smith 225 John Roberts 275 R L Johnson 276 Felix' Thomas 278 Nathan Holmes 279 Mariah Gilbert 289 Johnie Flew- ellen 291 West Searcy 293 Jerry Flewellen 223 Lizzie May 225 Mary Bowden 227 Minnie Barnes ne cor Macon Supply Co bldg material Macon Lmbr & Mfg Co 314 J E MitchumHaZel 315 Etheridge Tidwell 316 J S Stevens 319 R D Tidwell 321 W C Bobbitt 328 J T Hunnicutt 330 Mrs Lizzie Fuller 295 Mattie Neal Mulberry 823 J H Smith 310 Robt Lewis Wall Ash 311 (312) R M Logan gro 313 Fannie Jackson 314 Obie Curtis 307 T W Holt broker SHELL AV (E M) -- 349 Hub Fish & Oyster From 52 Hydrola Co south 315 Addie Bowman 351 Seventh St Bapt 2 Geo Moore 316 Wm Jones Mission 4 Jas Roberts 319 Everett Tharpe 353 Allen Lewis 6 Julia Bozeman 324 John Turner 355 Sami Harden 8 C H Bozeman 327 Vandavill Huff 357 (10) Richd New- 10 J H Brooks 328 Monroe Goodrum som 12 Howard Bozeman 330 Harmony Bap Ch 359 Chas Young 14-16 F T McGill 340 Liza Bonner 341 Robt Howard 364 Alf Bowman 368 Mary Boston 369 W C Carter 372 Wm Sams 375 Jas Clowers 361 Ada Young Cherry cor Willingham S & D Co factory Poplar SEVENTH AV (Belle- 18 J W Brake 20 Vacant 22-24 Bailey Wallace 26 Arth Wade 28 Dewey Brantley 30 Ida Lavender 32 C F Lavender SECOND (S H)--From vue) -- From Indus- 34-36 Chas McGahee Enterprise to Nel- trial Home rd north 38 Myrtle Howell son 2 w of Water- to Atlantic av 1 w of 40 Marvin Howell yille rd Sixth av 50' Wm Smallwood A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit We Do It Right R P 0 L L U L M E B R I N & G M 1 H L E L A I T R I 0 N N G S BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1114 Shell Av (E M) MAOON Simmons (S H) 52 Mary Williams 307 Harry Pitts 104 (489) Marsenia 59 Jas Pickett 311 Viola Jackson Butts 113 A L Watson 315 Burney Pults 105 (486) Ora Allen 134 H E Wade 317 Judge Goodwin 107 (487) Wm Jones 419 Hadie Hyatt 318 Emma Wilcox SHORT LANE (E M)-- SHERIDAN AV (V) -- From Grant av to Forest av 2 n of Highland av SHERMAN (V)--From Grant av to Forest av 1 n of Highland av 319 Walter Billingslea 321 Mamie Green 323 Chas Green 325 (125) Isadore Rowland 328 Mamie Thornton 411 Thos Moore 414 Geo Cooper 419 Robt McCall 424 (24) Sydney From Woolfolk n to Cowan bet Lexington and Clinton 107 Chas Dumas 109 Estelle Wilson 110 Edith Moore 111 Frank Vinson 112 Andrew Glover 150 Clarence Robinson SHOALS (E M)--From Ash west 1 s of Clinton Clements SHORT ST LANE (E 426 (23) Daisy Hutch- M) -- From Bowman ins west to Short 518 (18) Corine Bry- 1 Wm Gardner SHOALS AL (E M) -- son 2 Amanda Gardner From 416 Clinton s 520 M L Milton 3 Mamie Wilson I w of Center 720 Peter Hammock 4 Phillip Turner 5 Jas Billings 914 (14) Benj Braley 7 Sarah Hollomon 412 Marietta Anthony 979 Claude Brown 9 Edmond Curry 450 W M Sherman 14 Edw Farmer 453 Davis Key 611 Geo Blount 612 Chas Butler 613 Wm Mims SHORT (Payne Mill)-- From Davis e to Green 1 s of Payne 16 Thos Howard 18 Hattie Bailey 20 Danl Hodges av SIAM (E M) -- From SHORT (E M)-- 74 Henry Collins Clinton to Broad, 2 4 Boysey Johnson 5 Henry Johnson 6 Chas Barron 7 Harvey Stewart 7% Richd Carr 8 Belasco Hogan 8% Emanuel Bivins 9 Willie Golden 10 Marsh Mont- 75 Wm Perkins 76 Sarah Kimball 77 Jerry May 78 Mary Goodwin 79 Chester Cochran 95 Mollie Arnold 96 Mary Peeler w of Center 20 Robt Bird Nina Powell 22 Maude Shaw 24 Tobias Brown 25 Arth Mitchell 321 Danl Dumas 557 Jas Littleton 559 Sol Williams gomery II Norman Hicks 12 Wm Redding SHORT (S M) -- Be- 568 Mary Williams tween Henry and 571 Lula Gordon Heard 1 block long 579 Chas Shelly 107 Wm Wilburn 120 Wm Midds 200 Rufus Grigsby 212 Marshall McGriff 107 A R Johnson SIMMONS (SH)--From SHORT (V) -- From 769 Third av n Hanson south to Rutherford av, 2 e of Houston av 214 Wm Howard 215 Henry Stewart 216 Emma Moran SHORT AL (V)--From 115 Lamar west 201 O M Adams 203 L H Shelley 204 Seymour Driggars 226 Carrie Redding 100 (485) Thos Wil- 205 C C Bender 300 Daisy Hutchins son 206 Vacant 301 Edmund Bushing 101 (282) Lena Tasker Cleveland 303 Jos Sinclair 102 (488) Wm Butts 301 H L Hollis 305 Emma Laney 103 (484) Wm Gouder 302 J R Shellev 415 Third Phone 5113 FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R- L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 - Simmons Av STREET GUIDE Southern Heights 1115 SIMMONS AY (Belle- 316 W P Frazier 598 (506) John Rob- vue) -- From Log 326 Mrs M V Addison Grts Cabin Blvd west 1 n 336 W H Strozier 608 (308) Ida Little Columbus rd 346 T H Starling 610 (203) Julius 118 Malichia Fraley 234 John Simmons 382 Edgar Mattox SMALLING AL (S M) --From Long south Swiney 611 Ellis Haynes SMITH (S M) -- From SINGLETON'S LANE-- SMITH (E M) -- From Hall w to Broadway From 218 Spring e Jackson north to Mit- 6 s of Edgewood av to New chell 1 e of Fort Hill 9 Pauline Odom 260 Dissie Stone 99 Isaac Reid 10 Bettie Rouse 262 Mariah Beasley 100 Eugenia March- 11 Vacant 264 Carrie Brown man 22 Vacant 270 J H Nelson 102 Allen Payton 40 John Ellison 272 Vacant 103 Junior Swiney 78 Jas Smith 496 Cora Dixon 104 Alonzo Williams 120 (17) John Brown 498 Dora Preston 105 Jas Stevens 122 Mrs Mary Goodson 500 Solon Harris 106 Elder Bell 200 (5) Julia Wynn 552 Mary Phillips 107 S S Barnes 202 (4) Minnie Bros- 555 Lucile McKenzie 108 Lavinia Jordan well SIXTH -- From river south to Hawthorne 1 e of Fifth Ocmulgee Walnut ne cor Macon Gas Co Mulberry Wall cor Kinnett-Odom Co ice cream mfrs Mulberry ne cor Sawyer Coal & Ice Co Cherry se cor Builders' Lmbr Co Poplar 109 John Jordan 204 Dennis Cleveland 110 Wm Thomas 206 (2) Morris Royal 211 dll) Eliz Moore 207 Zudie Minton 300 John Hill 209 Minnie Smith 301 302 (201) Effie Vaughn (202) A W Wood SMITH AL--From 1st e to New 723 303 (201) Mary Dean SMITH ROW -- From 305 (203) Alice De Oak w to Arch bet 1st Shazar 307 (205) Gussie Crew and 2d 52 Henry Gary , 309 (130) Geraldine 53 Chas Might Abram 321 John Jackson 324 Wm Jackson 104 Mattie Caesar 515 Wm Wright 550 John Ivory 400 Rachel Washing- 552 Lewis Flournoy ton 554 John Burney 502 (402) Henry Hall 559 Willie Jordan SIXTH AV (Bellevue) 524 Emma Moreland -- From Industrial 533 Hattie Sampson Home rd north to At- 535 Allen Parker 560 Ben) Braswell 564 Chas Crapp 855 Emanuel Hymes lantic av 1 w Fifth av 537 (114) Anthony SOCIETY -- From 993 SIXTH (S H) -- From Enterprise to Nelson 6 w of Waterville rd Johnson 539 Jesse Ford 540 (248) Cleveland Donaldson # Cowan n to Cemetery bet Short and Bowman 100 W F Hall SIXTH AV (S M) -- 547 Ruby Ross From 248 Plant south 549 (449) (Frank to Jeff Davis Hampton 208 A L Roberts 595 (501) M J Red- SOUTH BOUNDARY-- From 543 Calhoun west 210 Vacant ding SOUTHERN HEIGHTS 216 Vacant 596 (504) Chas Daw- --South of city lim- 222 W E Grant son its and e of Colum- Tenney av 597 (503) Alice Jordan bus rd City Directory Answers All Questions as to , WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work R. L. POLK & 0) V o:b CM gen a, 0> (u SP a o CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1116 Sparks Alley MACON SPARKS AL -- From 82 Wm Swain 520 Washington av 84 L W Rogers Co west to Forsyth, bet gro Madison and Monroe Nash Meat Mkt 1 Carrie Taylor Ocmnlgee 2 Mamie Richards 103 A S Sellers 3 J H Nelson 104 R R Hawes den- 4 Hanna Henderson tist 5 Thos Woodard 105 Lura Jones 6 Oscar Waters 107 Garfield Stevens 7 Wm Roberson 108 Emma Monroe 8 Green Howard 109 Lumy Park 9 Richd Lawrence 111 Thos Smith 427 John Parker 530 Danl Bowden 537 Margie Kendall 750 Wm Wood 755 Mary Williams 757 Sarah Smith 112 Jos Poline 113 David Brisco 114 Rosa Farley 115 Katie Jones 117 Lucy Smith soft drinks 122 Annie Moore SPRING--From river s to Washington av and from High south to Orange, 2 w of 1st 2 W B Bullock 4 F C Brown 5 Joshua Phillips 152 Susie Woodard 163-65 Spring St Apts 1 W S Turner 2 H P Strickland 3 S R Adams 4 Wm Segress 5 E T Willingham 6 A D Torrence 6 W B Jordan 7 W R Torrence 8 Jesse Bivens 8 C B Grace 9 Geo Mann 12 Texas Lewis 14 Emmett Lockett 15 Fannie Barton 16 Eug Pender 17 Benj. Cobb 168 W N Brinson Walnut 204 Mrs Rena Gardner C D Brazzeal 208 C F Stewart 212 F L Dunwody 215 Annie McKervey 20 M E Butler 218 J W Minter 23 Seabron Strozier rear Bitha Johnson Willow 54 Zeb Harris 55 Mrs Eugenia Hamilton Mulberry 318 Mrs S L Stubbs G W Dial J W Seastrunk 320 C J Yates 57 U C Ragon H K Brown 58 Richd Wilson 354 W A Wright 59 Addie Greeley 61 E D Williams 67 Anna Hambry 68 R S Smith 70 Ella Quaintance 74 Dulie Latimore rear Wm Banks 358 R W Clark H G Williams rear Geo Rooker 364 C T Johnson C F Hooper 371 A M Bentley 76 Jas Nelson 80 Fredk Johnson J W Nash Cherrv Spring 403 Bernhardt Goldgar Nisbit Place 409 E H Dunn 413 Mrs J T Smith 422 Carrie F Colbert Magnolia 446 Wr W D Nottingham jr 451 C J Robertson R M Fullington 452 J M DeBorde 457 W S Simmons 458 W H Burson 460 E H Simmons 461 Henry Sharp R E Mann 463 H L Whitehead Clarence McCommon 467 R E Aven 469 Vacant 475 Mrs E M Fitts 477 W W Stripling D A Shirley Washington av Plum 612 R E Hartley 615 J N Weaver 616 Chas Moore 619 J W Austin 620 M A Jenkins 653 B S Hannah 659 J H G Williams 663 W E Wilson 672 Tharpe's Phar- macy Cotton av Pine 700 H B Brown U M Penn 710 Middle Ga San Nurses Home 722 Middle Ga Sanatorium 752 F R L Stroberg 753 H L Merkel 754 Vacant 756 W A Boggs 759 R L Finney 765 L D Palmer j FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION I DETROIT R. L. POLK & CO. CHICAGO LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings Spring STREET GUIDE Stratton (S M) 1117 771 Mrs H E Holsen- 418 Wesley Felton STINSONVILLE -- 4 beck 419 Red Strickland miles w of Court Mrs Eudora Slo- 420 Maltine Mathis House, n of Forsyth cumb Oak 802 Magruda Andrews S B Ivey 804 J P Shouse 421 (1313) Wm Robin- rd son STONEWALL PLACE 422 (1318) Mattie (V)--From 715 Vine- White ville av n 806 Vacant 426 (1323) Robt Tell 105 C C Culpepper 808 Geo N McCook 428 (1322) Wm Camp- 107 Herbert Loynd 810 A I Blum bell 109 S L Farrar 812 G T Douglas 430 (1320) Lee Grant SPRING LANE--From Spring e, 1 s of Mul- 456 Oscar Wisdom 458 Edw Tigner berry 722 (422) John Ken- 1 Ida Lester dall 3 (2) Della Turner 750 John Lowe 5 (4) Mary Bass 7 (5) Wm Jackson 752 Benj Davis 9 (6) Christine Nelious STEVEN'S AL (S M) -- From 15 Elbert south 111 G M Carr 112 Mrs L Broxton 113 Mrs Mary Brant- ley C W Tucker J M Epps 114 J B Allen 115 Vacant 116 J T Davis 117 W C Mosley 118 E C Wilder 11 (7) John Mitchell 301 (30i3) Edw Reese STEVEN'S SQUARE (S 303 (304) Jas Carson M)--From South to 350 Mary Jones Elbert nr Sou Cot- 356 (355) Cornelious ton Oil Mills Beal 360 Myra Smith 362 (354) Wm Banks STEVENS (S H) -- From Enterprise to Nelson, 3 w of Water- 119 E A Schaefer 120 J H Crawley 121 L J Knight 122 D L McGuire 123 T N McKibben 124 Vacant 125 H W Criswell 127 R A Williams STARNES AL -- From 520 Hazel s to Ash ville rd STEWART (E M) -- STRAIGHT (Unionville)--Crosses Pio STEELE (S M)--From From Norris to May- Nono av, 5 s of Col- Waterville rd w to nard, 1 block n of umbus rd Broadway, 2 s of Broad 231 Wm King Edgewood av 223 Henry Lee 309 Chas Pitts 114 W J Harrington 225 (25) Augustus 310 Edw King 121 R L Jones Jones 124 S L Dixon 227 Wm Battle 125 W P Harrington 126 Vacant STEWARTS AL--From 127 Mrs Annie McGer- Madison to Monroe ritt ibet Jefferson and 311 Danl Everett 329 Wm Hawkins 470 Sami Rose 604 Ruth Wilder 606 Geo Clyatt 128 C C Middlebrooks Jones STRATTON (S M) -- 132 B E Rummell 133 O L Clements 134 C E Wood 136 Vacant STEWARTS LA -- From College e bet Shamrock and Ap- From Elbert west to Broadway, 3 s of Edgewood av pleton av 103 E C Jeffers STEINS AL--From 420 Hazel s to 421 Ash 104 Prank Hopkins 416 Henry Thomas 1 Fannie Gibson 2 Martha Chapman 3 Anderson Walker 104 W W Kitchins 107 C A Leverett 114 D W Raley 116 Mrs Annie Rock- 417 Henrietta Parker 4 Julia Walker more Automobile owners are select prosjiects tor many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains muck valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. | Publishers 536 S. Clark St. Chicago, 111. 1118 Stratton (S M) MACON Tatnall Lane 121 J P Gufford 149 F E Roush 113 Lucius Minor 122 Lonnie Williams 150 C T Bailey 114 J F Lewis 124 E B Mercer 153 R L Crandall 116 Jas- Bond 125 W 0 Dye 154 M W Orr 117 Dr C W Dyer 126 J C Malone 157 W B Oneal 118 Jas Leslie 128 Eldred Wilder 158 S E McKenna 119 T B Bradley 331 J T Hill 162 E H Middlebrooks 120 H W Wilson 132 Mrs Tabitha Parker 134 R W Freeman 135 L D Davidson 137 E E Stewart 142 E D Flowers STRAYER'S AL (S M) --From 2420 2d east 122 Geo Curtis 306 Ida Winn 658 Monroe Grier 1209 Vacant 2436 Ralpli Hutchings 2437 Vacant STRIPLING AL (E M) --From 813 Main n to Applewood 7 Mittie Lane 9 Carrie West 11 Thos Walker 12 Gilford Slappy 124 Frank Toomer SYCAMORE (V)--From 205 Forest av west 115 Laura Howard 117 Wm Baull 117% Henry Whigham 119 Fannie Holloway 121 Norman Rake- straw 122 Mattie Simms 124 Mary Young 128 Martha Lockett 130 Henry Johnson 132 Thos Caruthers 134 Lizzie Shivers 136 Herbert Morris 138 (141) Ellen Jor- dan 140 (138) Manda Davis 141 Jas Brown 142 Rev D G Wood 143 B C Lowe 121 Wade Hampton 122 Lucius Ellis 143 David Greene Chestnut 202 Mrs C E Martin 204 Vacant 206 S B Fielding 208 W A Thompson 217 L C Hicks 219 C D Lavender 221 H S Connell 222 J A Scarborough 223 O L Martin 229 Vacant 230 Mrs S E Robinson L J Utley 232 G W Griffin 233 Oglethorpe In- firmary Nurses Home 234 S A Edwards Oglethorpe, Hazel, Ash and Elm SUMMIT AV (N H)-- From North av w to Boulevard 100 Michl Lettice 101 C S Joyner 104 T H Halliburton 110 J A Jackson 112 S S Chandler 116 Vacant 117 E W Smith 118 T E Crimmins rear Rebecca Tuff 121 J W Holland 126 J D Little 127 J O Hodges jr 144 O L Ellington TATNALL LANE -- 146 (145) Lee Oli- From Tatnall to phant Adams, bet Chestnut 148 (146) Rufus Mor- and C of Ga Ry ris 1 Richd Billingslea 149 Chas Solomon 2 Frank Holmes 150 (147) Missouri 3 (4) Cedan Greeter Brown 154 Horace Smith 4 (650) Callie Rogers 156 Adolphus Latimer 158 Ida Gilbert 160 W C Youngblood 162 Braymon James 164 Annie Chaney 10 (3) Nellie Hall 11 (652) Lake Josey 12 (654) A L Smith 111 Wm Phillips 113 Wm Evans 117 (119) Brown's Chapel 129 H D Cutter 130 Edw Lettice 133 R L Ziegler 134 I E Burkett TALMAGE (Y) -- From 119 (117) John Prit- Cleveland av west, 1 s of Vineville av chett 120 Mattie Merritt 122 Jacob Flanders 138 Mrs D L Stamps TATNALL--From For- 124 Wm Houston 145 C W Stroberg syth s to Elm and sw 126 Ashma Dixon 146 L A Graybill to limits 263 Alice Jones 147 J A Mitchell 111 W M Lawson 264 Eliza Smith E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS CARS - TRUCKS - TRACTORS hIffoarvIet'asit.aFoFrodr,d woer PHONE 1581 JONES MOTOR COMPANY 557-558 PLUM ST. Tatnall Lane TATNALL SQUARE -- West of College, bet Oglethorpe and Ash TAYLOR (E M)--From Fort Hill east to Williams TAYLOR AY--From 30 Hydrola e to Clinton 28 Carrie Wade 29 John Wade 30 Henry Bray 31 Lee Snow 32 Wm Benson 33 Wm Jones 34 Sami Akridge 35 Mrs Coral Lyles 36 Eliz Newberry 37 Frank Taylor 38 Leo Hornsby 39 Mary Edwards TELFAIR -- From jet of Hawthorne and Hazel, s of limits 100 Robt Clark 101 Ida Buckner 103 Troy Jordan 115 Fred Sanders barber 117 Andrew Cheese 121 Jas Patterson 105 Jerry Risby 123 G J Foreman 127 Jacob Jordan 131 Louis Humphreys 163 Chris Marden 165 Isiah Jackson 167 Loretto Spivey 168 Henry Williams Ash 203 Jas Huff 215 Geo Glowers 216 J W English 217 B B McClendon 218 Isom Evans 220 David Foster 221 Wilson Stevens 226 OhP'--.TTter White 227 M L Fleming 229 Forrest Howell 230 Tiny Cater 232 Thos Germany 233 W F Singleton STREET GUIDE Texas (S M) 1119 234 Chas Caslin 616 Mrs Hattie Ford- 235 Garland Singleton ham 236 Sami Stone 618 G A Bigler 238 Henry English 633 Mrs Augusta Elm Jones 302 Jas Fitts soft drinks 304 Melton Howard 310 R W Underwood 312 Jas Grimes TENNEL AY (8 1)From Edgewood av s to Plant, 1 w of Campbell av 313 Georgia Roberson 314 Laura Middle- brooks 315 Jack Robinson restr 392 India Woods 394 Maria Meredith 396 Mattie Spann Edgewood av 419 Vacant 425 Mrs Freddah Waters 429 Mrs Ida Oswald 442 J W Thomas gro TENNEY AY (S M)-- From Jeff Davis av w 2 s of Plant 116 J H Dunn 118 E L McCullough 119 Vacant 122 T A Gibson 123 C E Jones 125 L C Clark 128 E B Ashbell Jeff Davis 131 C E Bailey 134 F F Springer 138 B M Tucker Bright ends 139 Mrs S C Lamon Prince ends 141 F L Finney 502 Edw Moore 143 P T Hamilton 504 S J Johnson 148 Mrs L Scarbor- 505 Henry Miles ough 506 Mrs Sallie Green 150 E F Brunson 507 Richd Mullis Sixth av 510 G T Massingale 512 Talbott Miller 513 Mrs Dollie Holl- ingsworth 518 L M Cordle TENTH--From Central City Park, west to limits 1 Bibb Brick Co 520 Elwyn Studebaker TERMINAL AY--From 528 M F Gray 532 Mrs Mary Mills Mulberry to Poplar bet 5th and 6th 535 J L Herring 538 J T King Pebble ends 545 Mrs Mollie Atwell 1 Vacant 3 T C Burke whse 5 Ruan & Co brok- gro 549 W H King 551 J T Smith 553 Vacant 7 D W Hill broker 9 Ouzts, Mitchell & Whaley brokers 557 W F Stephens gro TEXAS (S M) -- From Henrietta begins Enterprise south to 603 H F Herring Nelson, 1 w of Water- 605 Vacant vill rd 607 H M Jones 100 (140) Luther 614 Mrs Mollie Camp- Banks bell gro 101 Lee Johnson 1 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r The most comprehensive reference work on tne hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Ave. 1120 Texas (S M) MACON Third 102 Ulysses Thorpe 304% Ga Invt Co 363 Hotel Dempsey 103 Henry Bowman T L Woodward Dempsey Barber 104 Vacant dentist Shop 201 (220) Henry J M Coppage phys Dempsey Billiard Fudge Jos Davis Parlor 203 (223) Jas Sealey Morris Moses ci- Yellow Cab Co br 400 (100) Alonzo gar mfr 364 Jacob Lazarus Zackery 306 Harry Wright furn 401 (190) Ida Wash- seeds 366-70 Citizens & Sou ington 306% Jos Davis fruits Bank THARPE -- From Industrial Home rd s 1 w American bird 308 Michl Burg dry gds 310 S Jones Co gro 311 Levy's Jewelry Citizens & Sou Co invts Cherry nw cor A Schulte ci- THIRD--From river s to limits, 1 e of 2d 101 W S Bell 104 W R Barnes T Z Fogarty 109 C A Allen 110 D N Sealy B N Sealy confr 115 Vacant 119 J O Martin 120 W H Clifton H P Sandifer Store 312 Jarrett Paint & Glass Co 313 Minnie Sheftall barber 313% Vacant 314 Geo Poulos restr 314% G F Parker pntr 315 Ries & Armstrong jwlrs 316 Vacant 317-19 C H Hunnicutt gars 402 Midland Pharm 404 Jacob Arenson shoes 406 Day's clo 408 W T Grant Co dept str 411% R E Solomon dentist 413 Mrs Lizzie Gold- man pawnbroker 414 Royal Shoe Store Eustace Spillers C F Williams 121 R C Garrison 123 J P Fitzpatrick Clo Co 415 Roller & Millirons 318 Macon Barber Sup Co 320 Pic and Pay Gro plmbrs 416 Askin's clo 417 Vacant 153 W I Horton 321 Vacant 418 G P Rankin & Co J D Murphy Wall dry gds 157 W E Lester 350 Burden, Smith & 420 N Y Waist House 161 Julia Lawrence Co dept str 421 David Fleischer drsmkr 353 Max Lazarus jwlr pawn broker Walnut 353% Monica Court 421% Macon Trading 210 Albert Harris auto Wallace Miller & Invt Co Indry 211 Christ Oh Parish House 212 M C Sheffield auto lawyer 450 S H Kress & Co A L Miller lawyer 451 Merritt & Co gro J J McCreary law- 456 Dunlap Hdw Co yer 457 Willingham Sash repr L C Dodge & Co & Door Co 214 L F Bailey 214% T A Cobb 215-19 W B Brooks garage accts Turpin & Lane lawyers 355 Sandefur-Har- well Clo Co 458 Collins clo 459 Vacant 461 Willingham Loan & Trust Co Willingham & 217 C H Roberts autos 358-60 T C Burke Inc Payne ins 218-20 Coleman Motor bldrs sups 461% Com] Loan & Inv Co 359 Mrs Alice Easter- Co Mulberry day mlnr J R Marcus 300-2 W A & J A Spil- 361 Macon Shoe Co ler restr 362 Vacant R H Smalling Sons contrs Amuatnoymkoibnidles oofwmneerrcshaanrdeises.eleScetndptroosHpeeacdtsqufaor-r ters for all kinds of Automobile Lists. Our new cCoaptya.log coRnt.aLin.sPmOLucKh &vaCluOa.,blDeEdTaRtaO.ITA, MskICfHor. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS Third 462-70 Dannenberg Co dept store 463 Jacob Arenson dry gds 469 Ga Seed Store 471 Kingman & Ever- ett gros 471% R G Stripling barber Murray Prtg Co Poplar 508 Vacant 508% E B Grace 510 Macon Adv Ser- vice Sou Paint & Var- nish Co 512 John C Ellis Co paints 512% lee Building J G Barnes furrier Jackson & Co loans Sou Loan & Real Est Corp 514 Vacant 517 Humphries Sheet Metal Wks 517% T I Harris & Co loans Max Morris Sch of Pharmacy Sou Loan & Real Est Corp 518 McDaniel Hdw Co 519 Karsten & Denson Co Macon Hatchery 521 H L Moore & Co gro 550 C E Hallman auto repr 551 Flourney Auto Co br 554 D B Griffin 555 R L Wayman auto repr 557 S 0 Kenyon 561 Williams Mfg Co auto dept 596 Hatcher Hdw Co 598 A S Hatcher Co vehicles Plum STREET GUIDE 600 Red Star Pilling sta 601 Phoenix Hotel 603 L & N Drug Co 607 Bearing Supply Co 608 Sadie Abdoo 609 Ga Auto Co reprs 610 Sadie Abdoo restr 611 H D Howell auto repr L A Mitchell feed 612 E D Gleason vet surg 612% B B Ford & Co cotton buyers J P Roosevelt cot- ton buyers 614 Vacant 617 W T Tharpe & Co live stock 618 Ellis Motor Co 620 Vacant 621 Ellis Garage 622 Manget Bros Co cotton 651-53 Vacant 652 Vacant 652% Central Cotton Oil Co 654 Southern Duco Enameling Co 655 W G Lee livery 655% Vacant 656- tor Co 657- repr 663 E T Willingham auto repr 682-90 Dunlap-Huck- abee Auto Co 687 Stewart Plating Works 689 Dickey Auto Sup- ply Co br Hammond Oil Co Pine 701 Farmers Exch gro 703 Vacant 706 Vacant 707 Yates Motor Co Third 1121 708 E H Rand cotton buyer W H Shadburn auto tops 710 Williamson, Inman & Co cotton buyers McNair Bros cotton buyers 712 Ga Battery & Vulc Co W E Bartlett tinner 713-15 H A Burke autos 714 A E Park furn rms 716 Mrs Mattie Stanley furn rms 717 G H Parrish auto repr 718 Jennie Brown 753 G M Jones 763 W F Evans 765 Wooten Marble Co 767 Mrs Leila Ivey screens Oak 802 J C Edwards gro 808 Mrs Callie Wallers 812 Mrs Sarah Will- iams 816 T J Bush 817 Edw Bryant 818 S M Hillard 819 Sarah Graham 821 Mariah Hunter 5 5 851 Vacant 856 Vacant 857 Vacant 859 Mrs Bertha Lewis 862 Mrs Luella Bos- tick W L Johnston 865 W R McCoy 866 J P Webb 871 J T Cooper Mrs Claudie Dozier Arch Auto Fire Co No 4 900 Macon Orange Crush Bottlg Co FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L POLIi & CO. CHICAGO HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER F, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 mm 1122 Third MACON Third as a City Weighing & 1332 Mrs Ella Trues- 1716 J C Mitchell Inspection Off- dell 1717 Mrs Eliza Ether- ice 1333 G C Willis edge MiKET Oglethorpe 1335 E L Sitton 1005 W C Petner 1723 Mrs A L Stewart Ash 1726 D A Nottage 1021 H L Brown 1405 O H Booker 1728 C S Mize 1025 Robt Jackson 1411 G G Jackson ElUs !PLACE 1031 W D Watson 1414 G R Griffin 1777 Mrs Dollie Whit- se cor Turner Taber- 1419 C A Burnette nacle A M E 1420 Jos Sharpies 1778 B L^Keith THE Ch 1421 Mrs G A Durden 1780 G A Thigpen Hawthorne 1424 J S Avery 1782 V A Hollomon DIRECTORY 1200 Vacant Bay 1425 Vacant 1427 W J Garrity 1783 J L Anderson Mrs Daisy Ander- 1204 Mary Cook S B Macon son gro IS THE 1206 Leana Lane 1430 Vacant Wood 1208 Ella Gibson 1431 Mrs K G McKay 1800 Mrs M S Clance GREATEST 1211 Charity Carter 1214 Willie Lee 1432 P D Reese 1801 J J Durden Elm 1807 C P Mullins MARKET rear Robt Hodges 1502 E B Cook 1811 R S Mingledorff 1215 Henrietta Cars- 1505 G E Cunningham 1812 W W Arnold well 1507 Mrs A A Burke C Z Brock PLACE 1216 Edw Tyson 1217 Robt Jackson 1510 J E Preston 1514 H W Bailey 1814 A P Wadsworth 1817 Mrs Gussie Ham- IN THE 1218 Mary Collins rear Roe Stanford G W Colson 1517 A D Jones lin 1823 L J Etheridge 1220 J B Bishop 1519 C J Brice Giles WORLD * 1221 Chas Harris 1222 Chas Williams 1225 Sanford Bailey 1520 T S Collins 1525 W F Walker 1528 W M Burke 1903 O J Smith C R Bassett 1907 W H McDonald Every Day in the Year 1227 Lettie Green 1529 J G Lyles 1229 Norman Simmons 1531 W C Sanders 1231 Wm Sword 1532 Mrs S A Dew- 1912 W H Moseley 1913 T J Reid 1917 Vacant the Directory 1232 Maggie Bryant berry 1918 C D Grissom Tells Where All Kinds of Goods and Service Can Be Had rear Leila Love 1533 S S Hall 1233 Wm Brown 1536 J B Adams 1235 Wm Brown blk- 1537 P S Cook smith 1539 Vacant 1237 John Dixon gro 1541 J E Chance Hazel 1542 W F Meek 1921 Mrs T McDonnell 1922 Henry Waterman 1974 E T Andrews 1975 A L Moore 1977 M L Sullivan 1980 W B Webb ), * The Directory is the Natural Source of 1303 J D Childs gro Edgewood av 1985 G A Schaffer 1304 Mrs B M Marston 1633 J V Bell 1305 Mrs Helen Amer- 1634 J T Chapman 11998876 J W W B Douglas Davis son 1666 W O Barnes 1993 J W Shine stove 1306 J W Etheridge 1667 W C Palmer repr 1308 C M Tyner 1670 W D Burnett 1998 P B Isaf Information and is "On 1310 S I Roquemore 1673 H C Burnett 1314 Mrs Effie High- 1674 W H Harris Jenkins 2001 W P Capps the Job" tower Gordon 2007 E W Crenshaw 365 Days Every Year 1315 Lum Kitchens 1318 Mrs M E Jones 1325 Vacant 1701 H M Goldwire 1702 J E Cook 2008 J R Wilcoxon 2010 W H Hartis 1706 Mrs Rosa Cara- 2011 C R Evans 1327 C E Gill way 2017 C W Jones 1328 W A Hammond 1709 Mrs Ethel Burke 2020 K B Wellons 1330 Felix Avery 1710 Clarence Austin 2023 Vacant PUBLISHERS 1331 W T Shaw C D Mclnvale 2028 Vacant PoIkDirecfojraS y DETROIT More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656% CHERRY ST. PHONE 3041 MACON, GA. Third 2032 Mrs Effie Robinson 2080 J W Culpepper Edw Stokes 2084 Mrs M L Johnson 2085 W E Field 2090 Mrs Margt Wilson 2091 E G Field 2098 Mrs Mary Peavy THIRD (S H)--Changed to Stevens THIRD AY (Bellevue) -- From Industrial Home rd north to Atlantic blvd, 1 w 2d av 121 John Wesley 143 Rev L S Patterson THIRD AY (E M)-- Changed to Niagara av THIRD AV (N H) -- Changed to Birch THIRD AV (V)--From 342 Middle to intersection of Culver and Highland 207 Harry Spivey 209 Monroe Barnes 210 Laura Havis 215 D V Stevens 217 New Hope Baptist Church 220 John Singleton 231 B A Carwin 232 Larkin Jackson Lillie Taylor 237 P-ul Duval 242 Julia Ray 243 Moses Lunsford 243% York Reynolds 24G Rev Sweet Slayton 247 Z D Jackson 256 Fredk Barnett 257 R M Logan 262 Peggie Howard 263 C J McCarthy 267 Wm Jackson 268 Mary Lockett 269 Vacant 272 Henry Hampton STREET GUIDE 273 J C Perry 275 Virgin Banks 308 Jas Gordon 314 Henry Elford 316 Lucian Griggs 319 Clark Holloway 319% Fletcher Kin- sey 320 Jas Whippier 321 Dozier Horne 321% Adolphus Mc- Creary 323 Dallas Cullers 324 Aurelia McCowan 325 Rev R L Taylor 326 Jas Lamar 330 Julia Cary 332 R B Stevens 333 Wm Dixon 336 Rozier Grady 337 Paul Duval 341 Alex Denis 410 Augustus Wicker 415 C N Pitts 417 J H Webb 419 Leonard Fields 420 Emma Gross 421 Tommie Cleveland 423 Chas Tharp 425 Blake Walker 450 (464) Geo Pitts 464 (450) Sol Cotton 468 Barbara Dudley 472 J D Bailey 474 Carrie Franks 501 Pleasant Hill 7th Day Adv Ch 503 (510) Benj Tas- 506 (503) Vacant 512 Geo Mason 514 Thos Collins 521 John Williams 524 Thos Hartwell 525 Jesse Williams 526 Geo Profit 528 S D Gary 530 (541) Lonnie Da- vis 535 (528) Orrie Cot- ton 539 (530) Janie Hutchins 541 (535) Zack Brun- son Third Av (V) 1123 542 Leola Idette 543 (541) Sallie Jack- son 544 Chas Pitts 546 Henry Clay gro 600 Louis Winberg gro 602 Lundy Hosp 603 J W Lundy phys 606 Wm Smith 609 W J Johnson 610 Aue Robinson 612 Vacant 613 Henry Stewart 617 Vacant 620 E W Patterson 622 M L Cooper gro 623 Mollie Adams 625 Hillie Snell 701 Victoria Thomas 702 Edw Powell 704 W M Zellner 705 T J Hunt 707 Burrell Ingram 709 Hattie Adams 710 Eug Dent 711 (708) David Bur- den 712 Frank Hood 713 J H JoAes J T McCormick 714 Belle Walker 715 Ivory Callaway 716 Ada Jones 717 Ada Grady 718 Jacob Johnson 719 Glasco Phelps 721 Rev Z C Solomon 730 (742) Geo Hen- derson 742 (730) Burton Wal- ker 805 J A Ammons 806 E E Gibbs 807 Jas Griffin 810 A J Jones 820 Robt Bailey 821 Herschel John- son 826 (830) Alethea Smith 829 Wm Smith 830 (826) Thos Brown 831 Wm Garfield 833 Celia May F Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. mfPt CO > 0 O 1 o > l l o m H SC > z PC *3 SO > o g n fT TERMINAL TRANSFER COMPANY POLK'S Denial Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L, Polk & Go. Publishers 536 S. Clark St. Chicago, 111. TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 1124 Third Ay (V) MACON Tinsley Lane 852 (854) Chas In- THOSIPSON'S AL -- 303 Dock Hart gram From 809 Elbert n to 304 Griffin Boner 853 (855) Melvin Chapnell 305 Wm Clayton Moreland 234 John Mays 854 (852) Jas Staneel 236 Prances Steven- 855 (856) Pauline son 307 Allen Nichols 326 Chas Grogg 309 Eug Davis Brown 239 Danl Martin 326 Chas Grogg 857 (858) Henry Davis 240 Vacant 242 Anderson Jeffer- 328 Cleveland Denison THIRD AV (W H) -- North and south from Jasamine to Dempsey 4 w of Carling 103 0 M Perry 107 C J Hunnicutt 205 P M Mondena 207 C P McCook 370 Prank Weiss 372 J D Mangham THIRD ST LANE -- From 1281 Third w to Plant al 1 Wm Jones 2 Geo Smith 3 Susie McCord 5 Wm Butler 6 Jeff Smith 7 Sami Henderson 8 Ethel Williams THOMAS (E 51)--From 217 Garden n to son 243 Emma Jones 244 Geraldine Thomas 248 John Thomas 406 Chas Driver 408 Essie Riley 410 Sami Ison 411 David Cleveland 412 Sami Thomas 413 Wm Akridge TINDALL AV (S 51)-- From Edgewood av s 1 w of Calhoun 101 J R Hunter 102 Lucy Battle 103 Lucius White 104 Wm Pullen 105 Levi Gibson 106 Wm Durham 107 Margie Thrush 108 Columbus Hardeman 329 Lou Williams 340 Louis Holt 400 Benj Williams 402 Wm Williams 436 Green Albea 437 Walter Killgore 438 Robt Williams 439 Norman Jackson 440 Cleve Comer 441 Rev John Wil- liams 443 Vacant 444 Neasy Oliver 445 Wm Wesley 446 Trinity C M E Ch 449 Vacant 469 Wm Davis TINDALL FIELD (S 51)--South of Elm bet Calhoun and Adams Broad 109 John Hatcher 100 Fred Norwood 101 Judge Snell 102 Wm H Standifer 103 Geo Stevens 104 J H Meriwether 108 Emma Rittenberry 109 Mamie Rugulas 110 Gus Meriweather 111 Henry Raven 112 A T Latimer 120 Emma Simmons 123 Harvey Lewis 152 Alex Campbell 158 Jas Cooper 159 Hattie Hardwick 207 S T Newsome 215 Arth Meriweather 217 Phoebe Puller 421 Carl Oliver 110 Jas Hill TINSLEY LANE-- 111 Ruben Braswell From College w bet 115 Lillie Jackson Washington av and 116 Chas Jones Forsyth 117 Richd Mallard gro 4 Martha Little 118 Ike Hart 119 John Bell 6 Vacant 8 Wm Smith 120 Fannie Redding 9 Vacant 122 Wm Stanley 10 Fannie Scott 124 Robt Henderson 11 Henry Lewis 133 Mary Dinson 188 Wm Brunson 196 Julius Gordon 239 Edw Hays 241 Edgar Lockett 243 Edgar Lockett gro 15 Ellen Irvin 18 Elisha Kind 20 Andrew Burney 21 Hattie Watkins 25 Lena Redding 27 Prank Smith 29 Leola Jones 245 Ella Respass 405 Mattie Booker 271 Wm Butler 541 Myrah Bernice THOMAS (Edna Pi) -- 300 Jerome Dixon 543 Vacant From Log Cabin Blvd 301 Mary McCrary 554 Lula Davis south 1 w of Edna pi 302 Homer Webb 676 Jonnie Jordan FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Toole's Row (S M) STREET GUIDE Vineville Av (V) 1125 TOOLE'S ROW (S M) 5 Laura Lundy ---A continuation of 50 Jack Pool Enterprise 148 Irene Jones UNIONVILLE -- From Pio Nono av w, s of Columbus rd TOOMBS (S M)--From Enterprise s to Nelson 2 w of Watervilie rd 100 (12) Edw Bel 101 (214) David Toomer 108 (8) Chas Young 104 (6) Edw Williams 106 (4) Dock Patrick 108 (2) B W Moody 200 (222) J F John- son 201 (114) Doc Brown 202 (137) Hilliard Ross 203 (112) Benj Har- vey 204 (135) Wm Stokes 205 Essie May TRACEY'S AL -- From 622 Hawthorne south 1 Ollie Williams 3 Mattie Thompson rear Emma Benjamin 6 Ellen Hicks 7 Fannie Thomas 10 Lizzie Sanders 48 Robt Lightfoot 122 Jewell Roberson 960 Pearl Wofford 964 Vacant 1229 Sami Sampson 1234 Jesse Middlebrook 1235 Vacant 202 Edw Green 204 Warren Prater 206 Bertha Hunter 208 Ora Stevens 210 Press Lewis 214 Ernest Dillard 215 Bird Hall 216 Wm Thornton 220 S F Anderson gro 222 Walter Tinley 224 Ace Edwards 225 Mary Rivers 226 Bass Weaver 227 Jos Phelps 228 Felton Roberts 229 Jack Shrem gro 231 Jessie Cummings rooms 237 (227) J C Glenn 300 Roxie Willis 301 Davis Bobo 302 Geo Slaughter 321 Roberta Smith rooms 348 Chas Duncan 350 Oscar Peterson TURPIN LANE--From 148 Turpin east to Bay 13 Agnes Clayton 14 Reid Green 15 Dolphus Samuels 16 Wesley Barton 17 Seaborn Lowe 18 Katie Battle 138 Jas Mitchell UNIVERSITY PL -- From 1208 Ash s to Edgewood av 1126 Williams Cottage 1128 Posey Cottage 1130 Pierce Cottage 1132 Miller Cottage 1134 Martin Cottage 1136 Reynolds Cottage 1138 Wise Cottage VALLEY (Bellevue) -- From Industrial Home rd south VILLA AV (Bellevue)-- From Grand av west 1 s American Blvd 3 A L Minter VINE (N H) -- From Napier av n to Dannenberg av 1 e of Holt av 93 Cora Evans 315 Vacant 316 J C Elliott 317 Mrs V J Evans 319 J H Moore 446 Chas Sutton 448 J H Pelt 450 W M Hawkins 455 Vacant VINE E (H H)--Changed to Huguenin av TROUP -- From Houston av e to Mikado av 1 s of Fulton 101 Boyce Linenkohl 102 J T Starke 103 J J Gordon 139 Wm Samuels 140 Abe Barron 144 General Tharpe 186 John Reid 188 Jos Harris 190 (186) Jerry Sar- VINEVILLE AV (V) -- From junc of Hardeman av and Forsyth w, 1 n of Central of Ga Ry TUPELO--From limits gent w to C of Ga Ry 1 n TYRONE BLYD (Ingle- of Bay side)--From Forsyth Seventh rd n to Woodland av 115 A E Rood TURPIN--From limits w to Division 1 s of UNION AY (E M)-- Bay From 503 Main n to , 2 Millie Jefferson Church 100 Mrs T R Schofield 101 J S Schofield 102 Standard Oil Co filling sta 103 J B Hart 104 O J Massee jr 105 E P Johnston 115 J W Ray 147 W H Ray 4 Alford Wellmaker 3 Mrs Lula Brantley Ward begins A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit NORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1126 Vineville Av (W) 205 R J Taylor 208 Mrs L T Adams 214 B E Wilingham 219 C M Adams 221 Vineville M E Ch 247 Rev 0 F Cook Forest av begins 214 B E Willingham Beverly pi 304 J S Birdsey 312 R G Jordan 315 Morris Michael 317 W H Reynolds 319 R I Neal 325 J G Dorsett 331 M E Goode 339 Dr W J Little 340 W E James Lamar begins Clisby begins 400 Vacant 406 H S Strozier 412 R P McEvoy 414 Vacant 415 Vineville Bapt Ch 417 F D Lawton 422 T E Toole 424 J T Gantt 425 E S Taylor 435 Mrs L E Bateman 438 C A Yarbrough 439 Vineville Pres Eh 452 Vacant Culver begins 461 H F Crawford 463 (511) H E Lowe 463y2 (515) J D Kinnett 465 (523) H S Butterworth 470 Jos Clisby Sch Rogers av begins 501 M B Smith 505 Mrs Eula Toole 507 R T Birdsey 513 C O Stone 515 Daisy L Churchwell 530 (654) R E Stubbs J V Sharp 533 S T Player 534 (712) E H Harvey 535 C H Hunnicutt 539 (707) Annie Callaway MACON Violet Lane (E M) 541 (717) J S Lewis 803 (1205) Dr N G Corbin av begins Gewinner 575 (813) A & P Tea 807 (1219) A P Find- Co lay Callaway begins 809 (1225) E L John- 599 (815) Vineville son Drug Co 1211 J J Willis 601 (817) L W Rogers 1301 T B Elfe Co gro 1303 W C Blount Nash Sausage Co 1304 H P Heath Buford pi begins 1305 Mrs Flora Bloch 604 (904) L M Happ 1306 Emanuel Ulman 605 (911) W R Rich- 1307 Mrs M R Wood- ardson ward 608 (912) F R Happ 1309 W B Combs 610 (910) Dr Harry 1311 S G Ryle Moses 1313 J N White Oak Haven av begins 1315 C F Andrews Hines Terrace begins 1317 W R Finch 612 (912) Vacant 1320 Vacant 626 (926) C H Gar- 1401 W O Tallent rett 629 (1013) Warren 1405 V R Patrick 1406 Hugh Chambers Grice 1408 P E Hertz 630 (930) C B Lewis 631 (9331 Eug Ander- son 633 (945) W D Ander- son 634 (934) E Y Mall- ary Cleveland av begins 650 (1014) J N Talley VINEVILLE STATION --C of Ga Ry, Holt and Roff Home avs (V) Kinnett Coal & Ice Co Chambers Lmbr Co 651 (1009) R F Bur- VIOLET AV (S M)-- den From east of Third 654 John DeBorde jr w to Second 2 s of 658 (1018) Annie Ergewood av Burghard 659 (1021) A H Hey- ward 665 (1033) R L Mc- 1 W W Irby 1A J B Wooten 2 Mrs Kate Rodney 3 J L Roberts Kenney 674 (1036) Mrs M G 4 C H Coleman 93 E D Bush Comer 97 W S Dye Pio Nono av begins Pierce av begins cor Vineville Bap Ch 707 (1107) Max Lazarus 709 (1109) L G Smith 711 (1133) L A Ma- graw 747 (1139) D S Wag- Third 111 J H Wilder 118 W R Weeks 122 Vacant 123 Mrs L Abbott 124 Vacant 127 A J Lockeman 128 Mrs Alice Davis 131 M B Leaptrot non VIOLET LANE (E M) Lynn av begins --Changed to Clara A^ natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STRGBERG AUTCOOMPMAIENRTCEIARL ATNRDUCTKOPBOBDUIEILSDER 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. Virgin (V) STREET GUIDE Walnut 1127 VIRGIN (V)--From ISO 401 A E Hartzog 29 Vacant Forsyth 407 Y A Kelley 29% J H Holt shoe 114 Lewis Norris 409 Mrs Fannie repr 156 Wm Smith Knowles 38 Daliis Hubbard 158 Robt Taylor 415 Rayfield Lines clo clnr 160 Thos Chaney 450 L E Brake 251 C P Bethea garage 162 Henry Fluker 455 L D Moulton 318 Noble James 164 Ogie Tharpe 457 W F Gordon blksmith 165 Adam Whitehead 460 W V Grimes R L Coleman furn 194 Seaborn Lamar 477 Romer Tidwell rms 196 Jesse Smith Winship 320 H Gordon tinner 198 Pauline Davis 507 S O Cavender 325 Oetter Elec Co 488 Robt Chambliss 490 Sami Lawrence 494 Geo Brown VIRGINIA (W H) -- From 300 Dempsey av south to Anthony rd 2 w of Third av 190 C H Lewis 203 F M Marshall 205 Wm Clyde 308 Liza Haygood 310 Vacant VIRGINS LANE (V)-- From 444 Forsyth to C of Ga Ry 6 Lizzie Thomas 23 Wm Cobb 43 Hays Howard 44 Mattie Rhines 53 Celia Birch 100 Peter Harris 102 W M Cofield gro 120 Warren Wright 123 Annie Brown 125 Claude Carter 355 Janie Averhart furn rms 449 The Buffeteria restr 451-53 Macon Mach Shop 455 W O Colbert auto repr WALL STREET LANE --From Seventh n to Sixth bet Mulberry and Cherry 4 Jos Young VIRGINIA AV J--From Montpelier of Harris av s9 2 w 101 A H Sanders 103 Jesse Burns 107 Mrs R L Williams 117 J G Jackson 125 M K Pattillo 127 Mrs M M Talbird 128 R D Leslie Fred Patterson 129 D C Collins 130 J R McCamy 131 Vacant 132 C G Burden 133 E E Reynolds 134 J W Burden 137 H L Batton 165 J Y Carlisle 166 E B Roberson 170 J M Duckworth 173 J W Lewis 175 E M Andrus 180 W C Munsch 127 Osia Brown 206 Elijah Simmons 367 Frank Brown 408 Edgar Pines 410 Chas Dixon 446 Wm Threat VISTA CIRCLE (Ingleside)--From Ridge av east to Ingleside av 119 T H Winchester 206 R D Feagin 255 Vacant WALL--From Seventh n bet Mulberry and Cherry Fifth 21 Lyon, Harris & Brooks printers 22 Vacant 22% J E Bunch 23 Vacant 23% Brown Sign Co 24 R Danforth shoe repr 5 Dolly Bryant 21 Wm Young 22 Clark Huff 25 Eugenia Brown 26 E L Wiley WALNUT --From Seventh w to Orange 1 s of Ocmulgee Seventh 101 Wofford Oil Co 129 Vacant Sixth 214 Atlantic Ice & Coal Corp C & Ga Ry 225 Mansfield Dray Line Co 253 Kate Hose 255 Frances Horton 257 Alberta Jackson 259 Annie Johnson 261 Jas Stephens 265 Ethel Matthews 185 E F Rowe 25 C W Jones contr Fifth 204 R W Roberts D Davis plmbr 307 Anna Dixon 215 J W James 26 C E Rohr soft 313 Alex Hodo 217 R F Baird drinks 316 John Jones Jasamine 27 Hamlin & Subers 318 Callie Fudge Belmont av tinners 319 Mrs S E Tyson "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy it. L. POLK & CO., DETROIT, MICH. < A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 1128 Walnut MACON Walnut 353 Clara Keen 623 Vacant 856 Merrymakers' 355 Mrs Jennie Smith 629 L M Erwin Retreat 363 Vacant rear Hannah Mando 859 M F Smith 367 Mrs Blanche Price Academy ends 865 Mrs Annie Hilliard Broadway 660 David Meredith 867 Vacant 401 Nicholas Camer- 661 Vacant 869 W D Miller iero 662 Vacant 871 J B Wardlaw 404 Morris Moses 663 J H Roberts Spring 407 Vacant 664 W E Bullington 903 L N Carmichael 408 J J Mercer 668 W A Willingham 906 C E Paul 412 L M Billingslea First 908 McLendon Roy L 413 Vacant rear Edw Staley 418 Mrs Gertrude Freeman 421 Hypolite Damour 452 Christian Huhn 453 R A Stephens 455 A A Conner 456 I N McCrary 468 Mrs S K Nutting 471 Mrs F A Conner Third 502 R E Lucas 504 S P McEachern 506 Mrs C M Abel 508 Mrs M A Ingalls 511 Vacant 512 Julia Jones Home 519 J W Johnson W T Tomlinson 520 Christ Episcopal Ch 553 Vacant 566 E E Smith 567 Clinic Hosp 701 J P Jarrett 709 C L Sloan 711 Vacant 715 W J Bennett 722 Vacant 725 J C Stripling 726 R K Stevens 727 Mrs 6'allie H Reinhart 728 J F Gober 742 Mark Zarks 744 R L Odom 746 V M Burnett 748 F M Mathews W J Mathews 750 Mrs Evelyn Miller 759 E R Thompson 765 Mrs N B Meadows 767 Mrs E C Hollings- worth 771 J M Holloway 772 P W Branch 774 Vacant 776 O K Powell 909 C C Darity 910 T B Ragsdale 911 I H Melton 912 Vacant 913 Vacant 915 Vacant 917 Vacant 918 J P Gallemore 919 Vacant 920 H E James 922 R L Rankin 924 Vacant 928 Vacant 930 W P Short 955 Vacant 961 R F Hill 963 Z T Miller jr 965 Jas Bryant 967 F E Norris 972 Mrs A W Ries 97 4 j s McGee 976 J F Penny 978 Lula Gagliardi Franklin ends 568 Mrs A L Fox 778 R C Moore 1003 Vacant 569 Nurses Home Oscar Phillips 1004 B H Fullington Second New 1005 H H Walls -- Gulf Refining Co 803 F F Davis 1008 T M Fowler filling sta 808 J T Lott tailor 1010 Maggie Wood 615 Belmont Apts 811 G W Smith 1015 J R Roundtree Apartments: 816 J T Lott 1017 Mrs M R Henry 1 Vacant 817 Mrs A L Stork 1020 Otis Allen 2 Vacant 818 Mrs Georgia Jones 1052 W W Sherwood 3 Herman Starr 819 J R Cosby 1053 Vacant 4 Vacant 820 W S Balkcom 1055 Vacant 5 H J Atkinson 822 R P Hewitt 1057 J T Bowman 6 Geo Bourne 850 J H Griggs 1060 Mrs Agnes 7 Vacant 851 M R Burg Staamer 8 Vacant 852 Crowell J Herring 1063 N G Askew Street continued 853 Vacant 1064 Vacant 616 J C Cooper 855 1 T A Dick 1065 M R Hitchcock 619 Mrs J S Riddick 2TB Fargason 1070 Mrs E C Phelts 620 Mrs Florence But- 3 Vacant 1071 J F Lloyd ler 4 Vacant 1073 Philip Dohme Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 Walnut STREET GUIDE Washington av 1129 1074 J T Arnold 1103 H R Huhn 414 Rev H T Anderson . 4 J B Parker 5 R J Bennett 1105 G W Lingo 1106 J R Rowell 1114 F H Hammack 1115 Vacant 1120 Mrs E L Pearce 1121 J W Hancock 1122 Claude Haisten 1127 Jos Crowill 1133 Vacant Orange WARD (V)--From 115 Vinevill ay n 108 Chas Kendick 108% Chas Kendrick gro 109 Jos Smith 110 Bruce Fort 112 Webb Ingram 116 Rev L H Smith 125 Levi Duncan 201 Lee Duncan 203 Jesse Duncan 204 Rev Edw Griggs 205 Sami Roberson 207 Chas Ferrell 210 John Minor 211 Carrie Coleman 215 Moses Duffey 301 Jas Bivins 302 W D Davis 303 Love Smith 304 Irene Haten 306 Clayborn Bryant 308 Hillery Mack 320 M A Turner 322 Vacant 323 Pleasant Hill Sch 324 Danl Chapman 325 Jas Joiner 330 Mamie Davis 400 B L Taylor 403 Henry Turner 404 Fannie Hall 405 C W Howard 406 N L Maughhon 415 Jas Wynn 416 Vacant 417 Donie Jon^S 418 Jerry Elder 421 Duncan Hicks 423 Mamie Felton 424 J O Bowden 425 Frank Slaughter 426 Robt Smith 427 Wiley Green 428 ?t Peter Claver Convent St Peter Claver Rectory Rev Alfonso Barthlen 429 Calvin Henry 430 St Peter Claver R C Church St Peter Claver Cath Sch 431 Wm Bailey 431a Jas Smith 460 Eliz Walker 497 Ellie Bryant 551 Florence Howard 557 Ben: Jones 558 Mary Gibson 560 Rev I W Evans Philip Mitchell WARE'S AL -- From 522 Elm south WASHINGTON (E M) --From 416 First w 123 Louis Brewington rear John Lundy 140 J W Ward 142 Claude Etheridge 150 W B Dumas 196 Albert Frazer 198 N A Daniels WASHINGTON AV -- From 817 Poplar w to limits 103 T A Hopkins 6 W C Mangham Street continued 115 Ida Mapes 117 J L Wilson 120 Chas McBreaity 121 P A McElmurray 122 Mrs Addie John- ston 123 Vacant 124 Vincent Canipelli 125 Mrs P D Arthur 126 Ellis Smith 126% Mrs M V Small 127 J A Wyche Spring 204 O'Hara Fox 206 Vacant 207 T M Wheeler 208 Vacant 211 J C Sanders 212 T A Cheatham 215 G E Smith 219 Washington Av Presby Ch 227 Vacant 231 S T Bass 233 J P Stripling 235 J K Brown 237 W P Bennett 239 Mrs Jennie Jones 240 Mrs M A Kane 242 W M Bragg 244 Vacant 246 F B Matthews 250 M G Ellis 251 John Caserio gro 252 Mrs M F Andrews Caldwell Frank B 253 John Caserio 254 Vacant 256 Vacant 258 Mrs Nanie Lane A E Gable 260 G L Dent 261 Holsey Temple C M E Ch 262 T L Gardner 407 Marian Shorter 109 Maynard Apts 264 Vacant 408 Rev W M Phillips Apartments: 267 Mrs Lena Davis 410 R R Redding 1 Mrs Frances C T Hadaway 411 Alfonso Gray Howard 271 Vacant 412 Rev E H Harris 2 Carl Dornhart 273 Aaron Danneman 413 Norman Wilson 3 Vacant 281 J C Whillingon FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION 39 DETROIT R. L. POLK & CO. CHICAGO City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be IFound The Classified Business Section i the Market Place Where Buyer* and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1130 Washington av MACON Whitehead (S M) 282 Vacant Central Sash & 45 Mrs Mary Jones 285 Vacant Door Co gro 288 College Hill Gro Atlantic Ice & 47 Homer Williams 289 Georgia Gro Coal Corp 48 Vacant 290 College Hill SOU Cotton Oil Co 49 Martha Wimbush Pharmacy 3 Chas Brown 291 Rogers Gro rear Austin Nelson Orange 46 Chas Wilson 306 Horace E Watson 124 Jas Walker 310 Mrs L B White 125 Mamie Burnett 316 Robt ? Latham 126 Edw Brown 320 Washington Mem 145 Robt Moore Central av 50 (352) M K Bostick 202 W T Barton 204 C K Moore 206 E O Odam 242 C B Childs Library 147 Broaches Steven- Ellis College son 303 W L Dean 400 Sami Karesh 148 Gertrude Williams 307 H A Faulkner 430 W F Turner 436 B B Willingham 167 Sylvester Hunter 202 Robt Mitchell 311 D T Shepard 315 Jas Ward 442 Vacant 240 Lindsey Craig 317 C P Wdrd 446 T W West 450 R L Sparks 328 Thos Spann 332 Ellen Clark 319 R C Bates 325 R O Roland Arlington pi begins 504 F B West real est 552 Mack Owens Cherokee Brick Co 340 E A White 342 J T Smith 512 520 530 534 538 540 544 618 622 624 628 630 638 640 646 M F Griffith jr A H Small F F Scarborough W M Crook Mrs Georgia Snow C E Cox A F Holt Hattie Sparks Monroe Eug Harden Phyllis Felder Jos Taylor Mattie Proctor Vacant Silas Ivory barber Vacant Moore & Boone gro Southern Ry Sys Shops WATSON AL (S M) -- From Pebble south one-half block e of Telfair 235 Viney Harris 304 Simon Jenkins 317 Lettie Zellner 618 C M Crewl 1052 Chas Hampton WEST END AV (W H) --(Formerly Pauline av)--From Linden av 1 w of Montpelier av 101 J D Holland 104 Mrs M A Bowles WHITE AL (S M) -- From White west S of limits 2 Lawrence Huff 4 Wm Birdsong 5 Henry Griggs 6 (143) Jones Taylor 7 Otis Stanford 8 (145) T E Billingsley 9 Simmons Chapel 257 Robt Battle 259 John Nelson 267 Lucius Eaton 269 Wm Byrd 271 Wm Wheeler 272 W L Grant WATER (E M)--From 108 W R Melton 274 Jas Wheeler Main north to Elbert 18 Lizzie Russell 306 John Watts 308 W M Mixon 110 209 210 W H Tharpe Johnson R L Stone Julia Anderson av WHITEHALL (C H) -- From Bartlett's la e 1 n of Napier av 315 Margt Fowler 318 Vacant WATERVILLE RD -- WHITE (S M) -- From Jeff Davis s continuation of Sixth av WHITEHEAD (S M) -- From 2224 Broadway west From Edgewood av south to limits 2 e of Broadway W S Dickey Clay 16 Martha Wimbush 23 Arnold Jones 37 J J Bates 41 Flemming Gill- 102 R L Patterson 104 J H Harrell 108 Mrs Ida Goodin gro Mfg Co man gro 110 W A Avery R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHIC. JAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 Whitehead A1 STREET GUIDE Willow 1131 WHITEHEAD AL -- 320 John Pitts 18 Rufus Brown From 717 Oak east 321 Medie Humphries 21 Wm King WHITLOCK (S M) -- From 2234 Broadway east to Elbert 100 W A Williams 102 Jordan Wesley 104 Vacant 108 Vacant 110 Murry Bunns 112 J D Washington 114 Chas Story 121 Geo Goodrum 222 Wm Cain 223 Vacant 224 w M Freeman 245 Jas Hudson 247 Vacant 249 Vacant 251 Thos James WHITT (E M) -- From Fort Hill west n of 322 Hiram Cook 600 E Smith 620 D D Dukes 622 Ellen Freeman 698 John Davis 700 Hazer Ball 798 (138) Richd Ward 801 (401) E J Skin- ner 804 (404) Wm Mc- Call 818 (418) Grant Mor- gan 840 (340) Geo San- ford 890 W M Lewis 901 Jas Jackson WILLIAMS (S M)-- From Second w to Davis 1 s of Anderson 113 T D Wood 22 Wm Parham 24 Kath Bundridge 117 Alex Brown 123 Eutau Davis 125 Lillie Miller 127 Rosa Coggins WILLINGHAM (E M) --From 359 Church 1 w of Milledgeville rd 15 H L Griffin Fort Hill 105 Mrs Fannie Lancaster 108 Mrs M A Barnes 109 L C Barlar 110 Henry White 113 J F Ross 118 Vacant 120 R T Dixon 121 Mrs M C Bow- Pringle 117 E C Moore den WILBOURNE (E M)-- From Broad n to Mitchell 1 e of Clinton 118 Mrs Hattie Raley 119 C H Littleton 125 J W Lee 127 Mrs Tero Barfield 125 E F Alford 130 Mrs Eugenia Herndon 132 Obie Maxwell WILDER (V H)--From Montpelier n to Beech 1 e of Pio Nono av 128 J T Stripling 130 W V Baggerly 133 Vacant 134 Mrs E E Roberts WILDER (S M)--From 138 Mercer Burns Bright south to Peb- 139 J W Wyatt ble 1 w of Second 143 H T Barker 77 J W Johnson 144 J F Byrd E S Shores . 149 Mrs Annie Hois- 79 C H Babb ten 80 Gus Buyer 150 W O Irby 82 S E Crockett 153 J W Lee 83 J E Andrews 155 W B Harris 85 Florence Diborn 156 W M Irwin Maynard 210 M P House 244 Chas Hudgings 246 Mrs Laura Yates 250 R L Jerkins 259 John Scott 261 Mrs Lucile Harper 263 Eliz Kendrick 267 J T Cooper 268 Chas Vaughn 274 Vacant 276 W N Rogers Norris 133 Mattie Breedlove WILEY (W H) -- Con- tinuation of Carling ay 157 W A Harris 160 J R Jordan 204 T J Childs 209 Mrs Martha Dur- den WILLINGHAM AL -- From College to Orange, bet Bond and Walnut WILLIAMS (E M) -- From 1101 Clinton e to beyond city limits 1 n Mitchell 215 W A Hoke 246 N H Parker 247 W C Wagnon 248 W G Smith WILLINGHAM ROW-- Foot of Tupelo WILLOW -- From the 134 Benj Sherman WILLIAMS LANE -- river nr Spring, west 203 Ernest Peacock From 217 CoRege w to Rose HiU Ceme- 242 Benj Barron to N Boundary tery Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 The most comprehensive reference work on the hanks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking ( Price $20 Published semi- annually MARCH and SEPTEMBER by R. L. POLK &C0. Polk Directory Bldg. Detroit, Mich. 1132 Wilson (E M) MACON Wood (S M) WILSON (E M)--From 246 J L Hamlin 16 Wm Cash junction First and 247 C A Leggett Washington north 249 C P Shell 260 Chas Finney 250 O R Bliss 265 Moses Miles 251 H A Parker 17 Mamie Woody 18 Wash McCloud 19 Lewis Little 20 Vacant WINDSOR (S M) -- From Broadway west to Second 1 s of Giles 255 John Cassini 259 J W Keen 260 A K VanEvera 264 Geo Ward 21 Flewelen Simmons 22 Edw Lomax WITKOWSKPS LA -- WING AL (S M) -- From Bright south to Pebble 1 e of Telfair 271 Mrs M E Jones From 720 Hazel s 274 Vincent Orlando 285 J P Miller WOLFE'S ROW--From 286 Mrs C M Edwards 332 Oglethorpe south WING'S HILL (S M)-- 289 L A Fox half a block From Henrietta to 290 J E Norman Elizabeth 1 s of Tel- 292 S H Mathews WOMACK (E M) -- fair 12 Chaney Phillips Oakland av From 720 Church n 302 W E Jones 100 J S Pierson 13 Frank Martin 314 S C Culpepper 103 L R Green 14 Sami Newman 318 H W Rogers 105 O C Herndon 15 Delia Allen 330 B L Thomas 251 (651) Benj Glaw- 16 Wm Newman 331 Vacant son 136 Annie Daniels 161 Richd Tyner 171 Henrietta Bell 218 Andie Henderson 237 Jas Brown 238 Emma Buckner 339 Taylor Coney 333 G F Moore 335 B A Fogarty Virginia av 402 G E Meadows 410 J E Mercer 411 Jos Baratta 412 B J Hunt 253 (653) Claiborn Council 303 Katie Thorpe 305 Wm Brannon 307 Roht Singleton 309 Marion Larry 310 Minter Vaughn WINSHIP (W H) (For. merly Rose)--From 1114 Edgewood av west to Fourth av 3 s of Montpelier av 120 W H Greer 415 A A Goins 417 E M Kitchens 418 M F West 420 W D Gercken F H Holloway 425 J P Patat 311 Wm Reed 315 Bert Robertson 410 (450) Rosa Mims 412 Lewis Reid 414 (314) Wm Brun- son 121 A C Smith 430 Emmie Gordon 414 Wm Reeves 125 F R Otto rear Harry Banks 450 Emma Jelks 127 J W McKay 509 J W Woodall 452 Jesse Wilcoxon 128 L C Schell 129 A S Bullington 130 N H Oliver 134 Vacant 135 J H Hyman, contr 136 W M Shinholser 146 H J Williams 160 P A Raby Carling av ends 206 W R Parker 210 W D Griffin contr 237 McDaniel & Smith gro 241 N B Goggans 243 R R Dauwalter WISE AV (V)--From N Boundary north 1 L A Lee 2 J P Banks 4 Arth Broady 5 R R Ingram 6 Enos Leonard 7 Marion Jones 8 Willis Stamps 9 Vacant 10 Lemmie Rozier 11 Wm Pope 12 Clyde Burrell 13 Luther Glover 14 E D Cummings 454 Emma Stubbs 456 Mattie Loyd 495 (60) Hattie Reeves 497 (101) Sami Northern WOOD (S 31)--From Second west to Broadway 3 s of Edgewood av 101 Vacant 102 Mrs Laura Herring Third 245 W W James 15 Mack Taylor 264 E B Willis KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--41/2% on Savings Wood A1 STREET GUIDE Wyche (S M) 1133 WOOD AL--From 338 181 Levi Wilkerson 809 J L Dekle Maple south to Edge- 192 Rufus Lawson 812 W W Liles wood ay, bet Calhoun 194 Wm Jemison 813 H W Lavender and Ross 201 John Singleton 820 J F Lyles WOODLAND AT (Ingleside) -- From Ingleside av north to Osborne pi 203 Edw Edwards 204 Cora Grimes 205 Julia Broomfield 207 John Herrington 209 Albert Cheeves 850 M O McMullen 930 Owen Jones 933 W H Harper 1101 (801) Mary Singleton WOODLIFF -- From College to Brewery la 2 n of Georgia av 2 Roman Wesley 4 Sami Birch 6 John Ladd 8 Susie Turner 10 L H White 12 Walter Penningman 14 Thos Martin 16 Jas Hart 18 Ephraim Rumph 20 Chas Carter 22 Elijah Smith 26 Clifford Williams 28 Kathleen Wilson 30 Arth Banks 32 Lena Smith 34 Jas White 35 Berry Clarke 36 Eug Scott 38 Jacob Davis 40 (10) Green Lowe 42 Sylvester Sykes 86 f?imon Felder 89 Silas Ivory 90 J J Corbin 93 Andrew Penny 95 Edw Hill 104 G W Lockhart 108 Vacant 109 Perry Hill 110 Mary Pinkston 112 Wm Pye 122 St Paul's Sancti- fied Church 124 Vacant 127 Henry Amos 133 Otis Burnett 136 Edw Thomas 137 Ada Faulk 139 Chas Wimberly 213 Vacant 215 Sami Searcy 218 Henry Glover 222 Rebecca Norman 224 Wa James 333 Dennis Taylor 334 Luther Alexander 336 Josephine Glover 337 Matilda Ford 338 Benj Sullivan WOOLFOLK (E M)-- From Main west to Clinton 102 Alex Grier 106 Vacant 112 Thos Glenn 301 Mrs L M Cowan 306 L D Calhoun 307 B W Massey 350 E B Warren 351 T W Cowan 352 C C Puckett 354 John McNeil 356 W M Mitchell 452 J W Flowers 453 Vacant 455 Vacant 465 J B McCardle 503 Lorie Dixon 556 J E Thompson 557 L J Ross 560 L B Ogburn 563 Wm Puckett 613 Rev A S Landis 711 (710) C N McPherson 715 J A Barge 716 W W Barentine 717 720) W R Mitchell 718 (200) G W Jones 804 Mrs Annie Munsch 1103 (803) Obie Minion 1105 (805) Wm Boyd- kin 1107 (807) Lewis Par1113 (222) Chas Mc- Carthy 1117 (116) Lymon Young 1132 Walker Wilder 1151 (811) Purvis Flewellen 1153 (1100) David Martin 1155 (1134) Benj Ren- froe 1159 (339) John Wil- liams 1161 (325) Sanctified Church 1163 (326) Jos Burney 1165 (327) Mahala Jackson 1211 (110) J R Waters 1213 (175) John An- drews 1223 (123) Henry Gil- liams 1227 (514) Mathews Stewart WRIGHT AL -- From Spring north 1 e of Ocmulgee 27 Amanda Stenson 227 Addie Gross 228 Nancy Jefferson 229 Stanley Lowe 369 Edw Groom WYCHE (S M)--From 2166 Second east 108 Agnes Briscoe 111 Riley Gustin 141 Louvenia Holmes 805 C M Hubbard 112 Mamie Wilder 147 Maggie Boyd 806 J J Moore 114 Adchie Dubose 179 A R Johnson 808 Robt Stevens 117 Jas Temple More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Wyehe (S M) 124 Vacant 127 W B Coleman 128 J A Fraser WYCHE'S AL -- From Second to Cedar, bet Giles and Jenkins YATES AL--A continnation of Yates ay 200 Margt Odom 202 Lois Smith 203 Crawford Turner 205 Thos Johnson 211 Fred Gardner 212 Bug Butts 213 Horace Howard YATES AY (E H)-- From Emerald to Powell 1 n of Flanders MACON 101 G T Mayo 102 Jennie Boat- wright 104 E A Griggs 105 S A Griggs 108 Jerry Simpson 109 T A Pruett 110 Mrs Alice J Hol- .ston 111 Lee Smith 112 Mrs Emmie Cros- by 113 Annie M Curry 114 Edw English 115 Vacant 116 W S Sconyers 117 F E Byrd 118 H E Tidwell Yates Av (E M) 119 W G Stephan Center begins 120 Mrs M Eliz Smith 122 R L Walden 123 Abner Monday 125 L H Hunnicutt 126 T W Wells 128 Vacant 129 J H Wooten 130 Vacant 203 Eug Ruttedge 205 Thos Johnson 208 Mitchell Vinson 211 Vacant 211% Fredk Garden 212 Vacant 212% Lillie Butts 213 Thos Marshall DIRECTORY IS THE COMMON INTERMEDIARY BETWEEN BUYER anoSELLER o Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-162 MACON BUSINESS DIRECTORY (1925) 1135 POLK'S dental ;WR#CTetaDTgnHISaRidTDsAaYtTEeAErRS & .1925 [EClOUS Petafolrms ; m M RentaIOlN MACON, GA. CITY DIRECTORY POLK'S Dental 1925 Classified Business Directory Names appearing under headings marked (#) are only inserted by special contract. of Titln SECURITY LOAN & ABSTRACT CO, 5th fl Macon Savings Bank Bldg Tabor H T 406 Poplar Register OP THE UNITED STATES AND CANADA 1925 Accountants Barnes Moses 764 Oak Dodge L C & Co 353i/2 3d Holcombe J L 610-11 Grand bldg McFerrin J M 409 Bibb bldg Patterson Sami room 514 Ga Casualty bldg THAGGARD WALTER L, 708 Georgia Casualty Bldg (See page 50) Adding Machines Burroughs Adding Machine Co 654 Mulberry Dalton Adding Machine Co 419 2d Monroe Calculating Machine Co 705-6 Bibb bldg Advertising LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Co. Publishers 536 S. Clark St. Chicago, III. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. TeL 2813 1136 (1926) R. L. POLK & CO.'S Advertising--Direct Mail LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Advertising Agents LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Macon Advertising Service 510 3d Agricultural Implements Gantt Mfg Co Bay sw cor Elbert Williams Mfg Co 660 Broadway Architects Blair Alex 401 Ga Casualty bldg Brown A Sidney 361% Cotton av DENNIS & DENNIS, 411 Cherry (See front cover) Dunwody & Oliphant 460 % Broadway Ellis C R 201% Cotton av Happ F R 24-25 4th Natl Bank bldg Shelverton C W 514 Grand bldg Art Goods Williams W L Art Store 107 Cotton av Artists Boone Jennie M 531 College Langford Margt S 3 Nevaro flats ^Asphfllt MACON SUPPLY CO, 7th cor Mulberry (See front cover) *Attorneys-at-Law (See also Lawyers) BROCK, SPARKS & RUSSELL, 214-218 Ga Casualty Bldg HARRIS, HARRIS & POPPER, 914-917 Ga Casualty Bldg Auditors THAGGARD WALTER L, 708 Georgia Casualty Bldg (See page 50) Automobile owners are select prospects for many kinds of merchandise. Send to Headquar- ( tcCeoarptsayl.foogr: aclolRnkt.ianLind.ssPomOfLuAcKhut&ovmaClouOba.,ibleDleELdTisaRttsaO..ITOA, usMrkInCfeoHwr. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA MACON BUSINESS DIRECTORY (1925) 1137 *Automobile Accessories ELLIS MOTOR CO, 362-378 1st (See right side lines and page 52) HATCHER A S CO, 598 3d (See front cover) JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) YATES MOTOR CO, 707 3d (See right center lines and page 54) * Automobile Accessories and Supplies PACE IV E, 657-659 3d (See right center lines and page 50) Automobile Batteries See Storage Batteries Automobile Laundries Harris Albert 210 3d Automobile Livery Clarke M A 453 2d Rent A Ford Co The 320 Broadway U-Drive-It System 409 Mulberry YELLOW CAB CO OF MACON, 5th St Side Terminal Hotel Bldg (See back cover, left side lines and page 85) Automobile Painters Avery & Patterson 2310 2d PEARCE E R, 523 Pine (See left bottom lines and page 53) SHADBURN W H, 708 3d (See right side lines and page 68) Shadburn & Hudson 514 Plum Southern Duco Enameling Co 654 3d STROBERG C W, 451-453 1st (See right top lines and page 53) "`Automobile Parts COLEMAN MOTOR CO, 218-220 3d (See page 51) ELLIS MOTOR CO, 362 (378) 1st (See right side lines and page 52) JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DIM as a mm 1138 (1925) R. L. POLK & CO.'S *Automobile Parts--Dodge Bros SOLOMON S M JR, 462 Broadway (See left bottom lines and page 53) pm THE DIRECTORY IS THE GREATEST MARKET PLACE i THE WORLD * Automobile Repairers Colbert W 0 455 Wall Dixie Highway Garage 1034 Broadway Ellis Garage 621 3d Georgia Auto Co 609 3d Hallman C E 550 3d Howell H D 611 3d Kenyon S O 557 3d McCullough J S 507 Mulberry PACE N E, 657-659 3d (See right center lines and page 50) Parrish G H 717 3d Sheffield M C 212 3d Stearns H R 514 1st United Auto Co 860 Broadway Wayman R L 555 3d Willingham E T 663 3d YATES MOTOR CO, 707 3d (See right center lines and page 54) Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year BLPoiK&fo PUBLBHEfiS *Automobile Service JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) *Automobile Service--Star, Durant, Paige and Jewett BEELAND-CONRAD MOTOR CO, 560 2d (See left top lines and page 51) Automobile Supplies Amspoker G E407 Cotton av Bearing Supply Co 607 3d Bond Auto Supply Co 322 Broadway Dickey Auto Supply Co 689 3d and 2d nw cor Poplar Flournoy Auto Co 519-521 Poplar Hammond Service Co 467 2d HATCHER A S CO, 598 3d (See front cover) Hertz P E 173 Broadway James J W 451 2d JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) PolItDirscbuiSiDfi DETROIT : A natural by-product of the Directory1 Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co. CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569% CHERRY ST. TELEPHONE 2391 MACON BUSINESS DIRECTORY (1925) 1139 Macon Bearing & Parts Co 517 Plum Stewart Oil Co 501 Mulberry Tharpe W T 613-15 Mulberry Triangle Service Co 501-07 Cotton av CL Wade & Co 566 2d Wall Brad Inc 369 Cotton av Wright Auto Supply Co 411-417 Poplar YATES MOTOR CO, 707 3d (See right center lines and page 54) SASH, Automobile Tires HATCHER A S CO, 598 3d (See front cover) JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) YATES MOTOR CO, 707 3d (See right center lines and page 54) DOORS Automobile Top Manufacturers HATCHER A S CO, 598 3d (See front cover) Shadburn J D Co 514 Plum SHADBURN W H, 708 3d (See right side lines and page 68) STROBERG C W, 451-453 1st (See right top lines and page 53) *Automobile Tops Built and Repaired PEARCE E R, 523 Pine (See left bottom lines and page 53) SCREENS *Auomobile Truck Bodies STROBERG C W, 451-453 1st (See right top lines and page 53) *Automobile Windshields JARRETT PAINT & GLASS CO, 312 3d (See page 78) MILLWORK Automobiles Adams-Buchanan Motor Co 716-720 Broadway BEELAND-CONRAD MOTOR CO, 560 2d (See left top lines and page 51) BUICK, Dunlap-Huckabee Auto Co Distributors 682- 690 3d (See left top lines and page 52) Burke H A 713-15 3d RESS I r\ A '%7`IC* I IN | IA Y S 'YLE | i/-Tl M. Kj | USE YOUR CREDI1 406 THIRD ST. TEL. 3026 >o H>CH/3 . t Haverfield Smith & Wood 303 Cherry Hightower M D 1203 Broadway Howell Connossie 161 Fifth Hunt T J 413 Cotton av Jackson & Gordy 650 Cherry Jenkins H L 308 Cherry Jones J H 711 Broadway Jordan Jas R 2105 2d Lane C B 613 Broadway Lee H L 1213 Broadway Mason Geo h500 (480) Charles (S M) Meadows J W 2657 2d Miles Moses 417 Cotton av Mitchell J C 1504 Broadway Mouzon M J 764 Broadway Palace Barber Shop 558 Mulberry Palm Barber Shop 615 Cherry Peek John 511 Broadway Pierce Lewis rear M A Nolan Forsyth rd (V) 5 w Riley av Piercey E Z 621 Broadway Sanders Fred 115 Telfair Sanitary Barber Shop 568 Mulberry Sheftall Minnie 313 3d Silas Ivory 638 Washington av Stallworth A J 316 Main (E M) Stripling R G 471% 3d Terminal Station Barber Shop Terminal Station Thompson Budrow 246 Main THORPE R S & SONS (Ladies and Children), 515517 Cherry 2d fl (See page 59) Trawick W M Forsyth rd (C P) cor Park av United Barber Supply Co 551 Broadway Wesley Arthur 808 Hazel Williams H W 2140 2d Wilson Albert 252 5th MOVING STORAGE Barbers' Supplies evr Macon Barber Supply Co 318 3d n oo FOR LISTS OF NAMES oL ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO j FOLK'S dental W^R 1 PRECIOUS yc PJ&eERtTafOlRsM m. V&J SR^CeAnTtIaOlN POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk Publishers 536 S. Clark St. Chicago, III. Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 1150 (1925) R. L. POLK & CO.'S Cement Ornaments CLARK R E, 1150 Napier av (See page 57) Cement Products CLARK R E, 1150 Napier av (See page 57) Cement and Lime BUILDERS LUMBER CO, 6th se cor Cherry (See page 74) BURKE T C INC, 358-360 3d (See front cover) ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) MACON SUPPLY CO, Mulberry cor 7th (See front cover) WILLINGHAM SASH & DOOR CO, 457 3d (See top edg eand left top lines) Certified Public Accountants THAGGARD WALTER L, 708 Georgia Casualty Bldg (See page 50) Chemists Morris-Flinn Co 569 Cherry OLIPHANT JAMES T, 658 Mulberry (See left center lines and page 75) Royster F S Guano Co 11 Jaques bldg Chero-Cola MACON CHERO-COLA BOTTLING CO, 618-620 Broadway (See right center lines and page 56) Children's Barbers THORPE R S & SONS, 515-517 Cherry (See page 59) Chiropractors Dick & Dick 208 Ga Casualty bldg ENGLAND ARCHIBALD, 613-618 right top lines and page 3) Rust J D 220 Bibb bldg Bibb Bldg (See Christian Science Practitioners Butts Jesse C 308 Grand bldg Snelling J P 308 Grand bldg E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS Lincoln CARS-TRUCKS -TRACTORS hIffoarvIet'asita.FoFrodr,d woer PHONE 1591 JONES MOTOR COMPANY 557-559 PLUM ST. MACON BUSINESS DIRECTORY (1925) 1151 Cigar Manufacturers Cowart Cigar Factory 614% Poplar Moses Morris 304% 3d Cigars and Tobacco--Retail Brown E C 422 2d Burr G W lobby Hotel Lanier Finney G P 672 Cherry HARDEMAN AVENUE PHARMACY, 124 Hardeman av (See page 64) Hotel Lanier Cigar Stand 525 Mulberry McCRARY DE WITT DRUG CO, 336 Main (See page 64) Schulte A 3d nw cor Cherry Cigars and Tobacco--Wholesale Carstarphen Warehouse Co 612 Poplar MACON CIGAR & TOBACCO CO, 656 Broadway (See page 58) *City Property BURNS KENMORE INC, 157 Cotton av (See left bot- tom lines and page 80) DESSAU WASHINGTON, 101 Ga Casualty Bldg (See page 81) THARPE L A, 308 2d (See front cover and page 82) Civil Engineers Cutter H D 563% Mulberry Gostin E L 29 Washington bldg Clay Products Georgia Kaolin Co 606 Ga Casualty bldg *Cleaners and Dyers CRESCENT LAUNDRY CO, 519 2d (See right side lines) INDEPENDENT LAUNDRY CO, 452 2d (See page 73) The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Muck Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by * Clock Repairing RIES & ARMSTRONG INC, 315 3d (See front cover and page 72) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3S17 MACON, GA. 211 Cotton Ave. 1152 (1925) R. L. POLK & CO.'S Clothes Cleaners and Pressers Banks Felix 314 Broadway Bayne M G 574 Cherry Durden & Mathews 2657 2d ^Electric Dry Cleaning Co 115 Cotton av Fleming Matthew L 615 Poplar Harvey G R 605 Linden av Herrington H C 55 Forsyth rd (V) Hicks Arth 213 1st av (V) Hill King 1011 Broadway Hubbard Dallis 38 Wall INDEPENDENT LAUNDRY CO, 452 2d (See page 73) Jackson Tink 621 Broadway Jones Dalton 809y2 Broadway Kidd & Taylor rear 626 (618) Montpelier av Liberty Pressing Club 558 Mulberry Martin Cleaning Co 565 Broadway Maund J W 36314 Broadway Pearson Bdw 971 Hazel Powers Wm 438 Alabama Sanders Fred 724 Nussbaum Sanford Solomon rear 246 Main Sanitary Pressing Club 568 Mulberry Sawyer Wm M 205*/2 5th Schelling G R 119 Cotton av Stallworth A J 316 Main (EM) Swain David 166 Douglas av Teal Clinton 410 Poplar Turner Julius 1012 Ocmulgee Wardrobe Pressing Club The 409 Cherry Willis James 872*4 Hazel zu gold g|2 Clothing--Retail Askins 416 3d Benson F C Co Inc 572 Cherry Burtons Inc 352 2d Collins 458 3d DAY'S, 406 3d (See right bottom lines and page 58) FEDERAL CLOTHING STORE, 312 2d (See page 58) Harry The Tailor 403 Cherry HART, SCHAFFNER & MARX, Sold by C H Hunni- cutt Clothing Co 317-319 3d (See right side lines and page 58) cAmtCeoauraptstnyaoy.lfmookgoribnacidlloelsIntkto.aiofnLiwndm. snsPeeormOrcfsLuhAcaKahnurdteovfiesmaeClso.uOeba.l,ibeSleDlceetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtMssrkqInuCffeaoHowrr-r. JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON BUSINESS DIRECTORY (1925) 1153 HUNNICUTT C H CLOTHING CO, 317-319 3d (See right side lines and page 58) NEEL JOSEPH N CO, 520 Cherry (See right top lines and page 59) RELIABLE OUTFITTERS, 355 2d and 156 Cotton av (See page 59) Sandefur-Harwell Clothing Co 355 3d SMART HERBERT CLOTHING CO, 559 Cherry (See left top lines and page 59) SNYBER'S REABY-TO-WEAR, 609 Cherry (See page 72) Terminal Tailors & Haberdashers 313 Cherry THORPE R S & SONS, 515-517 Cherry (See page 59) Trivers Clothes Stores Corp 566 Cherry Wachtel David 518 Cherry XV Clothes Shop 454 Cherry Clothing--Wholesale Carter Wm Co The 423 Plum Coal--Retail Atlantic Ice & Coal Corp (V Br) 301 Pio Nono av ATLANTIC ICE & COAL CO, Waterville rd BIXIE COAL CO, Hawthorne se cor 5th (See left side lines and page 60) KINNETT COAL & ICE CO, Vineville Station 1 e Holt MERRITT COAL & WOOB CO, 1st ne cor Ash (See left bottom lines and page 60) RAINBOW COAL CO, 353 Elm (See page 60) Ramsey J W Coal Co 153 Cotton av and 201 Edge- wood av Roberts Coal & Transfer Co Inc 361 Oak Sawyer Coal & Ice Co 6th and Mulberry RAINBOW COAL CO, 353 Elm (See page 60) *Coal and Wood MERRITT COAL & WOOB CO, 1st ne cor Ash (See left bottom lines and page 60) Coffee Roasters Bailey J H Coffee Co 503 5th * FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO HERBERT SMART WALTEWRALFT, ECRLAPREKA, RSChEoe Dept. DEAN BAKEWELL as a MMEI PLACE THE DIRECTORY IS THE GREATEST MARKET HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 1154 (1925) R. L. POLK & CO.'S Collections McCowen & McCowen 601 Grand bldg WILLIAMS LUTHER BANK & TRUST CO THE, Cherry cor Cotton av (See right top lines and page 55) *Colleges MERCER UNIVERSITY, Ash cor University Place (See page 61) WESLEYAN COLLEGE, 500 College (See page 62) Colleges and Schools KAIGLER'S BUSINESS COLLEGE, 211 Cotton av (See left top lines and page 57) SOUTHERN BUSINESS COLLEGE, 656y2 Cherry (See right top lines and page 60) PLACE IN THE *Commercial Colleges KAIGLER'S BUSINESS COLLEGE, 211 Cotton av (See left top lines and page 57) WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * The Directory is the Natural Source of Information and is "On the Job'' 365 Days Every Year MiKitb PUEBHEffi * Commercial Printers JONES & CONEY, 411 Broadway (See page 80) *Composition Roofing MACON SUPPLY CO, Mulberry cor 7th (See front cover) Composition Shingles BURKE T C INC, 358-360 3d (See front cover) MACON SUPPLY CO, Mulberry cor 7th (See front cover) Composition and Metal Building Specialties MACON SUPPLY CO, Mulberry cor 7th (See front cover) Confectioners--Retail (See also Fruits--Retail) King Duffy 122 2d Kitchens & Stevens se cor Pine and 3d Sealy B N 110 3d Tzimka E G 305 Broadway VanLandingham & Hadaway 304 Cherry DETROIT FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. TL. POLK & CO. Chicago Southern Business College E. L. RAY, President S? DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656/2 CHERRY ST. PHONE 3041 MACON, GA. 6. (1925) R. L. POLK & CO.'S 1155 in Confectioners--Wholesale g Block Prank E Co 253-55 5th Empire Candy Co 5th nw cor Ocmulgee S' Lettice-Goodwin Co 563 Broadway * Conservatories of Music WESLEYAN COLLEGE, 500 College (See page 62) * Consolidated Delivery Service PARCEL DELIYEEY CO THE, rear 520 Cherry (See page 63) Contractors Alley Jeff D (bldg) Log Cabin Hts Amerson G C (bldg) 561 Mulberry Arnold E J 413 Grand bldg Barnes Wm B (bldg) 57 Pio Nono av BEELAND WM J (Genl), 560 2d Bishop P J 501 Grand bldg Bishop J P (bldg) 616 Johnson av Bollinger R A 460 Carling av Cartledge Lamar 620 2d Cornell-Young Co 30-31 4th Natl Bank bldg Ellis Theodore 2 College Hill apts Panning George W 403 Ridge av Forrester G A 225 Belmont av Freeman A Pope 2525 Broadway Freeman Homer H (bldg) 2525 Broadway Griffin W D (bldg) 210 Winship Higgison Construction Co (paving) 313 Ga Casualty bldg Huff W P (bldg) 26 S College av Hyman J H (bldg) 135 Winship (WH) Jones C W (bldg) 25 Wall MILLER BEOS (Plumbing), 171 Cotton av (See left side lines and page 79) Molton C J 290 Hillyer av SCHWARTZ & PHAUL (Heating and Ventilating), 452 Plum (See page 79) SHROPSHIRE J T (Plumbing), 525 Cotton av (See page 79) Smalling R H Sons 461% 3d Smith J S 1204 (1242) Edgewood av Stephens F D (stone) 304 Citizens & Sou Bank bldg n Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. W > O O oJ_ i z PI > H * Oh > > s a mm*zirn[ 5O ZP1 m n pi Q > 1 r I i/)H > a H SL m Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4Va% on Savings MACON BUSINESS DIRECTORY (1925) 1165 Crump's Park Pilling Station Forsyth rd (V) Davidson Service Station Forsyth rd (V) Dunlap Hill Filling Station 1028 Main (EM) Ellis Austin J 1246 Broadway Ellis Service Station ss Forsyth rd opp Forest Hill av Flournoy Auto Co 667 N Cherry Fuller C H 3019 Houston av Gulf Refining Co 259 5th 362 Hardeman av 600 New 209 2d cor College and Oglethorpe and cor Walnut and 2d Highland Oil Co 113 North av Nolan and Herrington cor Forsyth rd and Riley av North Side Filling Station 99 North av (N H) Read & Pettey 570 2d Red Star Filling Station 600 3d Rodgers T F 2915 Houston av Shepard A B 2635 Broadway Standard Oil Co 2638 Broadway 101 Montpelier av 601 2d 102 Vineville av and sw cor Forsyth rd and Hartley av Stewart Oil Co 673 Cherry Texas Co The 2846 Houston av and 280 Main (EM) Wofford Oil Co 701 Broadway ne cor Forsyth rd and Hartley av and nw cor Poplar and Cotton av *Fire Brick and Clay BURKE T C INC, 358-360 3d (See front cover) Fish and Oysters Florida Fish & Oyster Co 318 Main (EM) George J G 456 1st Nomand R T Fish Co 655 Poplar Redding Edw 1126 Broadway Vineville Fish Co T17 Hardeman av CO OS m to t-tSi C/5 n O 9 o o H ? O 73 ,0 ro cgn w g I? "0 on ~mo Ip* i m M00 g* 0> Five and Ten Cent Stores Kress S H & Co 450-54 3d McLellan's 556 Cherry Woolworth F W & Co 514 Cherry *Floor Coverings MAXWELL BROS & BRIDGERS, 455 2d (See page 67) IFOR LISTS OF NAMES -- ANY BUSINESS' -- ANY PROFESSION - - R. L. POLK & CO. Chicago FOR LISTS OF NAMES ANY TRADE*-- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1366 (1925) R. L. POLK & CO.'S *FIoral Designs IDLE HOUR NURSERIES, 109 Cotton av (See right center lines and page 65) Florists IDLE HOUR NURSERIES, 109 Cotton av (See right center lines and page 65) Nutting Floral Co 414 2d Woodruff C N 650 Forsyth Flour and Feed Mills Birdsey Flour Mills Poplar nr 8th Macon Flour and Feed Co 270 5th Mitchell L A 611 3d National Milling Co 5th nw cor Ocmulgee *Flue Lining Manufacturers DICKEY W S CLAY MFG CO, 609-613 Ga Casualty Bldg (See left side lines and page 83) Founders and Machinists Macon Machine Shop 451-53 Wall *Founders and Machinery Manufacturers SCHOFIELD'S J S SONS CO INC, Edgewood av cor Hammond Fruits--Retail Adams & Poulos 319 Cherry Davis Jos 3063/2 3d Handy Geo 505 Broadway Maroon Tony 452 Poplar Nicholas & Nicholas 325 Cherry Sardis Sami 667 Broadway Union Tony 771 Broadway Fruits--Wholesale Georgia Banana Co 310 Cherry Macon Orange & Banana Co 451 5th *Funeral Designs IDLE HOUR NURSERIES, 109 Cotton av (See right center lines and page 65) 0. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 276 CHERRY TELS. 161-162 MACON BUSINESS DIRECTORY (19251 1167 *Funeral Directors BURGHARD L H, 718 Cherry (See page 66) CENTRAL CITY UNDERTAKING CO, 457 Cotton av (See page 66) HUBBARD UNDERTAKING CO THE, 468 Cotton av (See page 66) HUTCHINGS C H & SONS, 510 Cotton av (See page 67) H5 J1 in'll ft COS HAMLIN & SUBERS, 27 Wall (See page 85) Furnished Rooms Averhart Janie 355 Wall Burgamy Mollie 754 Broadway Coleman Rosa L 318 Wall Fudge Callie 318 Walnut Hancock Laura J 452% Mulberry Hilliard Marjorie 1206 Broadway Jones America Mrs 1521 Broadway Jones Bertha 619% Broadway McKinnon Robt 1216% Broadway Park Annie E 714 3d Ryon Mary M Mrs 760 Cherry Stanley Mattie 716 3d Stewart D M 460 Mulberry POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Furniture--Retail American Furniture Co 459 2d Backer Jacob 460-62 Poplar Empire Furniture Co 522 Poplar Estes G P 1225 Broadway Feb C I 616 Poplar Ford J W 1125-31 Broadway Georgia Furniture Co 466 Poplar Globe Furniture Co 420 Poplar Goldgar Furniture Co 412 Poplar Johnson Bros 461 2d JOHNSON, DURHAM & BURKE, 365 2d and 168 Cot- ton av (See left top lines and page 67) Lazarus Jacob 364 3d McManus Furniture Exchange 408 Broadway Marshall H Furn Co 558 Poplar Maxwell Bros & Bridgers 455 2d Drink in Bottles TELEPHONE 287 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. Tel. 2813 1168 (1925) R. L. POLK & CO.'S Furniture--Retail--Contd Mozo-Cater Co 113 Cotton av Rhodes A G & Son 616 Cherry Taylor Furniture Co 464 2d Union Furniture Co 510 Poplar Wood-Peavy Furn Co 357-63 2d 160-66 Cotton av Furniture Manufacturers and Dealers JOHNSON, DURHAM & BURKE, 365 2d and 168 Cot- ton av (See left top lines and page 67) MAXWELL BROS & BRIDGERS, 455 2d (See page 67) ^Furniture Moving MACON TRANSFER & STORAGE CO, 702-704 Broad- way (See right side lines and page 86) Furniture Repairs Duval Paul & Son 460 Cotton av Hooten W F 1123 Oglethorpe Johnson J L 416 Main Muecke's Antique Shop 703-5 Broadway Fur Dealers and Furriers Barnes J G 512^ 3d Garages Bethea C P 251 Wall Broadway Garage 506 Broadway Brooks W B 215-29 3d Carlisle Bros Forsyth rd (V) Cassidy's Garage 401 Mulberry Fuller's Garage 408-10 Main Hampton Garage 257 5th Jones C W 858 Hazel Jones Motor Co br 552 2d Kessler's D M Garage 419 Mulberry Montpelier Garage 945 Columbus rd Raley J S 769 Broadway South Side Garage 408 (11) Crisp Southland Garage 517-19 Broadway Thomas Wm 659 Georgia av Thornton A B 858 Broadway Willis R R 756 Broadway Zellner Garage & Battery Co 509 Cotton av Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable STATIONERS AND OFFICE OUTFITTERS Loose Leaf Goods of All Kinds Kept in Stock or Manufactured THE J. W. BURKE CO. 406 CHERRY STREET MACON BUSINESS DIRECTORY (1925j 1169 * Garden and Lawn Adornments CLARK R E, 1150 Napier av (See page 57) Gas Companies MACON GAS CO, 220 2d *Genasco Hoofing MACON SUPPLY CO, 7th cor Mulberry (See front cover) General Merchandise (See also Grocers) Fox H A 1751 Broadway Johnston R L 618 Broadway Saloom S & Sons 1243-45 Broadway Simmons I Mdse Co 973 Hazel Workingman's Store 418 Poplar *Gibson Mandolins, Guitars and Banjos WILLIAMS-GUTTENBERGER MUSIC CO, 466 2d (See page 75) *Glass--Window and Plate JARRETT PAINT & GLASS CO, 312 3d, (See page 78) *Glass and Oils BURKE T C INC, 358-360 3d (See front cover) ELDER W M LUMBER CO, Omulgee se cor 7th (See page 74) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) * Granite JAMES 0 D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) *Grates MOLTON C J LUMBER CO, 348 Oak (See right bot- tom lines and page 75) *Grates, Tiles and Mantels BURKE T C INC, 358-360 3d (See front cover) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) for lists of names ANY TRADER- ANY BUSINESS -- ANY PROFESSION DETROIT R. Tj. POLK & CO. CHICAGO Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 DIMS as a MMET PLACE THE 1170 (1925) R. L. POLK & CO.'S . Grocers--Retail Adams Isaac 257 Cowan Adams Sophie 670 Hazel Alexander J F 228 Cotton av Alexander Nathan 1201 Broadway Allen J W 852 Hazel Anderson Daisy Mrs 1783 3d Anderson George & Co Industrial Home rd sw cor Morris DIRECTORY Anderson S F 220 Turpin Annis Chas L, 302 Bay cor Hammond IS THE Appling Irving 122 Elliott Arnold Wm 410 Henderson GREATEST Ashton Rosa 102 Green MARKET Atwell Mattie 105 (99) Myrtle Atwell Mollie Mrs 545 Telfair PLACE Barfield Robt W Bellevue rd Barfield R B 16 Bellevue rd IN THE Barnes D A 318 Montpelier Barnes J B 780 Edgewood av WORLD * Beasley C P 670 Ash Beasley J B 902 Hazel Bell Chas 254 Plant Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had * Bell H E 504 Mitchell Bell Minnie 755 Broadway Bennett Hyman 1540 Broadway Birrick E J 203 5th Bobo Davis 301 Turpin Bolton G S 100 Johnson's al Braddy Jos D Bellevue rd Braddy J B 14 Bellevue rd Braddy J M 553 Pine Bradfield Gro Co 412% Montpelier av The Directory is the Natural Source of Information and is "On the Job'* 365 Days Every Year Bradley Oscar 466 1st Bragg Jas R 704 Hawthorne Brjo Brothers 432 Flanders (EM) Brown Felix 313 Curd (SM) Brown Grocery ne cor Forsyth rd and McGhee Bryant J W 159 Franklin Bulcken J B 1302 Broadway Burgamy Mollie 803 Broadway Burke Wm T 1106 Main MJteufo Burnette Chas I 3200 Houston av PUBLISHERS Butler & Smith 3011 Houston av IblltDirecb^ffi DETROIT . MICH- / A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit Central Sash & Door Co CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569^2 CHERRY ST. TELEPHONE 2391 MACON BUSINESS DIRECTORY (1925) 1171 Butts Andrew 455 Clinton Boatwright J L 328 Dannenberg av Byrd Jennie Lake (B) Byrd Richd 312 Pattison Caldwell J L 35 Bellevue rd Cameriero Nicholas 418 Mulberry Campbell Mollie Mrs 614 Telfair Carmichael L N 903 Walnut Carvest E C 620 Hazel Caserio John 251 Washington av Chaney Wm 303 Forest av (Y) Chanin Bennett 770 Hazel Clemons J H 111 Franklin Christian Genie Mrs 308 Pio Nono av Clay Henry 546 3d av (V) Clemons J HH 111 Franklin Clinton Road Cash Grocery 1026 Clinton rd Clourse Dina 143 Jones Clowers Randolph 501 Martha (EM) Cochran G A 514 Church Cody Amelia 307 Campbell av Cofield W M 102 Virginia la Cohen Max 300 Pio Nono av College Hill Grocery No 2 930 Napier av and 288 Washington av Collins J W 454 1st Combrevi Augusto 530 Cotton av Cooper Mary L 190 Forest av (V) and 622 3d av (V) to Croom Burley 198 Hydrola n Crumps Park Grocery Forsyth rd (V) Daly C B 2314 2d David Jones 475 Douglas av Davis Wm 275 and 337 Madison Dempsey C A 344 Gilmer Dixon Floyd 314 Division to Dixon John 1237 3d Donnelly T M Co 970 Oglethorpe Dukes Frank 111 Bay Dukes John 234 Clinton Dumas C M 1243 2d Dunn Cornelius 119 Elliott (EM) Durden & Abbott 1156 Edgewood av Dyes S L 202 Crisp East Macon Packing Co 304 Main (EM) 406 THIRD ST. USE YOUR CREDIT TEL. 3026 0) c o M ^ oz os I_JdJ IJJd s < d Z H aoVcs s t/> 5 u o5 5 H gu o 1X 1u>1 Q 5< 2 a2 on Savings MACON BUSINESS DIRECTORY (1925) 1181 Ice Manufacturers and Dealers ATLANTIC ICE & COAL CO, Waterville rd 2 s of Edgewood av MINNETT-ODOM CO, 6th ne cor Cherry (See page 0 70) Macon Ice & Cold Storage Co 305 Bay Sawyer Coal & Ice Co 6th and Mulberry incinerator Manufacturers Nye Odorless Crematory Co 601 Ga Casualty bldg income Tax Experts BARRON & REAGAN, Bibb Bldg (See left top lines and page 84) industrial Loans BENEFICIAL LOAN SOCIETY INC, 103 Ga Casualty Bldg (See page 73) Insect Exterminators Weevilnip Co of America 509 5th Insurance Agents ADAMS C M & SON, 205-206 Citizens & Southern Bank Bldg (See page 70) Bagley Willet & Paine J.005-6 Ga Casualty bldg BARNES & BARNES INC, 214-215-216 Bibb Bldg Beall O P (life) 801-3 Ga Casualty bldg Birch Insurance Agency 557 Mulberry BLOCH CARL, 310-311 Citizens & Southern Bank Bldg (See page 80) BURNS KENMORE INC, 157 Cotton av (See left bot- tom lines and page 80) CALHOUN & CALHOUN, 569i/2 Cherry (See right top lines and page 81) Chandler Sam S & Co 102 Ga Casualty bldg CITY REALTY CO, 565 Mulberry (See page 81) Coleman T A (life) 305 Ga Casualty bldg Crocker W J 507 Bibb bldg DESSAU WASHINGTON, 101 Ga Casualty Bldg (See page 81) Dure & Beeks Co 610 Mulberry Gandy J Ogden 911 Ga Casualty bldg Griffith Wm S & Son 208-9 Macon Natl Bank bldg O? > El. >; S -B . C3 O fa 3 ffg l IS *-a O g po ca ?r | e Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. e- 3 Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. 1182 (1925) R. L. POLK & CO.'S Insurance Agents--Contd Halliburton Mamie W Mrs 522 Citizens & Sou Bank bldg HARDEMAN G G CO, 563 Mulberry (See page 81) HARDEMAN & WILLIAMS, 808-809 Georgia Cas- ualty Bldg (See page 71) HARRIS MORRIS, 210-212 Bibb Bldg (See left top lines) HARROLD BROS CO, 321-24 Macon Natl Bank Bldg HATCHER-TURPIN CO, 523 Mulberry (See page 82) Head G W (life) 565 Mulberry Jackson & Middlebrooks 305-6 Citizens & Sou Bank bldg Jordan Insurance Agency 354 1st LOWRY T S JR, 901-2 Georgia Casualty Bldg McKay John J 911 Ga Casualty bldg Mann Bros 813 Ga Casualty bldg Mason P B 601 Bibb bldg MITCHELL T L, 411-12 Citizens & Southern Bank Bldg (See page 70) MORGAN & MORGAN INSURANCE AGENCY, 606 Georgia Casualty Bldg (See left bottom lines and page 71) PENDLETON W E, 411-412 Citizens & Southern Bank Bldg (See page 70) Rankin G A (life) 404 Ga Casualty bldg SHIRLEY LOUIS A, 411-12 Citizens & Sou Bank Bldg (See page 70) Southeastern Underwriters Association 302-3 Bibb bldg Southern Underwriters Co 28-29 Fourth Natl Bank bldg Stokes T W 153 Cotton av THARPE L A, 308 2d (See front cover and page 82) TYNER HERMAN 0, 411-12 Citizens & Southern Bank Bldg (See page 70) Vincent Ned 154 Cotton av WEST F B, 309-311 Bibb Bldg WHITEHEAD HENRY, 308 Bibb Bldg (See page 83) WILLIAMS R A, 36-37 Fourth Natl Bank Bldg (See left side lines and page 83) Willingham B B 516 1st WILLINGHAM & PAYNE (General), 461 3d Willis W C (life) 308 Ga Casualty bldg E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED DEALERS ,mcoln Ford CARS-TRUCKS-TRACTORS khllfoarvPPietHH'asOOItNNa.FEEoFr11od55r,99d11woer JONES MOTOR COMPANY 557-559 PLUM ST MACON BUSINESS DIRECTORY (1925) 1182 WILSON JOHN E, 207 Citizens & Southern Bank Bldg (See bottom edge) ^Insurance Agents--Automobile BARNES & BARNES INC, 214-215-216 Bibb Bldg Insurance Companies--Accident HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) ,, TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & South- ern Bank Bldg (See bottom edge) Insurance Companies--Automobile GEORGIA CASUALTY CO OF MACON, GA, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) , _ GEORGIA CASUALTY CO OF MACON, GA, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) ,, GLENS FALLS INSURANCE CO OF GLENS FALLS, N Y, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) _ . INSURANCE CO OF NORTH AMERICA, PHILA- DELPHIA, PA, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) ^ . NEW YORK UNDERWRITERS, Hatcher-Turpm Co Agts, 523 Mulberry (See page 82) NORTHWESTERN FIRE & MARINE INSURANCE CO OF MINNEAPOLIS, MINN, Morgan & Mor- gan Insurance Agency Agts, 606 Georgia Cas- ualty Bldg (See left bottom lines and page 71) TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & South- ern Bank Bldg (See bottom edge) UNITED STATES MERCHANTS & SHIPPERS, Mor- ris Harris Agt, 210-212 Bibb Bldg (See left top lines) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. r The most comprehensive reference work on me banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. KAIGLER'S BUSINESS COLLEGE TERMS $12.50 PER MONTH Telephone 3517 MACON, GA. 211 Cotton Aye. 1184 (1925) R. L. POLK & CO.'S Insurance Companies--Automobile Liability GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) Insurance Companies--Automobile Theft STERLING FIRE INSURANCE CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Boiler MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) Insurance Companies--Bonds FIDELITY & DEPOSIT CO OF MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Burglary GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) GEORGIA CASUALTY CO OF MACON, GA, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) Insurance Companies--Casualty AETNA CASUALTY AND SURETY CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) GEORGIA CASUALTY CO, Hatcher-Turpin Co Agts, 523 Mulberry (See page 82) AmtcCeoauraptstnayoly.fmoogkor:ibnacidlloelsRnkto.aiofnLiwndm.snsPeeomrOrcfsLuhAcaKhanurdt&eovismaeClso.uOeba.l,ibeSleDcleetnELddTipsatRrtotsoaO.s.HIpTeeOA,acudtMssrkqInuCffeaHoowrrr-. CRESCENT LAUNDRY CO. .Laundry Work, Dry Cleaning and Dyeing Always Reliable JOS. N. NEEL CO. MACON'S BEST CLOTHING STORE STEIN-BLOCH SMART CLOTHES, MANHATTAN SHIRTS EDWIN CLAPP SHOES, KNOX HATS MACON BUSINESS DIRECTORY (1925) 1185 GEORGIA CASUALTY CO OF MACON, GA, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) GEORGIA CASUALTY CO OF MACON, GA, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) HOME ACCIDENT INSURANCE CO OF LITTLE ROCK, ARK, Morgan & Morgan Agts,. Local Claim Agcy, 606 Georgia Casualty Bldg (See left bottom lines and page 71) MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) TRAVELERS INSURANCE CO, Hatcher-Turpin Co Agts, 523 Mulberry (See page 82) ZURICH GENERAL ACCIDENA AND LIABILITY INSURANCE CO OF ZURICH, SWITZERLAND, Morgan & Morgan Insurance Co Agts, Local Claim Dept, 606 Georgia Casualty Bldg (See left bottom lines and page 71) Insurance Companies--Collision STERLING FIRE INSURANCE CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Compensation GEORGIA CASUALTY CO OF MACON, GA, John B Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) Insurance Companies--Elevator GEORGIA CASUALTY CO, 2d PI Ga Casualty Bldg (See page 3) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO cn rn . * S'?50 "Gl NJ ^ I >4 $w5 ! C/5 as a MARKET HERBERT SMART WALTER PEARCE DEAN BAKEWELL WALTER E, CLARK, Shoe Dept. HERBERT SMART 559 CHERRY ST. CLOTHING CO. PHONE 951 1186 (1925) R. L. POLK & CO.'S Insurance Companies--Explosion FIDELITY PHENIX FIRE INSURANCE CO OF NEW YORK, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) pm THE DIRECTORY IS THE GREATEST MARKET PUCE IN THE WORLD * Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had j> * The Directory is the Natural Source of Information and is "On the Job" 365 Days Every Year RLIkiG) prams Insurance Companies--Fire AMERICAN CENTRAL INSURANCE CO OF ST LOUIS, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) AMERICAN EAGLE FIRE INSURANCE CO, Hatcher-Turpin Co Agts, 523 Mulberry (See page 82) AMERICAN INSURANCE CO OF NEWARK, N J, Henry Whitehead Agt, 308 Bibb Bldg (See page 83) BRITISH-AMERICAN ASSURANCE CO, Washington Dessau Agt, 101 Ga Casualty Bldg (See page 81) CALEDONIA INSURANCE CO OF SCOTLAND, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) CITIZENS INSURANCE CO OF MISSOURI, Morgan & Morgan Insurance Agency Agts, 606 Georgia Casualty Bldg (See left bottom lines and page 71) COMMERCIAL UNION FIRE INSURANCE CO OF NEW YORK, Henry Whitehead Agt, 308 Bibb Bldg (See page 83) CONTINENTAL INSURANCE CO OF N Y, G G Hardeman Co Agts, 563 Mulberry (Ste page 81) FIDELITY PHENIX FIRE INSURANCE CO OF NEW YORK, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) GEORGIA CASUALTY CO, Washington Dessau Agt, 101 Ga Casualty Bldg (See page 81) GEORGIA CASUALTY INSURANCE CO, G G Hardeman Co Agts, 563 Mulberry (See page 81) GLENS FALLS INSURANCE CO OF GLENS FALLS, N Y, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) INSURANCE CO OF NORTH AMERICA OF PHILA, PA, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) PoIlcnDrTiremcbTrTyB More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. Southern Business College E. L. RAY, President DAY AND NIGHT OUR MOTTO: "THOROUGHNESS" WRITE FOR INFORMATION 656^2 CHERRY ST. PHONE 3041 MACON, GA. MACON BUSINESS DIRECTORY (1925) 1187 LONDON ASSURANCE CO OF LONDON, ENGLAND, Morgan & Morgan Insurance Agency Agts, 606 Georgia Casualty Bldg (See left bottom lines and page 71) NORTHERN INSURANCE CO, John E Wilson, 207 Citizens & Southern Bank Bldg NORTHWESTERN EIRE & MARINE INSURANCE CO OF MINNEAPOLIS, MINN, Morgan & Morgan Insurance Agency Agts, 606 Georgia Casualty Bldg (See left bottom lines and page 71) NORWICH UNION FIRE INSURANCE CO, HatcherTurpin Co Agts, 523 Mulberry (See page 82) ORIENT INSURANCE CO, Hatcher-Turpin Co Agts, 523 Mulberry (See page 82) PATRIOTIC INSURANCE CO, Washington Dessau Agt, 101 Ga Casualty Bldg (See page 81) PENNSYLVANIA FIRE INSURANCE CO, HatcherTurpin Co Agts, 523 Mulberry (See page 82) PROVIDENCE-WASHINGTON INSURANCE CO OF PROVIDENCE, R I, Morris Harris Agt,. 210-212 Bibb Bldg (See left top lines) SECURITY INSURANCE CO, Washington Dessau Agt, 101 Ga Casualty Bldg (See page 81) STERLING FIRE INSURANCE CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80)- STUYVESANT INSURANCE CO OF NEW YORK, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) SUPERIOR FIRE INSURANCE CO, Calhoun & Thomas Agts, 5691/2 Cherry (See right top lines and page 81) UNITED STATES FIRE INSURANCE CO, HatcherTurpin Co Agts, 523 Mulberry (See page 82) UNITED STATES MERCHANTS & SHIPPERS, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) 5* i. m E S' > o O o > 0 w z > H SO > 2^ 1 to I ZS3 m 13 Oq E *0 > r a *2* Hi > Insurance Companies--General and Public Liability O GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg H m (See page 3) Automobile owners are select prospects for 2nsaLr many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. w00 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 1188 (1925) R. L. POLK & CO.'S Insurance Companies--Health TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) Insurance Companies--Liability GEORGIA CASUALTY CO, G G Hardeman Co Agts, 563 Mulberry (See page 81) POLK'S Dental Register OF THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. Insurance Companies--Life American National Insurance Co 608 Ga Casualty bldg Atlanta Life Insurance Co 556 New Bankers Health & Life Insurance Co 211 Cotton av Carolina Life Insurance Co 504-5 Grand bldg Chatham Mut Life & Health Insurance Co 556 New EQUITABLE LIFE ASSURANCE SOCIETY OF THE U S, 411-412 Citizens & Southern Bank Bldg (See page 70) Fidelity Mutual Life Insurance Co 413-15 Macon Natl Bank bldg Franklin Life Insurance Co 308 Ga Casualty bldg George Washington Life Insurance Co 305 Ga Casualty bldg Georgia Mutual Industrial Life & Health Insurance Co 608 New Guaranty Life Insurance Co 556 New Industrial Life & Health Insurance Co 151 Cotton av Interstate Life & Accident Insurance Co 612-13 Grand bldg Jefferson Standard Life Insurance Co 404 Ga Casualty bldg Life Insurance Co of Virginia 508-10 Grand bldg Life & Casualty Insurance Co 315-18 Bibb bldg Metropolitan Life Insurance Co 717 Citizens & Sou Bank bldg Missouri State Life Insurance Co 302-3 Bibb bldg National Accident & Health Insurance Co 813 Ga Casualty bldg National Benefit Life Insurance Co Colored Pythian Temple National Life & Accident Insurance Co of Nashville Tenn 414-15 Citizens & Sou Bank bldg New England Mutual Life Insurance Co 801-3 Ga Casualty bldg FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON BUSINESS DIRECTORY (1925) 1189 New York Life Insurance Co 209 Ga Casualty bldg North Carolina Mutual Life Insurance Co 556 New NORTHWESTERN MUTUAL LIFE INSURANCE CO, 470 Cherry Penn Mutual Insurance Co 1005-6 Ga Casualty bldg Peoples Health & Life Insurance Co 425 Cotton av Pilgrim Health & Life Insurance Co 556 New PRUDENTIAL INSURANCE CO OF AMERICA, C M Adams & Son Mgrs, 205-206 Citizens & Southern Bank Bldg (See page 70) Southern States Life Insurance Co 203 Citizens & Sou Bank bldg TRAVELERS INSURANCE CO OF HARTFORD, CONN, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) UNION CENTRAL LIFE INSURANCE CO, T S Lowry Jr Mgr, 901-2 Georgia Casualty Bldg UNITED AMERICAN LIFE INSURANCE CO, 201205 Georgia Casualty Bldg (See page 71) Insurance Companies--Marine UNITED STATES MERCHANTS & SHIPPERS, Mor- ris Harris Agt, 210-212 Bibb Bldg (See left top lines) Insurance Companies--Physicians' and Dentists' Liability GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) Insurance Companies--Plate Glass GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) GEORGIA CASUALTY CO OF MACON, GA, John E Wilson Agt, 207 Citizens & Southern Bank Bldg (See bottom edge) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit n A H o o sW iyr 3 z I2Q "I A 3 2 > o 73 >P1 s n> "<2 sD 2 c73^ pziZS>z H C > 73 03 r "2 m PtjJHW n >> 30 1 C/3 E > rB 2 iH8n i d ? Ifi*u 8! HO AA *Z2 MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1190 (1925) R. L. POLK & CO.'S Insurance Companies--Property Damage GEORGIA CASUALTY CO, 2d PI Ga Casualty Bldg (See page 3) HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Rain STERLING FIRE INSURANCE CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Sprinkler Leakage MARYLAND CASUALTY CO OF BALTIMORE, MD, Morris Harris Agt, 210-212 Bibb Bldg (See left top lines) Insurance Companies--Surety Bonds HARTFORD ACCIDENT & INDEMNITY CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Teams GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) Insurance Companies--Theatre GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) Insurance Companies--Theft CONTINENTAL INSURANCE CO OF N Y, G G Harde- man Co Agts, 563 Mulberry (See page 81) Insurance Companies--Tornado STERLING EIRE INSURANCE CO, Carl Bloch Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) Insurance Companies--Woman's Compensation GEORGIA CASUALTY CO, 2d FI Ga Casualty Bldg (See page 3) A natural by-product of the Directory business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON BUSINESS DIRECTORY (1925) 1191 Insurance Companies--Workmen's Compensation GEORGIA CASUALTY CO, G G Hardeman Co Agts, 563 Mulberry (See page 81) HARTFORD ACCIDENT & INDEMNITY CO, Carl Block Agt, 310-311 Citizens & Southern Bank Bldg (See page 80) i More Interior Finish WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) Investments Davis E L 910 Ga Casualty bldg FIDELITY LOAN & INVESTMENT CO, 207 Georgia Casualty Bldg Industrial Loan & Investment Co 153 Cotton av JORDAN REALTY CO, 354 1st (See page 82) Nottingham W D jr 1 Macon Sav Bank bldg WILLIAMS LUTHER BANK & TRUST CO THE, Cherry cor Cotton av (See right top lines and page 55) WILLIAMS R A, 36>-37 Fourth Natl Bank Bldg (See left side lines and page 83) Iron and Steel Works SCHOFIELD'S J S SONS CO INC,. Edgewood av cor Hammond Jewelers Chappell S S 410 2d Davis W A 658 Poplar Lazarus Max 353 3d Levy's Jewelry Store 311 3d McNelis & Bartlett 462 Mulberry MATTHEWS JEWELRY CO, 409 Broadway (See page 72) Orr S L Co 511 Cherry Parnett Philip 468 Poplar RIES & ARMSTRONG INC, 315 3d (See front cover and page 72) Sherwood J H 370 2d WILLIAMS JEWELRY CO, 457 Cherry (See page 72) are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit "More Goods are Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Medium On Earth" 1X92 (19251 R. L. POLK & CO.'S Junk Dealers Central City Iron & Metal Co 245 5th Coplan Junk Co 816-18 Broadway DuBose J H Poplar se cor 7th Hirsch Jacob 352 Plum Justices of the Peace Barton C W jr 3494% Houston ay ^TTifpliAn r.flhinDffi JOHNSON, DURHAM & BURKE, 365 2d and 168 Cotton av (See left top lines and page 67) Kodaks and Supplies BURKE J W CO THE, 406 Cherry (See right top lines, page 84 and opp 200) Ladies' Ready-to-Wear ALLEN J P & CO, Cherry sw cor Broadway DANNENBERG CO THE, 462-464-466-468-470 3d (See page 63) DAY'S, 406 3d (See right bottom lines and page 58) FEDERAL CLOTHING STORE, 312 2d (See page 58) New York Waist House 420 3d SNYDER'S READY-TO-WEAR, 609 Cherry (See page 72) ^Ladies' and Children's Hair Cutting THORPE R S & SONS, 515-517 Cherry (See page 59) *Lamps JOHNSON, DURHAM & BURKE, 365 2d and 168 Cot- ton av (See left top lines and page 67) *Lath and Shingles BUILDERS LUMBER CO, 6th se cor Cherry (See page 74) McCOOK J W LUMBER CO, Hawthorne bet Broadway and 5th (See page 74) MOLTON C J LUMBER CO, 348 Oak (See right bottom lines and page 75) WILLINGHAM SASH & DOOR CO, 437 3d (See top edge and left top lines) Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 1 462 BROADWAY TELS. 4956-4957 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON BUSINESS DIRECTORY (1925) 1193 Laundries CRESCENT LAUNDRY CO, 519 2d (See right side lines) Gar Low 657 Broadway IDEAL LAUNDRY CO, Ocmulgee ne cor 1st INDEPENDENT LAUNDRY CO, 452 2d (See page 73) Sam Chung 454 Cotton av Sam Lee 519 Mulberry Yin Gee 363 Cotton av Lawyers (See also Attorneys-at-Law) Akerman Chas 211-13 Citizens & Sou Bank bldg Barnett J W 619-20 Bibb bldg Bartlett C L 301 Ga Casualty bldg Bartlett W E 5 Hardeman bldg Bell H B 14-15 Hardeman bldg Bloodworth L U 3-4 Hardeman bldg Bootle Wm A Citizens & Southern Bank bldg Burnett J P 14 Washington bldg Butler E W 314-16 Citizens & Sou Bank bldg Carlisle J D 417 Ga Casualty bldg Carthron G T 314 Citizens & Sou Bank bldg Clements O L 619-20 Bibb bldg Clements & Clements 3-4 Hardeman bldg Cochran T J 3 Washington bldg Cooper Wm O jr 18-19 Fourth Natl Bank bldg Cork Chas 305 Grand bldg Dasher & Mann 5th fl Macon Sav Bank bldg DeFore & Estes 501-2 Ga Casualty bldg Ellis & Glawson 819 Ga Casualty bldg Feagin R D 2 Hardeman bldg Felder T S 506 Ga Casualty bldg Fowler B J 314 Macon Natl Bank bldg Gillen L T 214-18 Ga Casualty bldg Gillon & Churchwell 2 Washington bldg Gilmore A E jr 214-18 Ga Casualty bldg Goodrum E F 907 Ga Casualty bldg Graves A W 219-20 Ga Casualty bldg Hall C H 618-19 Ga Casualty bldg Hall Grice & Bloch 614-18 Ga Casualty bldg Hall M P 150 Georgia av Hancock J M 1 Washington bldg Hardin Alene 301 Ga Casualty bldg _ FOR LISTS OF NAMES ANY TRADE ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO #1 City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be Found The Classified Business Section is {he Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet BARRON & REAGAN TAX SPECIALISTS AND ADVISERS Income and Estate Tax Returns Given Special Attention BIBB REALTY BLDG. TELEPHONE 213 1194 (1925) R. L. POLK & CO.'S Lawyers--Contd Harris Jesse 211-13 Citizens & Sou Bank bldg Hatcher S W 34-35 Fourth Natl Bank bldg Hatcher & Smith 20 Fourth Natl Bank bldg Herndon F F 219-20 Ga Casualty bldg Herring B C 417 Ga Casualty bldg Heyward A H 310 Grand bldg Hines R K 818 Ga Casualty bldg Holliday P 0 1011 Ga Casualty bldg Horne J B 1 Washington bldg Hughes J D 513 Bibb bldg Hunter & Daly 5 Hardeman bldg Jackson & Jackson 201 Bibb bldg Jacobs T A jr 10 Washington bldg Johnson W T 919 Ga Casualty bldg Jones Park & Johnston 6th fl Citizens & Sou Bank bldg Lawton J L 15 Washington bldg Lewis Arth 417 Ga Casualty bldg McClellan W A 8 Washington bldg McCoy D W 513 Bibb bldg McCreary J J 353% 3d Martin W E rm 6 Washington bldg Martin & Martin 415-19 Bibb bldg Maynard E W 308 Citizens & Sou Bank bldg Miller A L 353% 3d Miller Wallace 353% 3d Monsees J A 3 Washington bldg Moore L D 714 Ga Casualty bldg Moore R W 1011 Ga Casualty bldg Napier V R Mrs 314 Ga Casualty bldg Nelson P J 3 Washington bldg NOTTINGHAM & NOTTINGHAM, 312-13 Citizens & Sou Bank bldg Plunket R G 26-27 Fourth Natl Bank bldg Reid N Hendricks 767 Cherry Renitz B B 311-12 Grand bldg Roberts J Y 614-18 Ga Casualty bldg Rutland H F 565 Mulberry Ryals Anderson & Anderson 421-24 Macon Natl Bank bldg Smith R L Colored Pythian Temple Smith & Smith 520-23 Bibb bldg Snow B C 715 Ga Casualty bldg R. L POLK & Company FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO A ENGLAND Trip To THE CHIROPRACTOR Will Remove the CAUSE of Your Disease 613-618 BIBB REALTY BLDG. PHONE 4557 MACON BUSINESS DIRECTORY (1925) Spillers W H 618 Bibb bldg Stephens A J 226)4 Cotton av Stewart S J 226)4 Cotton av Strohecker H F 15 Washington bldg Strozier & Deaver 715-17 Ga Casualty bldg Talley J N 303-4 Grand bldg Taylor Edw F 308 Citizens & Sou Bank bldg Tipton E W 13 Hardeman bldg Turpin & Lane 5-6^7-8 Monica ct Urquhart J F 14-15 Hardeman bldg Wallace & Wallace 511-12 Grand bldg Weatherly E B 406 Ga Casualty bldg Weaver & Craven 918-19 Ga Casualty bldg Williams C M 415-19 Bibb bldg 1195 - Leather and Findings CENTRAL GEORGIA POWER CO, 220 2d CENTRAL GEORGIA TRANSMISSION CO, 220 2d Lime, Cement and Plaster BUILDERS LUMBER CO, 6th se cor Cherry (See page 74) BURKE T C INC, 358-360 3d (See front cover) ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) France E H 1015 5th McCOOK J W LUMBER CO, Hawthorne bet Broad- way and 5th (See page 74) MACON SUPPLY CO, 7th cor Mulberry (See front cover) MOLTON C J LUMBER CO, 348 Oak (See right bot- tom lines and page 75) UNITED SUPPLY CO, 7 Terminal av (See back cover) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) *Linoleums JOHNSON, DURHAM & BURKE, 365 2d and 168 Cotton av (See left top lines and page 67) Linotype Composition Olmstead E C 517 Poplar Telephone 2687 J. T. MOLTON, Mgr., 348 Oak G. J. MOLTON LUMBER COMPANY Manufacturers of Yellow Pine Lumber, Sash, Doors, Screens and General Mill Work PAINTS, GLASS, LIME AND CEMENT Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1396 (1925) R. L. POLK & CO.'S *Lithograph Schools SOUTHERN BUSINESS COLLEGE, 656y2 Cherry (See right top lines and page 60) ^Lithographers BURKE J W CO THE, 406 Cherry (See right top lines, page 84 and opp 200) The most comprehensive reference work on the banks of the world1 Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking r Price $20 Published semi- annually MARCH and SEPTEMBER by R. L POLK &C0. Polk Directory Bldg. Detroit, Mich. Live Stock Lee W G 655 3d Tharpe W T & Co 617 3d Livery, Feed and Sales Stables See Hores and Mules *Living Room Furniture JOHNSON, DURHAM & BURKE, 365 2d and 168 Cot- ton av (See left top lines and page 67) Loans (See also Brokers) Bankers Finance Corp 469 2d BENEFICIAL LOAN SOCIETY INC, 103 Ga Casualty Bldg (See page 73) BLOCH CARL, 310-311 Citizens & Southern Bank Bldg (See page 80) Broadway Trading Co 4 Jaques bldg BURNS KENMORE INC, 157 Cotton av (See left bottom lines and page 80) Calvert Mortgage Co 565 Mulberry Central City Brokerage Co 574 Cherry Central City Security Co 662% Poplar Central Loan & Investment Co 10 Jaques bldg Commercial Credit Co 515-20 Ga Casualty bldg Commercial Loan & Investment Co 461% 3d CUTLER J M JR, 908 Ga Casualty Bldg (See front edge and page 73) Dallas Investment Co 721 Broadway Empire Investment Co 356% 2d FIDELITY LOAN & INVESTMENT CO, 207 Georgia Casualty Bldg Fulton Investment Co 318% 2d Georgia Investment & Trust Co 306 Ga Casualty Bldg KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--4%% on Savings MACON BUSINESS DIRECTORY (1925) 1197 Georgia Loan & Trust Co The Macon Natl Bank bldg Hagan J O 552% 2d HARDEMAN G G CO, 563 Mulberry (See page 81) Harris T I & Co 517% 3d HATCHER-TURPIN CO, 523 Mulberry (See page 82) Industrial Loan & Investment Co 153 Cotton av Jackson & Co 512% 3d Jones C H 4 Jaques bldg JORDAN REALTY CO, 354 1st (See page 82) LIBERTY SAYINGS & REAL ESTATE CORPORA- TION, 453 Cotton av (See page 55^) McElrod J R 612% Poplar Macon Credit Guarantee Co 469 2d MURPHEY, TAYLOR & ELLIS, 470 Cherry (See back cover) Owens J H 200 Pythian bldg Parker J B 515 2d Pearson-Taft Co 604 Ga Casualty bldg Smith Howard M & Co 8 Macon Sav Bank bldg So'uthern Investment Co 7 Jaques bldg Southern Loan & Real Estate Corp 613% Poplar 515 2d 512% and 517% 3d THARPE L A, 308 2d (See front cover and page 82) Union Trading Co 422% Mulberry United Credit Corp 404 Bibb bldg UNITED STATES MORTGAGE & TRUST CO, 565 Mulberry West F B 309-11 Bibb bldg WHITEHEAD HENRY, 308 Bibb bldg (See page 83) WILLIAMS R A, 36-37 Fourth Natl Bank Bldg (See left side lines and page 83) Willingham Loan & Trust Co 461 3d *Loans--Industrial BENEFICIAL LOAN SOCIETY INC, 103 Ga Casualty Bldg (See page 73) *Loans--Personal BANKERS FINANCE CORPORATION, 469 2d (See page 73) Locksmiths Hubn H & H R 422 2d More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. FOR. LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 1198 (1925) R. L, POLK & CO.'S *Long Distance Hauling MACON TRANSFER & STORAGE CO, 702-704 Broadway (See right side lines and page 86) Lumber--Wholesale Bibb Lumber Co 709 Ga Casualty bldg Cartledge Lumber Co 9 Jaques bldg Chapman H D & Co 708-10 Citizens & Sou Bank bldg Georgia-Carolina Lumber Co 1001-4 Ga Casualty bldg Krim Charles R Lumber Co 9 Jaques bldg North Carolina Pine Association Inc 721 Citizens & Sou Bank bldg Redding Lumber Co 16-17 Jaques bldg Rood A B Lumber Co 1001-4 Ga Casualty bldg Smith B B Lumber Co ft of Division Lumber Manufacturers and Dealers Adams-Richardson Lumber Co Poplar nr 12th BUILDERS LUMBER CO, 6th .se cor Cherry (See page 74) Case-Fowler Lumber Co Forsyth rd % mi w Pio Nono av CENTRAL SASH & DOOR CO, Waterville rd cor Steele (See right side lines and page 74) Chambers Lumber Co Inc Vineville Sta 2 w Linden av Dasher J M Lumber Co Poplar nr 12th Daugherty L L Jr & Co 413 Bibb bldg Davis-Richardson Lumber Co 307 Citizens & Sou Bank bldg Duncan Basil 722 Citizens & Sou Bank bldg ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) Fowler Lumber & Plywood Co ft Division Glyck Lumber Co 613 Cherry Hamlin Jones & Eaton 8 Jaques bldg Interstate Lumber Co 601-3 Bibb bldg McCOOK J W LUMBER CO, Hawthorne bet Broadway and 5th (See page 74) Macon Lumber & Mfg Co Mulberry and 7th Massee-Felton Lumber Co ft of Division MOLTON C J LUMBER CO, 348 Oak (See right bottom lines and page 75) Reid H M & Co 708-10 Citizens & Sou Bank bldg O. D. JAMES GRANITE AND MARBLE WORKS 207 Jones Street Wholesale and Retail Phone 4687 Bibb National Bank of Macon "SERVICE AND SAFETY" 576 CHERRY TELS. 161-16? MACON BUSINESS DIRECTORY (1925) 1199 Richardson Lumber Co 307 Citizens & Sou Bank bldg WILLINGHAM SASH & BOOR CO, 457 3d (See top edge and left top lines) POLK'S j DENTAL i^WRtIh-CteT'eedHadgtinIetRisaieoDdtsnnaatYttheEeArRs ,1L.!9?u2c 5CO. ".!!-! >54I precious Sals M Machinery Schofleld-Burkett Construction Co 504 Bibb bldg SCHOFIELD'S J S SONS CO INC, Edgewood av cor Hammond Yates P B Machinery Co 461 5th Mailing Lists LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) POLK R L & CO, Woolworth Bldg 1826% 3d av N, Birmingham, Ala *MaiIing and Addressing LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) *Mantels and Grates BURKE T C INC, 358-360 3d (See front cover) MOLTON C J LUMBER CO, 348 Oak (See right bot- tom lines and page 75) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) Manufacturers' Agents Watson E T 318 Broadway *Marble and Granite (See also Monuments) JAMES O D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) WOOTEN MARBLE CO, 765 3d (See right side lines and page 75) & POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Feature* of Past Editions are retained, with much New, Useful and Interesting Data added. Mattress Manufacturers Acme Mattress Co 312 Main (EM) Central Bedding Co 325 Oglethorpe av Meaders Mattress Co rear 425 Arch Drink in Bottles TELEPHONE 287 R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. w 8 WE GIVE REAL SERVICE ON ANY MAKE CARS Beeland-Conrad Motor Co., 560 2d St. TeL 2813 1200 (1925) R. L. POLK & CO.'S ^Mausoleums JAMES 0 D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) WOOTEN MARBLE CO, 765 3d (See right side lines and page 75) Meats--Retail Allen J W 852 Hazel Arnold Dock 157 5th Brown N H 803% Broadway Campbell Mollie Mrs 614 Telfair Chanin Bennett 770 Hazel Crystal Market 662 Poplar Danneman Aaron 478 Cotton ay Diamond Market Co 474 Cotton av Dixie Cash Market 1003 Broadway Donnelly T M Co 970 Oglethorpe Harris A L 666 Poplar Hill Moses 344 Middle (V) Holloman V A 1245 Broadway Johnson H J 452 Ballard Kash & Karry Market No 4, 410 Broadway 654 Poplar and 412 2d McDaniel & Smith 237 Winship Moseley Meat Market 692 College Mulberry Market 414 Mulberry Nash Meat Market 460 2d and 84 Spring Nash Sausage Co 222 Cotton av Patterson W P 726 Hawthorne Pittman J P 1749 Broadway Quality Market 466 Mulberry Robinson W H 1002 2d Sample H B 1500 Broadway Sanitary Market 420 Mulberry Sowell A D 95 Clayton Stephens W F 527 Telfair Trawick J C 115 Middle (V) Meats--Wholesale Adams Bros Co 105 Cherry Armour & Co 250 Broadway Cudahy Packing Co 336 Poplar Enterprise Packing Co 7th cor Ocmulgee Morris & Co 453 S 5th Automobile owners are select prospects for u d mtcCeoaarptsnayyl.foogkr:inacdlolsRnkto.aifnLindm.ssPeormOcfLuhAcaKhnudt&ovismaeClo.uOba.,ibSlelDeenELddTisatRtotsaO..HITeOA,audMsrqkIun-CfeaHowrr-. GOOD PRINTING is Never Done by Accident Burke Printing is Backed by Years of Experience and Careful Observation 406 CHERRY STREET MACON, GEORGIA CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable MACON BUSINESS DIRECTORY (1925) 1201 Short L H 1025 Broadway Spiller Wm A (barbecue) 327 Main (EM) Swift & Co 300 Cherry Vineville Packing Co 123 Hardeman av Wilson & Co 268 5th Medicine Manufacturers OLIPHANT JAMES T, 658 Mulberry (See left center lines and page 75) Viavi Co 711 Bibb bldg *Men's Clothing BAY'S, 406 3d (See right bottom lines and page 58) Men's Furnishings Dempsey Haberdashery 503 Cherry HUNNICUTT CLOTHING CO, 317-319 3d (See right side lines and page 58) NEEL JOS ST CO, 520 Cherry (See right top lines and page 59) Sher Harry 565 Cherry Smerling Moses 361 Broadway THORPE R S & SONS, 515-517 Cherry (See page 59) *Men's Ready-to-Wear DAY'S, 406 3d (See right bottom lines and page 58) THORPE R S & SONS, 515-517 Cherry (See page 59) Mercantile Agencies Bradstreet Co The 209 Citizens & Sou Bank bldg Dun R G & Co 713-18 Bibb bldg Macon Credit Bureau 702 Citizens & Sou Bank bldg * Merchant Tailors CANIPELLI VINCENT, 320^4 2d (See right side lines and page 84) *Metal Cornices SCHWARTZ & PHAUL, 452 Plum (See page 79) *Metal Lath WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R L.. POLK & CO. Chicago 2 P ^5 E m Dunlap-Huckabee Auto Co. BUICKS--CADILLACS--USED CARS 682-690 THIRD ST. PHONES 5100-5101 mm as a wr PIU THE DIRECTORY IS THE GREATEST MARKET PLACE j ffl THE WORLD Every Day in the Year the Directory Tells Where All Kinds of Goods and Service Can Be Had The Director^ is the Natural Source of Information and is "On the Job" 365 Days Every Year 1202 (1925) R. L. POLK & CO.'S *Hetal Shingles BURKE T C CO INC, 358-360 3d (See front cover) MACON SUPPLY CO, 7th cor Mulberry (See front cover) SCHWARTZ & PHAUL, 452 Plum (See page 79) Mill Supplies Arnett Mfg Co ft Division Corbin Supply Co 464-66 Broadway Krewson L H 1507 Broadway SCHOFIELD'S J S SONS CO INC, 354-356 Broadway Taylor Iron Works & Supply Co 1014-1028 Broadway Milliners Cherry Hat Shoppe 506 Cherry DAY'S, 406 3d (See right bottom lines and page 58) Easterday Alice Mrs 359 3d Lafferty's Millinery Parlor 652i/2 Cherry Lorraine Shop The 411-13 Cherry Newman's Millinery 622 Cherry Reese Dora Mrs 366 2d SNYDER'S READY-TO-WEAR, 609 Cherry (See page 72) Millinery--Wholesale Belle Millinery Co 352 Broadway *Mill Work CENTRAL SASH & DOOR CO, Waterville rd cor Steele (See right side lines and page 74) MOLTON C J LUMBER CO, 348 Oak (See right bottom lines and page 75) ^Mimeographing LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Mineral Water High Point Mineral Wells High Point RLPoffiifo Miners and Mining PUBLISHERS Jones R H & Co 31 Fourth Natl Bank bldg PolltDirecbraM DETROIT . V -MICH* J A natural by-product of the Directory Business is the compilation of Mailing Lists, if interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit CALHOUN & THOMAS REAL ESTATE AND INSURANCE BUILDING HOMES A SPECIALTY 569 % CHERRY ST. TELEPHONE 2391 MACON BUSINESS DIRECTORY (1925) 1203 *Mirrors BURKE T C CO INC, 358-360 3d (See front cover) JARRETT PAINT & GLASS CO, 312 3d (See page Monuments See also Marble and Granite Artope Monumental Works 617 MulberryPrance E H 1015 5th JAMES 0 D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) WOOTEN MARBLE CO, 765 3d (See right side lines and page 75) *Morticians CENTRAL CITY UNDERTAKING CO, 457 Cotton av (See page 66) HUBBARD UNDERTAKING CO THE, 468 Cotton av (See page 66) Motor Trucks MACK, Sparks Motor Co Distributors 550 Broadway (See backbone and page 51) SPARKS MOTOR CO, 550 Broadway (See backbone and page 51) STEWART MOTOR TRUCKS, A S Hatcher Co Dis- tributors, 598 3d (See front cover) *Mouth Wash Manufacturers OLIPHANT JAMES T, 658 Mulberry (See left center lines and page 75) Moving Pictures Capitol Theatre 368 2d Criterion Theatre 410 Cherry Douglass Theatre 357 Broadway Grand Theatre 617 Mulberry Rialto Theatre 173 Cotton av *Multigraphing LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) S I DAY'S USE YOUR CREDIT 406 THIRD ST. TEL. 3026 l\ SCREENS DOORS SASH, Central Sash & Door Co. 2 S'O#u >co c>Ho< juoos co yazos co < < K2 ScP . 2 o.i CMgCO a SI S a "oJ s=esj H Is* to 1212 (1925) R. L. POLK & CO.'S Plumbers, Steam and Gas Fitters Daly F X Co 613 Poplar Davis Durward 25 Wall Irby Ray 565 Mulberry Jordan W H 561 Mulberry MILLER BROS, 171 Cotton av (See left side lines and page 79) Newby L R 511 Cotton av O'Pry Plumbing & Heating Co 163 Cotton av ROLLER & MILLIRONS, 511 Cotton av (See left side lines and page 79) SHROPSHIRE J T, 525 Cotton av (See page 79) WOOD T L, 476 Cotton av (See back cover and page 80) Yetter G F 458 Cotton av Plumbers' Supplies Ideal Supply Co 521 Mulberry *Porch Boxes CLARK R E, 1150 Napier av (See page 57) Poultry Dealers Harden W T 409 Cotton av McKinnon R L 12131/2 Broadway Macon Hatchery 519 3d Wood T J 419 Cotton av ^Prescriptions THORP'S PHARMACY, 672 Spring (See left sidelines and page 65) a cti JC Printers--Book and Job t Barton John 115 Dixie av Bibb Printing Co 258-60 2d BURKE J W CO THE, 406 Cherry (See right top lines page 84 and opp 200) Coggin Printing Co 615 Poplar Holt & Hanberry 318 Broadway JONES & CONEY, 411 Broadway (See page 80) Lyon, Harris & Brooks 21 Wall Murray Printing Co 471% 3d Olmstead E C 562 Mulberry Saxon J T 515 Cotton av Smith & Watson 517 Poplar More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. LUTHER WILLIAMS BANKING & TRUST CO. "FOUNDED AND BUILT ON HONOR" Open All Day From 9 to 6--^Vz% on Savings MACON BUSINESS DIRECTORY (1925) 1213 Printers--Commercial JONES & CONEY, 411 Broadway (See page 80) Produce Burney Bros Co 313 Poplar Few M C 621 Poplar Howard Produce Co 348 Poplar Morgan Thos Inc 661 Poplar Newton C E & Bro 353 Pine Roughton-Halliburton Co 315 Poplar ^Property Management BURNS KENMORE INC, 157 Cotton av (See left bottom lines and page 80) *Publie Accountants THAGGARD WALTER L, 708 Georgia Casualty Bldg (See page 50) Public Stenographers LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) * Public Utilities GEORGIA PUBLIC SERYICE CORPORATION, 220 2d Publishers MACON NEWS PRINTING CO, 412-414 Cherry .... MACON TELEGRAPH PUBLISHING CO, 450-452 Cherry POLK R L & CO (City Directories), Woolworth Bldg 1826% 3d av N, Birmingham, Ala *Radio Equipment HATCHER HARDWARE CO, 596 3d *Radio Supplies MACON ELECTRIC CO, 367-369 2d (See page 65) Railroads Central of Georgia R R Co Pine nw cor 5th Georgia Southern Florida Ry Co sw cor Plum and 5th FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS , -- ANY PROFESSION DETROIT R. II. POLK & CO. CHICAGO 0a_c0 ,v251s0. > 5 >--4 e po CO is 25 --9 e/a C/a POLK'S dental U^RnT>nCIetrSeaiogwnltSaiDuTdsiAiatYmTeEAErRS ,1CP9OL2K 5C< JJECIOUS PSjeLlYtafQlBsM Johnson, Durham & Burke Better Furniture For Less Money 365 SECOND ST. PHONE 3826 168 COTTON AVE. 1214 (1925) R. L. POLK & CO.'S Eailroad Supplies Hatfield Rail Joint Mfg Co 919 Ga Casualty bldg *Raincoats DAY'S, 406 3d (See right bottom lines and page 58) THORPE R S & SONS, 515-517 Cherry (See page 59) POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 The Splendid Features of Past Editions are retained, with much New, Useful and Interesting 5ata added. R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, III. Real Estate Avant N A 1 Hardeman bldg BARNES & BARNES INC, 214-215-216 Bibb Bldg BLOCH CARL, 310-311 Citizens & Southern Bank Bldg (See page 80) BURNS KENMORE INC, 157 Cotton av (See left bot- tom lines and page 80) CALHOUN & THOMAS, 56914 Cherry (See right top lines and page 81) City Investment Co 470 Cherry CITY REALTY CO, 565 Mulberry (See page 81) Clemons S C 465 Cotton av Coral Babies 213 Cotton av DESSAU WASHINGTON, 101 Ga Casualty Bldg (See page 81) Dure Leon S Co 610 Mulberry Florida Real Estate Co 311 Cherry Hamlin W J 504 Mulberry HARDEMAN G G CO, 563 Mulberry (See page 81) HATCHER-TURPIN CO, 523 Mulberry (See page 82) Haven Villa Corp 705-6 Ga Casualty Bldg HOLT A T CO, 569 Mulberry (See right top lines and page 82) JORDAN REALTY CO, 354 1st (See page 82) Kinney Guerry & Co 9-10 Macon Kinney Realty Co 9-10 Macon Sav Bk bldg LIBERTY SAVINGS & REAL ESTATE CORPORATION, 453 Cotton av (See page 55) Mikado Realty Co 470 Cherry Mortgage Investment Co 470 Cherry MURPHEY, TAYLOR & ELLIS, Luther Williams Bank Bldg 470 Cherry (See back cover) Napier E T 421 2d Nevaro Apartments Co 610 Mulberry Odom Realty Co ground fl Ga Casualty bldg Owens J H 200 Pythian bldg Park E T Mrs 565 Mulberry E. R. PEARCE CARS AND TRUCKS PAINTED TOPS BUILT and REPAIRED. TAILOR-MADE SEAT COVERS 523 PINE ST. PHONE 1279 AUTHORIZED T-, , DEALERS Lincoln romsoivif it's a '"Ford or CARS-TRUCKS TRACTORS JONES MOTOR COMPANY hfoarve ait.Ford, we PHONE 1591 557-559 PLUM ST. MACON BUSINESS DIRECTORY (1925) 1215 Realty Investment Co 610 Mulberry Rivoli Improvement Co 610 Mulberry Sapp H H 14 Washington bldg Southern Land Co 610 Mulberry Sparks W B 422 Cherry THARPE L A, 308 2d (See front cover and page 82) Vincent P T Realty Co 154 Cotton av Vineville Improvement Co 321-24 Macon Natl Bank bldg West P B 309-11 Bibb bldg WHITEHEAD HENRY, 308 Bibb Bldg (See page 83) WILLIAMS R A, 36-37 Fourth Natl Bank Bldg (See left side lines and page 83) WILSON JOHN E, 207 Citizens & Southern Bank Bldg (See bottom edge) Wilson R L Inc 22 Jaques bldg *Real Estate Loans BURNS KENMORE INC, 157 Cotton av (See left bot- tom lines and page 80) CALHOUN & THOMAS, 56914 Cherry (See right top lines and page 81) CUTLER J M JR, 908 Ga Casualty Bldg (See front edge and page 73) JOHNSON, DURHAM & BURKE, 365 2d and 168 Cotton av (See left top lines and page 67) *Rent Collections HATCHER-TURPIN CO, 523 Mulberry (See page 82) *Rental Agents BURNS KENMORE INC, 157 Cotton av (See left bot- tom lines and page 80) CITY REALTY CO, 565-Mulberry (See page 81) HOLT A T CO, 569 Mulberry (See right top lines and page 82) JORDAN REALTY CO, 354 1st (See page 82) ^Rentals BLOCH CARL, 310-311 Citizens & Southern Bank Bldg (See page 80) HARDEMAN G G CO, 563 Mulberry (See page 81) MURPHEY TAYLOR & ELLIS, 470 Cherry (See back cover) More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of A11 Banks, Digest of State Banking Laws and Much Other Data related to Banking Price $20 Published semi- annually MARCH and SEPTEMBER hy R. L. POLK &C0. Polk Directory Bldg. Detroit, Mich. HI (ulHOj dSo <0 Georgia Investment Co 304% 3d O Macon Brokerage Co 464% Poplar o Macon Trading & Investment Co 421% 3d > Palm Purchasing Co 8 Hardeman bldg Watts & Co 664 Poplar o PI West Brokerage Co 574% Poplar H Sand and Gravel Macon Sand Co 409 Ga Casualty bldg > 2 a *Sash, Doors and Blinds 90 BUILDERS' LUMBER CO, 6th se cor Cherry (See page 74) CENTRAL SASH & DOOR CO, Waterville rd cor Steele (See right side lines and page 74) ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) MOLTON C J LUMBER CO, 348 Oak (See right bottom lines and page 75) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) Sausage Manufacturers Nash Sausage Co 1999 2d T & T Sausage Co Poplar nr 11th *Savings Banks > CITIZENS & SOUTHERN BANK THE, 3d cor Cherry (See front cover and page 54) o FOURTH NATIONAL BANK, 502-504 Cherry (See H right top lines and page 54) Vn L Automobile owners are select prospects for S- many kinds of merchandise. Send to Headquar- ters for all kinds of Automobile Lists. Our new Catalog: contains much valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. 1 w 00 TRY-ME BOTTLING COMPANY Manufacturers of HIGH-GRADE BEVERAGES 359 COTTON AVENUE TELEPHONE 5061 1220 (1925) R. L. POLK & CO.'S Savings Banks--Contd MERCHANS & MECHANICS SAVINGS BANK, 1446 Broadway (See page 55) * WILLIAMS LUTHER BANK & TRUST CO THE, Cherry cor Cotton av (See right top lines and page 55) POLK'S Dental Register OP THE UNITED STATES AND CANADA 1925 Saw Filers Delk B F 860 Broadway Scales Dayton Scale Co 411 Mulberry * School of Fine Arts WESLEYAN COLLEGE, 500 College (See page 62) Schools and Colleges KAIGLER'S BUSINESS COLLEGE, 211 Cotton av (See left top lines and page 58) MERCER UNIVERSITY, Ash cor University Place (See page 61) Morris Max School of Pharmacy 517% 3d Scotts Art School 411-13 Cherry SOUTHERN BUSINESS COLLEGE, 656% Cherry (See right top lines and page 60) The Splendid Features of Past Editions are retained, with much New, Useful and Interesting Data added. Screens BUILDERS' LUMBER CO, 6th se cor Cherry (See page 74) BURKE ,T C INC, 358-360 3d (See front cover) Ivey Leila Mrs 767 3d WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) * Screens--Window and Door CENTRAL SASH & DOOR CO, Waterville rd cor Steele (See right side lines and page 74) MOLTON C J LUMBER CO, 348 Oak (See right bottom lines and page 75) R. L. Polk & Go. Publishers 536 S. Clark St. Chicago, 111. Seed; Georgia Seed Store 469 3d Karsten & Denson Co 519 3d Wright Harry 306 3d FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSIOt N DETROIT R. L. POLK & CO. CHICAGO Automobile owners are select prospects for many kinds of merchandise. Send to Headquar- n ters for all kinds of Automobile Lists. Our new p Catalog contains much valuable data. Ask for H a copy R. L. POLK & CO., DETROIT, MICH. o MACON BUSINESS DIRECTORY (1925) *Seminaries 1221 m o H z = WESLEYAN COLLEGE, 500 College (See page 62) WOOTEN MARBLE COMPANY MANUFACTURERS OF MARBLE AND GRANITE MONUMENTS AND SLABS *Service Station PACE N E, 657-659 3d (See right center lines and page 50) Sewer Contractors MILLER BROS, 171 Cotton av (See left side lines and page 79) * Sewer Pipe MACON SUPPLY CO, 7th cor Mulberry (See front cover) * Sewer Pipe Manufacturers DICKEY W S CLAY MFG CO, 609-13 Ga Casualty Bldg (See left side lines and page 83) * Sewerage WOOD T L, 476 Cotton av (See back cover and page 80) Sewing Machines Burnett J R 529 Cotton av Singer Sewing Machine Co 123 Cotton av Sheet Metal Works HAMLIN & SUBERS, 27 Wall (See page 85) *Sheet Music WILLIAMS-GUTTENBERGER MUSIC CO, 466 2d (See page 75) *Sheet Rock BURKE T C INC, 358-360 3d (See front cover) * Shingles BUILDERS' LUMBER CO, 6th se cor Cherry (See page 74) ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) McCOOK J W LUMBER CO, Hawthorne bet Broad- way and 5th (See page 74) WILLINGHAM SASH & DOOR CO, 457 3d (See top edge and left top lines) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." R. L. POLK & CO., Detroit T] z->o< o z c 2PI z d > z a Ur 5 05 > m~Po0I r > r 3O>3 5H 3 12 s35a-i. ^ rr 01 HO n> z MORRIS HARRIS INSURANCE SURETY BONDS 210-212 Bibb Building Telephone 131 1222 (1925) R. L. POLK & CO.'S *Shingles--Composition BUILDERS' LUMBER CO, 6th se cor Cherry (See page 74) MACON SUPPLY CO, 7th cor Mulberry (See front cover) * Shipping Agents MACON TRANSFER & STORAGE CO, 702-704 Broad- way (See right side lines and page 86) Shoemakers and Repairers Andros Peter 307 Broadway Blue Edw 822 Columbus rd Bostock Robt 350 Cherry Boston Shoe Shop 414 Poplar Craps Wm M 713 % Broadway Danforth Remus 24 Wall Georgia Shoe Factory 660 Poplar Gullatt Wm 1219 Broadway Harris H H 572 Mulberry Holt J H 291/2 Wall Isaf Betrus 650 Poplar Jsaf Nagweb F 236 Main (EM) Johnson H S 170 New Jordan John 161 Fifth Kell Alex 517 Mulberry Latimer Albert T 447 Clinton (EM) Morgan Sidney 1624 Broadway Morris W D 520 Cotton av Nelson Alexander 15 Clayton Phillips John 1030 Broadway Proctor A P 363 Hazel Schelling G R 119 Cotton av Schelling R M 228 Cotton av Sharp S G 607 Cherry Shier Sami 456 Cherry Tanner H G 456 Cotton av Thomas Felix 340% Middle (V) Turner Jacob 508 Cherry Walker A J 103 Hardeman av Wolf Myer 554 Poplar Wolf Zelik 615 Broadway More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. CHAS. W. STROBERG AUTO PAINTER AND TOP BUILDER COMMERCIAL TRUCK BODIES 451-453 First St., Macon Telephone 1244 The new lacquer finish applied on your car by experts. MACON BUSINESS DIRECTORY (1925) 1223 Shoes--Eetail Arenson Jacob 404 3d Fashion Shoe Store 613 Cherry Hanover Shoe The 362 2d HUNNICUTT C H CLOTHING CO, 317-319 3d (See right side lines and page 58) Jake's Shoe Store 568 Poplar Kinney G R Co Inc 570 Cherry Macon Shoe Co 361 3d Macon Shoe Shop and Army Store 422-24 Mulberry NEEL JOSEPH N CO, 520 Cherry (See right top lines and page 59) Newark Shoe Co 356 2d Royal Shoe Store 414 3d SMART HERBERT CLOTHING CO, 559 Cherry (See left top lines and page 59) Strong Shoe Co 360 2d THORPE R S & SONS, 515-517 Cherry (See page 59) Shoes--Wholesale Waxelbaum E A & Bro 351 Cherry Shorthand and Stenography SOUTHERN BUSINESS COLLEGE, 656i/2 Cherry (See right top lines and page 60) Sign Painters Crimmins Sign Co 671 Cherry Silverware RIES & ARMSTRONG INC, 315 3d (See front cover and page 72) The most comprehen- sive refer- ence work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to Banking Skylights HAMLIN & SUBERS, 27 Wall (See page 85) (See page 85) HUMPHRIES SHEET METAL WORKS, 517 3d (See page 85) SCHWARTZ & PHAUL, 452 Plum (See page 79) * Slabs--Marble JAMES O D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) Price $20 Published semiannually MARCH and SEPTEMBER by R. L POLK Automobile owners are select prospects for many kinds of merchandise. Send to Headquarters for all kinds of Automobile Lists. Our new Catalog: contains muck valuable data. Ask for a copy R. L. POLK & CO., DETROIT, MICH. &C0. Polk Directory Bldg. Detroit, Mich. - --. More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. You? City Directory Answers All Questions as to WHOM You Are Looking For and WHERE They Can Be {Found The Classified Business Section is the Market Place Where Buyers and Sellers of All Kinds of Merchandise and Service Meet 1224 (1925) R. L. POLK & CO.'S *Slate 1 HUMPHRIES SHEET METAL WORKS, 517 3d (See page 85) * Slate Surface Shingles ELDER W F LUMBER CO, Ocmulgee se cor 7th (See page 74) Soap Manufacturers Procter & Gamble Co 301 Hazel Soft Drinks Bragg J S 2142 2d Butler C S 151 Fifth Campbell Sami 235% Middle j Clayton Emanuel 531 Campbell av Clyde Mattie 230,(830) Penn Couch J M cor 8th and Poplar Couch R C 240 Ruff Home av Dixon Haywood 163 5th Fitts Jas 302 Telfair Gabbert's Candy Land 464 Cherry ' Glover Benj 228 Green HARDEMAN AVENUE PHARMACY, 124 Hardeman av (See page 64) Harris Geo 213 5th Holt Jos 210 Green Jenkins C J 523 Cotton av Jones I E 1703 Broadway Lee W L 1216 Broadway Life Obie 452 Martha (EM) McCRARY DE WITT DRUG CO, 336 Main (See page 64) Miles Moses 415 Cotton av Read Bernard 2635 Broadway Rohr C E 26 Wall Searcy Jackson 122 Elliott Smith Emma Mrs 316 Jackson Smith Howard 1133 Broadway Statham Eug 608% Ross THARP'S PHARMACY, 672 Spring (See left side lines and page 65) Union News Co Terminal Station Wimberley Eliza 527 Hazel R. L POLK & Company Steve M. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 C. H. HUNNICUTT CLOTHING CO. Nothing but the Best in Men's Apparel A. T. HOLT CO. REAL ESTATE AND RENTING AGENTS 569 MULBERRY STREET MACON BUSINESS DIRECTORY (1925) 1225 Soft Drinks--Manufacturers MACON CHERO-COLA BOTTLING CO, 618-620 Broadway (See right center lines and page 56) TRY-ME BOTTLING CO, 359 Cotton av (See left top lines and page 56)" *Soft Drinks--Wholesale MACON CHERO-COLA BOTTLING CO, 618-620 Broadway (See right center lines and page 56) Sporting Goods BURKE J W CO THE, 406 Cherry (See right top lines, page 84 and opp 200) HATCHER HARDWARE CO, 596 3d Southern Sport Supply Co 509 Cherry ^Stationers BURKE J W CO THE, 406 Cherry (See right top lines, page 84 and opp 200) * Steam Fitters MILLER BROS, 171 Cotton av (See left side lines and page 79) * Steam and Hot Water Heating MILLER BROS, 171 Cotton av (See left side lines and page 79) * Steel Ceilings HAMLIN & SUBERS, 27 Wall (See page 85) *Stenographers--Public LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Stenographic Schools KAIGLER'S BUSINESS COLLEGE,. 211 Cotton av (See left top lines and page 57) * Steps--Cement CLARK R E, 1150 Napier av (See page 57) Stock Yards Macon Stock Yards 348 Oak 317-319 Third St. FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION DETROIT R. L. POLK & CO. CHICAGO 12 W. R. Finch Motor Co. Nash Leads the World in Motor Car Value Ask your neighbor how he likes his 658 THIRD ST., MACON, GA. PHONE 4354 1226 (1925) R. Li. POLK & CO.'S Stone Quarries Morris Stone Co 33 Fourth Natl Bank bldg "More Goods are Storage Ideal Storage Service (auto) 415 Mulberry MACON TRANSFER & STORAGE CO, 702-704 Broad- way (See right side lines and page 86) TERMINAL TRANSFER CO, Terminal Station (See right sidel ines and page 86) Bought and Sold Through the Classified Business Lists of the Directory Than Any Other Storage Batteries Georgia Battery & Vulcanizing Co 712 3d Stewart G T 407% Cotton av Wade & Co 566 2d Willingham Battery Co 516 1th Stove Repairers Shine J W 1993 3d JOHNSON, DURHAM & BURKE, 365 2d and 168 Cot- ton av (See left top lines and page 67) *Stucco--Pebble Dashing CLARK R E, 1150 Napier av (See page 57) ^Suburban Property DESSAU WASHINGTON, 101 Ga Casualty Bldg (See page 81) ^Surety Bonds MURPHY TAYLOR & ELLIS, 470 Cherry (See back cover) Medium On Earth" Tailors Bell A H 425 Cotton av CANIPELLI VINCENT, 320% 2d (See right side lines and page 84) Daniel Wm L 723 Broadway Ellis John 416 % 2d Fit Right Tailors 406 Mulberry Fleming M L 615 Poplar Goette P W 123%2 Cotton av Jacobs Bernard 416 Cherry Johnson Herschel 1227 Broadway Johnson W N 429 Cotton av Morgan & Morgan Insurance Agency GENERAL INSURANCE 606 Georgia Casualty Bldg. Telephone 4147 CRESCENT LAUNDRY CO. Laundry Work, Dry Cleaning and Dyeing Always Reliable The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4166 MACON BUSINESS DIRECTORY (1925) 1227 Jones L A 571 Mulberry Koskin Boris 574 Cherry Lott J T 808 Walnut Myers Aug 506 2d Schwab Co The 355 Cherry Spivey Harry 519 Mulberry Zemlich Carl 356% 2d *Tailors--Custom CANIPELLI VINCENT, 320% 2d (See right side lines and page 84) * Tailors--Merchant CANIPELLI VINCENT, 320% 2d (See right side lines and page 84) *Tank Manufacturers SCHOFIELD'S J S SONS CO INC, Edgewood av cor Hammond Xax Advisers BARRON & REAGAN, Bibb Bldg (See left top lines and page 84) *Tax Specialists BARRON & REAGAN, Bibb Bldg (See left top lines and page 84) Taxicabs Swift W O 456% Poplar U-DRIVE-IT-SYSTEM, 409 Mulberry (See page 50) YELLOW CAB CO OF MACON, GA, 5th St Side Ter- minal Hotel Bldg (See back cover, left side lines and page 85) Tea, Coffee and Spices Kenny C D Co 212 Cotton av Telephone and Telegraph Companies Postal Telegraph-Cable Co 451 Cherry SOUTHERN BELL TELEPHONE & TELEGRAPH CO, 501-505 2d TENNESSEE DISTRICT ELEGRAPH CO, 455 Cherry WESTERN UNION TELEGRAPH CO, 455 Cherry . FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION ^DETROIT R. L. POLK & CO. CHICAGO Everything for Building and Painting Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1228 (1925) R. L. POLK & CO.'S *Tile HUMPHRIES SHEET METAL WORKS, 517 3d (See page 85) *Tile Manufacturers--Drain DICKEY W S CLAY MFf} CO, 609-13 Ga Casualty Bldg (See left side lines and page 83) The most comprehensive reference work on the banks of the world Contains Condensed Statements of All Banks, Lists of Officers of All Banks, Digest of State Banking Laws and Much Other Data related to 9 Banking Price $20 Published semi- annually MARCH and SEPTEMBER by L POLK Tin, Copper and Sheet Metal Workers Abbott Bros 521 Broadway Falkner Tin Shop 469 Cotton av Gordon Harry 320 Wall Hamlin & Subers 27 Wall HUMPHRIES SHEET METAL WORKS, 517 3d (See page 85) Tobacco--Wholesale Liggett & Myers 415 Ga Casualty bldg Reynolds Tobacco Co 204 Citizens & Sou Bank bldg ^Tombstones JAMES 0 D GRANITE & MARBLE WORKS, 207 Jones (See left bottom lines and page 68) WOOTEN MARBLE CO, 765 3d (See right side lines and page 75) *Tower Manufacturers SCHOFIELD'S J S SONS CO INC, Edgewood av cor Hammond Tractors ELLIS MOTOR CO, 362-378 1st (See right side lines and page 52) FORDSON, Ellis Motor Co Authorized Dealers, 362- 378 1st (See right side lines and page 52) FORDSON, Jones Motor Co Authorized Dealers, 557- 559 Plum (See right top lines and page 53) *Tractors--Farm JONES MOTOR CO, 557-559 Plum (See right top lines and page 53) Transfer Companies MACON TRANSFER & STORAGE CO, 702-704 Broad- way (See right side lines and page 86) &C0. r Polk Directory > Bldg. Detroit, Mich. KENMORE BURNS Inc. Real Estate, Rents and Insurance 157 COTTON AVENUE PHONE 89 More goods are bought and sold through the Classified Business Lists of the Directory than any other medium on earth. MACON BUSINESS DIRECTORY (1925) 1229 Mansfield Dray Line Co 225 Walnut Ott T C 826 Orange Roberts Coal & Transfer Co Inc 361 Oak Taylor Transfer Co 409 Poplar TERMINAL TRANSFER CO, Terminal Station (See right side lines and page 86) *Track Repairers PACE N E, 657-659 3d, Phone 4846 (See right center lines and page 50) *Trucks--Motor MACK, Sparks Motor Co Distributors, 550 Broadway' (See backbone and page 51) SPARKS MOTOR CO, 550 Broadway (See backbone and page 51) * Trust Sompanies MACON SAVINGS BANK, Cotton av cor 2d (See front cover) "Typewriter Repairers SCOTT-PARKER CO, 367 Broadway (See right center lines and page 86) "Typewriters Rented SCOTT-PARKER CO, 367 Broadway (See right cen- ter lines and page 86) typewriters Supplies SCOTT-PARKER CO, 367 Broadway (See right cen- ter lines and page 86) Typewriters and Supplies Bishop H C 501 Grand bldg CORONA, Scott-Parker Co Authorized Dealers, 367 Broadway (See right center lines and page 86) LETTER SHOP THE, 702-703 Bibb Bldg (See page 50) Remington Typewriter Co 417 2d ROYAL, Scott-Parker Co Authorized Dealers, 367 Broadway (See right center lines and page 86) SCOTT-PARKER CO, 367 Broadway (See right cen- ter lines and page 86) Underwood Typewriter Co 107 Ga Casualty bldg A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit 1230 (19251 R. L. POLK & CO.'S typewriting Schools KAIGLER'S BUSINESS. COLLEGE, 211 Cotton av (See left top lines and page 57) "More Goods ^Umbrella Recovering RIES & ARMSTRONG INC, 315 3d (See front cover and page 72) are Bought and Sold Through the Classified Umbrella Repairers Polenz Gustav 467 Cotton av Undertakers BURGHARD L H, 718 Cherry (See page 66) CENTRAL CITY UNDERTAKING CO, 457 Cotton av (See page 66) Hart J B & Bro 559 Mulberry HUBBARD UNDERTAKING CO THE, 468 Cotton av (See page 66) C H & SONS, 510 Cotton av (See page Business Lists of the Directory Than Any ^ nivcrsitic s MERCER UNIVERSITY, Ash cor University Place (See page 61) *Used Cars DUNLAP-HUCKABEE AUTO CO, 682-690 3d (See left top lines and page 52) SPARKS MOTOR CO, 550 Broadway (See backbone and page 51) Other Medium * Vacuum Cleaners MACON ELECTRIC CO, 367-369 2d (See page 65) *Varnish JARRETT PAINT & GLASS CO, 312 3d (See page 78) ^Ventilators HAMLIN & SUBERS, 27 Wall (See page 85) HUMPHRIES SHEET METAL WORKS, 517 3d (See page 85) SCHWARTZ & PHAUL,452 Plum (See page 79) Veterinary Surgeons Gleason E D 612 3d Steve SVS. Solomon, Jr. DODGE BROTHERS MOTOR VEHICLES 462 BROADWAY TELS. 4956-4957 The Fourth National Bank CENTRAL GEORGIA'S LARGEST NATIONAL BANK TELEPHONE 4X66 MACON BUSINESS DIRECTORY (1925) 1231 Jarvis Elmer L 127 Crescent av Proctor & Shouthard 659 Broadway *Victrolas and Records WILLIAMS-GUTTENBERGER MUSIC CO, 466 2d (See page 75) Yinegar Manufacturers Gibson H A 149 Fifth " Vulcanized Shingles ELDER W F LUMBER CO, Osmulgee se cor 7th (See page 74) Vulcanizers Georgia Battery & Vulcanizing Co 712 3d Holleman C B 461 Broadway Levine D P 514 2d *Vulcanizing IDEAL BATTERY CO, 256 2d (See right top lines and page 52) Wagon Manufacturers Snead S J 312 Cherry *Wagons and Buggies HATCHER A S CO, State Distributors 598 3d (See Front cover) Wall Coping Manufacturers DICKEY W S CLAY MFG CO, 609-13 Ga Casualty Bldg (See left side lines and page 83) Wall Paper Hainline J L 228^ Cotton av ~W ftrdiousGS ELLIOTT WAREHOUSE CO, 201-209 Poplar Southeastern Compress & Whse Co cor Poplar and 8th Warm Air Heating SCHWARTZ & PHAUL, 452 Plum (See page 79) A natural by-product of the Directory Business is the compilation of Mailing Lists. If interested, ask for our Free "List of Mailing Lists." r. l. POLK & CO., Detroit u ctf JG CABINET MANTELS, TILE, GRATES, ETC. Willingham Sash & Door Co. Office, 457 Third St. Telephones 278 & 3976 1232 (1925) R. L. POLK & CO.'S "W atch.es MATTHEWS JEWELRY CO, 409 Broadway (See page 72) Watchmakers Banks R B 517 Cotton av Fincher I D 503 Broadway MATTHEWS JEWELRY CO, 409 Broadway (See page 72) RIES & ARMSTRONG INC, 315 3d (See front cover and page 72) WILLIAMS JEWELRY CO, 457 Cherry (See page 72) * Waterproofing BURKE T C INC, 358-360 2d (See front cover) TOCH BROS, Sold by T C Burke Inc, 358-360 2d (See front cover) *Wedding Designs IDLE-HOUR NURSERIES, 109 Cotton av (See right center lines and page 65) *Wedding Presents REES & ARMSTRONG INC, 315 3d (See front cover and page 72) Welding Acme Welding & Electric Co 756 Broadway *Window Sills--Cement CLARK R E, 1150 Napier av (See page 57) *Wood--Retail MERRITT COAL & WOOD CO, 1st ne cor Ash (See left bottom lines and page 60) Zeigler E H 216 Middle (V) Wooden ware--Wholesale Jackson-Wynn Co 301 Poplar Woolen Mills Macon Woolen Mills 246 Broadway X-Ray Laboratories ENGLAND ARCHIBALD, 613-618 Bibb Bldg (See right top lines and page 3) ^ I FOR LISTS OF NAMES ANY TRADE -- ANY BUSINESS -- ANY PROFESSION I DETROIT R. L. POLK & CO. CHICAGO X It Pays To Be Prominently Displayed To let people know WHO you are, WHERE you are and WHAT you have to sell. The City Directory keeps your name before the public 365 days in the year, and it cannot be prominently displayed in any book so CONSTANTLY used as the City Directory. MACON CITY DIRBCTORY (1925) y FOURTEENTH CENSUS OF THE UNITED STATES Population of Cities Having 25,001 Inhabitants or More in 1920 BMMioorbmnitligenAogmlhaaebmraym.. a1746803,,,124576104 PhoenixAriz.o..na 29,053 LFoitrttle SARmrkoitachnk.s.. as 2684,,891917 ECDMTCHIKRSGJMRRSEDPQAFNMPAACSCDEEEONNWDWMCCBHMNSABLPWJTABFLOSSSDSPSnooeopeaaie.vaeoooaotlaavouhaiutanaeaouoaraoealueeradotoiecuaiealalaguerdcucocrSasoovmnaeciklraasninwkcvarclwnmineasiwndinlcshlgrnrrkicrirmrloeadkuytnicnatcseotktmtisoSranpsokmrnakbewnamctveaeioghnomuvnlrmrenahri.mkagncspfdtarnmmtsrnafigderloFCftisiCAnanrieesraog.oePJaeymiDtoiotcuasleecoivoHonnRWLCltaofDaebHBbIntonarlrBpdnCodolooihorenIononGBiprBtrarinaedsaFI.npaknneuouiegndnLgoaaadlgoy.adinnervlgnasIlelo.oedhar.ldnelconglealsnlasplvraiodtotl.noeuueraeid..kol..griyi.tn.oa.yooacttldnloi.etwni.ff...ta..lcfeu.t.oo....irl..gnod....dw.anir.ne.o..o.ef....ndr..s..eo...ih.ci........i.s...ng..a..oes.s..n2.a.s.....n...d......nrsC;.............t...ai..-.'.i..dn,iasaar7ocoie320ua14l211616246753152u3533882736233343956643382330293235132354635132740t143465472656066465605669695595540m8778263633011911172075929286530486905455685,,..,,,.,.,.,.,,.,,,,...,.,7,,.,..,,,,,..,,,.,,,,,,50971.1,7,,,,502,,3,,,,,.0,511,,79689197427497837265766017515035890653136b62346856880688269626672046658535779342961977515321044679134038360609581159708i633724547415849771443887642557876126855a6838816672868814056430673366 WDSDieuoasbuteuxrMqluoCoeoiintye...s...... 173321966,,,,214224637180 KTWoaipnceshkaitasaKCaintysa. s 1570021,,,021217277 CLNLooeeuxvwiiispnnvoggKirttloetolennn.t.u...c.... ky242631974,,,,531831294711 NSherwevOeLproolueriatsnias. na34837,,827149 LBPeoawrntglisaotnrodnMa..i..n..e 362195,,,729977128 ABCLOMBNCSSKMPSMSJKSSTWBHHJDLNNWBDGLPCHHLLMPQRSFCHBFSBBBFMoatttipalaaopmatuoaoiyadloa.aaaaae.iaae.uiaenuruoeaoraiaauicplatiNyergmotagl.fsuorwnyrowmtnnllnwtmvnawmtlnntlcimlvsecgikslaldattltolithisruPtnrhyJndMonnecnntsiLetsooekmdcltnthnheieNsecrmofetfnibonouttcRohewbliegkHmaearkttolheoeneaoirBraarlgbCheraonMioiRNrennnyaenskaaesealfuthsMMlaagnnMvnrtceMawcnisnfuuogoiiuweneepsrdlmetdizmliCoisciepniteiddolCHrrntrsdllpeoievianootgiealnbCeilyoglecsar..we..scdflrlrhed.ni.on..een.a.e.r...J.h.ndoics..rytk..iP............ssae.m.tr..dnye..eto...hi.r.......l......a......y....s.ksg....k....da...r.u................u...n..opksanrsatsaenid.171ae323191111h1717y25172797545732339t86224433444997243492434321969434520423263it6066881241779444809586717r68813099613897119226409730988769s3,.,,.,.,,,e,,,,,,,,,,.,,,,.,.,,,,,,.,.,,,.,.,,,.,,4,6,37,,3,,,36,96839645285993469566857177080825019507221184607208857808703192331957847931507159365592371125610670438896856324029491417791055324494473058994411386759433390387454444076 WYMLMSRTZCHLLMACCCNPUYCESTWAWWDJNNNPRRABMNSEENOABKHKPTWAEIJNPWPMPpaoiaraootecooloraiyaakhoeotleusoeualaeCrlaemaaieaimluraiSovuBkeeenCMBQRFmroVRolnkHiiaiaBhrYirnrmlnbaeesmhueuonrwwmwarnryafrwnewsctlssnicrbzvNuabwsbaaitculiyetaeeoateftimesnastrgiingraseonkunrndggsresntrtohsnekBBBaoeBBeseaoremlehtioacoaaiiuieowconstetbnoetlnlrnfuvgoaaeahrtcyoemonggtnnhvsrtlbsfregreybnlehlnlonvrOiniksuoooorotYoonncnpoteunNaymkiiiafehrnrorttbstganeOeosknes-yrornNtovoAmelteciheoosiloktrrracnkorrxonrnnssokletdmstuletllogoeaahekoootineoolnndgoaeetrnwlaewnleiuwsmd-llCedlhoOsnalr.wtidtaeeyauuueuullrathnwtdw.irok.tmneedtnno.nn.iCnibbgg.gh-.ggh..d..an...c...td....yn.Y...n.gi.o..hh.o..hhh..y.......n....a.....ok...........................ey......m........or.522or,a,,2k27411l1261024721541112i42832693224232053230478472834302236926953851032334321n344319316242229362807906777316712279781812361018685630226445605068268435353059616759782a.,..,,,......,.,,...,,,.,,.,.,,..,,,,,,,..,.,,,,,,,,,,,,,,1,,8.,,,8,,5225,8003,70,02653247337033227157888702119730172976583362208287774981796231079649217544559334917382120515261576069520111280481166680020826671441111875906850798252572856334011406956042263037685420688690740064691 MCCGKMOSLPBESTHLRSPWCONPRSWCCMNAGHSSNSYNCBDWWNRBCLNRPSKEFPAHHJMPPWOTEAEWhpouoaaeaheayihvcarlsrleoeooghiaoriueaehoaeauoeuheeoaaainorlaCNokeFalahaBencioeccoCtahihploratlrclinntaiieawdwlwalslndratwlanruralssrleozcmtrtuwelrWlcelthroPSaleKbueoevtvahkknliiokeentskhrtnsfoocrueSaitirtCtsiadrlcrslskthtRxaotxnnrPnmleopnttlmoimnsopolotaawiWeeiorailseAbnlilpLenasmyvhhiorstmdteoayaseiunsdlaisaveseoereelnWitsTnootshCestyeuongoltttWsnnuhshsstuieokbiboonosuosesbabtoaonkmhcnetoosiVsnbotaglhBonrnanrooto-gauerhoeikgaslttFmeonrualrkltsutndtihnwOkuntoetinBstwTlouetsugnpdhcepangnaaoogwUoeisssasdnereoarcmerohrrknan.rtroeeesmcpnhntheaygnVrtnhn.g..g....gelnh.tCetn..ggliy.toex..r..r..D..eo..li...ia.ne..h.ig...i.t...asIro...t....a..l..n.aas....nrh..r........g..s..ev.......o.....a...............s....ts..r.gs....iltknaoe1iaaion,4nenol1131111112n1185112.ni53231353334501752952313437432506i3it67333412235634364n832470437567d535997536a7aa0758301064591069054815844709861702728787776350743873432356797288023031a.,.....,,,......,,......,....,.,..,6,..,..,..,..,41,.,,.,,8,31109246.,,,.966,,,863,0514682509943735835589712504243878912359730303271384242467671503560647809701547578775021/495972751774934873510182395778318901147982775872587720726053966291046-8257256652865.385:;957555:5:527/: HIP (1925) R. L. POLK & POLK'S PUBLICATIONS BANKERS ENCYCLOPEDIA (DIRECTORY) OF THE UNITED STATES AND CANADA DENTAL REGISTER AND DIRECTORY OF THE UNITED STATES AND CANADA NATIONAL IRON AND STEEL BLUE BOOK CITY AND COUNTY DIRECTORIES AND STATE GAZETTEERS ALAAlYaSsukKkaoAnanGdazetteer ARPPhIreZoseOcnoNitxtA ARTSHLetKioatxtttAaleerNSkGpaRSnraoAiazncSekgtsteer COSSSSSTVVVWMORRSSSSSSSSVACFLMMMNPPRSAABBCCDEEGGIPB-taaaaaaaaaaoaauraociaoeoeiieuxoaiaheaeoalrLlalaoeoneVacnnvnnnnnncnsnnmnesanhsnldramnklprlnreikcrdrsndhadtraulIaetcttatkmtteihadulcatlatikteeaneoaaaeaaFceemrpnlsasoraduecFIskeFJmelaDAebPrjmtBierrnostesae-eltnnr-iOoleoordsaamaenavroeooatiaaeeyOMRdBanbPCifdednoMadensryanniueydiRagrnrnnsleaoreaeradgiolanroueaastcClNsreroonodavlnazikrbeoisriIOidcaaUcsdAaorboieanisopo COGBCMSFTPLaoouorralialreOuinnotnbdlriiRddlatadCoeedAaurooJdCDulliSniOtnycpstriionngs DEWLilAmWinAgtRonE DIW8TCasROhILiCnUgTtMonOBFIA FLSSJPSSCDFGKLMODAaOatettoalceeaacranienkrcayRlyiakPtfaA-sntealemtosaraaeIoeldouwrnDcaWtsniMidGnegdonavaaAvruldeytia-saielssezbllrtletreuiesntrtegeer TTWaaemllsapthaPasasleme Beach GETABCAAMMVWAhOorualtmaoaubolllcgRauyudnameounmclonsrGntsrawtisyrboactsitIaiuuesavAcsssiklle HIDC'ANPBBILHCITKMSAdodoowoaoeWotioaaoecwanHzninhhiosusatynncAoiooerteOtsooeeePltnuIwFndvoleFCIlGClai'naoArulAaiiocllatellNeyzllsesentTteeEeCrRity ILJJKLPPRSBCCCDDEHHKLMMPSTBBEORWPPCLAaotoea'tiaovhaedeoleeloeiiaathcIelonrorlioxalkntSncntawrolaciwonNibennkrlanacollcuouokenkaristtailrpaaektvmsowmnaaoniadnimknbtOioslnevtoaanlingarnsletoeonanpolsFaIciknedoigteoIlgltrnsruaoeSevsanoelolagietwvelinaghntllinonlnsleldne INCPRWGKLLMSVVSCEEEITFHDnoerliotavoelilaoawuacdaaanikurfIgkarrlnrhrwbtuniaAcpytrohnaotieathmeayetoaoonafmsniNnseonrdnvnsroWGahanotHrtpBAignptidleaoestdaleoassoeozrynvlutneindi-tstleetleeer IOSBCCCDDFMSFWiotoooorhaoaae#oruvrAasutsttnnoerextleocnMneMDinpGslCoooaCaiirBddnCtzitigytelesiyusettoytfnefser KASICEFHotmNthulaaattpScSenohAcurioGtinSeatstaoMn tttel LLPTWSKOPaaoeaitaiwartpltcnltsavensrhoswekebaainnnataussawcregoCrtihty KELNexTinUgtCoKn Y LOANSLhUelaerwkIexe8vaIeOnApCdroNlrheriaataArnless MBSCAatuRalmttYiembLeGorAlraaeNznedDtteer MPRTCJLOPSSSWYBCDFHHHHIKLMMMMNSAAABBCfGIsaCoaertaouhwatleoaaaopheaesoanalecd.ruaeayaaigtnupuydencnylrglHamruptknlstnoonvrsnrtauaiutlbtabrlearJitcniaiegesksqnsoaleittnionmiomlIdanonlnooosoeuadsmkuheauanrCmGAdngoniaasnayctSrcsnngawetmOGnetdeeoebtlikoieagirAezoyttoentCttenpHtaRbeSanaatieoyntngeehN.rkCoenzpoaaeeerCrprieMtitbkitonydeoagesrrsrie MWEOSSAFGMMRRSBCDHIVANNttvtawieMhilieui.iiuiaiacwblebdrlNrninwlnabsetlsiglieubonewattebhknPeEriiotienhtWoannnarthCnUaahnSaGaittleuitukgomnpoLOalaeilanlanoptreTzilgoaieaAsltintsedeBrlue MBCMNVGIHSoiaiuaelclStoltruckftixIhmpsidSiebeoibsSzaurubntrIsguPrPgI MJJKSSSHISIenoSitteafa,.d.pdSfnneelaJOCLsiiprlLonbasleohUasaoosnuaelunRdripCiselsIhenCistBcyCietlyuitey MOSABtniNTalaoltTicewnoAsgntGNosdnaaAezaentdteeYrel BGHLLMMDHHKBeiueriGoaaiavliCFTFwlelsllmzltnlileeleslilathonei,edmsaesonsrtiamngnptlgtuathtbosdeeSauolFBCteneiCilanownsvlarailun,itaed1leaty,liaeynsnCPtnBdeadoaGinr'gskdraansds NELOSFKHYBirtmeoanaeaRrscetakretomhniAlnaenoGSgynsaKtzAetteer NESRVteaaWnAntoedaD,sG.hACoSaaepzrsaeorCtktneoseu,rnty NNEAJNOWABBCHSVMeWaoeacarsoitriilniwlmrebylsbeldatdaeleouomhdngvwnlyJnrkaBeeityEnoeliHnntlcrCneooCdReuudPninidCSttasyysEiwrotkynYick NESRSAiWtollasvbtwueerqeMluGlCeEarizXqtyeuIteCteOer NWEGJJOORRFHHLNBMVBaaWryoielrlseamuamnacaQeeeowncsmrlfmhteaenoikelbruefannmerpiapksvrareiYssYyitocoltlsriehoonCoooyloaotOrnolningwenwotnkepsrSdaRveknndtecCrKCakeHCneaodniimplttlyaerrtNOMSRtianTtoeHt GaDnadAzeKWttOeaeTrrdA OHMTTFILMMNPPABOCCCEFB-oooiioilIoloaeehrsafaqnmaelOrisrwlsnhflierrvdurutdaltlitinttdsailoaanemgioaliaeimeonarnilrcLenbtarkabiyo'tpoeuiansuauvtouldthsearFterhtpeorroyl OKSAGODLMEMtaLkrunuuawdclAtirstaAmhdeakthoHrnolooneiGgtOermseetaMaeezreACttietyer TShuTalsweacnueme seahnd OWRPUJUSABCDPSEaoaEotoumanaesccAraPslaslrosrtogskoikGeloonttootacoucsswwlmeeesplndaortnhOhidaonrivainCn,ulnlianeGiNalntdStalodaaH.anelganhuneansaadBozdanendCndn,oeMnlrdtdduodymtdCtGMee.We,LadeJReCrMaBnfanaaraiorlcontvnioilarronkoe-erdatt-nk---r,l P.. ETWJPSWWWCEACCCCGGHLMMNPPPRSUWACCCDSKLLMMMMNPPSBYBHLPNocyheuhaiioahoialihaernoelarialrauarouiohaaooCtnCtteiaacceelidwterEltrwotnNneiaentwartabiirrentnrtallrteBronznatntmonyaKeKrassretoglbsoenrskkceelxdasrtsdklsraisntngolraanocehodtrsSoeoinntecenhbbownloaienbnbntesdeneitdeeesfdtsethbndecntsvsievnnkeeeKanorostYuiusngteiounoeivsslooeoesunyCloaroebesaovreenteskinxglebhstlnet-dcwisnsrnricenles,gerynbkenswlaLrliauebahdBivolaanlugpgetrgdkasylpCnvtanleyowennholc*nrRnueianrbVooehl*hahdheislrggdgkeeonCsndCirdlunrlnooirinllAVeetg,utendrraeeaCBcoVeoBnc,genCgJykarNuuaMllLiateltulsodntnnFyuollaIyadeueltrtdUAanenyeys-idynlnyp-iltgasy80.SSAMHUitbuoaiTtertuceroHxhdneeGleFDlnaaAzlelKsttOeeTrA TEMNNaeNsmhEpvhi8lil8seEC TEAFBCCDBADESADXorolemtlaebueoeaarrAlnniswbstltaultiPteaieuorsSmnicWsnainornwalneosnG.lnooooennaortatdzhetteer WWWWUPSBWSWYLNRSWCTWLCGJOPSSBWAGJMMMMORSWWCLSPTTWSPSABBEKlPSSTCCEFHMMMCEFKMYGGPPTOSABEVWMMIHMPSSSWADEAGIWeaathSrstuhprokotoliAaaeaatathealaethaaheavahyhloesehlrlreplaadreagausuSOroOfoisoanieahrcGfaaooaaeolaaeenKJCSaueeaaaiah-CkalyaiceeaCpgoaeheaarnwesinxancrkunemlefllieelonnaehliratllpaklrndeownronutdciiuerruvbrturcusHirtvoTwtraeptreloeesreetvynpxmeewminHrltakkieyMregitnClrdelanntirglcrmgrtnotlelegcelminirieierOtlkthsanssitlottekonsfaiogmnslaaomrppnseeammina&lmenrnsdeteeaesrnannaoeirtrosiiaioealvedCdseantdiAhvnrasesLsoraneAspIGitnsldnyenianltrlennsiktelAtesehtrooltnenInNgsvhouussdononotlhoiibNuCGGaihlsabiaoeilaCVauirkowaatastnaiAwsgaa,tNdslaHK,hagalnaCGennnenvenbllntvhaiktBottantaunsntanCar,nakuludrvwnnnCWhneCablSennlaooaokaomnowCgaotGalieegselguaIenacztCeoltGiaelrairoanddDaln!unuinwnddsheuaoeeIzRCaczerronlheiaFmelgeFPgroBue!LtrzaayaTlndNeeicenrdenluneguyiunlobetFnuntainneeroGlgefUeaktaC.ttCtnOtdPCytnlrdauaonyettntlddaaytsBycayLiStytelntIeaantgtreinydNlteytsayFNetlcecdaallOikrtGdeyuhafnrChrienttlrIfsekeia-rAiiC,nratrcyyo-- MACON CITY DIRECTORY (1925) L. WOOD Plumbing and Heating Vork Guaranteed 476 Cotton Avenue, Telephone 529 ; TAYLOR & ELLIS REAL ESTATE--LOANS--INVESTMENTS GENERAL INSURANCE--RENTS COMMERCIAL LEASES GEORGIA FARM LANDS 470 Cherry St., Cor. Third St. Phone 267 Northwestern Mutual Life fesurasca Company J. CLAY MURPHEY, Dist. Agent 410-11 Bibb Bldg., Macon, Ga. LICENSED AND BONDED Service from our criminal department may be obtained by any individual or business concern. Special attention and protection to those who are enrolled on our mem-' bership list* For Further Information . Phone 5347 POLK'S BANKERS ENCYCLOPEDIA ISSUED MARCH AND SEPTEMBER* BANKERS ENCYCLOPEDIA COs THE WORLD BANK DIRECTORY DETROIT, MICH.